1RMSA

Crystal structures of ribonuclease ms complexed with 3'-guanylic acid a gp*c analogue, 2'-deoxy-2'-fluoroguanylyl-3',5'-cytidine
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
ESCEYTCGSTCYWSSDVSAAKAKGYSLYESGDTIDDYPHEYHDYEGFDFPVSGTYYEYPIMSDYDVYTGGSPGADRVIFNGDDELAGVITHTGASGDDFVACSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE MS
publication title Crystal structure of ribonuclease Ms (as a ribonuclease T1 homologue) complexed with a guanylyl-3',5'-cytidine analogue.
pubmed doi rcsb
source organism Aspergillus phoenicis
total genus 25
structure length 105
sequence length 105
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rmsA00
1BNIA 1RCKA 2SARA 5RNTA 3AHSA 3AGOA 1BU4A 1RNBA 1LRAA 1BRGA 3RNTA 1BRKA 1BOXA 1FYSA 1RGLA 1YNVX 4J5GA 2F5WA 7RNTA 1X1YA 3DGYA 2AADA 1TRQA 1BNSA 3D5IA 1GMRA 3WHOA 1FUTA 1I0VA 1HYFA 1RGAA 1BNEA 3DH2A 2GSPA 1ZGXA 3HOHA 4RNTA 3A5EA 5HOHA 1GMPA 3BIRA 2F4YA 1I8VA 2RBIA 1BRSA 1UCLA 1RN4A 1RTUA 8RNTA 1BNRA 1RGGA 1FW7A 2BU4A 7GSPA 2BIRA 4HAAA 1LNIA 1I2GA 1B21A 3AGNA 1I3FA 1B2MA 1BVIA 1RN1A 1G02A 1BAOA 1DE3A 1B2UA 1B2SA 1T2HA 3Q3FA 3BU4A 1BNJA 1RCLA 1A2PA 2KF4A 2HOHA 1BSCA 1UCKA 1BRIA 1LOVA 1X1XA 1MGRA 1C54A 1LOWA 1RGKA 4J5KA 1YGWA 3AHWA 1RDSA 1LOYA 1RGCA 1RGHA 1B27A 1JBTA 1B20A 1RSNA 1BUJA 2C4BA 1R4YA 1Q9EA 1X1WA 6RNTA 1I0XA 1JBSA 1TTOA 1BIRA 1AQZA 1BSBA 3D4AA 1PY3A 1BNGA 1GOUA 3WR2A 1YVSA 1BRHA 1I2EA 2RNTA 1DETA 1IYYA 1AY7A 1RHLA 3D5GA 1RMSA 1I2FA 1TRPA 2ZA4A 5BU4A 4GHOA 1GMQA 2KF5A 9RNTA 4GSPA 1BSDA 1FUSA 4HOHA 1BRNL 1BNFA 1RNTA 1GOVA 6GSPA 1BANA 1HZ1A 4BIRA 1FZUA 3KCHA 1CH0A 1UCIA 2KF6A 1B2ZA 3SYUA 1SARA 1I70A 1MGWA 1GSPA 1RGEA 1PYLA 1T2IA 1GOYA 1BSAA 1X1UA 2AAEA 3URPA 1BRJA 5GSPA 2KF3A 1B3SA 2F56A 1I3IA 1BGSA 1UCJA 1RGFA 1JBRA 2F5MA 5BIRA 4BU4A 1BSEA 2KAAA 1RLSA 3GSPA 1B2XA
chains in the Genus database with same CATH superfamily
3DXOA 3PXMA 4N6UA 1W5ZA 1AR0A 3AHSA 5D81A 1DVDA 1FUWA 2UUGC 3WOFB 1GD3A 2KCDA 1BRKA 1BOXA 1FYSA 4J5GA 1OPYA 2IUKA 2C10A 4FCJA 4H3UA 4BL3A 4XM4A 1A2VA 3RDEA 5AI1A 1W6YA 4CDLA 1Q42A 5IG4A 3BNCA 3NM7A 3QK9A 1U8CB 2RCDA 1OHSA 2P09A 3S28A 2IYJA 5LC7A 1RGAA 4FMDA 1N9EA 3F8XA 2GSPA 1JN5B 1JB4A 1ZGXA 3HOHA 3RGAA 3JUPA 1DYUA 3CCM3 1FGQA 3A5EA 4EBGA 2CKFB 1AVKA 2XGLA 4OUQA 3F8HA 2I9WA 4K61A 5CF2A 1O7HB 2BMQB 1VZZA 3NHXA 4HKVB 1BRSA 4XBXA 1VQN3 1UCLA 4HM7B 3F9SA 3CCU3 1RGGA 2R4IA 3OV4A 2OQEA 1IK3A 1NU3A 1O7WB 1OF5A 3UB1A 4HAAA 1ROAA 1I2GA 5G2GA 1B21A 2INXA 3NM2A 3AGNA 5CF1A 3K7CA 3V98A 3NXJA 1WMOA 2BMRB 1DMNA 2PNCA 3IPTA 3K0ZA 4BTXA 1DE3A 1RRHA 3H3HA 3BU4A 5G1KA 1KQS2 1KD14 1M1K4 1CYUA 3I563 1K734 1Q7HA 2HMNB 3UL5A 2KF4A 1A2PA 3K63A 3EE1A 2GU3A 1OHOA 3EF8A 4O2HA 3PZWA 1LOVA 1W6GA 4XBYA 1C54A 5CXOA 2IA7A 1YGWA 2QGUA 2K0MA 3NBRA 2W9QA 4XDWA 1B20A 1UW1A 3BNEA 3S29A 3X40A 1LQMB 2OQEC 1I0XA 2CIUA 3CMA3 