3CCU3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccu300
3I553 1VQL3 1KD14 1Q864 3CCQ3 3CCV3 1YHQ3 1VQ53 1VQN3 3OW22 3CCR3 1VQ83 1VQ63 3CCJ3 1QVG2 1Q824 3G713 2OTJ3 1YI23 2QEX3 3I563 1S723 1KQS2 3CC23 1VQ73 1YJ93 3G4S3 1Q814 3CPW2 1K9M4 2QA43 3CCM3 1K734 1N8R4 1VQ93 1JJ22 3CMA3 1QVF2 1YJW3 2OTL3 3CC43 1YIJ3 1VQM3 1YIT3 1VQK3 1VQP3 1M904 1M1K4 1Q7Y4 1YJN3 1W2B2 3CD63 3CCL3 1KC84 1NJI4 1VQ43 3CCE3 3CME3 1K8A4 3CC73 1VQO3 3CCS3 3CXC2 3CCU3 3G6E3
chains in the Genus database with same CATH superfamily
3K63A 5AIFA 4I4KA 1D6ZA 4LEHA 4KFEA 2CFKA 4N3VA 1FGRA 3CCR3 3LH4A 1N5PA 3MG2A 4EW5A 4HM0B 1QAFA 2B1XB 1OF5B 1BSDA 3LTAA 1ULIB 1LNIA 3BU4A 2STDA 4IT7A 4O8SA 3D5IA 3OWSA 4EV5A 3DMCA 3QK9A 2PNCA 3MG1A 2XH9A 1I8VA 1Q7Y4 3PS8A 3UJMA 4AEQA 2W0QA 1IQYA 4ORLA 2XSOB 1O7PB 3FG3A 3ZFZA 1VQ43 3IJEB 3N9HA 1CYVA 3F40A 3JUPA 1EKMA 1QMAA 3KE7A 3Q90A 3GZYB 1UGHI 2W9QA 3ECFA 3HI7A 1WMNA 3PCRA 4AKZA 4STDA 4O02B 1TP6A 5D81A 5D82A 3SOYA 1O7MB 4J9AA 1EQKA 1UCKA 3VSYA 1HU9A 1RRLA 3T0UA 1RMSA 3I563 4RBNA 3MG3A 1Q40B 1Q42A 3F7XA 1F8NA 1MWUA 4CCVA 3HZPA 4L8PA 1RCLA 4EYCA 5EEOA 4XBTA 1UUVB 3WOEB 1B2UA 1OHPA 3LYGA 3NHXA 1BNGA 1VQL3 3CC43 5BU4A 3FF0A 3FH1A 1AR0A 3B8LA 3NBJA 3PZWA 1HYFA 7STDA 3DGNA 3GRDA 1GY5A 2K0MA 4KFFA 5D83A 5BVBA 3UNLA 3EE1A 3SYUA 2RCDA 3X41A 4O2HA 1X1XA 1Z1SA 2CG0A 2D42A 4R9KA 4WP5A 4X2OA 3U97A 3MPHA 5CF1A 1VQO3 4GSPA 5G1LA 2O3OA 3DUKA 3D4AA 1UCIA 1M1XB 1IK3A 1AVKA 2WGOA 1KQS2 1GS3A 2RSXA 4HZ9B 3HIGA 2GXFA 2QGUA 1I3IA 4GL6A 4L7KA 5IEOA 1K9M4 1T2HA 2HMNB 1NU3A 4BL2A 1IVUA 3ER7A 1OGXA 2W2CA 1OUNA 2SBLA 3OWYA 3SX1A 1GD4A 2UUGC 4RNTA 1UI8A 3SVAA 1HZ1A 6STDA 3BLZA 3WDGB 3Q2PA 4RNZA 4NPBA 1BRKA 4CJNA 1SARA 1BRJA 1RKYA 1WMOA 1ASKA 3CXC2 3VGNA 1IU7A 3BNEA 1W7CA 1LQGC 3Q1CA 3G713 4K61A 3CC23 2E2TA 2KF4A 1VQ73 5AIHA 3RGAA 4IPBA 1BIRA 2UGIA 1LRAA 2L4VA 4OUQA 1STDA 2P0XA 3F7SA 3LTBA 1BVIA 2CWTA 4WHAA 1ROAA 3S27A 3DGYA 1GD3A 1YIJ3 1M9GA 3DXOA 4HM1B 1BSAA 2ML5A 1M904 3G0KA 4FR9A 1GOUA 4XM4A 1TU5A 4H3UA 1RHLA 3X40A 4MEIA 4MMYB 2P0MA 1RDSA 3RGRA 1JB4A 1GSPA 5BXQA 1C54A 3FG4A 2R41A 1FYSA 3OV4A 4KZ1A 4BTXA 1KD14 2XSHB 1Q40A 3KKGA 4I5QA 1BRNL 2GU1A 1BOXA 1MWTA 1PFPA 4DKIA 3F8XA 1TRPA 1LOYA 1WNHA 3H3HA 2RGQA 4N6V0 1ZS7A 1IDPA 3WMDA 1BNFA 2K3DA 2XFTA 1BNSA 3CMA3 2F4YA 3D79A 2P09A 3HIIA 2M7OA 3WOFB 4HOHA 1M1K4 1E3RA 3CD63 1LNHA 1BNIA 1PYLA 3DH2A 2GBXB 3NQZA 3CCE3 1E3VA 7RNTA 4MJDA 2XR8B 5AEUB 5IF6A 1Q814 5IG3A 3I553 1D6YA 5HOHA 2F86B 3CCQ3 1W2ZA 4FMCA 1U5OA 2CFLA 1HKXA 1LOXA 1OCVA 2KAAA 3DGMA 3G16A 3MSOA 4QWTA 1DETA 3D5GA 1ZX2A 4JRFA 2RNTA 1IV7A 2YFIB 2HMJB 2CK3H 4LYLB 2CHCA 5BIRA 2BMRB 2B24B 4RZMA 1A2VA 1ROVA 1TRQA 2FXTA 1MWSA 4WWUC 4XB5A 3T8UA 2GSPA 3WA3A 1V58A 1DMNA 3EB8A 1AV4A 5IEPA 1BRSA 1TUHA 1W2B2 1JN5B 3NBRA 1PY3A 3RNTA 3AHSA 1YVBI 3LT9A 1UDII 3ZG0A 4U13A 1FGQA 1K734 3URPA 4HZBB 4OK0A 1UCJA 4R9LA 3K9MC 1G96A 5IENA 1YHQ3 2OOVA 2E2VA 1VQ83 1X1UA 5EQLA 4N6NB 4AKYA 1B2MA 5IG5A 1G02A 4HM2B 1BNJA 3CNXA 3B4OA 3V98A 3PGBA 2BIRA 2JDIH 5JPUA 3FKAA 2ZDJA 3NBBA 1GYBA 2CWUA 3AHWA 1O7HB 1US1A 3A76A 4LSOA 1YJW3 2CC3A 1GMQA 1VQM3 4N6MA 1VQK3 1OPYA 3FCSB 1S5AA 2BMQB 1IV9A 3EN1B 5G2GA 5AIIA 3LTDA 2C11A 4HAAA 1KC84 4IIAA 5AIGA 1NO3A 5FGOA 3WA2X 2QIYA 1CQSA 3O8YA 1I3FA 3EHCA 5AYSC 1TIJA 3U1WA 1VQ53 3OW22 1GOYA 1EG9B 1B21A 8CHOA 8RNTA 5KP1A 2Y73A 1VQ63 2W56B 3SEDA 1A2KA 2UX0A 4HM4B 3V92A 2O9UX 4MMZB 2SARA 7GSPA 1RGCA 1ZGXA 2INXA 1JZDA 3B7CA 1FUWA 2AAEA 2KF5A 3KFQC 4N6LA 2CFDA 4LMIA 1EA2A 3MYTA 1YGWA 3L0RA 3Q3FA 1QAKA 2F5MA 4K1UA 1FW7A 3NV0B 3GWRA 3TDGA 2Z6BA 2JQ5A 2XRXB 2YFLB 4HM3B 4HKVB 2IYJA 2KXGA 4LGQA 3S67A 4J5GA 1I2FA 1SIHA 2MF7A 2XGNA 3CCS3 1V74A 3K0ZA 1TJDA 3KZTA 3CCL3 1A90A 2W03A 1W6GA 1MGWA 