3CCU3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccu300
3CMA3 1VQ93 2OTJ3 1QVG2 1VQ73 3I553 2QEX3 1YI23 1YIT3 1YJN3 1VQN3 1N8R4 1VQO3 1QVF2 1VQ83 1KD14 1VQK3 3CCQ3 3CCS3 1Q814 1K734 3G713 3CXC2 1M904 3CC23 3CCJ3 1YIJ3 1KQS2 1K9M4 1VQL3 3CME3 1VQP3 1YHQ3 1Q824 3CPW2 1YJW3 3CCV3 3CCM3 3G6E3 3CC73 1M1K4 3CCR3 1NJI4 1KC84 3CC43 1Q7Y4 1VQ63 2QA43 1Q864 1JJ22 1S723 3CCU3 3CCL3 1YJ93 1K8A4 3CCE3 1W2B2 1VQM3 3I563 1VQ53 3G4S3 1VQ43 3CD63 3OW22 2OTL3
chains in the Genus database with same CATH superfamily
2XSOB 1RGKA 3JUOA 1QVG2 1QALA 2CFDA 4QWTA 5AIFA 2UX0A 5M19A 3GZXB 1E97A 5JPUA 1F8NA 4I4KA 1BUQA 1QVF2 5IG5A 3D3LA 1RN7A 1I2EA 3EX9A 3CXC2 1QMAA 1DVDA 2UUGC 3LTBA 3FG1A 1PU4A 1TFOA 3GZYB 3FH1A 5IEOA 3EB8A 4K90B 5I97A 2BU4A 3KSPA 3CU3A 1TRPA 3CCR3 3HI7A 1STFI 5G1KA 4EV2A 1YGEA 2CFKA 1RN1A 1M1XB 1X1UA 1ZS7A 2KAAA 3MPHA 1EEJA 1Q864 1UCJA 1FA3A 1B2SA 3WA2X 1OUNA 1W4NA 4HYZA 3I563 7GSPA 1GY7A 4ZM8A 3KIIA 2STDA 1RGEA 5AEWB 1JZDA 1O7HB 1W2ZA 2K54A 2KF4A 2CWTA 3J7Yd 1GY5A 1EUIC 1GOUA 1YIT3 3RNTA 4H3UA 3BNDA 3F40A 1NNVA 1B2XA 3X3XA 3NQZA 3GAXA 5IERA 4GSPA 4JRFA 3MSOA 1NDOB 3DM8A 1Q824 5CXOA 3F7SA 3KZTA 1LQMB 1AVLA 1FGQA 2HMMB 3SXXA 3CC73 3K63A 3EN1B 3NBJA 1IK3A 2HMJB 1Q7Y4 1B20A 1HKXA 3DUKA 1VZZA 1N9EA 2GU1A 1N9JA 3ZG5A 3S29A 3MHEA 1UCIA 1WQLB 3H51A 2HMNB 2XH9A 3OW22 5KP1A 1JRQA 3B4PA 3DGLA 1LOWA 1YI23 4HM0B 5JBSA 4AEQA 3WODG 1NU3A 2W0QA 5AIGA 2ZL8A 2W56A 4R9KA 1Q9EA 1JKGB 3X3YA 1ULIB 1VQL3 2W03A 3DGNA 3SX1A 1QAKA 5AIIA 2GEXA 4HM5B 1OF5A 1CH0A 3HK4A 1RGFA 3NXJA 4J8TA 1GD4A 4LYLB 4L8PA 3VSYA 4XDWA 3NBRA 2CX1A 1RHLA 2WGQA 2XFTA 1D6UA 4AKZA 3BLZA 1SIIA 5CK6A 2BHMA 1IV9A 5IW9A 2SBLA 1IVUA 3CCL3 3DY5A 4CDLA 4MEIA 4HZBB 1I70A 5M1AA 3JUMA 3AHSA 4O02B 3V92A 1RGCA 1WNHA 2F56A 4N3VA 4KFEA 2OTJ3 1T5YA 4XBYA 3A5EA 1RSNA 1T2IA 4IIAA 1KWIA 1OHPA 5CF1A 3F8XA 1BRIA 2B1XB 5IENA 4GL6A 3WOEB 1KD14 1DETA 3B8LA 3V99A 3KN4A 1Q814 4PEJA 2XFSA 2J8XB 3GSPA 3FZWA 2CK3H 4XDVA 1LOVA 8RNTA 3UB1A 1IVXA 2Y74A 2AAEA 1RGGA 4N6MA 1O7NB 4RZMA 1FYSA 1SQWA 5D83A 2CIUA 2GXFA 3O8YA 4HKVB 2IA7A 2B24B 3N9HA 1VQ63 1ASKA 1UI8A 2F99A 1Q42A 2IUJA 1Q7HA 3PZWA 3N54B 3G4S3 4KVHA 3ROBA 1PY3A 1S5AA 3MKIA 1OGXA 1YNVX 1BNEA 2CW9A 2O9UX 3SOYA 3LZAA 2R41A 3SVAA 1X1WA 1X1XA 1VQN3 1BNRA 1W01A 4XBXA 1JB4A 4O3VA 