1IT8A 5IEPA 4N6MA 4EW5A 2Z6BA 1JRQA 2D42A 3VGNA 5CLKA 1BNGA 3WR2A 2W9PA 3SVAA 5JPUA 3CC23 2CG0A 4XDVA 1QAKA 1IYYA 3HIIA 5M19A 1IVUA 4X2HA 2KRTA 4N6NB 3RGRA 2YFJB 3VF1A 1GMQA 4N3VA 3UNLA 3WOEB 5IERA 1ISKA 1BSDA 2HMMB 3V92A 1NB5I 3PS8A 1BNFA 1FGMA 1RNTA 1CQSA 1GOVA 6GSPA 3EC9A 2LQVA 3FLJA 3ZG0A 3CCS3 3HX8A 2IMJA 2OTL3 1G96A 2GXFA 1CH0A 5DRVA 1N8R4 2F98A 1MGWA 2E2TA 4FCMA 3N9HA 2CW9A 1X1UA 1E3VA 2QA43 3DGLA 4CPKA 1IQYA 1IVVA 3JUMA 3PGBA 1VQP3 2YFIB 1ZO2A 1RGFA 2F5MA 5BIRA 2OWPA 3CCL3 1UI8A 1KSIA 1DMMA 1N9JA 2ZHXB 3GSPA 4K1UA 5AIHA 1YGEA 1GS3A 3CPOA 4I4KA 3SXXA 2XGNA 2F86B 2CFLA 1D6ZA 3DY5A 1IVWA 3HIGA 3RNTA 3K9MC 2PZVA 4L8PA 1JNQA 4O3VA 2MC8A 3OWUA 3UJMA 2CFWA 1VQK3 4WHAA 1M904 3QRDA 1UUVB 3D5IA 2B24B 1HYFA 4HYZA 1K8A4 1WMNA 1JZOA 1S5AA 1STFI 3M8CA 4NPBA 4GB5A 3WODG 1TUHA 1IV7A 3LZAA 4N6TA 4RNTA 1FA3A 3ALAA 4XB5A 3KN4A 5IG0A 3F14A 4CCVA 3DUKA 4LMIA 5JBSA 1Q814 1SQWA 1JKGA 1RN4A 1RTUA 3WDGB 1GY7A 8RNTA 1BUQA 1YI23 3B4PA 1FW7A 2Z76A 1DMQA 3CNMA 3GZRA 3ZFZA 1D6UA 2F99A 1UI7A 2BHMA 3LTDA 3NV0A 1OUNA 1UGHI 4X2OA 5DREA 4RNYA 3G16A 4N6V0 2LYXA 3LXUX 1OH0A 1B2UA 1B2SA 2OTJ3 2V1LA 3JUQA 1K9M4 1NNVA 1N8QA 2FGTA 4STDA 1BNJA 3U97A 4OVMA 1FGRA 1ZX2A 2HOHA 2RFRA 2XRXB 4LZIA 1PU4A 2P05A 1QALA 3OXAA 2GBWB 3DGMA 4LEHA 3AHWA 1RDSA 1LOYA 1RGCA 2JDIH 2CFGA 3ECFA 3LOYA 3OX9A 2W2CA 3FG1A 3FZWA 1JBTA 3NBJA 1BUJA 3G0KA 6RNTA 3GWRA 3X41A 3WMDA 3KZTA 1QVG2 1AQZA 1BSBA 3NUVA 5CK6A 1L5GB 2KXGA 1PY3A 2CHCA 3CCQ3 2P0MA 3X3YA 5EQLA 4CJNA 3D3LA 1I2EA 1W2ZA 1DETA 2UGIA 5IG5A 1N5PA 5G1LA 4FMBA 1TRPA 1UUGB 4MEIA 1SIHA 1D6YA 3LTCA 4GHOA 2W6JH 1G0TA 1V58A 2O3OA 2Z77A 4NHFA 1V74A 1NJI4 3MSOA 1FUSA 2SBLA 3AMOB 3N54B 4HM2B 2STDA 1BRNL 4QWTA 2WO0A 2XFSA 5TGNA 3EB8A 1HZ1A 1Y4KA 2CWUA 3DM8A 3L0RA 3LYGA 4WYKB 1US1A 5ELUA 4R1KA 3MG3A 5KP3A 1JKGB 4RBNA 4HJLB 1UCIA 2W56A 1ASKA 1U5OA 3ROBA 3S27A 3UL6A 1E97A 4HZ9B 5FW5A 4IIAA 1M9GA 1RGEA 1PYLA 1LOXA 1GOYA 1R4CA 2FNQA 3F7XA 3MYTA 3G8ZA 3LT8A 1TU5A 3SEDA 3BB9A 3EJVA 1Q864 5IENA 3EBYA 4KT3B 3GZXB 1UDII 4EV5A 2KAAA 1RLSA 2P38A 1SPUA 3FGYA 3J7Yd 2D1WA 1ROVA 2BO9B 2ML5A 3BNDA 3OWYA 2HMKB 1IV9A 1YVBI 3NQYA 4HZBB 1RCKA 2SARA 1K28A 3MHEA 5RNTA 1BU4A 4BTWA 1W01A 3TDGA 5BXQA 1BRGA 5EVHA 2J8XB 1RGLA 3DGOA 1YNVX 7RNTA 2F5WA 5D82A 4H61A 1IQXA 1X1YA 1JZDA 1WTHA 3DGYA 1OF5B 1TRQA 1W4NA 1T5YA 2ZDJA 5HGRA 1AVLA 1OHPA 3GZBA 4IPBA 2C11A 4JF8A 3ZG5A 1VQ43 3E99A 1FUTA 3FG4A 3KSPA 4HM3B 1RJOA 3G6E3 2OOVA 3WA2X 1EUIC 3KIIA 1TJDA 3LH4A 1W7CA 3EQQB 2B1XB 2W04A 3HK4A 2BT3A 1GMPA 3BIRA 4KFDA 5HOHA 3A76A 3FF0A 3CCR3 1EEJA 3K5TA 5AEWB 4HM6B 1MWSA 2H0GA 3FH1A 2W0QA 2YX9A 2CWVA 2CG1A 1WQLB 3EN1B 1VQM3 2BIRA 3PCRA 1LNIA 2CK3H 3LMLA 3B4OA 4BL2A 1A2KA 1EKMA 3CCV3 3IMAB 3CC43 2W56B 3KE7A 1B2MA 2IY2A 1BVIA 3JUOA 4EXRA 1G02A 4JRFA 1BAOA 1JB2A 1JN5A 1T2HA 3VSYA 2R41A 2ZL8A 1QMAA 3I0YA 3FKAA 