3JVCA 1JBRA 1GY7A 1ULJB 2W04A 1TTOA 3GSPA 4H61A 2OQEA 4FCMA 4J8TA 1CYUA 1LXEA 1JBTA 1IT7A 3CCM3 1YNVX 4FMAA 3J7Yd 4KVHA 4BTWA 1QJGA 3EF8A 3X42A 1UGIA 5JPPA 3NX0A 1GOVA 4FMDA 4JF8A 2XFSA 1JN5A 2BHMA 3D3LA 1VQP3 4K90B 1FA3A 2P38A 3M8CA 2W9PA 2H0GA 1YGEA 1IYYA 3KSPA 5CK6A 3G8ZA 4R1KA 2YFJB 3F8HA 2C10A 5LC6A 2E2UA 3KSED 1MWRA 1B3SA 2L1SA 3BB9A 5DRVA 3SLUA 1K41A 1B2ZA 3EX9A 3FGYA 3A5EA 1VQN3 1JKGB 4MMXB 3S28A 3STDA 4EV2A 3WR2A 4PEJA 1RGAA 1O7WB 2YX9A 3QRDA 2F98A 2H0HA 3AGOA 1JZOA 2IUKA 2BT3A 3GZBA 1X1WA 2CWVA 3SOAA 5IG4A 1IVXA 1G0TA 3E99A 4R4KA 4WYKA 2C4BA 1QALA 3LZAA 1DVDA 2HMMB 5AI1A 5FW5A 1RNTA 1I2EA 1STFI 1TFOA 4NHFA 3HK4A 1UCLA 4XDWA 1BUJA 3CME3 2Q07A 4TX4A 4X2HA 1X1YA 3CPOA 5CF2A 3CCU3 1SIIA 2A15A 1RGFA 3DZLA 1Q7HA 3X3YA 1UUWB 1MNLA 1Q9EA 2KF3A 2OCTA 2W56A 3BNBA 3IPTA 3JUNA 3ZG5A 1BRIA 1K28A 1RGGA 3EJVA 5IERA 5M19A 2IY2A 2P05A 1O7GB 3V99A 2QEX3 3FG1A 1S723 1W02A 4R80A 3MHEA 3UB1A 4CPKA 1BRHA 3CPW2 1I70A 1JB2A 1RGHA 1WQLB 2BNGA 3HOHA 2RFRA 3NXJA 1FUSA 1LOVA 1VQ93 3D9RA 1IQ8A 1QVF2 1JB5A 1RCKA 3WODG 3HX8A 3MKIA 3NV0A 3VF1A 3LT8A 1W5ZA 2I9WA 5CXOA 3DGOA 3LOYA 2MC8A 2F56A 5HGRA 1B2SA 3X3ZA 5M1AA 4ZM8A 1O7NB 1VZZA 3LMLA 3KIIA 4HM7B 1Y4KA 1J2BA 1DVCA 4GB5A 1MGRA 3KCHA 2AADA 1R4CA 1BAOA 1IVWA 3WHOA 1FUTA 2WOFA 2IMJA 3KN4A 2KRTA 3NUVA 3CCJ3 1A2PA 3H51A 4XBYA 1RNBA 9RNTA 1YJ93 1RLSA 1N8QA 4HVNA 1JNQA 3N54B 2GBWB 1FGOA 3JUOA 3PCSA 4HYZA 2QA43 2CX0A 1OH0A 3EBYA 2Y74A 3JUMA 2OTL3 1RGLA 1UUGB 1FGTA 3N8BA 1RJOA 1VQQA 4ILFA 4WYKB 2XGLA 1FZUA 2CX1A 3AGNA 1L5GB 3JUQA 3EN8A 1BSEA 2F99A 2HMLB 1SQWA 1OHOA 3S5CA 1JKGA 1WMPA 1LVNA 4HJLB 2ZL8A 4XBXA 1CEWI 2HMKB 2ML6A 4N6UA 5RNTA 2ZHXB 1B2XA 2CW9A 1NDOB 3SXXA 5M18A 3CNMA 1OACA 5CLKA 1C7HA 3MWZA 5ELUA 2HMOB 1LOWA 1B20A 1BU4A 1LQMB 1NWWA 3DGLA 3AMOB 3PXMA 5STDA 1AY7A 1A67A 1ISKA 3EC9A 3RDEA 1MOLA 1NNVA 3NM7A 2GEXA 2XEPA 6GSPA 1N8R4 1RN1A 4K1VA 3OWUA 4EXRA 5IW9A 1AVLA 1DMQA 5DREA 4G1MB 3GZXB 5TGNA 2GU3A 1SPUA 1PU4A 2IUJA 4OVMA 1EEJA 3PYJA 1W01A 1UW1A 2PZVA 1NJI4 1RN4A 2OOVC 2OWPA 2KF6A 4EBGA 4NREA 3CC73 1DYUA 1SJWA 1I0XA 3DM8A 3FF2A 3I0YA 3NQYA 1KWIA 1IT8A 4FCZA 4O3VA 2IA7A 5G1KA 1QVG2 4FCJA 1FGMA 2CKFB 2W6JH 1I0VA 2OTJ3 3DY5A 1GMRA 2CFWA 3G4S3 1W00A 2FGTA 4HM6B 1RGKA 3K7CA 1N5HA 2ZA4A 3FZWA 5AYRB 5I97A 1RSNA 1RTUA 4N6TA 2CH9A 3X3XA 3B4PA 2WOHA 1R4YA 1BSCA 4GHOA 4KT3B 1U8CB 4RNYA 1NB3I 3NM2A 3UL6A 1N9JA 5GSPA 5KP3A 1BUQA 1T5YA 1DMMA 2J8XB 2R4IA 1NB5I 5A0OB 3FLJA 1T3BA 4Q53A 1Q864 3CCV3 3S29A 1OF5A 2XF3A 3CU3A 3F9SA 3OX9A 2V1LA 4L8OA 5IG0A 4KFDA 3BIRA 1BGSA 1BANA 1KSIA 1W6CA 2CFGA 5KP4A 1YI23 1JBSA 1IQXA 1OGZA 4J5KA 3OXAA 3EBTA 1W4NA 1JJ22 2HOHA 3K5TA 4XDVA 2GEYA 3GZRA 5EVHA 4N6OB 3ROBA 2BMOB 1ZO2A 3LXUX 1IVVA 1CH0A 2LYXA 3IMAB 4BL3A 1JV2B 1DE3A 1BRGA 2D1WA 5JBSA 2Z76A 1W6YA 4BTYA 5AEWB 1RN7A 4HM8B 1BSBA 1K8A4 1EUIC 3F14A 2OQEC 2H0IA 3G6E3 6RNTA 1RRHA 1JRQA 3EQQB 1OHSA 1AQZA 1TFKA 3AMOA 3UL5A 1BNRA 1N9EA 1E97A 1GY6A 4LZIA 1B27A 3T8NA 1Q824 2LQVA 1WTHA 3BNDA 2CIUA 4BU4A 1BNEA 2BU4A 2BO9B 1I2GA 3FSDA 2FNQA 2RBIA 4FMBA 5LC7A 2WO0A 3ALAA 2WGQA 1GMPA 1T2IA 1V57A 1YIT3 2F5WA 1YJN3 2Z77A 5ELJA 4HBRA 4BIRA 1D6UA 1YVSA 2KCDA 3BNCA 2K54A 3LTCA 2Z7AA 2CG1A 4WFOA 4HM5B 4CDLA 4EC6A 1UI7A 1RGEA 3GAXA
chains in the Genus database with same CATH topology
