3CCU3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccu300
3I553 1Q864 2QA43 1NJI4 1VQ53 1VQO3 1S723 1VQ83 1JJ22 1YJN3 3CCM3 1K8A4 2OTL3 3CC43 3CMA3 3CCL3 3CCS3 1VQ63 1YJW3 1VQK3 3G713 3CPW2 3CCJ3 1QVG2 1KQS2 3G4S3 1VQ43 1QVF2 3CME3 1YI23 1N8R4 3CCV3 1Q824 3OW22 3CD63 1YJ93 1VQ73 1YIT3 1VQ93 1VQL3 3CC73 1VQM3 1K9M4 1VQN3 3CCE3 1VQP3 2OTJ3 3G6E3 1Q814 1K734 1KC84 1M1K4 3CCQ3 3I563 3CC23 3CCU3 1KD14 1YIJ3 1YHQ3 1W2B2 1Q7Y4 3CXC2 2QEX3 1M904 3CCR3
chains in the Genus database with same CATH superfamily
2C10A 1NO3A 1W6GA 4HZ9B 1I8VA 2HMLB 3ECFA 4RNZA 1BNEA 1QAKA 3DGLA 3GZXB 3CCM3 3G16A 7STDA 3G0KA 2OOVA 2C11A 5D83A 2FNQA 4AEQA 1A67A 3G4S3 1TIJA 3S5CA 2KCDA 3FGYA 1YJ93 1NB5I 2Z76A 2W0QA 1HU9A 2Z7AA 5IG3A 2W03A 4R4KA 2KF4A 4R80A 3F14A 4KFFA 4XBYA 2BU4A 4CDLA 2XFTA 4LEHA 1RKYA 3D79A 2F56A 1ULIB 1BRHA 2C4BA 1UGHI 3D9RA 3K7CA 4K61A 2D42A 3AMOA 2GBXB 1IYYA 3WHOA 3MYTA 1US1A 1JB2A 4MMXB 1YVSA 1YNVX 1CYVA 1GOYA 1LOWA 1I3IA 1EA2A 4FMCA 3OWSA 4BU4A 1PYLA 2BMQB 1X1UA 1IQ8A 3EQQB 3LT8A 1BNSA 3SX1A 3X3YA 1LOYA 6RNTA 1BUQA 1IT7A 1GY5A 2CFKA 2XRXB 4K1UA 3FH1A 1IVWA 1T2HA 2YFJB 2P0MA 2YFLB 2OQEC 3DM8A 3KSPA 5G1KA 2P05A 2A15A 5BIRA 1OF5B 1GD4A 1RCKA 3IJEB 5TGNA 1ISKA 1UUVB 1BOXA 3ZG5A 2WGOA 1WQLB 3CU3A 5IF6A 1BNGA 1O7MB 1UCKA 1Q7Y4 2IUJA 1EUIC 5AI1A 2F86B 2OOVC 5KP1A 1FUSA 2XSHB 3GSPA 3FLJA 4N6OB 1BAOA 5IG5A 2OTL3 1MOLA 3STDA 1SIHA 1K41A 2CW9A 5G2GA 3PCRA 5CXOA 1VQK3 3F8HA 3MPHA 1G0TA 1RN4A 1TRPA 4EXRA 3DGMA 1B21A 3AHWA 2XSOB 3X40A 4O8SA 2CG1A 2CG0A 2OCTA 3FG4A 4J8TA 3CCE3 1VQP3 4NPBA 5EVHA 1E97A 1O7WB 3EN1B 2J8XB 1TRQA 5IG0A 2WOHA 5ELUA 1QAFA 1B2XA 3N9HA 1JB5A 1LOVA 3I553 1JB4A 1V58A 1IVUA 2CFWA 2HMMB 4XBXA 1ULJB 2F5MA 2BO9B 3DGYA 3F9SA 3Q90A 1DMQA 1SJWA 2K54A 4DKIA 1TU5A 3FSDA 1YJN3 1ZO2A 3PS8A 9RNTA 1BGSA 1FGMA 2BMOB 4OUQA 4MJDA 5JPPA 2CH9A 4O2HA 1DE3A 3B7CA 3FG1A 5CLKA 1UI7A 5G1LA 2KRTA 1Q824 1UW1A 3NQYA 3OW22 1N8R4 3X3ZA 3AHSA 3FZWA 5DREA 1FGTA 1VQ73 1C54A 3GZBA 4MMZB 5LC7A 1B27A 3G6E3 1MWSA 2GXFA 1UGIA 2FXTA 3EF8A 1ASKA 4HM0B 1AV4A 1RGAA 4HKVB 3ROBA 3LZAA 2GBWB 3JUQA 4HVNA 3UL5A 1L5GB 3NM7A 4Q53A 1RN1A 1W7CA 3Q2PA 1YGEA 1PY3A 4O3VA 1FYSA 4LZIA 1KSIA 5IENA 3HIGA 2KAAA 1N5HA 1X1YA 1ZX2A 2Y74A 3WR2A 5CK6A 3J7Yd 3GZRA 2W56B 3EJVA 4LMIA 1JV2B 2ML5A 2PNCA 3MSOA 2BT3A 1QVF2 1RGKA 1M1XB 1RMSA 1ZS7A 1UI8A 5EEOA 3D5GA 5CF1A 4BTYA 1LRAA 2XGNA 1RGGA 1BSAA 3T8NA 1JBTA 1IVVA 2Y73A 1KC84 3HI7A 2W6JH 2CWUA 1RN7A 4HJLB 2RFRA 4WWUC 3I563 3IPTA 2CWVA 2ZDJA 3B4OA 1X1XA 4G1MB 5BXQA 1M904 1TP6A 2UUGC 1O7HB 2RSXA 2XH9A 3BU4A 1GY6A 1O7GB 5IEOA 4FMBA 2HMKB 1IT8A 4N3VA 1EG9B 1STFI 1UUWB 2E2VA 4X2HA 5HGRA 3CCL3 3CCS3 2CWTA 3CPW2 1RHLA 4WFOA 1BSEA 4HM1B 3D3LA 4KZ1A 2XEPA 1B2ZA 1I3FA 1YIT3 1GYBA 5BVBA 3NQZA 1SQWA 2IY2A 1TFKA 2LQVA 2V1LA 4XDWA 1TFOA 5D81A 2B1XB 4N6TA 2IA7A 3E99A 1OHSA 3SOYA 3WA2X 3NV0A 3PGBA 1MNLA 4NREA 3UB1A 1W2B2 1DMNA 2WO0A 1K28A 2P0XA 3LYGA 1X1WA 1VQ53 1E3RA 1Q42A 2OWPA 1S723 2SBLA 3UJMA 3K0ZA 3Q3FA 4HM4B 3X41A 1A2KA 5D82A 2HOHA 4HM3B 2HMOB 5M18A 1JN5A 5AYRB 5JBSA 1OPYA 1U8CB 2IUKA 4HBRA 2K3DA 1YI23 4RNYA 4LYLB 1BSBA 2ML6A 1QMAA 3A76A 1VQ93 1WTHA 2CX0A 3BNBA 3K63A 3BNEA 2RGQA 3K5TA 1BSCA 3FF2A 3LH4A 1W6YA 4AKZA 3X3XA 1I2FA 1M9GA 6STDA 5HOHA 8RNTA 3CNXA 1U5OA 1W02A 1MGWA 2KF6A 2WOFA 3F40A 4K1VA 3DY5A 3DUKA 4XDVA 4J5KA 3SLUA 1GOUA 1DMMA 1LQMB 1Q9EA 1MWUA 5A0OB 2F5WA 3HZPA 4ILFA 1K8A4 4LSOA 1OHOA 3LXUX 4X2OA 3HK4A 1MWTA 1GSPA 1LNHA 1NNVA 1UCLA 2F4YA 4RNTA 3NUVA 1RNBA 2GU1A 7RNTA 3X42A 1I2GA 4FCJA 1MGRA 1RRLA 3NV0B 3S67A 5IG4A 2CFDA 3RGAA 3V99A 4EBGA 1VQL3 1R4YA 1G96A 1UCIA 1RGFA 3BIRA 3BNCA 1IDPA 1FGQA 4MMYB 1J2BA 4TX4A 3VGNA 7GSPA 2H0GA 1FGOA 1TTOA 1IK3A 1FW7A 1Z1SA 2E2TA 1SIIA 