3LT9A 2GBXB 2OOVC 1FGTA 1M1XB 3NQZA 2XF3A 1BRIA 2CWTA 1X1XA 4LGQA 2IUJA 1MGRA 4FMCA 1LOWA 4R9KA 1QJGA 1CEWI 4J5KA 2W03A 2Y73A 1YJN3 1CYVA 2HMOB 4FCZA 1RGHA 1B27A 1ZS7A 3B7CA 4HM4B 4EYCA 1MNLA 1ULJB 1X1WA 3WA3A 3Q2PA 1LNHA 1TTOA 1KC84 5AYSC 2CC3A 1E3RA 3EN8A 5KP4A 5ELJA 1NO3A 3D4AA 5IG3A 3ER7A 4ILFA 4EC6A 1GOUA 4RZMA 2WOFA 1RHLA 1SJWA 3MPHA 1RMSA 2RGQA 1I2FA 1TFKA 1J2BA 8CHOA 2M7OA 5BU4A 2XSOB 3CXC2 1S723 9RNTA 4GSPA 3IJEB 4HOHA 5EEOA 4KFEA 3F7SA 1TP6A 4OK0A 1JB5A 3STDA 1WMPA 4LSOA 1VQL3 4BIRA 5AIFA 1FZUA 3KCHA 2RSXA 4AEQA 1YHQ3 5AIGA 1QVF2 2KF6A 1Q7Y4 4KFFA 4FMAA 1B2ZA 2FXTA 3G4S3 1SARA 2XR8B 2MF7A 3H51A 1SIIA 1EG9B 1BSAA 2AAEA 2XFTA 3EX9A 3GRDA 1BRJA 4MMYB 3URPA 2KF3A 1B3SA 1MWRA 2O9UX 3I553 3CCE3 4TX4A 4WFOA 2CH9A 3CNXA 1BGSA 1QAFA 1UCJA 1GY5A 3PYJA 1UGIA 3HZPA 1YIT3 3BLZA 1IU7A 1RN7A 2CFKA 3KSED 4PEJA 5JPPA 1HU9A 4GL6A 4J8TA 3NBBA 5M1AA 1VQO3 1BNIA 1OGXA 1T3BA 4G1MB 4RNZA 3S67A 3AGOA 1GYBA 2ML6A 5LC6A 1RNBA 1LRAA 2UX0A 2XSHB 1FGOA 2L1SA 1EQKA 3JUNA 4IT7A 4AKYA 3F40A 2CX1A 2AADA 5FGOA 3D9RA 1F8NA 1GD4A 5D83A 1BNSA 3LTAA 1GMRA 3WHOA 2YFLB 3DMCA 3NV0B 1A67A 1I0VA 1PFPA 3Q1CA 3JVCA 4HVNA 7STDA 4N6LA 4NREA 3D79A 1BNEA 3DH2A 3FF2A 1Q40A 1O7PB 4U13A 3T0UA 4XBTA 3V99A 2H0IA 1DVCA 3CU3A 3N8BA 4R9LA 1W02A 3SOAA 1TIJA 2F4YA 5IEOA 1WNHA 4MMXB 1VQ53 4J9AA 1EA2A 1I8VA 1MWTA 2RBIA 1LQGC 2Y74A 1NB3I 2WOHA 1BNRA 4ORLA 2CFDA 2GEYA 4O02B 2HMLB 2BU4A 1K41A 4L8OA 3EHCA 7GSPA 1NDOB 2XEPA 1RRLA 1V57A 1OCVA 4Q53A 1I3FA 3SLUA 1RN1A 4HBRA 4R80A 3X3ZA 3CME3 4KZ1A 3OWSA 1YIJ3 3Q3FA 5IW9A 3MG2A 4AKZA 4HM5B 3Q90A 1RCLA 4I5QA 1VQ63 1KWIA 5I97A 3G713 1AV4A 1BSCA 1UCKA 4LYLB 2GU1A 4HM0B 1O7GB 5AIIA 3X42A 2QEX3 1Z1SA 2K3DA 1GY6A 4HM1B 4K90B 2L4VA 1RGKA 5IF6A 5STDA 1O7MB 2QIYA 1LVNA 2Z7AA 3S5CA 1Q824 1RSNA 3O8YA 1MWUA 1LXEA 1Q9EA 1R4YA 1W00A 2C4BA 3EBTA 4N6OB 1JBSA 1BIRA 4MJDA 5KP1A 5AEUB 5BVBA 2A15A 1YJW3 3SOYA 4WP5A 1JJ22 3NX0A 1A90A 1OACA 1YVSA 1BRHA 3LTBA 2RNTA 1YJ93 1RKYA 1AY7A 2E2UA 2K54A 2OCTA 3CCJ3 3D5GA 3MKIA 3DZLA 3SX1A 1IVXA 2ZA4A 2WGOA 4FR9A 1Q40B 2Q07A 2KF5A 4HM8B 3DGNA 2WGQA 3CD63 3B8LA 3BNBA 1BANA 1JV2B 1IDPA 2H0HA 3HI7A 4WWUC 2E2VA 4EV2A 3KFQC 3CC73 1OGZA 2BNGA 1VQ73 3MWZA 3FG3A 1VQ83 1IT7A 4R4KA 1O7NB 1N5HA 1I70A 1NWWA 1TFOA 5AYRB 3SYUA 2XH9A 1GSPA 1T2IA 3GAXA 1W6CA 3KKGA 1UUWB 3X3XA 4KVHA 3OW22 5GSPA 1ULIB 5M18A 1MOLA 1VQQA 2F56A 2HMJB 3GZYB 4ZM8A 1I3IA 1W2B2 3T8NA 3T8UA 1VQ93 2CX0A 1HKXA 3PCSA 4BTYA 2P0XA 1IQ8A 2GEXA 4L7KA 3AMOA 4MMZB 1JBRA 3MG1A 2JQ5A 4K1VA 3U1WA 4BU4A 1BSEA 3CPW2 2BMOB 6STDA 1STDA 3FSDA 4WYKA 5A0OB 4O8SA 1B2XA 3FCSB 4DKIA 1C7HA
chains in the Genus database with same CATH topology