3K63A 5AIFA 4I4KA 1D6ZA 4LEHA 4KFEA 2CFKA 4N3VA 1FGRA 3CCR3 3LH4A 1N5PA 3MG2A 4HM0B 1QAFA 2B1XB 1OF5B 3LTAA 1ULIB 4IT7A 2STDA 4O8SA 3OWSA 4EV5A 3DMCA 3QK9A 2PNCA 3MG1A 2XH9A 1Q7Y4 3PS8A 3UJMA 4AEQA 2W0QA 1IQYA 4ORLA 2XSOB 1O7PB 3FG3A 1VQ43 3IJEB 3N9HA 1CYVA 3F40A 3JUPA 1EKMA 1QMAA 3KE7A 3Q90A 3GZYB 2W9QA 3ECFA 3HI7A 1WMNA 3PCRA 4AKZA 4STDA 4O02B 1TP6A 5D81A 5D82A 3SOYA 1O7MB 4J9AA 1EQKA 3VSYA 1HU9A 1RRLA 3T0UA 3I563 4RBNA 3MG3A 1Q40B 1Q42A 3F7XA 1F8NA 4CCVA 3HZPA 4L8PA 4EYCA 5EEOA 4XBTA 1UUVB 3WOEB 3LYGA 1OHPA 3NHXA 3CC43 3FF0A 3FH1A 1AR0A 3B8LA 3NBJA 3PZWA 7STDA 3DGNA 3GRDA 1GY5A 2K0MA 4KFFA 5D83A 5BVBA 3UNLA 3EE1A 3X41A 2RCDA 4O2HA 4X2OA 1Z1SA 2CG0A 2D42A 4R9KA 4WP5A 3U97A 3MPHA 5CF1A 1VQO3 2O3OA 3DUKA 1M1XB 1IK3A 1AVKA 2WGOA 1KQS2 1GS3A 2RSXA 4HZ9B 3HIGA 2GXFA 2QGUA 4GL6A 4L7KA 5IEOA 1K9M4 2HMNB 1NU3A 1IVUA 3ER7A 1OGXA 2W2CA 1OUNA 2SBLA 3OWYA 3SX1A 1GD4A 6STDA 1UI8A 3SVAA 3BLZA 3WDGB 3Q2PA 4RNZA 1RKYA 1WMOA 1ASKA 3CXC2 3VGNA 1IU7A 3BNEA 1W7CA 3Q1CA 3G713 4K61A 3CC23 2E2TA 1VQ73 5AIHA 3RGAA 4IPBA 2L4VA 4OUQA 1STDA 2P0XA 3F7SA 3LTBA 4WHAA 2CWTA 3S27A 1ROAA 3X3XA 5BXQA 1GD3A 1YIJ3 1M9GA 3DXOA 4HM1B 2ML5A 1M904 3G0KA 4FR9A 4XM4A 1TU5A 4H3UA 3X40A 4MMYB 2P0MA 3RGRA 1JB4A 3FG4A 3OV4A 4KZ1A 4BTXA 1KD14 2XSHB 1Q40A 3KKGA 2GU1A 1PFPA 3F8XA 1WNHA 3H3HA 2RGQA 4N6V0 1IDPA 3WMDA 2XFTA 3CMA3 2P09A 3HIIA 2M7OA 3WOFB 1M1K4 1E3RA 3CD63 1LNHA 2GBXB 3NQZA 3CCE3 1E3VA 4MJDA 2XR8B 5AEUB 5IF6A 1Q814 5IG3A 3I553 1D6YA 2F86B 3CCQ3 1W2ZA 4FMCA 1U5OA 2CFLA 1HKXA 1LOXA 1OCVA 3DGMA 3MSOA 3G16A 4QWTA 4JRFA 1ZX2A 1IV7A 2YFIB 2HMJB 2CK3H 2CHCA 2BMRB 2B24B 4RZMA 1A2VA 1ROVA 2FXTA 4WWUC 4XB5A 3T8UA 3WA3A 1DMNA 3EB8A 1AV4A 5IEPA 1TUHA 1W2B2 1JN5B 3NBRA 3LT9A 1YVBI 4U13A 1FGQA 1K734 4HZBB 4OK0A 4R9LA 3K9MC 1G96A 5IENA 1YHQ3 2OOVA 2E2VA 1VQ83 5EQLA 4N6NB 4AKYA 5IG5A 4HM2B 3CNXA 3B4OA 3V98A 3PGBA 2JDIH 5JPUA 3FKAA 2ZDJA 3NBBA 1GYBA 2CWUA 1O7HB 1US1A 3A76A 4LSOA 1YJW3 2CC3A 1VQM3 4N6MA 1VQK3 1OPYA 3FCSB 1S5AA 2BMQB 1IV9A 3EN1B 5G2GA 5AIIA 3LTDA 2C11A 1KC84 4IIAA 5AIGA 1NO3A 5FGOA 3WA2X 2QIYA 1CQSA 3O8YA 3EHCA 5AYSC 1TIJA 3U1WA 1VQ53 3OW22 5KP1A 1EG9B 8CHOA 2Y73A 1VQ63 2W56B 3SEDA 1A2KA 2UX0A 4HM4B 3V92A 2O9UX 4MMZB 2INXA 3B7CA 1FUWA 4N6LA 3KFQC 2CFDA 4LMIA 1EA2A 3MYTA 3L0RA 4K1UA 1QAKA 3NV0B 3GWRA 3TDGA 2Z6BA 2JQ5A 2XRXB 2YFLB 4HM3B 4HKVB 2KXGA 4LGQA 3S67A 2MF7A 2XGNA 1SIHA 3CCS3 1V74A 3K0ZA 3CCL3 3KZTA 1A90A 2W03A 1W6GA 3JVCA 1GY7A 1ULJB 2W04A 4H61A 2OQEA 4FCMA 4J8TA 1CYUA 1LXEA 1IT7A 3CCM3 4FMAA 3J7Yd 4KVHA 4BTWA 1QJGA 3EF8A 3X42A 5JPPA 3NX0A 4FMDA 4JF8A 2XFSA 1JN5A 2BHMA 3D3LA 1VQP3 4K90B 1FA3A 2P38A 3M8CA 2W9PA 1YGEA 3KSPA 5CK6A 3G8ZA 4R1KA 2YFJB 3F8HA 2C10A 5LC6A 2E2UA 3KSED 3BB9A 3SLUA 5DRVA 1K41A 3EX9A 3FGYA 1VQN3 1JKGB 4MMXB 3S28A 3STDA 4EV2A 4PEJA 1O7WB 2YX9A 3QRDA 2F98A 2IUKA 2BT3A 3GZBA 2CWVA 3SOAA 5IG4A 1IVXA 3E99A 4R4KA 4WYKA 1DVDA 1QALA 3LZAA 2HMMB 5AI1A 5FW5A 1STFI 1TFOA 4NHFA 3HK4A 4XDWA 3CME3 2Q07A 4TX4A 4X2HA 3CPOA 5CF2A 3CCU3 1SIIA 2A15A 3DZLA 3X3YA 1UUWB 1MNLA 2OCTA 2W56A 3IPTA 3BNBA 3JUNA 1VQL3 1K28A 3EJVA 5IERA 2P05A 1O7GB 3V99A 2QEX3 3FG1A 1S723 1W02A 4R80A 3MHEA 3UB1A 3CPW2 1JB2A 2BNGA 1WQLB 1VQ93 2RFRA 3NXJA 3D9RA 1IQ8A 1QVF2 1JB5A 3WODG 3HX8A 3MKIA 3NV0A 3VF1A 3LT8A 1W5ZA 2I9WA 5CXOA 3DGOA 3LOYA 2MC8A 5HGRA 3X3ZA 4ZM8A 1O7NB 1VZZA 3LMLA 3KIIA 4HM7B 1Y4KA 1J2BA 1DVCA 4GB5A 1R4CA 1IVWA 2WOFA 2IMJA 3KN4A 2KRTA 3NUVA 3CCJ3 3H51A 4XBYA 1YJ93 1N8QA 4HVNA 1JNQA 3N54B 2GBWB 1FGOA 3JUOA 3PCSA 4HYZA 2QA43 1OH0A 3EBYA 2Y74A 3JUMA 2OTL3 1FGTA 3N8BA 1RJOA 4WYKB 2XGLA 1L5GB 3JUQA 3EN8A 2F99A 2HMLB 1SQWA 1OHOA 3S5CA 1JKGA 1WMPA 1LVNA 4HJLB 2ZL8A 4XBXA 1CEWI 2HMKB 2ML6A 4N6UA 2CW9A 1NDOB 3SXXA 3CNMA 1OACA 5CLKA 1C7HA 3MWZA 5ELUA 2HMOB 5STDA 1NWWA 3DGLA 3AMOB 3PXMA 1A67A 1ISKA 3EC9A 3RDEA 1MOLA 3NM7A 2GEXA 2XEPA 1N8R4 4K1VA 3OWUA 4EXRA 5IW9A 1AVLA 1DMQA 5DREA 4G1MB 3GZXB 5TGNA 2GU3A 1SPUA 1PU4A 2IUJA 4OVMA 3PYJA 1W01A 1UW1A 2PZVA 1NJI4 2OOVC 2OWPA 4EBGA 4NREA 3CC73 1DYUA 1SJWA 3DM8A 3FF2A 3I0YA 3NQYA 1KWIA 1IT8A 4FCZA 4O3VA 2IA7A 1QVG2 4FCJA 1FGMA 2CKFB 2W6JH 2OTJ3 3DY5A 2CFWA 