3A5EA 3GWRA 4IT7A 1G02A 1OH0A 1RLSA 3OV4A 1I70A 4CPKA 4HZBB 1DVCA 1B3SA 1AY7A 1GS3A 1ROAA 3HOHA 1GY7A 3OX9A 2P09A 4R9LA 1JZOA 1Q40B 1W01A 4L7KA 3KKGA 3MHEA 4N6UA 1LVNA 2ZL8A 3QK9A 3SEDA 1BU4A 4PEJA 2JQ5A 3UNLA 2KXGA 1OUNA 3H51A 4N6LA 1NWWA 3G713 5IEPA 2CHCA 1YVBI 3IMAB 4OVMA 2SARA 3CNMA 3LTAA 1RJOA 2E2UA 1BRIA 4STDA 4H61A 3CD63 1DETA 4GHOA 1CYUA 3FCSB 3I0YA 3KN4A 1LNIA 1EEJA 2M7OA 1RGEA 1BRJA 2L4VA 1W6CA 2BIRA 2YFIB 3AMOB 3Q1CA 1M1K4 3WA3A 1B20A 3EBTA 3N8BA 1KD14 4FMDA 2LYXA 1YHQ3 3D5IA 3GAXA 3VF1A 3DXOA 5AIFA 1W5ZA 3G8ZA 1BNJA 3RNTA 3EX9A 1N5PA 1CQSA 1VQ83 2UX0A 3S28A 3LTBA 3WODG 1EKMA 5I97A 2YX9A 1HZ1A 3B4PA 1DVDA 6GSPA 1AQZA 4BL2A 1RNTA 1YJW3 2CFLA 1S5AA 4HYZA 1T3BA 2GU3A 3F8XA 3CCJ3 3LOYA 1UCJA 1BUJA 2XGLA 5STDA 3LT9A 2BMRB 3EE1A 1F8NA 3S27A 1IQYA 4EYCA 1D6YA 5M19A 1RCLA 1IQXA 2L1SA 1K9M4 2MF7A 1LOXA 1NU3A 1I2EA 3EBYA 5AEWB 3S29A 3CCQ3 3QRDA 2CK3H 2ZA4A 3NX0A 5LC6A 4CCVA 3O8YA 1OF5A 1C7HA 1OACA 4EV5A 1NJI4 1QALA 1NB3I 1A2PA 1OGZA 1V74A 3F7XA 4R9KA 5M1AA 3K9MC 3CMA3 1FA3A 1IV7A 5RNTA 1STDA 3UL6A 1PFPA 4JRFA 2CKFB 1O7NB 1IU7A 3AGNA 1VQ43 1E3VA 1TJDA 2H0HA 2RBIA 3CME3 2GSPA 3M8CA 1BSDA 4N6NB 2BNGA 1LXEA 2GEYA 1V57A 1CH0A 1Q814 1K734 1HKXA 4OK0A 3DMCA 4IPBA 1B2UA 5AIHA 1BRGA 1Q40A 4FCMA 2O3OA 3DGOA 3MG1A 2IMJA 1R4CA 1Q864 2W56A 3EB8A 1AVKA 3OWYA 3ER7A 1GMRA 3F7SA 4ORLA 4HM8B 3H3HA 3JUNA 3D4AA 2XF3A 4I5QA 1D6UA 4GB5A 4HM7B 4XM4A 4EW5A 1QVG2 2R4IA 3BNDA 1I0XA 1JN5B 1JBSA 3LTCA 2JDIH 4XBTA 4AKYA 3WOFB 3CCV3 1A90A 1T2IA 3FKAA 4KFEA 2W9QA 3LTDA 2INXA 3MWZA 1NDOB 2HMJB 3ALAA 1AR0A 1A2VA 2Z6BA 5FGOA 1KWIA 3URPA 3BB9A 1OCVA 5AIGA 4BTWA 3L0RA 1VZZA 1AVLA 2F99A 1BRKA 1TUHA 2B24B 1BANA 4BL3A 1VQO3 1B2MA 1BRNL 2PZVA 1RGLA 5IW9A 3GZYB 1JNQA 3AGOA 5AEUB 5AYSC 3KSED 2UGIA 3SVAA 3FG3A 3EN8A 1JKGB 3N54B 3HIIA 4J9AA 4QWTA 1VQM3 1N8QA 4J5GA 5EQLA 1BNIA 3PCSA 4EC6A 1ROVA 4H3UA 3OXAA 4IIAA 3MKIA 3ZG0A 1HYFA 1I0VA 2RCDA 1IV9A 2WGQA 1WMNA 3WOEB 2STDA 5IERA 3LMLA 3MG3A 3SOAA 1OGXA 3PXMA 1FUTA 1QJGA 2QA43 1FUWA 1YGWA 1JBRA 1N9JA 1JJ22 3V92A 2W2CA 4WP5A 1RRHA 2MC8A 1GMPA 2QIYA 4HAAA 4GSPA 5CF2A 1DYUA 1W4NA 2D1WA 2CIUA 4L8PA 1GOVA 1MWRA 1OHPA 2AAEA 4HM2B 4NHFA 5ELJA 2W04A 2CFGA 1W2ZA 1RSNA 3HX8A 4N6V0 1WMPA 3RGRA 2R41A 1WMOA 1BRSA 3KCHA 1JZDA 3NBJA 1VQN3 1UUGB 3T0UA 2W9PA 4KVHA 4FCZA 2KF5A 3FF0A 4I4KA 3ZFZA 3OWUA 3NBRA 4N6MA 3CXC2 4HOHA 3KIIA 3JUMA 1Y4KA 3CCR3 2FGTA 1B2SA 1FGRA 1EQKA 1JRQA 8CHOA 1Q7HA 4MEIA 3BLZA 3KFQC 5FW5A 3U1WA 5JPUA 4RZMA 1T5YA 3DH2A 3CC43 3U97A 2IYJA 1CEWI 1LQGC 2Q07A 2Z77A 3WDGB 5KP4A 1JKGA 3JVCA 3KE7A 4BIRA 4BTXA 2KF3A 4FMAA 1RTUA 3DZLA 3SYUA 2ZHXB 4HM5B 4XB5A 4CJNA 2AADA 4WYKB 4EV2A 1WNHA 3WMDA 2CX1A 3NM2A 4O02B 1IVXA 2I9WA 3CPOA 4RBNA 5AIIA 5DRVA 2OTJ3 3PYJA 3TDGA 1BNRA 1SPUA 4KFDA 1W00A 4ZM8A 2QGUA 4JF8A 4K90B 4WHAA 4FR9A 1ZGXA 5KP3A 2XFSA 2H0IA 3VSYA 3JUPA 2CC3A 1RGHA 3NXJA 1RDSA 1O7PB 2BHMA 2K0MA 3V98A 2RNTA 1BVIA 1D6ZA 3KZTA 1GD3A 2GEXA 1PU4A 1VQ63 2XR8B 3DGNA 5BU4A 4LGQA 5GSPA 1KQS2 4KT3B 1SARA 2OQEA 3T8UA 1BIRA 1N9EA 2HMNB 3JUOA 3EC9A 1RGCA 2P38A 3B8LA 4WYKA 4GL6A 3CC73 3PZWA 4HM6B 3NBBA 3EHCA 1UDII 2F98A 4R1KA 3CC23 3MG2A 4L8OA 1GMQA 2O9UX 4U13A 3CCU3 1YIJ3 1FZUA 1VQQA 2QEX3 3SXXA 3NHXA 3GRDA 1BNFA 3RDEA
chains in the Genus database with same CATH topology