1BNIA 1RCKA 2SARA 5RNTA 3AHSA 3AGOA 1BU4A 1RNBA 1LRAA 1BRGA 3RNTA 1BRKA 1BOXA 1FYSA 1RGLA 1YNVX 4J5GA 2F5WA 7RNTA 1X1YA 3DGYA 2AADA 1TRQA 1BNSA 3D5IA 1GMRA 3WHOA 1FUTA 1I0VA 1HYFA 1RGAA 1BNEA 3DH2A 2GSPA 1ZGXA 3HOHA 4RNTA 3A5EA 5HOHA 1GMPA 3BIRA 2F4YA 1I8VA 2RBIA 1BRSA 1UCLA 1RN4A 1RTUA 8RNTA 1BNRA 1RGGA 1FW7A 2BU4A 7GSPA 2BIRA 4HAAA 1LNIA 1I2GA 1B21A 3AGNA 1I3FA 1B2MA 1BVIA 1RN1A 1G02A 1BAOA 1DE3A 1B2UA 1B2SA 1T2HA 3Q3FA 3BU4A 1BNJA 1RCLA 1A2PA 2KF4A 2HOHA 1BSCA 1UCKA 1BRIA 1LOVA 1X1XA 1MGRA 1C54A 1LOWA 1RGKA 4J5KA 1YGWA 3AHWA 1RDSA 1LOYA 1RGCA 1RGHA 1B27A 1JBTA 1B20A 1RSNA 1BUJA 2C4BA 1R4YA 1Q9EA 1X1WA 6RNTA 1I0XA 1JBSA 1TTOA 1BIRA 1AQZA 1BSBA 3D4AA 1PY3A 1BNGA 1GOUA 3WR2A 1YVSA 1BRHA 1I2EA 2RNTA 1DETA 1IYYA 1AY7A 1RHLA 3D5GA 1RMSA 1I2FA 1TRPA 2ZA4A 5BU4A 4GHOA 1GMQA 2KF5A 9RNTA 4GSPA 1BSDA 1FUSA 4HOHA 1BRNL 1BNFA 1RNTA 1GOVA 6GSPA 1BANA 1HZ1A 4BIRA 1FZUA 3KCHA 1CH0A 1UCIA 2KF6A 1B2ZA 3SYUA 1SARA 1I70A 1MGWA 1GSPA 1RGEA 1PYLA 1T2IA 1GOYA 1BSAA 1X1UA 2AAEA 3URPA 1BRJA 5GSPA 2KF3A 1B3SA 2F56A 1I3IA 1BGSA 1UCJA 1RGFA 1JBRA 2F5MA 5BIRA 4BU4A 1BSEA 2KAAA 1RLSA 3GSPA 1B2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNI A;  1RCK A;  2SAR A;  5RNT A;  3AHS A;  3AGO A;  1BU4 A;  1RNB A;  1LRA A;  1BRG A;  3RNT A;  1BRK A;  1BOX A;  1FYS A;  1RGL A;  1YNV X;  4J5G A;  2F5W A;  7RNT A;  1X1Y A;  3DGY A;  2AAD A;  1TRQ A;  1BNS A;  3D5I A;  1GMR A;  3WHO A;  1FUT A;  1I0V A;  1HYF A;  1RGA A;  1BNE A;  3DH2 A;  2GSP A;  1ZGX A;  3HOH A;  4RNT A;  3A5E A;  5HOH A;  1GMP A;  3BIR A;  2F4Y A;  1I8V A;  2RBI A;  1BRS A;  1UCL A;  1RN4 A;  1RTU A;  8RNT A;  1BNR A;  1RGG A;  1FW7 A;  2BU4 A;  7GSP A;  2BIR A;  4HAA A;  1LNI A;  1I2G A;  1B21 A;  3AGN A;  1I3F A;  1B2M A;  1BVI A;  1RN1 A;  1G02 A;  1BAO A;  1DE3 A;  1B2U A;  1B2S A;  1T2H A;  3Q3F A;  3BU4 A;  1BNJ A;  1RCL A;  1A2P A;  2KF4 A;  2HOH A;  1BSC A;  1UCK A;  1BRI A;  1LOV A;  1X1X A;  1MGR A;  1C54 A;  1LOW A;  1RGK A;  4J5K A;  1YGW A;  3AHW A;  1RDS A;  1LOY A;  1RGC A;  1RGH A;  1B27 A;  1JBT A;  1B20 A;  1RSN A;  1BUJ A;  2C4B A;  1R4Y A;  1Q9E A;  1X1W A;  6RNT A;  1I0X A;  1JBS A;  1TTO A;  1BIR A;  1AQZ A;  1BSB A;  3D4A A;  1PY3 A;  1BNG A;  1GOU A;  3WR2 A;  1YVS A;  1BRH A;  1I2E A;  2RNT A;  1DET A;  1IYY A;  1AY7 A;  1RHL A;  3D5G A;  1RMS A;  1I2F A;  1TRP A;  2ZA4 A;  5BU4 A;  4GHO A;  1GMQ A;  2KF5 A;  9RNT A;  4GSP A;  1BSD A;  1FUS A;  4HOH A;  1BRN L;  1BNF A;  1RNT A;  1GOV A;  6GSP A;  1BAN A;  1HZ1 A;  4BIR A;  1FZU A;  3KCH A;  1CH0 A;  1UCI A;  2KF6 A;  1B2Z A;  3SYU A;  1SAR A;  1I70 A;  1MGW A;  1GSP A;  1RGE A;  1PYL A;  1T2I A;  1GOY A;  1BSA A;  1X1U A;  2AAE A;  3URP A;  1BRJ A;  5GSP A;  2KF3 A;  1B3S A;  2F56 A;  1I3I A;  1BGS A;  1UCJ A;  1RGF A;  1JBR A;  2F5M A;  5BIR A;  4BU4 A;  1BSE A;  2KAA A;  1RLS A;  3GSP A;  1B2X A; 
#chains in the Genus database with same CATH topology