3G4S3 1W00A 2FGTA 4HM6B 3K7CA 5AYRB 1N5HA 3FZWA 5I97A 4N6TA 2CH9A 3B4PA 2WOHA 1U8CB 4RNYA 1NB3I 3NM2A 3UL6A 1N9JA 5KP3A 1BUQA 1T5YA 1DMMA 2R4IA 1NB5I 5A0OB 3FLJA 4Q53A 1Q864 3CCV3 3S29A 1OF5A 2XF3A 3CU3A 3F9SA 3OX9A 2V1LA 4L8OA 5IG0A 4KFDA 1W6CA 1KSIA 2CFGA 1YI23 5KP4A 1IQXA 1OGZA 3OXAA 3EBTA 1W4NA 1JJ22 3K5TA 4XDVA 2GEYA 3GZRA 5EVHA 4N6OB 3ROBA 2BMOB 1ZO2A 3LXUX 1IVVA 2LYXA 3IMAB 1JV2B 2D1WA 5JBSA 2Z76A 1W6YA 4BTYA 5AEWB 1RN7A 4HM8B 1K8A4 3F14A 2OQEC 3G6E3 1RRHA 1JRQA 3EQQB 1OHSA 1TFKA 3AMOA 3UL5A 1N9EA 1E97A 1GY6A 4LZIA 3T8NA 1Q824 2LQVA 1WTHA 3BNDA 2CIUA 2BO9B 3FSDA 2FNQA 4FMBA 5LC7A 2WO0A 3ALAA 2WGQA 1YIT3 1YJN3 2Z77A 5ELJA 4HBRA 1D6UA 2KCDA 3BNCA 2K54A 3LTCA 2Z7AA 2CG1A 4WFOA 4HM5B 4CDLA 4EC6A 1UI7A 4MEIA 3GAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 3;  1VQL 3;  1KD1 4;  1Q86 4;  3CCQ 3;  3CCV 3;  1YHQ 3;  1VQ5 3;  1VQN 3;  3OW2 2;  3CCR 3;  1VQ8 3;  1VQ6 3;  3CCJ 3;  1QVG 2;  1Q82 4;  3G71 3;  2OTJ 3;  1YI2 3;  2QEX 3;  3I56 3;  1S72 3;  1KQS 2;  3CC2 3;  1VQ7 3;  1YJ9 3;  3G4S 3;  1Q81 4;  3CPW 2;  1K9M 4;  2QA4 3;  3CCM 3;  1K73 4;  1N8R 4;  1VQ9 3;  1JJ2 2;  3CMA 3;  1QVF 2;  1YJW 3;  2OTL 3;  3CC4 3;  1YIJ 3;  1VQM 3;  1YIT 3;  1VQK 3;  1VQP 3;  1M90 4;  1M1K 4;  1Q7Y 4;  1YJN 3;  1W2B 2;  3CD6 3;  3CCL 3;  1KC8 4;  1NJI 4;  1VQ4 3;  3CCE 3;  3CME 3;  1K8A 4;  3CC7 3;  1VQO 3;  3CCS 3;  3CXC 2;  3CCU 3;  3G6E 3; 
#chains in the Genus database with same CATH topology
 3K63 A;  5AIF A;  4I4K A;  1D6Z A;  4LEH A;  4KFE A;  2CFK A;  4N3V A;  1FGR A;  3CCR 3;  3LH4 A;  1N5P A;  3MG2 A;  4EW5 A;  4HM0 B;  1QAF A;  2B1X B;  1OF5 B;  1BSD A;  3LTA A;  1ULI B;  1LNI A;  3BU4 A;  2STD A;  4IT7 A;  4O8S A;  3D5I A;  3OWS A;  4EV5 A;  3DMC A;  3QK9 A;  2PNC A;  3MG1 A;  2XH9 A;  1I8V A;  1Q7Y 4;  3PS8 A;  3UJM A;  4AEQ A;  2W0Q A;  1IQY A;  4ORL A;  2XSO B;  1O7P B;  3FG3 A;  3ZFZ A;  1VQ4 3;  3IJE B;  3N9H A;  1CYV A;  3F40 A;  3JUP A;  1EKM A;  1QMA A;  3KE7 A;  3Q90 A;  3GZY B;  1UGH I;  2W9Q A;  3ECF A;  3HI7 A;  1WMN A;  3PCR A;  4AKZ A;  4STD A;  4O02 B;  1TP6 A;  5D81 A;  5D82 A;  3SOY A;  1O7M B;  4J9A A;  1EQK A;  1UCK A;  3VSY A;  1HU9 A;  1RRL A;  3T0U A;  1RMS A;  3I56 3;  4RBN A;  3MG3 A;  1Q40 B;  1Q42 A;  3F7X A;  1F8N A;  1MWU A;  4CCV A;  3HZP A;  4L8P A;  1RCL A;  4EYC A;  5EEO A;  4XBT A;  1UUV B;  3WOE B;  1B2U A;  1OHP A;  3LYG A;  3NHX A;  1BNG A;  1VQL 3;  3CC4 3;  5BU4 A;  3FF0 A;  3FH1 A;  1AR0 A;  3B8L A;  3NBJ A;  3PZW A;  1HYF A;  7STD A;  3DGN A;  3GRD A;  1GY5 A;  2K0M A;  4KFF A;  5D83 A;  5BVB A;  3UNL A;  3EE1 A;  3SYU A;  2RCD A;  3X41 A;  4O2H A;  1X1X A;  1Z1S A;  2CG0 A;  2D42 A;  4R9K A;  4WP5 A;  4X2O A;  3U97 A;  3MPH A;  5CF1 A;  1VQO 3;  4GSP A;  5G1L A;  2O3O A;  3DUK A;  3D4A A;  1UCI A;  1M1X B;  1IK3 A;  1AVK A;  2WGO A;  1KQS 2;  1GS3 A;  2RSX A;  4HZ9 B;  3HIG A;  2GXF A;  2QGU A;  1I3I A;  4GL6 A;  4L7K A;  5IEO A;  1K9M 4;  1T2H A;  2HMN B;  1NU3 A;  4BL2 A;  1IVU A;  3ER7 A;  1OGX A;  2W2C A;  1OUN A;  2SBL A;  3OWY A;  3SX1 A;  1GD4 A;  2UUG C;  4RNT A;  1UI8 A;  3SVA A;  1HZ1 A;  6STD A;  3BLZ A;  3WDG B;  3Q2P A;  4RNZ A;  4NPB A;  1BRK A;  4CJN A;  1SAR A;  1BRJ A;  1RKY A;  1WMO A;  1ASK A;  3CXC 2;  3VGN A;  1IU7 A;  3BNE A;  1W7C A;  1LQG C;  3Q1C A;  3G71 3;  4K61 A;  3CC2 3;  2E2T A;  2KF4 A;  1VQ7 3;  5AIH A;  3RGA A;  4IPB A;  1BIR A;  2UGI A;  1LRA A;  2L4V A;  4OUQ A;  1STD A;  2P0X A;  3F7S A;  3LTB A;  1BVI A;  2CWT A;  4WHA A;  1ROA A;  3S27 A;  3DGY A;  1GD3 A;  1YIJ 3;  1M9G A;  3DXO A;  4HM1 B;  1BSA A;  2ML5 A;  1M90 4;  3G0K A;  4FR9 A;  1GOU A;  4XM4 A;  1TU5 A;  4H3U A;  1RHL