2C10A 1NO3A 1W6GA 4HZ9B 2HMLB 4RNZA 3ECFA 1QAKA 3DGLA 3GZXB 3CCM3 3G16A 7STDA 3G0KA 2OOVA 2C11A 5D83A 2FNQA 4AEQA 1A67A 3G4S3 1TIJA 3S5CA 2KCDA 3FGYA 1YJ93 1NB5I 2Z76A 2W0QA 1HU9A 2Z7AA 5IG3A 2W03A 4R4KA 4R80A 3F14A 4KFFA 4XBYA 4CDLA 2XFTA 4LEHA 1RKYA 1ULIB 3D9RA 4K61A 3K7CA 2D42A 3AMOA 2GBXB 3MYTA 1US1A 1JB2A 4MMXB 1CYVA 1EA2A 4FMCA 3OWSA 2BMQB 3SX1A 1IQ8A 3EQQB 3LT8A 3X3YA 1BUQA 1IT7A 1GY5A 2CFKA 2XRXB 4K1UA 3FH1A 1IVWA 2YFJB 2P0MA 2YFLB 2OQEC 3DM8A 3KSPA 2P05A 2A15A 1OF5B 1GD4A 3IJEB 5TGNA 1ISKA 1UUVB 2WGOA 1WQLB 3CU3A 5IF6A 1O7MB 1Q7Y4 2IUJA 5AI1A 2F86B 2OOVC 5KP1A 2XSHB 3FLJA 4N6OB 5IG5A 2OTL3 1MOLA 3STDA 1SIHA 1K41A 2CW9A 5G2GA 3PCRA 5CXOA 1VQK3 3F8HA 3MPHA 4EXRA 3DGMA 2XSOB 3X40A 4O8SA 2CG1A 2CG0A 2OCTA 3FG4A 4J8TA 3CCE3 1VQP3 5EVHA 1E97A 1O7WB 3EN1B 5IG0A 2WOHA 5ELUA 1QAFA 3N9HA 1JB5A 3I553 1JB4A 2CFWA 1IVUA 2HMMB 4XBXA 1ULJB 2BO9B 3F9SA 1TU5A 3Q90A 1DMQA 1SJWA 2K54A 1YJN3 3FSDA 1ZO2A 3PS8A 1FGMA 2BMOB 4OUQA 4MJDA 5JPPA 2CH9A 4O2HA 3B7CA 3FG1A 5CLKA 1UI7A 1N8R4 2KRTA 1Q824 1UW1A 3NQYA 3OW22 3X3ZA 3FZWA 5DREA 1FGTA 1VQ73 3GZBA 4MMZB 5LC7A 3G6E3 2GXFA 2FXTA 3EF8A 1ASKA 4HM0B 1AV4A 3ROBA 4HKVB 3LZAA 2GBWB 3JUQA 4HVNA 3UL5A 1L5GB 3NM7A 4Q53A 1W7CA 3Q2PA 1YGEA 4O3VA 4LZIA 1KSIA 5IENA 3HIGA 1N5HA 1ZX2A 2Y74A 5CK6A 3J7Yd 3GZRA 2W56B 3EJVA 4LMIA 1JV2B 2ML5A 2PNCA 3MSOA 2BT3A 1QVF2 1M1XB 1UI8A 5EEOA 5CF1A 4BTYA 2XGNA 3T8NA 1IVVA 2Y73A 1KC84 3HI7A 2W6JH 2CWUA 1RN7A 4HJLB 2RFRA 4WWUC 3I563 3IPTA 2CWVA 2ZDJA 3B4OA 4G1MB 5BXQA 1M904 1TP6A 1O7HB 2RSXA 2XH9A 1GY6A 1O7GB 5IEOA 4FMBA 2HMKB 1IT8A 4N3VA 1EG9B 1STFI 1UUWB 2E2VA 4X2HA 5HGRA 3CCL3 3CCS3 2CWTA 3CPW2 4WFOA 4HM1B 3D3LA 4KZ1A 2XEPA 1YIT3 1GYBA 5BVBA 3NQZA 1SQWA 2LQVA 2V1LA 1TFKA 4XDWA 5D81A 1TFOA 2B1XB 4N6TA 2IA7A 3E99A 1OHSA 3SOYA 3WA2X 3NV0A 3PGBA 1MNLA 4NREA 3UB1A 1W2B2 1DMNA 2WO0A 1K28A 2P0XA 3LYGA 1VQ53 1E3RA 1Q42A 2OWPA 1S723 2SBLA 3UJMA 3K0ZA 4HM4B 3X41A 1A2KA 5D82A 4HM3B 2HMOB 1JN5A 5AYRB 5JBSA 1OPYA 1U8CB 2IUKA 4HBRA 1YI23 4RNYA 2ML6A 1QMAA 3A76A 1VQ93 1WTHA 3BNBA 3K63A 3BNEA 2RGQA 3K5TA 3FF2A 3LH4A 1W6YA 4AKZA 3X3XA 1M9GA 6STDA 3CNXA 1U5OA 1W02A 2WOFA 3F40A 4K1VA 3DY5A 3DUKA 4XDVA 3SLUA 1DMMA 5A0OB 3HZPA 1K8A4 4LSOA 1OHOA 3LXUX 4X2OA 3HK4A 1LNHA 3NUVA 2GU1A 3X42A 4FCJA 1RRLA 3NV0B 3S67A 5IG4A 2CFDA 3RGAA 3V99A 4EBGA 1VQL3 1G96A 3BNCA 1IDPA 1FGQA 4MMYB 1J2BA 4TX4A 3VGNA 1FGOA 1IK3A 1Z1SA 2E2TA 1SIIA 3GWRA 4IT7A 1OH0A 3OV4A 4HZBB 1DVCA 1GS3A 1ROAA 1GY7A 3OX9A 2P09A 4R9LA 1Q40B 1W01A 4L7KA 4N6UA 3KKGA 3MHEA 1LVNA 2ZL8A 3QK9A 3SEDA 4PEJA 2JQ5A 3UNLA 2KXGA 1OUNA 3H51A 4N6LA 1NWWA 3G713 5IEPA 2CHCA 1YVBI 3IMAB 4OVMA 3CNMA 3LTAA 1RJOA 2E2UA 4STDA 4H61A 3CD63 1CYUA 3FCSB 3I0YA 3KN4A 2M7OA 2L4VA 1W6CA 3Q1CA 2YFIB 3AMOB 1M1K4 3WA3A 3EBTA 3N8BA 1KD14 4FMDA 2LYXA 1YHQ3 3GAXA 3VF1A 3DXOA 5AIFA 1W5ZA 3G8ZA 3EX9A 1N5PA 1CQSA 1VQ83 2UX0A 3S28A 3LTBA 3WODG 1EKMA 5I97A 2YX9A 3B4PA 1DVDA 1YJW3 2CFLA 1S5AA 4HYZA 3CCJ3 2GU3A 3F8XA 3LOYA 2XGLA 5STDA 3LT9A 2BMRB 3EE1A 1F8NA 3S27A 1IQYA 4EYCA 1D6YA 1K9M4 1IQXA 2MF7A 1LOXA 1NU3A 3EBYA 5AEWB 3S29A 3CCQ3 3QRDA 2CK3H 5LC6A 3NX0A 4CCVA 3O8YA 1OF5A 1C7HA 1OACA 4EV5A 1NJI4 1QALA 1NB3I 1OGZA 1V74A 3F7XA 4R9KA 3K9MC 3CMA3 1FA3A 1IV7A 1STDA 3UL6A 1PFPA 4JRFA 2CKFB 1O7NB 1IU7A 1VQ43 1E3VA 3CME3 3M8CA 4N6NB 2BNGA 1LXEA 2GEYA 1Q814 1K734 1HKXA 4OK0A 3DMCA 4IPBA 5AIHA 1Q40A 4FCMA 2O3OA 3DGOA 3MG1A 2IMJA 1R4CA 1Q864 2W56A 3EB8A 1AVKA 3OWYA 3ER7A 4ORLA 3F7SA 4HM8B 3H3HA 3JUNA 4XM4A 2XF3A 1D6UA 4GB5A 4HM7B 1QVG2 2R4IA 3BNDA 1JN5B 3LTCA 2JDIH 4XBTA 4AKYA 3WOFB 3CCV3 1A90A 3FKAA 4KFEA 2W9QA 3LTDA 2INXA 3MWZA 1NDOB 2HMJB 3ALAA 1AR0A 1A2VA 2Z6BA 5FGOA 1KWIA 3BB9A 1OCVA 5AIGA 4BTWA 3L0RA 1VZZA 1AVLA 2F99A 1TUHA 2B24B 1VQO3 2PZVA 5IW9A 3GZYB 1JNQA 5AEUB 5AYSC 3KSED 3SVAA 3FG3A 3EN8A 1JKGB 3N54B 3HIIA 4J9AA 4QWTA 1VQM3 1N8QA 5EQLA 4EC6A 3PCSA 1ROVA 4H3UA 3OXAA 4IIAA 3MKIA 2RCDA 1IV9A 2WGQA 1WMNA 3WOEB 2STDA 5IERA 3LMLA 3MG3A 3SOAA 1OGXA 3PXMA 2QA43 1QJGA 1FUWA 1N9JA 1JJ22 3V92A 2W2CA 4WP5A 1RRHA 2MC8A 2QIYA 5CF2A 1DYUA 1W4NA 2D1WA 2CIUA 4L8PA 1OHPA 4HM2B 4NHFA 5ELJA 2W04A 2CFGA 1W2ZA 3HX8A 