 3DXO A;  3PXM A;  4N6U A;  1W5Z A;  1AR0 A;  3AHS A;  5D81 A;  1DVD A;  1FUW A;  2UUG C;  3WOF B;  1GD3 A;  2KCD A;  1BRK A;  1BOX A;  1FYS A;  4J5G A;  1OPY A;  2IUK A;  2C10 A;  4FCJ A;  4H3U A;  4BL3 A;  4XM4 A;  1A2V A;  3RDE A;  5AI1 A;  1W6Y A;  4CDL A;  1Q42 A;  5IG4 A;  3BNC A;  3NM7 A;  3QK9 A;  1U8C B;  2RCD A;  1OHS A;  2P09 A;  3S28 A;  2IYJ A;  5LC7 A;  1RGA A;  4FMD A;  1N9E A;  3F8X A;  2GSP A;  1JN5 B;  1JB4 A;  1ZGX A;  3HOH A;  3RGA A;  3JUP A;  1DYU A;  3CCM 3;  1FGQ A;  3A5E A;  4EBG A;  2CKF B;  1AVK A;  2XGL A;  4OUQ A;  3F8H A;  2I9W A;  4K61 A;  5CF2 A;  1O7H B;  2BMQ B;  1VZZ A;  3NHX A;  4HKV B;  1BRS A;  4XBX A;  1VQN 3;  1UCL A;  4HM7 B;  3F9S A;  3CCU 3;  1RGG A;  2R4I A;  3OV4 A;  2OQE A;  1IK3 A;  1NU3 A;  1O7W B;  1OF5 A;  3UB1 A;  4HAA A;  1ROA A;  1I2G A;  5G2G A;  1B21 A;  2INX A;  3NM2 A;  3AGN A;  5CF1 A;  3K7C A;  3V98 A;  3NXJ A;  1WMO A;  2BMR B;  1DMN A;  2PNC A;  3IPT A;  3K0Z A;  4BTX A;  1DE3 A;  1RRH A;  3H3H A;  3BU4 A;  5G1K A;  1KQS 2;  1KD1 4;  1M1K 4;  1CYU A;  3I56 3;  1K73 4;  1Q7H A;  2HMN B;  3UL5 A;  2KF4 A;  1A2P A;  3K63 A;  3EE1 A;  2GU3 A;  1OHO A;  3EF8 A;  4O2H A;  3PZW A;  1LOV A;  1W6G A;  4XBY A;  1C54 A;  5CXO A;  2IA7 A;  1YGW A;  2QGU A;  2K0M A;  3NBR A;  2W9Q A;  4XDW A;  1B20 A;  1UW1 A;  3BNE A;  3S29 A;  3X40 A;  1LQM B;  2OQE C;  1I0X A;  2CIU A;  3CMA 3;  1IT8 A;  5IEP A;  4N6M A;  4EW5 A;  2Z6B A;  1JRQ A;  2D42 A;  3VGN A;  5CLK A;  1BNG A;  3WR2 A;  2W9P A;  3SVA A;  5JPU A;  3CC2 3;  2CG0 A;  4XDV A;  1QAK A;  1IYY A;  3HII A;  5M19 A;  1IVU A;  4X2H A;  2KRT A;  4N6N B;  3RGR A;  2YFJ B;  3VF1 A;  1GMQ A;  4N3V A;  3UNL A;  3WOE B;  5IER A;  1ISK A;  1BSD A;  2HMM B;  3V92 A;  1NB5 I;  3PS8 A;  1BNF A;  1FGM A;  1RNT A;  1CQS A;  1GOV A;  6GSP A;  3EC9 A;  2LQV A;  3FLJ A;  3ZG0 A;  3CCS 3;  3HX8 A;  2IMJ A;  2OTL 3;  1G96 A;  2GXF A;  1CH0 A;  5DRV A;  1N8R 4;  2F98 A;  1MGW A;  2E2T A;  4FCM A;  3N9H A;  2CW9 A;  1X1U A;  1E3V A;  2QA4 3;  3DGL A;  4CPK A;  1IQY A;  1IVV A;  3JUM A;  3PGB A;  1VQP 3;  2YFI B;  1ZO2 A;  1RGF A;  2F5M A;  5BIR A;  2OWP A;  3CCL 3;  1UI8 A;  1KSI A;  1DMM A;  1N9J A;  2ZHX B;  3GSP A;  4K1U A;  5AIH A;  1YGE A;  1GS3 A;  3CPO A;  4I4K A;  3SXX A;  2XGN A;  2F86 B;  2CFL A;  1D6Z A;  3DY5 A;  1IVW A;  3HIG A;  3RNT A;  3K9M C;  2PZV A;  4L8P A;  1JNQ A;  4O3V A;  2MC8 A;  3OWU A;  3UJM A;  2CFW A;  1VQK 3;  4WHA A;  1M90 4;  3QRD A;  1UUV B;  3D5I A;  2B24 B;  1HYF A;  4HYZ A;  1K8A 4;  1WMN A;  1JZO A;  1S5A A;  1STF I;  3M8C A;  4NPB A;  4GB5 A;  3WOD G;  1TUH A;  1IV7 A;  3LZA A;  4N6T A;  4RNT A;  1FA3 A;  3ALA A;  4XB5 A;  3KN4 A;  5IG0 A;  3F14 A;  4CCV A;  3DUK A;  4LMI A;  5JBS A;  1Q81 4;  1SQW A;  1JKG A;  1RN4 A;  1RTU A;  3WDG B;  1GY7 A;  8RNT A;  1BUQ A;  1YI2 3;  3B4P A;  1FW7 