A;  3X40 A;  4MEI A;  4MMY B;  2P0M A;  1RDS A;  3RGR A;  1JB4 A;  1GSP A;  5BXQ A;  1C54 A;  3FG4 A;  2R41 A;  1FYS A;  3OV4 A;  4KZ1 A;  4BTX A;  1KD1 4;  2XSH B;  1Q40 A;  3KKG A;  4I5Q A;  1BRN L;  2GU1 A;  1BOX A;  1MWT A;  1PFP A;  4DKI A;  3F8X A;  1TRP A;  1LOY A;  1WNH A;  3H3H A;  2RGQ A;  4N6V 0;  1ZS7 A;  1IDP A;  3WMD A;  1BNF A;  2K3D A;  2XFT A;  1BNS A;  3CMA 3;  2F4Y A;  3D79 A;  2P09 A;  3HII A;  2M7O A;  3WOF B;  4HOH A;  1M1K 4;  1E3R A;  3CD6 3;  1LNH A;  1BNI A;  1PYL A;  3DH2 A;  2GBX B;  3NQZ A;  3CCE 3;  1E3V A;  7RNT A;  4MJD A;  2XR8 B;  5AEU B;  5IF6 A;  1Q81 4;  5IG3 A;  3I55 3;  1D6Y A;  5HOH A;  2F86 B;  3CCQ 3;  1W2Z A;  4FMC A;  1U5O A;  2CFL A;  1HKX A;  1LOX A;  1OCV A;  2KAA A;  3DGM A;  3G16 A;  3MSO A;  4QWT A;  1DET A;  3D5G A;  1ZX2 A;  4JRF A;  2RNT A;  1IV7 A;  2YFI B;  2HMJ B;  2CK3 H;  4LYL B;  2CHC A;  5BIR A;  2BMR B;  2B24 B;  4RZM A;  1A2V A;  1ROV A;  1TRQ A;  2FXT A;  1MWS A;  4WWU C;  4XB5 A;  3T8U A;  2GSP A;  3WA3 A;  1V58 A;  1DMN A;  3EB8 A;  1AV4 A;  5IEP A;  1BRS A;  1TUH A;  1W2B 2;  1JN5 B;  3NBR A;  1PY3 A;  3RNT A;  3AHS A;  1YVB I;  3LT9 A;  1UDI I;  3ZG0 A;  4U13 A;  1FGQ A;  1K73 4;  3URP A;  4HZB B;  4OK0 A;  1UCJ A;  4R9L A;  3K9M C;  1G96 A;  5IEN A;  1YHQ 3;  2OOV A;  2E2V A;  1VQ8 3;  1X1U A;  5EQL A;  4N6N B;  4AKY A;  1B2M A;  5IG5 A;  1G02 A;  4HM2 B;  1BNJ A;  3CNX A;  3B4O A;  3V98 A;  3PGB A;  2BIR A;  2JDI H;  5JPU A;  3FKA A;  2ZDJ A;  3NBB A;  1GYB A;  2CWU A;  3AHW A;  1O7H B;  1US1 A;  3A76 A;  4LSO A;  1YJW 3;  2CC3 A;  1GMQ A;  1VQM 3;  4N6M A;  1VQK 3;  1OPY A;  3FCS B;  1S5A A;  2BMQ B;  1IV9 A;  3EN1 B;  5G2G A;  5AII A;  3LTD A;  2C11 A;  4HAA A;  1KC8 4;  4IIA A;  5AIG A;  1NO3 A;  5FGO A;  3WA2 X;  2QIY A;  1CQS A;  3O8Y A;  1I3F A;  3EHC A;  5AYS C;  1TIJ A;  3U1W A;  1VQ5 3;  3OW2 2;  1GOY A;  1EG9 B;  1B21 A;  8CHO A;  8RNT A;  5KP1 A;  2Y73 A;  1VQ6 3;  2W56 B;  3SED A;  1A2K A;  2UX0 A;  4HM4 B;  3V92 A;  2O9U X;  4MMZ B;  2SAR A;  7GSP A;  1RGC A;  1ZGX A;  2INX A;  1JZD A;  3B7C A;  1FUW A;  2AAE A;  2KF5 A;  3KFQ C;  4N6L A;  2CFD A;  4LMI A;  1EA2 A;  3MYT A;  1YGW A;  3L0R A;  3Q3F A;  1QAK A;  2F5M A;  4K1U A;  1FW7 A;  3NV0 B;  3GWR A;  3TDG A;  2Z6B A;  2JQ5 A;  2XRX B;  2YFL B;  4HM3 B;  4HKV B;  2IYJ A;  2KXG A;  4LGQ A;  3S67 A;  4J5G A;  1I2F A;  1SIH A;  2MF7 A;  2XGN A;  3CCS 3;  1V74 A;  3K0Z A;  1TJD A;  3KZT A;  3CCL 3;  1A90 A;  2W03 A;  1W6G A;  1MGW A;  3JVC A;  1JBR A;  1GY7 A;  1ULJ B;  2W04 A;  1TTO A;  3GSP A;  4H61 A;  2OQE A;  4FCM A;  4J8T A;  1CYU A;  1LXE A;  1JBT A;  1IT7 A;  3CCM 3;  1YNV X;  4FMA A;  3J7Y d;  4KVH A;  4BTW A;  1QJG A;  3EF8 A;  3X42 A;  1UGI A;  5JPP A;  3NX0 A;  1GOV A;  4FMD A;  4JF8 A;  2XFS A;  1JN5 A;  2BHM A;  3D3L A;  1VQP 3;  4K90 B;  1FA3 A;  2P38 A;  3M8C A;  2W9P A;  2H0G A;  1YGE A;  1IYY A;  3KSP A;  5CK6 A;  3G8Z A;  4R1K A;  2YFJ B;  3F8H A;  2C10 A;  5LC6 A;  2E2U A;  3KSE D;  1MWR A;  1B3S A;  2L1S A;  3BB9 A;  5DRV A;  3SLU A;  1K41 A;  1B2Z A;  3EX9 A;  3FGY A;  3A5E A;  1VQN 3;  1JKG B;  4MMX B;  3S28 A;  3STD A;  4EV2 A;  3WR2 A;  4PEJ A;  1RGA A;  1O7W B;  2YX9 A;  3QRD A;  2F98 A;  2H0H A;  3AGO A;  1JZO A;  2IUK A;  2BT3 A;  3GZB A;  1X1W A;  2CWV A;  3SOA A;  5IG4 A;  1IVX A;  1G0T A;  3E99 A;  4R4K A;  4WYK A;  2C4B A;  1QAL A;  3LZA A;  1DVD A;  2HMM B;  5AI1 A;  5FW5 A;  1RNT A;  1I2E A;  1STF I;  1TFO A;  4NHF A;  3HK4 A;  1UCL A;  4XDW A;  1BUJ A;  3CME 3;  2Q07 A;  4TX4 A;  4X2H A;  1X1Y A;  3CPO A;  5CF2 A;  3CCU 3;  1SII A;  2A15 A;  1RGF A;  3DZL A;  1Q7H A;  3X3Y A;  1UUW B;  1MNL