4N6V0 1WMPA 3RGRA 1VQN3 1WMOA 3NBJA 3T0UA 2W9PA 4KVHA 4FCZA 3FF0A 4I4KA 3OWUA 3NBRA 4N6MA 3CXC2 3KIIA 3JUMA 1Y4KA 3CCR3 2FGTA 1FGRA 1EQKA 1JRQA 8CHOA 4MEIA 3BLZA 3KFQC 5FW5A 3U1WA 5JPUA 4RZMA 1T5YA 3CC43 3U97A 3WDGB 1CEWI 2Q07A 5KP4A 2Z77A 1JKGA 3JVCA 3KE7A 4BTXA 4FMAA 3DZLA 4HM5B 4XB5A 4WYKB 4EV2A 1WNHA 3WMDA 3NM2A 4O02B 1IVXA 2I9WA 3CPOA 4RBNA 5AIIA 5DRVA 2OTJ3 3PYJA 3TDGA 1SPUA 4KFDA 1W00A 4ZM8A 2QGUA 4JF8A 4K90B 4WHAA 4FR9A 5KP3A 2XFSA 3VSYA 3JUPA 2CC3A 3NXJA 1O7PB 2BHMA 2K0MA 3V98A 3KZTA 1D6ZA 1GD3A 2GEXA 1PU4A 1VQ63 2XR8B 3DGNA 4LGQA 1KQS2 2OQEA 3T8UA 1N9EA 2HMNB 3JUOA 3EC9A 3B8LA 2P38A 4WYKA 4GL6A 3CC73 3PZWA 4HM6B 3NBBA 3EHCA 4R1KA 2F98A 3CC23 3MG2A 4L8OA 3CCU3 2O9UX 4U13A 1YIJ3 2QEX3 3SXXA 3NHXA 3GRDA 3RDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 3;  1Q86 4;  2QA4 3;  1NJI 4;  1VQ5 3;  1VQO 3;  1S72 3;  1VQ8 3;  1JJ2 2;  1YJN 3;  3CCM 3;  1K8A 4;  2OTL 3;  3CC4 3;  3CMA 3;  3CCL 3;  3CCS 3;  1VQ6 3;  1YJW 3;  1VQK 3;  3G71 3;  3CPW 2;  3CCJ 3;  1QVG 2;  1KQS 2;  3G4S 3;  1VQ4 3;  1QVF 2;  3CME 3;  1YI2 3;  1N8R 4;  3CCV 3;  1Q82 4;  3OW2 2;  3CD6 3;  1YJ9 3;  1VQ7 3;  1YIT 3;  1VQ9 3;  1VQL 3;  3CC7 3;  1VQM 3;  1K9M 4;  1VQN 3;  3CCE 3;  1VQP 3;  2OTJ 3;  3G6E 3;  1Q81 4;  1K73 4;  1KC8 4;  1M1K 4;  3CCQ 3;  3I56 3;  3CC2 3;  3CCU 3;  1KD1 4;  1YIJ 3;  1YHQ 3;  1W2B 2;  1Q7Y 4;  3CXC 2;  2QEX 3;  1M90 4;  3CCR 3; 
#chains in the Genus database with same CATH topology
 2C10 A;  1NO3 A;  1W6G A;  4HZ9 B;  1I8V A;  2HML B;  3ECF A;  4RNZ A;  1BNE A;  1QAK A;  3DGL A;  3GZX B;  3CCM 3;  3G16 A;  7STD A;  3G0K A;  2OOV A;  2C11 A;  5D83 A;  2FNQ A;  4AEQ A;  1A67 A;  3G4S 3;  1TIJ A;  3S5C A;  2KCD A;  3FGY A;  1YJ9 3;  1NB5 I;  2Z76 A;  2W0Q A;  1HU9 A;  2Z7A A;  5IG3 A;  2W03 A;  4R4K A;  2KF4 A;  4R80 A;  3F14 A;  4KFF A;  4XBY A;  2BU4 A;  4CDL A;  2XFT A;  4LEH A;  1RKY A;  3D79 A;  2F56 A;  1ULI B;  1BRH A;  2C4B A;  1UGH I;  3D9R A;  3K7C A;  4K61 A;  2D42 A;  3AMO A;  2GBX B;  1IYY A;  3WHO A;  3MYT A;  1US1 A;  1JB2 A;  4MMX B;  1YVS A;  1YNV X;  1CYV A;  1GOY A;  1LOW A;  1I3I A;  1EA2 A;  4FMC A;  3OWS A;  4BU4 A;  1PYL A;  2BMQ B;  1X1U A;  1IQ8 A;  3EQQ B;  3LT8 A;  1BNS A;  3SX1 A;  3X3Y A;  1LOY A;  6RNT A;  1BUQ A;  1IT7 A;  1GY5 A;  2CFK A;  2XRX B;  4K1U A;  3FH1 A;  1IVW A;  1T2H A;  2YFJ B;  2P0M A;  2YFL B;  2OQE C;  3DM8 A;  3KSP A;  5G1K A;  2P05 A;  2A15 A;  5BIR A;  1OF5 B;  1GD4 A;  1RCK A;  3IJE B;  5TGN A;  1ISK A;  1UUV B;  1BOX A;  3ZG5 A;  2WGO A;  1WQL B;  3CU3 A;  5IF6 A;  1BNG A;  1O7M B;  1UCK A;  1Q7Y 4;  2IUJ A;  1EUI C;  5AI1 A;  2F86 B;  2OOV C;  5KP1 A;  1FUS A;  2XSH B;  3GSP A;  3FLJ A;  4N6O B;  1BAO A;  5IG5 A;  2OTL 3;  1MOL A;  3STD A;  1SIH A;  1K41 A;  2CW9 A;  5G2G A;  3PCR A;  5CXO A;  1VQK 3;  3F8H A;  3MPH A;  1G0T A;  1RN4 A;  1TRP A;  4EXR A;  3DGM A;  1B21 A;  3AHW A;  2XSO B;  3X40 A;  4O8S A;  2CG1 A;  2CG0 A;  2OCT A;  3FG4 A;  4J8T A;  3CCE 3;  1VQP 3;  4NPB A;  5EVH A;  1E97 A;  1O7W B;  3EN1 B;  2J8X B;  1TRQ A;  5IG0 A;  2WOH A;  5ELU A;  1QAF A;  1B2X A;  3N9H A;  1JB5 A;  1LOV A;  3I55 3;  1JB4 A;  1V58 A;  1IVU A;  2CFW A;  2HMM B;  4XBX A;  1ULJ B;  2F5M A;  2BO9 B;  3DGY A;  3F9S A;  3Q90 A;  1DMQ A;  1SJW A;  2K54 A;  4DKI A;  1TU5 A;  3FSD A;  1YJN 3;  1ZO2 A;  3PS8 A;  9RNT A;  1BGS A;  1FGM A;  2BMO B;  4OUQ A;  4MJD A;  5JPP A;  2CH9 A;  4O2H A;  1DE3 A;  3B7C A;  3FG1 A;  5CLK A;  1UI7 A;  5G1L A;  2KRT A;  1Q82 4;  1UW1 A;  3NQY A;  3OW2 2;  1N8R 4;  3X3Z A;  3AHS A;  3FZW A;  5DRE A;  1FGT A;  1VQ7 3;  1C54 A;  3GZB A;  4MMZ B;  5LC7 A;  1B27 A;  3G6E 3;  1MWS A;  2GXF