A;  2Z76 A;  1DMQ A;  3CNM A;  3GZR A;  3ZFZ A;  1D6U A;  2F99 A;  1UI7 A;  2BHM A;  3LTD A;  3NV0 A;  1OUN A;  1UGH I;  4X2O A;  5DRE A;  4RNY A;  3G16 A;  4N6V 0;  2LYX A;  3LXU X;  1OH0 A;  1B2U A;  1B2S A;  2OTJ 3;  2V1L A;  3JUQ A;  1K9M 4;  1NNV A;  1N8Q A;  2FGT A;  4STD A;  1BNJ A;  3U97 A;  4OVM A;  1FGR A;  1ZX2 A;  2HOH A;  2RFR A;  2XRX B;  4LZI A;  1PU4 A;  2P05 A;  1QAL A;  3OXA A;  2GBW B;  3DGM A;  4LEH A;  3AHW A;  1RDS A;  1LOY A;  1RGC A;  2JDI H;  2CFG A;  3ECF A;  3LOY A;  3OX9 A;  2W2C A;  3FG1 A;  3FZW A;  1JBT A;  3NBJ A;  1BUJ A;  3G0K A;  6RNT A;  3GWR A;  3X41 A;  3WMD A;  3KZT A;  1QVG 2;  1AQZ A;  1BSB A;  3NUV A;  5CK6 A;  1L5G B;  2KXG A;  1PY3 A;  2CHC A;  3CCQ 3;  2P0M A;  3X3Y A;  5EQL A;  4CJN A;  3D3L A;  1I2E A;  1W2Z A;  1DET A;  2UGI A;  5IG5 A;  1N5P A;  5G1L A;  4FMB A;  1TRP A;  1UUG B;  4MEI A;  1SIH A;  1D6Y A;  3LTC A;  4GHO A;  2W6J H;  1G0T A;  1V58 A;  2O3O A;  2Z77 A;  4NHF A;  1V74 A;  1NJI 4;  3MSO A;  1FUS A;  2SBL A;  3AMO B;  3N54 B;  4HM2 B;  2STD A;  1BRN L;  4QWT A;  2WO0 A;  2XFS A;  5TGN A;  3EB8 A;  1HZ1 A;  1Y4K A;  2CWU A;  3DM8 A;  3L0R A;  3LYG A;  4WYK B;  1US1 A;  5ELU A;  4R1K A;  3MG3 A;  5KP3 A;  1JKG B;  4RBN A;  4HJL B;  1UCI A;  2W56 A;  1ASK A;  1U5O A;  3ROB A;  3S27 A;  3UL6 A;  1E97 A;  4HZ9 B;  5FW5 A;  4IIA A;  1M9G A;  1RGE A;  1PYL A;  1LOX A;  1GOY A;  1R4C A;  2FNQ A;  3F7X A;  3MYT A;  3G8Z A;  3LT8 A;  1TU5 A;  3SED A;  3BB9 A;  3EJV A;  1Q86 4;  5IEN A;  3EBY A;  4KT3 B;  3GZX B;  1UDI I;  4EV5 A;  2KAA A;  1RLS A;  2P38 A;  1SPU A;  3FGY A;  3J7Y d;  2D1W A;  1ROV A;  2BO9 B;  2ML5 A;  3BND A;  3OWY A;  2HMK B;  1IV9 A;  1YVB I;  3NQY A;  4HZB B;  1RCK A;  2SAR A;  1K28 A;  3MHE A;  5RNT A;  1BU4 A;  4BTW A;  1W01 A;  3TDG A;  5BXQ A;  1BRG A;  5EVH A;  2J8X B;  1RGL A;  3DGO A;  1YNV X;  7RNT A;  2F5W A;  5D82 A;  4H61 A;  1IQX A;  1X1Y A;  1JZD A;  1WTH A;  3DGY A;  1OF5 B;  1TRQ A;  1W4N A;  1T5Y A;  2ZDJ A;  5HGR A;  1AVL A;  1OHP A;  3GZB A;  4IPB A;  2C11 A;  4JF8 A;  3ZG5 A;  1VQ4 3;  3E99 A;  1FUT A;  3FG4 A;  3KSP A;  4HM3 B;  1RJO A;  3G6E 3;  2OOV A;  3WA2 X;  1EUI C;  3KII A;  1TJD A;  3LH4 A;  1W7C A;  3EQQ B;  2B1X B;  2W04 A;  3HK4 A;  2BT3 A;  1GMP A;  3BIR A;  4KFD A;  5HOH A;  3A76 A;  3FF0 A;  3CCR 3;  1EEJ A;  3K5T A;  5AEW B;  4HM6 B;  1MWS A;  2H0G A;  3FH1 A;  2W0Q A;  2YX9 A;  2CWV A;  2CG1 A;  1WQL B;  3EN1 B;  1VQM 3;  2BIR A;  3PCR A;  1LNI A;  2CK3 H;  3LML A;  3B4O A;  4BL2 A;  1A2K A;  1EKM A;  3CCV 3;  3IMA B;  3CC4 3;  2W56 B;  3KE7 A;  1B2M A;  2IY2 A;  1BVI A;  3JUO A;  4EXR A;  1G02 A;  4JRF A;  1BAO A;  1JB2 A;  1JN5 A;  1T2H A;  3VSY A;  2R41 A;  2ZL8 A;  1QMA A;  3I0Y A;  3FKA A;  3LT9 A;  2GBX B;  2OOV C;  1FGT A;  1M1X B;  3NQZ A;  2XF3 A;  1BRI A;  2CWT A;  1X1X A;  4LGQ A;  2IUJ A;  1MGR A;  4FMC A;  1LOW A;  4R9K A;  1QJG A;  1CEW I;  4J5K A;  2W03 A;  2Y73 A;  1YJN 3;  1CYV A;  2HMO B;  4FCZ A;  1RGH A;  1B27 A;  1ZS7 A;  3B7C A;  4HM4 B;  4EYC A;  1MNL A;  1ULJ B;  1X1W A;  3WA3 A;  3Q2P A;  1LNH A;  1TTO A;  1KC8 4;  5AYS C;  2CC3 A;  1E3R A;  3EN8 A;  5KP4 A;  5ELJ A;  1NO3 A;  3D4A A;  5IG3 A;  3ER7 A;  4ILF A;  4EC6 A;  1GOU A;  4RZM A;  2WOF A;  1RHL A;  1SJW A;  3MPH A;  1RMS A;  2RGQ A;  1I2F A;  1TFK A;  1J2B A;  8CHO A;  2M7O A;  5BU4 A;  2XSO B;  3CXC 2;  1S72 3;  9RNT A;  4GSP A;  3IJE B;  4HOH A;  5EEO A;  4KFE A;  3F7S A;  1TP6 A;  4OK0 A;  1JB5 A;  3STD A;  1WMP A;  4LSO A;  1VQL 3;  4BIR A;  5AIF A;  1FZU A;  3KCH A;  2RSX A;  4AEQ A;  1YHQ 3;  5AIG A;  1QVF 2;  2KF6 A;  1Q7Y 4;  4KFF A;  4FMA A;  1B2Z A;  2FXT A;  3G4S 3;  1SAR A;  2XR8 B;  2MF7 A;  3H51 A;  1SII A;  1EG9 B;  1BSA A;  2AAE A;  2XFT A;  3EX9 A;  3GRD A;  1BRJ A;  4MMY B;  3URP A;  2KF3 A;  1B3S A;  1MWR A;  2O9U X;  3I55 3;  3CCE 3;  4TX4 A;  4WFO A;  2CH9 A;  3CNX A;  1BGS A;  1QAF A;  1UCJ A;  1GY5 A;  3PYJ A;  1UGI A;  3HZP A;  1YIT 3;  3BLZ A;  1IU7 A;  1RN7 A;  2CFK A;  3KSE D;  4PEJ A;  5JPP A;  1HU9 A;  4GL6 A;  4J8T A;  3NBB A;  5M1A A;  1VQO 3;  1BNI A;  1OGX A;  1T3B A;  4G1M B;  4RNZ A;  3S67 A;  3AGO A;  1GYB A;  2ML6 A;  5LC6 A;  1RNB A;  1LRA A;  2UX0 A;  2XSH B;  1FGO A;  2L1S A;  1EQK A;  3JUN A;  4IT7 A;  4AKY A;  3F40 A;  2CX1 A;  2AAD A;  5FGO A;  3D9R A;  1F8N A;  1GD4 A;  5D83 A;  1BNS A;  3LTA A;  1GMR A;  3WHO A;  2YFL B;  3DMC A;  3NV0 B;  1A67 A;  1I0V A;  1PFP A;  3Q1C A;  3JVC A;  4HVN A;  7STD A;  4N6L A;  4NRE A;  3D79 A;  1BNE A;  3DH2 A;  3FF2 A;  1Q40 A;  1O7P B;  4U13 A;  3T0U A;  4XBT A;  3V99 A;  2H0I A;  1DVC A;  3CU3 A;  3N8B A;  4R9L A;  1W02 A;  3SOA A;  1TIJ A;  2F4Y A;  5IEO A;  1WNH A;  4MMX B;  1VQ5 3;  4J9A A;  1EA2 A;  1I8V A;  1MWT A;  2RBI A;  1LQG C;  2Y74 A;  1NB3 I;  2WOH A;  1BNR A;  4ORL A;  2CFD A;  2GEY A;  4O02 B;  2HML B;  2BU4 A;  1K41 A;  4L8O A;  3EHC A;  7GSP A;  1NDO B;  2XEP A;  1RRL A;  1V57 A;  1OCV A;  4Q53 A;  1I3F A;  3SLU A;  1RN1 A;  4HBR A;  4R80 A;  3X3Z A;  3CME 3;  4KZ1 A;  3OWS A;  1YIJ 3;  3Q3F A;  5IW9 A;  3MG2 A;  4AKZ A;  4HM5 B;  3Q90 A;  1RCL A;  4I5Q A;  1VQ6 3;  1KWI A;  5I97 A;  3G71 3;  1AV4 A;  1BSC A;  1UCK A;  4LYL B;  2GU1 A;  4HM0 B;  1O7G B;  5AII A;  3X42 A;  2QEX 3;  1Z1S A;  2K3D A;  1GY6 A;  4HM1 B;  4K90 B;  2L4V A;  1RGK A;  5IF6 A;  5STD A;  1O7M B;  2QIY A;  1LVN A;  2Z7A A;  3S5C A;  1Q82 4;  1RSN A;  3O8Y A;  1MWU A;  1LXE A;  1Q9E A;  1R4Y A;  1W00 A;  2C4B A;  3EBT A;  4N6O B;  1JBS A;  1BIR A;  4MJD A;  5KP1 A;  5AEU B;  5BVB A;  2A15 A;  1YJW 3;  3SOY A;  4WP5 A;  1JJ2 2;  3NX0 A;  1A90 