A;  1Q9E A;  2KF3 A;  2OCT A;  2W56 A;  3BNB A;  3IPT A;  3JUN A;  3ZG5 A;  1BRI A;  1K28 A;  1RGG A;  3EJV A;  5IER A;  5M19 A;  2IY2 A;  2P05 A;  1O7G B;  3V99 A;  2QEX 3;  3FG1 A;  1S72 3;  1W02 A;  4R80 A;  3MHE A;  3UB1 A;  4CPK A;  1BRH A;  3CPW 2;  1I70 A;  1JB2 A;  1RGH A;  1WQL B;  2BNG A;  3HOH A;  2RFR A;  3NXJ A;  1FUS A;  1LOV A;  1VQ9 3;  3D9R A;  1IQ8 A;  1QVF 2;  1JB5 A;  1RCK A;  3WOD G;  3HX8 A;  3MKI A;  3NV0 A;  3VF1 A;  3LT8 A;  1W5Z A;  2I9W A;  5CXO A;  3DGO A;  3LOY A;  2MC8 A;  2F56 A;  5HGR A;  1B2S A;  3X3Z A;  5M1A A;  4ZM8 A;  1O7N B;  1VZZ A;  3LML A;  3KII A;  4HM7 B;  1Y4K A;  1J2B A;  1DVC A;  4GB5 A;  1MGR A;  3KCH A;  2AAD A;  1R4C A;  1BAO A;  1IVW A;  3WHO A;  1FUT A;  2WOF A;  2IMJ A;  3KN4 A;  2KRT A;  3NUV A;  3CCJ 3;  1A2P A;  3H51 A;  4XBY A;  1RNB A;  9RNT A;  1YJ9 3;  1RLS A;  1N8Q A;  4HVN A;  1JNQ A;  3N54 B;  2GBW B;  1FGO A;  3JUO A;  3PCS A;  4HYZ A;  2QA4 3;  2CX0 A;  1OH0 A;  3EBY A;  2Y74 A;  3JUM A;  2OTL 3;  1RGL A;  1UUG B;  1FGT A;  3N8B A;  1RJO A;  1VQQ A;  4ILF A;  4WYK B;  2XGL A;  1FZU A;  2CX1 A;  3AGN A;  1L5G B;  3JUQ A;  3EN8 A;  1BSE A;  2F99 A;  2HML B;  1SQW A;  1OHO A;  3S5C A;  1JKG A;  1WMP A;  1LVN A;  4HJL B;  2ZL8 A;  4XBX A;  1CEW I;  2HMK B;  2ML6 A;  4N6U A;  5RNT A;  2ZHX B;  1B2X A;  2CW9 A;  1NDO B;  3SXX A;  5M18 A;  3CNM A;  1OAC A;  5CLK A;  1C7H A;  3MWZ A;  5ELU A;  2HMO B;  1LOW A;  1B20 A;  1BU4 A;  1LQM B;  1NWW A;  3DGL A;  3AMO B;  3PXM A;  5STD A;  1AY7 A;  1A67 A;  1ISK A;  3EC9 A;  3RDE A;  1MOL A;  1NNV A;  3NM7 A;  2GEX A;  2XEP A;  6GSP A;  1N8R 4;  1RN1 A;  4K1V A;  3OWU A;  4EXR A;  5IW9 A;  1AVL A;  1DMQ A;  5DRE A;  4G1M B;  3GZX B;  5TGN A;  2GU3 A;  1SPU A;  1PU4 A;  2IUJ A;  4OVM A;  1EEJ A;  3PYJ A;  1W01 A;  1UW1 A;  2PZV A;  1NJI 4;  1RN4 A;  2OOV C;  2OWP A;  2KF6 A;  4EBG A;  4NRE A;  3CC7 3;  1DYU A;  1SJW A;  1I0X A;  3DM8 A;  3FF2 A;  3I0Y A;  3NQY A;  1KWI A;  1IT8 A;  4FCZ A;  4O3V A;  2IA7 A;  5G1K A;  1QVG 2;  4FCJ A;  1FGM A;  2CKF B;  2W6J H;  1I0V A;  2OTJ 3;  3DY5 A;  1GMR A;  2CFW A;  3G4S 3;  1W00 A;  2FGT A;  4HM6 B;  1RGK A;  3K7C A;  1N5H A;  2ZA4 A;  3FZW A;  5AYR B;  5I97 A;  1RSN A;  1RTU A;  4N6T A;  2CH9 A;  3X3X A;  3B4P A;  2WOH A;  1R4Y A;  1BSC A;  4GHO A;  4KT3 B;  1U8C B;  4RNY A;  1NB3 I;  3NM2 A;  3UL6 A;  1N9J A;  5GSP A;  5KP3 A;  1BUQ A;  1T5Y A;  1DMM A;  2J8X B;  2R4I A;  1NB5 I;  5A0O B;  3FLJ A;  1T3B A;  4Q53 A;  1Q86 4;  3CCV 3;  3S29 A;  1OF5 A;  2XF3 A;  3CU3 A;  3F9S A;  3OX9 A;  2V1L A;  4L8O A;  5IG0 A;  4KFD A;  3BIR A;  1BGS A;  1BAN A;  1KSI A;  1W6C A;  2CFG A;  5KP4 A;  1YI2 3;  1JBS A;  1IQX A;  1OGZ A;  4J5K A;  3OXA A;  3EBT A;  1W4N A;  1JJ2 2;  2HOH A;  3K5T A;  4XDV A;  2GEY A;  3GZR A;  5EVH A;  4N6O B;  3ROB A;  2BMO B;  1ZO2 A;  3LXU X;  1IVV A;  1CH0 A;  2LYX A;  3IMA B;  4BL3 A;  1JV2 B;  1DE3 A;  1BRG A;  2D1W A;  5JBS A;  2Z76 A;  1W6Y A;  4BTY A;  5AEW B;  1RN7 A;  4HM8 B;  1BSB A;  1K8A 4;  1EUI C;  3F14 A;  2OQE C;  2H0I A;  3G6E 3;  6RNT A;  1RRH A;  1JRQ A;  3EQQ B;  1OHS A;  1AQZ A;  1TFK A;  3AMO A;  3UL5 A;  1BNR A;  1N9E A;  1E97 A;  1GY6 A;  4LZI A;  1B27 A;  3T8N A;  1Q82 4;  2LQV A;  1WTH A;  3BND A;  2CIU A;  4BU4 A;  1BNE A;  2BU4 A;  2BO9 B;  1I2G A;  3FSD A;  2FNQ A;  2RBI A;  4FMB A;  5LC7 A;  2WO0 A;  3ALA A;  2WGQ A;  1GMP A;  1T2I A;  1V57 A;  1YIT 3;  2F5W A;  1YJN 3;  2Z77 A;  5ELJ A;  4HBR A;  4BIR A;  1D6U A;  1YVS A;  2KCD A;  3BNC A;  2K54 A;  3LTC A;  2Z7A A;  2CG1 A;  4WFO A;  4HM5 B;  4CDL A;  4EC6 A;  1UI7 A;  1RGE A;  3GAX A; 
#chains in the Genus database with same CATH homology