A;  1UGI A;  2FXT A;  3EF8 A;  1ASK A;  4HM0 B;  1AV4 A;  1RGA A;  4HKV B;  3ROB A;  3LZA A;  2GBW B;  3JUQ A;  4HVN A;  3UL5 A;  1L5G B;  3NM7 A;  4Q53 A;  1RN1 A;  1W7C A;  3Q2P A;  1YGE A;  1PY3 A;  4O3V A;  1FYS A;  4LZI A;  1KSI A;  5IEN A;  3HIG A;  2KAA A;  1N5H A;  1X1Y A;  1ZX2 A;  2Y74 A;  3WR2 A;  5CK6 A;  3J7Y d;  3GZR A;  2W56 B;  3EJV A;  4LMI A;  1JV2 B;  2ML5 A;  2PNC A;  3MSO A;  2BT3 A;  1QVF 2;  1RGK A;  1M1X B;  1RMS A;  1ZS7 A;  1UI8 A;  5EEO A;  3D5G A;  5CF1 A;  4BTY A;  1LRA A;  2XGN A;  1RGG A;  1BSA A;  3T8N A;  1JBT A;  1IVV A;  2Y73 A;  1KC8 4;  3HI7 A;  2W6J H;  2CWU A;  1RN7 A;  4HJL B;  2RFR A;  4WWU C;  3I56 3;  3IPT A;  2CWV A;  2ZDJ A;  3B4O A;  1X1X A;  4G1M B;  5BXQ A;  1M90 4;  1TP6 A;  2UUG C;  1O7H B;  2RSX A;  2XH9 A;  3BU4 A;  1GY6 A;  1O7G B;  5IEO A;  4FMB A;  2HMK B;  1IT8 A;  4N3V A;  1EG9 B;  1STF I;  1UUW B;  2E2V A;  4X2H A;  5HGR A;  3CCL 3;  3CCS 3;  2CWT A;  3CPW 2;  1RHL A;  4WFO A;  1BSE A;  4HM1 B;  3D3L A;  4KZ1 A;  2XEP A;  1B2Z A;  1I3F A;  1YIT 3;  1GYB A;  5BVB A;  3NQZ A;  1SQW A;  2IY2 A;  1TFK A;  2LQV A;  2V1L A;  4XDW A;  1TFO A;  5D81 A;  2B1X B;  4N6T A;  2IA7 A;  3E99 A;  1OHS A;  3SOY A;  3WA2 X;  3NV0 A;  3PGB A;  1MNL A;  4NRE A;  3UB1 A;  1W2B 2;  1DMN A;  2WO0 A;  1K28 A;  2P0X A;  3LYG A;  1X1W A;  1VQ5 3;  1E3R A;  1Q42 A;  2OWP A;  1S72 3;  2SBL A;  3UJM A;  3K0Z A;  3Q3F A;  4HM4 B;  3X41 A;  1A2K A;  5D82 A;  2HOH A;  4HM3 B;  2HMO B;  5M18 A;  1JN5 A;  5AYR B;  5JBS A;  1OPY A;  1U8C B;  2IUK A;  4HBR A;  2K3D A;  1YI2 3;  4RNY A;  4LYL B;  1BSB A;  2ML6 A;  1QMA A;  3A76 A;  1VQ9 3;  1WTH A;  2CX0 A;  3BNB A;  3K63 A;  3BNE A;  2RGQ A;  3K5T A;  1BSC A;  3FF2 A;  3LH4 A;  1W6Y A;  4AKZ A;  3X3X A;  1I2F A;  1M9G A;  6STD A;  5HOH A;  8RNT A;  3CNX A;  1U5O A;  1W02 A;  1MGW A;  2KF6 A;  2WOF A;  3F40 A;  4K1V A;  3DY5 A;  3DUK A;  4XDV A;  4J5K A;  3SLU A;  1GOU A;  1DMM A;  1LQM B;  1Q9E A;  1MWU A;  5A0O B;  2F5W A;  3HZP A;  4ILF A;  1K8A 4;  4LSO A;  1OHO A;  3LXU X;  4X2O A;  3HK4 A;  1MWT A;  1GSP A;  1LNH A;  1NNV A;  1UCL A;  2F4Y A;  4RNT A;  3NUV A;  1RNB A;  2GU1 A;  7RNT A;  3X42 A;  1I2G A;  4FCJ A;  1MGR A;  1RRL A;  3NV0 B;  3S67 A;  5IG4 A;  2CFD A;  3RGA A;  3V99 A;  4EBG A;  1VQL 3;  1R4Y A;  1G96 A;  1UCI A;  1RGF A;  3BIR A;  3BNC A;  1IDP A;  1FGQ A;  4MMY B;  1J2B A;  4TX4 A;  3VGN A;  7GSP A;  2H0G A;  1FGO A;  1TTO A;  1IK3 A;  1FW7 A;  1Z1S A;  2E2T A;  1SII A;  3A5E A;  3GWR A;  4IT7 A;  1G02 A;  1OH0 A;  1RLS A;  3OV4 A;  1I70 A;  4CPK A;  4HZB B;  1DVC A;  1B3S A;  1AY7 A;  1GS3 A;  1ROA A;  3HOH A;  1GY7 A;  3OX9 A;  2P09 A;  4R9L A;  1JZO A;  1Q40 B;  1W01 A;  4L7K A;  3KKG A;  3MHE A;  4N6U A;  1LVN A;  2ZL8 A;  3QK9 A;  3SED A;  1BU4 A;  4PEJ A;  2JQ5 A;  3UNL A;  2KXG A;  1OUN A;  3H51 A;  4N6L A;  1NWW A;  3G71 3;  5IEP A;  2CHC A;  1YVB I;  3IMA B;  4OVM A;  2SAR A;  3CNM A;  3LTA A;  1RJO A;  2E2U A;  1BRI A;  4STD A;  4H61 A;  3CD6 3;  1DET A;  4GHO A;  1CYU A;  3FCS B;  3I0Y A;  3KN4 A;  1LNI A;  1EEJ A;  2M7O A;  1RGE A;  1BRJ A;  2L4V A;  1W6C A;  2BIR A;  2YFI B;  3AMO B;  3Q1C A;  1M1K 4;  3WA3 A;  1B20 A;  3EBT A;  3N8B A;  1KD1 4;  4FMD A;  2LYX A;  1YHQ 3;  3D5I A;  3GAX A;  3VF1 A;  3DXO A;  5AIF A;  1W5Z A;  3G8Z A;  1BNJ A;  3RNT A;  3EX9 A;  1N5P A;  1CQS A;  1VQ8 3;  2UX0 A;  3S28 A;  3LTB A;  3WOD G;  1EKM A;  5I97 A;  2YX9 A;  1HZ1 A;  3B4P A;  1DVD A;  6GSP A;  1AQZ A;  4BL2 A;  1RNT A;  1YJW 3;  2CFL A;  1S5A A;  4HYZ A;  1T3B A;  2GU3 A;  3F8X A;  3CCJ 3;  3LOY A;  1UCJ A;  1BUJ A;  2XGL A;  5STD A;  3LT9 A;  2BMR B;  3EE1 