A;  1OAC A;  1YVS A;  1BRH A;  3LTB A;  2RNT A;  1YJ9 3;  1RKY A;  1AY7 A;  2E2U A;  2K54 A;  2OCT A;  3CCJ 3;  3D5G A;  3MKI A;  3DZL A;  3SX1 A;  1IVX A;  2ZA4 A;  2WGO A;  4FR9 A;  1Q40 B;  2Q07 A;  2KF5 A;  4HM8 B;  3DGN A;  2WGQ A;  3CD6 3;  3B8L A;  3BNB A;  1BAN A;  1JV2 B;  1IDP A;  2H0H A;  3HI7 A;  4WWU C;  2E2V A;  4EV2 A;  3KFQ C;  3CC7 3;  1OGZ A;  2BNG A;  1VQ7 3;  3MWZ A;  3FG3 A;  1VQ8 3;  1IT7 A;  4R4K A;  1O7N B;  1N5H A;  1I70 A;  1NWW A;  1TFO A;  5AYR B;  3SYU A;  2XH9 A;  1GSP A;  1T2I A;  3GAX A;  1W6C A;  3KKG A;  1UUW B;  3X3X A;  4KVH A;  3OW2 2;  5GSP A;  1ULI B;  5M18 A;  1MOL A;  1VQQ A;  2F56 A;  2HMJ B;  3GZY B;  4ZM8 A;  1I3I A;  1W2B 2;  3T8N A;  3T8U A;  1VQ9 3;  2CX0 A;  1HKX A;  3PCS A;  4BTY A;  2P0X A;  1IQ8 A;  2GEX A;  4L7K A;  3AMO A;  4MMZ B;  1JBR A;  3MG1 A;  2JQ5 A;  4K1V A;  3U1W A;  4BU4 A;  1BSE A;  3CPW 2;  2BMO B;  6STD A;  1STD A;  3FSD A;  4WYK A;  5A0O B;  4O8S A;  1B2X A;  3FCS B;  4DKI A;  1C7H A; 
#chains in the Genus database with same CATH homology
 1BNI A;  1RCK A;  2SAR A;  5RNT A;  3AHS A;  3AGO A;  1BU4 A;  1RNB A;  1LRA A;  1BRG A;  3RNT A;  1BRK A;  1BOX A;  1FYS A;  1RGL A;  1YNV X;  4J5G A;  2F5W A;  7RNT A;  1X1Y A;  3DGY A;  2AAD A;  1TRQ A;  1BNS A;  3D5I A;  1GMR A;  3WHO A;  1FUT A;  1I0V A;  1HYF A;  1RGA A;  1BNE A;  3DH2 A;  2GSP A;  1ZGX A;  3HOH A;  4RNT A;  3A5E A;  5HOH A;  1GMP A;  3BIR A;  2F4Y A;  1I8V A;  2RBI A;  1BRS A;  1UCL A;  1RN4 A;  1RTU A;  8RNT A;  1BNR A;  1RGG A;  1FW7 A;  2BU4 A;  7GSP A;  2BIR A;  4HAA A;  1LNI A;  1I2G A;  1B21 A;  3AGN A;  1I3F A;  1B2M A;  1BVI A;  1RN1 A;  1G02 A;  1BAO A;  1DE3 A;  1B2U A;  1B2S A;  1T2H A;  3Q3F A;  3BU4 A;  1BNJ A;  1RCL A;  1A2P A;  2KF4 A;  2HOH A;  1BSC A;  1UCK A;  1BRI A;  1LOV A;  1X1X A;  1MGR A;  1C54 A;  1LOW A;  1RGK A;  4J5K A;  1YGW A;  3AHW A;  1RDS A;  1LOY A;  1RGC A;  1RGH A;  1B27 A;  1JBT A;  1B20 A;  1RSN A;  1BUJ A;  2C4B A;  1R4Y A;  1Q9E A;  1X1W A;  6RNT A;  1I0X A;  1JBS A;  1TTO A;  1BIR A;  1AQZ A;  1BSB A;  3D4A A;  1PY3 A;  1BNG A;  1GOU A;  3WR2 A;  1YVS A;  1BRH A;  1I2E A;  2RNT A;  1DET A;  1IYY A;  1AY7 A;  1RHL A;  3D5G A;  1RMS A;  1I2F A;  1TRP A;  2ZA4 A;  5BU4 A;  4GHO A;  1GMQ A;  2KF5 A;  9RNT A;  4GSP A;  1BSD A;  1FUS A;  4HOH A;  1BRN L;  1BNF A;  1RNT A;  1GOV A;  6GSP A;  1BAN A;  1HZ1 A;  4BIR A;  1FZU A;  3KCH A;  1CH0 A;  1UCI A;  2KF6 A;  1B2Z A;  3SYU A;  1SAR A;  1I70 A;  1MGW A;  1GSP A;  1RGE A;  1PYL A;  1T2I A;  1GOY A;  1BSA A;  1X1U A;  2AAE A;  3URP A;  1BRJ A;  5GSP A;  2KF3 A;  1B3S A;  2F56 A;  1I3I A;  1BGS A;  1UCJ A;  1RGF A;  1JBR A;  2F5M A;  5BIR A;  4BU4 A;  1BSE A;  2KAA A;  1RLS A;  3GSP A;  1B2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...