 3K63 A;  5AIF A;  4I4K A;  1D6Z A;  4LEH A;  4KFE A;  2CFK A;  4N3V A;  1FGR A;  3CCR 3;  3LH4 A;  1N5P A;  3MG2 A;  4HM0 B;  1QAF A;  2B1X B;  1OF5 B;  3LTA A;  1ULI B;  4IT7 A;  2STD A;  4O8S A;  3OWS A;  4EV5 A;  3DMC A;  3QK9 A;  2PNC A;  3MG1 A;  2XH9 A;  1Q7Y 4;  3PS8 A;  3UJM A;  4AEQ A;  2W0Q A;  1IQY A;  4ORL A;  2XSO B;  1O7P B;  3FG3 A;  1VQ4 3;  3IJE B;  3N9H A;  1CYV A;  3F40 A;  3JUP A;  1EKM A;  1QMA A;  3KE7 A;  3Q90 A;  3GZY B;  2W9Q A;  3ECF A;  3HI7 A;  1WMN A;  3PCR A;  4AKZ A;  4STD A;  4O02 B;  1TP6 A;  5D81 A;  5D82 A;  3SOY A;  1O7M B;  4J9A A;  1EQK A;  3VSY A;  1HU9 A;  1RRL A;  3T0U A;  3I56 3;  4RBN A;  3MG3 A;  1Q40 B;  1Q42 A;  3F7X A;  1F8N A;  4CCV A;  3HZP A;  4L8P A;  4EYC A;  5EEO A;  4XBT A;  1UUV B;  3WOE B;  3LYG A;  1OHP A;  3NHX A;  3CC4 3;  3FF0 A;  3FH1 A;  1AR0 A;  3B8L A;  3NBJ A;  3PZW A;  7STD A;  3DGN A;  3GRD A;  1GY5 A;  2K0M A;  4KFF A;  5D83 A;  5BVB A;  3UNL A;  3EE1 A;  3X41 A;  2RCD A;  4O2H A;  4X2O A;  1Z1S A;  2CG0 A;  2D42 A;  4R9K A;  4WP5 A;  3U97 A;  3MPH A;  5CF1 A;  1VQO 3;  2O3O A;  3DUK A;  1M1X B;  1IK3 A;  1AVK A;  2WGO A;  1KQS 2;  1GS3 A;  2RSX A;  4HZ9 B;  3HIG A;  2GXF A;  2QGU A;  4GL6 A;  4L7K A;  5IEO A;  1K9M 4;  2HMN B;  1NU3 A;  1IVU A;  3ER7 A;  1OGX A;  2W2C A;  1OUN A;  2SBL A;  3OWY A;  3SX1 A;  1GD4 A;  6STD A;  1UI8 A;  3SVA A;  3BLZ A;  3WDG B;  3Q2P A;  4RNZ A;  1RKY A;  1WMO A;  1ASK A;  3CXC 2;  3VGN A;  1IU7 A;  3BNE A;  1W7C A;  3Q1C A;  3G71 3;  4K61 A;  3CC2 3;  2E2T A;  1VQ7 3;  5AIH A;  3RGA A;  4IPB A;  2L4V A;  4OUQ A;  1STD A;  2P0X A;  3F7S A;  3LTB A;  4WHA A;  2CWT A;  3S27 A;  1ROA A;  3X3X A;  5BXQ A;  1GD3 A;  1YIJ 3;  1M9G A;  3DXO A;  4HM1 B;  2ML5 A;  1M90 4;  3G0K A;  4FR9 A;  4XM4 A;  1TU5 A;  4H3U A;  3X40 A;  4MMY B;  2P0M A;  3RGR A;  1JB4 A;  3FG4 A;  3OV4 A;  4KZ1 A;  4BTX A;  1KD1 4;  2XSH B;  1Q40 A;  3KKG A;  2GU1 A;  1PFP A;  3F8X A;  1WNH A;  3H3H A;  2RGQ A;  4N6V 0;  1IDP A;  3WMD A;  2XFT A;  3CMA 3;  2P09 A;  3HII A;  2M7O A;  3WOF B;  1M1K 4;  1E3R A;  3CD6 3;  1LNH A;  2GBX B;  3NQZ A;  3CCE 3;  1E3V A;  4MJD A;  2XR8 B;  5AEU B;  5IF6 A;  1Q81 4;  5IG3 A;  3I55 3;  1D6Y A;  2F86 B;  3CCQ 3;  1W2Z A;  4FMC A;  1U5O A;  2CFL A;  1HKX A;  1LOX A;  1OCV A;  3DGM A;  3MSO A;  3G16 A;  4QWT A;  4JRF A;  1ZX2 A;  1IV7 A;  2YFI B;  2HMJ B;  2CK3 H;  2CHC A;  2BMR B;  2B24 B;  4RZM A;  1A2V A;  1ROV A;  2FXT A;  4WWU C;  4XB5 A;  3T8U A;  3WA3 A;  1DMN A;  3EB8 A;  1AV4 A;  5IEP A;  1TUH A;  1W2B 2;  1JN5 B;  3NBR A;  3LT9 A;  1YVB I;  4U13 A;  1FGQ A;  1K73 4;  4HZB B;  4OK0 A;  4R9L A;  3K9M C;  1G96 A;  5IEN A;  1YHQ 3;  2OOV A;  2E2V A;  1VQ8 3;  5EQL A;  4N6N B;  4AKY A;  5IG5 A;  4HM2 B;  3CNX A;  3B4O A;  3V98 A;  3PGB A;  2JDI H;  5JPU A;  3FKA A;  2ZDJ A;  3NBB A;  1GYB A;  2CWU A;  1O7H B;  1US1 A;  3A76 A;  4LSO A;  1YJW 3;  2CC3 A;  1VQM 3;  4N6M A;  1VQK 3;  1OPY A;  3FCS B;  1S5A A;  2BMQ B;  1IV9 A;  3EN1 B;  5G2G A;  5AII A;  3LTD A;  2C11 A;  1KC8 4;  4IIA A;  5AIG A;  1NO3 A;  5FGO A;  3WA2 X;  2QIY A;  1CQS A;  3O8Y A;  3EHC A;  5AYS C;  1TIJ A;  3U1W A;  1VQ5 3;  3OW2 2;  5KP1 A;  1EG9 B;  8CHO A;  2Y73 A;  1VQ6 3;  2W56 B;  3SED A;  1A2K A;  2UX0 A;  4HM4 B;  3V92 A;  2O9U X;  4MMZ B;  2INX A;  3B7C A;  1FUW A;  4N6L A;  3KFQ C;  2CFD A;  4LMI A;  1EA2 A;  3MYT A;  3L0R A;  4K1U A;  1QAK A;  3NV0 B;  3GWR A;  3TDG A;  2Z6B A;  2JQ5 A;  2XRX B;  2YFL B;  4HM3 B;  4HKV B;  2KXG A;  4LGQ A;  3S67 A;  2MF7 A;  2XGN A;  1SIH A;  3CCS 3;  1V74 A;  3K0Z A;  3CCL 3;  3KZT A;  1A90 A;  2W03 A;  1W6G A;  3JVC A;  