A;  1F8N A;  3S27 A;  1IQY A;  4EYC A;  1D6Y A;  5M19 A;  1RCL A;  1IQX A;  2L1S A;  1K9M 4;  2MF7 A;  1LOX A;  1NU3 A;  1I2E A;  3EBY A;  5AEW B;  3S29 A;  3CCQ 3;  3QRD A;  2CK3 H;  2ZA4 A;  3NX0 A;  5LC6 A;  4CCV A;  3O8Y A;  1OF5 A;  1C7H A;  1OAC A;  4EV5 A;  1NJI 4;  1QAL A;  1NB3 I;  1A2P A;  1OGZ A;  1V74 A;  3F7X A;  4R9K A;  5M1A A;  3K9M C;  3CMA 3;  1FA3 A;  1IV7 A;  5RNT A;  1STD A;  3UL6 A;  1PFP A;  4JRF A;  2CKF B;  1O7N B;  1IU7 A;  3AGN A;  1VQ4 3;  1E3V A;  1TJD A;  2H0H A;  2RBI A;  3CME 3;  2GSP A;  3M8C A;  1BSD A;  4N6N B;  2BNG A;  1LXE A;  2GEY A;  1V57 A;  1CH0 A;  1Q81 4;  1K73 4;  1HKX A;  4OK0 A;  3DMC A;  4IPB A;  1B2U A;  5AIH A;  1BRG A;  1Q40 A;  4FCM A;  2O3O A;  3DGO A;  3MG1 A;  2IMJ A;  1R4C A;  1Q86 4;  2W56 A;  3EB8 A;  1AVK A;  3OWY A;  3ER7 A;  1GMR A;  3F7S A;  4ORL A;  4HM8 B;  3H3H A;  3JUN A;  3D4A A;  2XF3 A;  4I5Q A;  1D6U A;  4GB5 A;  4HM7 B;  4XM4 A;  4EW5 A;  1QVG 2;  2R4I A;  3BND A;  1I0X A;  1JN5 B;  1JBS A;  3LTC A;  2JDI H;  4XBT A;  4AKY A;  3WOF B;  3CCV 3;  1A90 A;  1T2I A;  3FKA A;  4KFE A;  2W9Q A;  3LTD A;  2INX A;  3MWZ A;  1NDO B;  2HMJ B;  3ALA A;  1AR0 A;  1A2V A;  2Z6B A;  5FGO A;  1KWI A;  3URP A;  3BB9 A;  1OCV A;  5AIG A;  4BTW A;  3L0R A;  1VZZ A;  1AVL A;  2F99 A;  1BRK A;  1TUH A;  2B24 B;  1BAN A;  4BL3 A;  1VQO 3;  1B2M A;  1BRN L;  2PZV A;  1RGL A;  5IW9 A;  3GZY B;  1JNQ A;  3AGO A;  5AEU B;  5AYS C;  3KSE D;  2UGI A;  3SVA A;  3FG3 A;  3EN8 A;  1JKG B;  3N54 B;  3HII A;  4J9A A;  4QWT A;  1VQM 3;  1N8Q A;  4J5G A;  5EQL A;  1BNI A;  3PCS A;  4EC6 A;  1ROV A;  4H3U A;  3OXA A;  4IIA A;  3MKI A;  3ZG0 A;  1HYF A;  1I0V A;  2RCD A;  1IV9 A;  2WGQ A;  1WMN A;  3WOE B;  2STD A;  5IER A;  3LML A;  3MG3 A;  3SOA A;  1OGX A;  3PXM A;  1FUT A;  1QJG A;  2QA4 3;  1FUW A;  1YGW A;  1JBR A;  1N9J A;  1JJ2 2;  3V92 A;  2W2C A;  4WP5 A;  1RRH A;  2MC8 A;  1GMP A;  2QIY A;  4HAA A;  4GSP A;  5CF2 A;  1DYU A;  1W4N A;  2D1W A;  2CIU A;  4L8P A;  1GOV A;  1MWR A;  1OHP A;  2AAE A;  4HM2 B;  4NHF A;  5ELJ A;  2W04 A;  2CFG A;  1W2Z A;  1RSN A;  3HX8 A;  4N6V 0;  1WMP A;  3RGR A;  2R41 A;  1WMO A;  1BRS A;  3KCH A;  1JZD A;  3NBJ A;  1VQN 3;  1UUG B;  3T0U A;  2W9P A;  4KVH A;  4FCZ A;  2KF5 A;  3FF0 A;  4I4K A;  3ZFZ A;  3OWU A;  3NBR A;  4N6M A;  3CXC 2;  4HOH A;  3KII A;  3JUM A;  1Y4K A;  3CCR 3;  2FGT A;  1B2S A;  1FGR A;  1EQK A;  1JRQ A;  8CHO A;  1Q7H A;  4MEI A;  3BLZ A;  3KFQ C;  5FW5 A;  3U1W A;  5JPU A;  4RZM A;  1T5Y A;  3DH2 A;  3CC4 3;  3U97 A;  2IYJ A;  1CEW I;  1LQG C;  2Q07 A;  2Z77 A;  3WDG B;  5KP4 A;  1JKG A;  3JVC A;  3KE7 A;  4BIR A;  4BTX A;  2KF3 A;  4FMA A;  1RTU A;  3DZL A;  3SYU A;  2ZHX B;  4HM5 B;  4XB5 A;  4CJN A;  2AAD A;  4WYK B;  4EV2 A;  1WNH A;  3WMD A;  2CX1 A;  3NM2 A;  4O02 B;  1IVX A;  2I9W A;  3CPO A;  4RBN A;  5AII A;  5DRV A;  2OTJ 3;  3PYJ A;  3TDG A;  1BNR A;  1SPU A;  4KFD A;  1W00 A;  4ZM8 A;  2QGU A;  4JF8 A;  4K90 B;  4WHA A;  4FR9 A;  1ZGX A;  5KP3 A;  2XFS A;  2H0I A;  3VSY A;  3JUP A;  2CC3 A;  1RGH A;  3NXJ A;  1RDS A;  1O7P B;  2BHM A;  2K0M A;  3V98 A;  2RNT A;  1BVI A;  1D6Z A;  3KZT A;  1GD3 A;  2GEX A;  1PU4 A;  1VQ6 3;  2XR8 B;  3DGN A;  5BU4 A;  4LGQ A;  5GSP A;  1KQS 2;  4KT3 B;  1SAR A;  2OQE A;  3T8U A;  1BIR A;  1N9E A;  2HMN B;  3JUO A;  3EC9 A;  1RGC A;  2P38 A;  3B8L A;  4WYK A;  4GL6 A;  3CC7 3;  3PZW A;  4HM6 B;  3NBB A;  3EHC A;  1UDI I;  2F98 A;  4R1K A;  3CC2 3;  3MG2 A;  4L8O A;  1GMQ A;  2O9U X;  4U13 A;  3CCU 3;  1YIJ 3;  1FZU A;  1VQQ A;  2QEX 3;  3SXX A;  3NHX A;  3GRD A;  1BNF A;  3RDE A; 
#chains in the Genus database with same CATH homology
 2C10 A;  1NO3 A;  1W6G A;  4HZ9 B;  2HML B;  4RNZ A;  3ECF A;  1QAK A;  3DGL A;  3GZX B;  3CCM 3;  3G16 A;  7STD A;  3G0K A;  2OOV A;  2C11 A;  5D83 A;  2FNQ A;  4AEQ A;  1A67 A;  3G4S 3;  1TIJ A;  3S5C A;  2KCD A;  3FGY A;  1YJ9 3;  1NB5 I;  2Z76 A;  2W0Q A;  1HU9 A;  2Z7A A;  5IG3 A;  2W03 A;  4R4K A;  4R80 A;  3F14 A;  4KFF A;  4XBY A;  4CDL A;  2XFT A;  4LEH A;  1RKY A;  1ULI B;  3D9R A;  4K61 A;  3K7C A;  2D42 A;  3AMO A;  2GBX B;  3MYT A;  1US1 A;  1JB2 A;  4MMX B;  1CYV A;  1EA2 A;  4FMC A;  3OWS A;  2BMQ B;  3SX1 A;  1IQ8 A;  3EQQ B;  3LT8 A;  3X3Y A;  1BUQ A;  1IT7 A;  1GY5 A;  2CFK A;  2XRX B;  4K1U A;  3FH1 A;  1IVW A;  2YFJ B;  2P0M A;  2YFL B;  2OQE C;  3DM8 A;  3KSP A;  2P05 A;  2A15 A;  1OF5 B;  1GD4 A;  3IJE B;  5TGN A;  1ISK A;  1UUV B;  2WGO A;  1WQL B;  3CU3 A;  5IF6 A;  1O7M B;  1Q7Y 4;  2IUJ A;  5AI1 A;  2F86 B;  2OOV C;  5KP1 A;  2XSH B;  3FLJ A;  4N6O B;  5IG5 A;  2OTL 3;  1MOL A;  3STD A;  1SIH A;  1K41 A;  2CW9 A;  5G2G A;  3PCR A;  5CXO A;  1VQK 3;  3F8H A;  3MPH A;  4EXR A;  3DGM A;  2XSO B;  3X40 A;  4O8S A;  2CG1 A;  2CG0 A;  2OCT A;  3FG4 A;  4J8T A;  3CCE 3;  1VQP 3;  5EVH A;  1E97 A;  1O7W B;  3EN1 B;  5IG0 A;  2WOH A;  5ELU A;  1QAF A;  3N9H A;  1JB5 A;  3I55 3;  1JB4 A;  2CFW A;  1IVU A;  2HMM B;  4XBX A;  1ULJ B;  2BO9 B;  3F9S A;  1TU5 A;  3Q90 A;  1DMQ A;  1SJW A;  2K54 A;  1YJN 3;  3FSD A;  1ZO2 A;  3PS8 A;  1FGM A;  2BMO B;  4OUQ A;  4MJD A;  5JPP A;  2CH9 A;  4O2H A;  3B7C A;  3FG1 A;  5CLK A;  1UI7 A;  1N8R 4;  2KRT A;  1Q82 4;  1UW1 A;  3NQY A;  3OW2 2;  3X3Z A;  3FZW A;  5DRE A;  1FGT A;  1VQ7 3;  3GZB A;  4MMZ B;  5LC7 A;  3G6E 3;  2GXF A;  2FXT A;  3EF8 A;  1ASK A;  4HM0 B;  1AV4 A;  3ROB A;  4HKV B;  3LZA A;  2GBW B;  3JUQ A;  4HVN A;  3UL5 A;  1L5G B;  3NM7 A;  4Q53 A;  1W7C A;  3Q2P A;  1YGE A;  4O3V A;  4LZI A;  1KSI A;  5IEN A;  3HIG A;  1N5H A;  1ZX2 A;  2Y74 A;  5CK6 A;  3J7Y d;  3GZR A;  2W56 B;  3EJV A;  4LMI A;  1JV2 B;  2ML5 A;  2PNC A;  3MSO A;  2BT3 A;  1QVF 2;  1M1X B;  1UI8 A;  5EEO A;  5CF1 A;  4BTY A;  2XGN A;  3T8N A;  1IVV A;  2Y73 A;  1KC8 4;  3HI7 A;  2W6J H;  2CWU A;  1RN7 A;  4HJL B;  2RFR A;  4WWU C;  3I56 3;  3IPT A;  2CWV A;  2ZDJ A;  3B4O A;  4G1M B;  5BXQ A;  1M90 4;  1TP6 A;  1O7H B;  2RSX A;  2XH9 A;  1GY6 A;  1O7G B;  5IEO A;  4FMB A;  2HMK B;  1IT8 A;  4N3V A;  1EG9 B;  1STF I;  1UUW B;  2E2V A;  4X2H A;  5HGR A;  3CCL 3;  3CCS 3;  2CWT A;  3CPW 2;  4WFO A;  4HM1 B;  3D3L A;  4KZ1 A;  2XEP A;  1YIT 3;  1GYB A;  5BVB A;  3NQZ A;  1SQW A;  2LQV A;  2V1L A;  1TFK A;  4XDW A;  5D81 A;  1TFO A;  2B1X B;  4N6T A;  2IA7 A;  3E99 A;  1OHS A;  3SOY A;  3WA2 X;  3NV0 A;  3PGB A;  1MNL A;  4NRE A;  3UB1 A;  1W2B 2;  1DMN A;  2WO0 A;  1K28 A;  2P0X A;  3LYG A;  1VQ5 3;  1E3R A;  1Q42 A;  2OWP A;  1S72 3;  2SBL A;  3UJM A;  3K0Z A;  4HM4 B;  3X41 A;  1A2K A;  5D82 A;  4HM3 B;  2HMO B;  1JN5 A;  5AYR B;  5JBS A;  1OPY A;  1U8C B;  2IUK A;  4HBR A;  1YI2 3;  4RNY A;  2ML6 A;  1QMA A;  3A76 A;  1VQ9 3;  1WTH A;  3BNB A;  3K63 A;  3BNE A;  2RGQ A;  3K5T A;  3FF2 A;  3LH4 A;  1W6Y A;  4AKZ A;  3X3X A;  1M9G A;  6STD A;  3CNX A;  1U5O A;  1W02 A;  2WOF A;  3F40 A;  4K1V A;  3DY5 A;  3DUK A;  4XDV A;  3SLU A;  1DMM A;  5A0O B;  3HZP A;  1K8A 4;  4LSO A;  1OHO A;  3LXU X;  4X2O A;  3HK4 A;  1LNH A;  3NUV A;  2GU1 A;  3X42 A;  4FCJ A;  1RRL A;  3NV0 B;  3S67 A;  5IG4 A;  2CFD A;  3RGA A;  3V99 A;  4EBG A;  1VQL 3;  1G96 A;  3BNC A;  1IDP A;  1FGQ A;  4MMY B;  1J2B A;  4TX4 A;  3VGN A;  1FGO A;  1IK3 A;  1Z1S A;  2E2T A;  1SII A;  3GWR A;  4IT7 A;  1OH0 A;  3OV4 A;  4HZB B;  1DVC A;  