1GY7 A;  1ULJ B;  2W04 A;  4H61 A;  2OQE A;  4FCM A;  4J8T A;  1CYU A;  1LXE A;  1IT7 A;  3CCM 3;  4FMA A;  3J7Y d;  4KVH A;  4BTW A;  1QJG A;  3EF8 A;  3X42 A;  5JPP A;  3NX0 A;  4FMD A;  4JF8 A;  2XFS A;  1JN5 A;  2BHM A;  3D3L A;  1VQP 3;  4K90 B;  1FA3 A;  2P38 A;  3M8C A;  2W9P A;  1YGE A;  3KSP A;  5CK6 A;  3G8Z A;  4R1K A;  2YFJ B;  3F8H A;  2C10 A;  5LC6 A;  2E2U A;  3KSE D;  3BB9 A;  3SLU A;  5DRV A;  1K41 A;  3EX9 A;  3FGY A;  1VQN 3;  1JKG B;  4MMX B;  3S28 A;  3STD A;  4EV2 A;  4PEJ A;  1O7W B;  2YX9 A;  3QRD A;  2F98 A;  2IUK A;  2BT3 A;  3GZB A;  2CWV A;  3SOA A;  5IG4 A;  1IVX A;  3E99 A;  4R4K A;  4WYK A;  1DVD A;  1QAL A;  3LZA A;  2HMM B;  5AI1 A;  5FW5 A;  1STF I;  1TFO A;  4NHF A;  3HK4 A;  4XDW A;  3CME 3;  2Q07 A;  4TX4 A;  4X2H A;  3CPO A;  5CF2 A;  3CCU 3;  1SII A;  2A15 A;  3DZL A;  3X3Y A;  1UUW B;  1MNL A;  2OCT A;  2W56 A;  3IPT A;  3BNB A;  3JUN A;  1VQL 3;  1K28 A;  3EJV A;  5IER A;  2P05 A;  1O7G B;  3V99 A;  2QEX 3;  3FG1 A;  1S72 3;  1W02 A;  4R80 A;  3MHE A;  3UB1 A;  3CPW 2;  1JB2 A;  2BNG A;  1WQL B;  1VQ9 3;  2RFR A;  3NXJ A;  3D9R A;  1IQ8 A;  1QVF 2;  1JB5 A;  3WOD G;  3HX8 A;  3MKI A;  3NV0 A;  3VF1 A;  3LT8 A;  1W5Z A;  2I9W A;  5CXO A;  3DGO A;  3LOY A;  2MC8 A;  5HGR A;  3X3Z A;  4ZM8 A;  1O7N B;  1VZZ A;  3LML A;  3KII A;  4HM7 B;  1Y4K A;  1J2B A;  1DVC A;  4GB5 A;  1R4C A;  1IVW A;  2WOF A;  2IMJ A;  3KN4 A;  2KRT A;  3NUV A;  3CCJ 3;  3H51 A;  4XBY A;  1YJ9 3;  1N8Q A;  4HVN A;  1JNQ A;  3N54 B;  2GBW B;  1FGO A;  3JUO A;  3PCS A;  4HYZ A;  2QA4 3;  1OH0 A;  3EBY A;  2Y74 A;  3JUM A;  2OTL 3;  1FGT A;  3N8B A;  1RJO A;  4WYK B;  2XGL A;  1L5G B;  3JUQ A;  3EN8 A;  2F99 A;  2HML B;  1SQW A;  1OHO A;  3S5C A;  1JKG A;  1WMP A;  1LVN A;  4HJL B;  2ZL8 A;  4XBX A;  1CEW I;  2HMK B;  2ML6 A;  4N6U A;  2CW9 A;  1NDO B;  3SXX A;  3CNM A;  1OAC A;  5CLK A;  1C7H A;  3MWZ A;  5ELU A;  2HMO B;  5STD A;  1NWW A;  3DGL A;  3AMO B;  3PXM A;  1A67 A;  1ISK A;  3EC9 A;  3RDE A;  1MOL A;  3NM7 A;  2GEX A;  2XEP A;  1N8R 4;  4K1V A;  3OWU A;  4EXR A;  5IW9 A;  1AVL A;  1DMQ A;  5DRE A;  4G1M B;  3GZX B;  5TGN A;  2GU3 A;  1SPU A;  1PU4 A;  2IUJ A;  4OVM A;  3PYJ A;  1W01 A;  1UW1 A;  2PZV A;  1NJI 4;  2OOV C;  2OWP A;  4EBG A;  4NRE A;  3CC7 3;  1DYU A;  1SJW A;  3DM8 A;  3FF2 A;  3I0Y A;  3NQY A;  1KWI A;  1IT8 A;  4FCZ A;  4O3V A;  2IA7 A;  1QVG 2;  4FCJ A;  1FGM A;  2CKF B;  2W6J H;  2OTJ 3;  3DY5 A;  2CFW A;  3G4S 3;  1W00 A;  2FGT A;  4HM6 B;  3K7C A;  5AYR B;  1N5H A;  3FZW A;  5I97 A;  4N6T A;  2CH9 A;  3B4P A;  2WOH A;  1U8C B;  4RNY A;  1NB3 I;  3NM2 A;  3UL6 A;  1N9J A;  5KP3 A;  1BUQ A;  1T5Y A;  1DMM A;  2R4I A;  1NB5 I;  5A0O B;  3FLJ A;  4Q53 A;  1Q86 4;  3CCV 3;  3S29 A;  1OF5 A;  2XF3 A;  3CU3 A;  3F9S A;  3OX9 A;  2V1L A;  4L8O A;  5IG0 A;  4KFD A;  1W6C A;  1KSI A;  2CFG A;  1YI2 3;  5KP4 A;  1IQX A;  1OGZ A;  3OXA A;  3EBT A;  1W4N A;  1JJ2 2;  3K5T A;  4XDV A;  2GEY A;  3GZR A;  5EVH A;  4N6O B;  3ROB A;  2BMO B;  1ZO2 A;  3LXU X;  1IVV A;  2LYX A;  3IMA B;  1JV2 B;  2D1W A;  5JBS A;  2Z76 A;  1W6Y A;  4BTY A;  5AEW B;  1RN7 A;  4HM8 B;  1K8A 4;  3F14 A;  2OQE C;  3G6E 3;  1RRH A;  1JRQ A;  3EQQ B;  1OHS A;  1TFK A;  3AMO A;  3UL5 A;  1N9E A;  1E97 A;  1GY6 A;  4LZI A;  3T8N A;  1Q82 4;  2LQV A;  1WTH A;  3BND A;  2CIU A;  2BO9 B;  3FSD A;  2FNQ A;  4FMB A;  5LC7 A;  2WO0 A;  3ALA A;  2WGQ A;  1YIT 3;  1YJN 3;  2Z77 A;  5ELJ A;  4HBR A;  1D6U A;  2KCD A;  3BNC A;  2K54 A;  3LTC A;  2Z7A A;  2CG1 A;  4WFO A;  4HM5 B;  4CDL A;  4EC6 A;  1UI7 A;  4MEI A;  3GAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...