1GS3 A;  1ROA A;  1GY7 A;  3OX9 A;  2P09 A;  4R9L A;  1Q40 B;  1W01 A;  4L7K A;  4N6U A;  3KKG A;  3MHE A;  1LVN A;  2ZL8 A;  3QK9 A;  3SED A;  4PEJ A;  2JQ5 A;  3UNL A;  2KXG A;  1OUN A;  3H51 A;  4N6L A;  1NWW A;  3G71 3;  5IEP A;  2CHC A;  1YVB I;  3IMA B;  4OVM A;  3CNM A;  3LTA A;  1RJO A;  2E2U A;  4STD A;  4H61 A;  3CD6 3;  1CYU A;  3FCS B;  3I0Y A;  3KN4 A;  2M7O A;  2L4V A;  1W6C A;  3Q1C A;  2YFI B;  3AMO B;  1M1K 4;  3WA3 A;  3EBT A;  3N8B A;  1KD1 4;  4FMD A;  2LYX A;  1YHQ 3;  3GAX A;  3VF1 A;  3DXO A;  5AIF A;  1W5Z A;  3G8Z A;  3EX9 A;  1N5P A;  1CQS A;  1VQ8 3;  2UX0 A;  3S28 A;  3LTB A;  3WOD G;  1EKM A;  5I97 A;  2YX9 A;  3B4P A;  1DVD A;  1YJW 3;  2CFL A;  1S5A A;  4HYZ A;  3CCJ 3;  2GU3 A;  3F8X A;  3LOY A;  2XGL A;  5STD A;  3LT9 A;  2BMR B;  3EE1 A;  1F8N A;  3S27 A;  1IQY A;  4EYC A;  1D6Y A;  1K9M 4;  1IQX A;  2MF7 A;  1LOX A;  1NU3 A;  3EBY A;  5AEW B;  3S29 A;  3CCQ 3;  3QRD A;  2CK3 H;  5LC6 A;  3NX0 A;  4CCV A;  3O8Y A;  1OF5 A;  1C7H A;  1OAC A;  4EV5 A;  1NJI 4;  1QAL A;  1NB3 I;  1OGZ A;  1V74 A;  3F7X A;  4R9K A;  3K9M C;  3CMA 3;  1FA3 A;  1IV7 A;  1STD A;  3UL6 A;  1PFP A;  4JRF A;  2CKF B;  1O7N B;  1IU7 A;  1VQ4 3;  1E3V A;  3CME 3;  3M8C A;  4N6N B;  2BNG A;  1LXE A;  2GEY A;  1Q81 4;  1K73 4;  1HKX A;  4OK0 A;  3DMC A;  4IPB A;  5AIH A;  1Q40 A;  4FCM A;  2O3O A;  3DGO A;  3MG1 A;  2IMJ A;  1R4C A;  1Q86 4;  2W56 A;  3EB8 A;  1AVK A;  3OWY A;  3ER7 A;  4ORL A;  3F7S A;  4HM8 B;  3H3H A;  3JUN A;  4XM4 A;  2XF3 A;  1D6U A;  4GB5 A;  4HM7 B;  1QVG 2;  2R4I A;  3BND A;  1JN5 B;  3LTC A;  2JDI H;  4XBT A;  4AKY A;  3WOF B;  3CCV 3;  1A90 A;  3FKA A;  4KFE A;  2W9Q A;  3LTD A;  2INX A;  3MWZ A;  1NDO B;  2HMJ B;  3ALA A;  1AR0 A;  1A2V A;  2Z6B A;  5FGO A;  1KWI A;  3BB9 A;  1OCV A;  5AIG A;  4BTW A;  3L0R A;  1VZZ A;  1AVL A;  2F99 A;  1TUH A;  2B24 B;  1VQO 3;  2PZV A;  5IW9 A;  3GZY B;  1JNQ A;  5AEU B;  5AYS C;  3KSE D;  3SVA A;  3FG3 A;  3EN8 A;  1JKG B;  3N54 B;  3HII A;  4J9A A;  4QWT A;  1VQM 3;  1N8Q A;  5EQL A;  4EC6 A;  3PCS A;  1ROV A;  4H3U A;  3OXA A;  4IIA A;  3MKI A;  2RCD A;  1IV9 A;  2WGQ A;  1WMN A;  3WOE B;  2STD A;  5IER A;  3LML A;  3MG3 A;  3SOA A;  1OGX A;  3PXM A;  2QA4 3;  1QJG A;  1FUW A;  1N9J A;  1JJ2 2;  3V92 A;  2W2C A;  4WP5 A;  1RRH A;  2MC8 A;  2QIY A;  5CF2 A;  1DYU A;  1W4N A;  2D1W A;  2CIU A;  4L8P A;  1OHP A;  4HM2 B;  4NHF A;  5ELJ A;  2W04 A;  2CFG A;  1W2Z A;  3HX8 A;  4N6V 0;  1WMP A;  3RGR A;  1VQN 3;  1WMO A;  3NBJ A;  3T0U A;  2W9P A;  4KVH A;  4FCZ A;  3FF0 A;  4I4K A;  3OWU A;  3NBR A;  4N6M A;  3CXC 2;  3KII A;  3JUM A;  1Y4K A;  3CCR 3;  2FGT A;  1FGR A;  1EQK A;  1JRQ A;  8CHO A;  4MEI A;  3BLZ A;  3KFQ C;  5FW5 A;  3U1W A;  5JPU A;  4RZM A;  1T5Y A;  3CC4 3;  3U97 A;  3WDG B;  1CEW I;  2Q07 A;  5KP4 A;  2Z77 A;  1JKG A;  3JVC A;  3KE7 A;  4BTX A;  4FMA A;  3DZL A;  4HM5 B;  4XB5 A;  4WYK B;  4EV2 A;  1WNH A;  3WMD A;  3NM2 A;  4O02 B;  1IVX A;  2I9W A;  3CPO A;  4RBN A;  5AII A;  5DRV A;  2OTJ 3;  3PYJ A;  3TDG A;  1SPU A;  4KFD A;  1W00 A;  4ZM8 A;  2QGU A;  4JF8 A;  4K90 B;  4WHA A;  4FR9 A;  5KP3 A;  2XFS A;  3VSY A;  3JUP A;  2CC3 A;  3NXJ A;  1O7P B;  2BHM A;  2K0M A;  3V98 A;  3KZT A;  1D6Z A;  1GD3 A;  2GEX A;  1PU4 A;  1VQ6 3;  2XR8 B;  3DGN A;  4LGQ A;  1KQS 2;  2OQE A;  3T8U A;  1N9E A;  2HMN B;  3JUO A;  3EC9 A;  3B8L A;  2P38 A;  4WYK A;  4GL6 A;  3CC7 3;  3PZW A;  4HM6 B;  3NBB A;  3EHC A;  4R1K A;  2F98 A;  3CC2 3;  3MG2 A;  4L8O A;  3CCU 3;  2O9U X;  4U13 A;  1YIJ 3;  2QEX 3;  3SXX A;  3NHX A;  3GRD A;  3RDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...