1I2FA 5G2GA 1YIJ3 1JN5A 5DREA 4L8OA 2XEPA 3NV0B 3OV4A 4BL3A 3Q2PA 3LH4A 4FR9A 2IYJA 1GOVA 2P05A 4RNTA 3VF1A 3Q1CA 1QAFA 1GMRA 2F4YA 1STDA 1AR0A 4HM3B 4STDA 1MGRA 2GBXB 1IDPA 1EG9B 4ORLA 1JJ22 1B27A 2GBWB 1YJ93 1JNQA 1UDII 3EHCA 1VQ53 4XM4A 3FF0A 1TUHA 1HU9A 4JF8A 3OXAA 1WMNA 1VQ93 3PS8A 5DRVA 3IJEB 1ROVA 4NPBA 7RNTA 3DMCA 1VQO3 3FG3A 2KCDA 3EBYA 3PGBA 3PYJA 4EYCA 3EC9A 1O7PB 2W9QA 3NBBA 4HM4B 3LYGA 4HOHA 4BIRA 5BIRA 5JPPA 1BSDA 1RJOA 3AGOA 1GS3A 4WWUC 4DKIA 3IMAB 3S28A 1BIRA 1MWUA 1NB5I 2XGNA 1OHOA 3FF2A 4N6V0 1FGOA 1LNHA 4O8SA 2PNCA 1G02A 4R4KA 2LQVA 2E2TA 2HMLB 3STDA 1VQQA 3FCSB 4HM2B 3MYTA 4J5GA 4FMBA 4IPBA 4HM8B 1TRQA 1L5GB 2P38A 2XRXB 2BMQB 4RNYA 1RKYA 1YJN3 3DZLA 1IT7A 4RNZA 5EVHA 3URPA 1GY6A 1IU7A 1HYFA 3HX8A 4KZ1A 3RGRA 1JV2B 4EBGA 1M904 4HM7B 1B2MA 4HVNA 1OACA 1NB3I 1TTOA 1FGRA 2H0GA 4R9LA 3E99A 3TDGA 5M18A 1Y4KA 1KQS2 2M7OA 4HZ9B 4TX4A 3MG1A 3BU4A 5IG0A 1LOXA 2JDIH 2K0MA 2PZVA 3FGYA 3WHOA 1TU5A 1RGHA 2F98A 3DGOA 1BOXA 4HAAA 1T3BA 1DVCA 3MWZA 3X40A 1MWTA 3UL6A 2ZHXB 1GMPA 2MC8A 4LMIA 3S5CA 3F7XA 3LMLA 2Z6BA 1YGWA 2QA43 2W9PA 1AV4A 3WOFB 1BUJA 2KRTA 3K0ZA 2F5MA 4MJDA 1W7CA 2D42A 3NHXA 3K9MC 3KCHA 2JQ5A 2QEX3 1WTHA 2CFLA 3DGMA 3K5TA 3LTCA 1OCVA 2KXGA 3CCQ3 1MWRA 1GMQA 1X1YA 5IF6A 4X2OA 1FUWA 3LTDA 1RMSA 4CCVA 1K9M4 4GHOA 3PCSA 4Q53A 5IG3A 1VQP3 3V98A 2RCDA 3CPOA 4HJLB 2P0XA 1BSAA 3ZG0A 2GEYA 1JBTA 1UUGB 4CJNA 1RDSA 1ISKA 3T8NA 3ER7A 1BRKA 4H61A 1K8A4 3Q90A 3WMDA 1LXEA 3GZBA 4L7KA 3CD63 2BNGA 4R1KA 1RNTA 2OTL3 4X2HA 3HOHA 1BAOA 2W6JH 2CX0A 3G8ZA 1BSCA 1JKGA 4OVMA 5EQLA 1U5OA 2RSXA 2OQEA 1HZ1A 1V74A 1N8R4 3UL5A 1VQK3 5IEPA 1B2UA 2OWPA 2KF3A 9RNTA 3G713 2BMRB 3BNEA 3CME3 2P0MA 4G1MB 2XR8B 1J2BA 5CF2A 1Q40B 1RGLA 1JB5A 1A2VA 1YJW3 3D5IA 4N6UA 1W5ZA 1UCKA 5KP3A 5LC7A 3GRDA 3FG4A 3EN8A 3LOYA 4RBNA 3GZRA 5AYSC 4EC6A 3X41A 3ZFZA 3AMOB 5AEUB 5EEOA 1N5HA 1I2GA 2XSHB 3GWRA 4GB5A 3NUVA 1VQM3 1W2B2 1M9GA 3EQQB 3DXOA 1VQ43 1GYBA 1O7WB 5D81A 4EV5A 1UGHI 1B2ZA 2FXTA 5KP4A 1I0XA 1VQ73 4EXRA 3DH2A 1E3VA 4N6LA 2L4VA 1BRJA 3BIRA 3G0KA 4BTXA 4WP5A 4J5KA 1W6CA 3CC23 3BNCA 4IT7A 4LSOA 3SLUA 4FMDA 3FLJA 1C7HA 1DMNA 1JB2A 4WYKB 5TGNA 1UW1A 3AMOA 1NO3A 1BNSA 1V57A 3Q3FA 1EKMA 1WMOA 2ZDJA 3D5GA 3CPW2 3CCM3 3JVCA 1BNGA 1MOLA 3FSDA 1UCLA 1MWSA 3BB9A 1T2HA 2C4BA 2YFJB 3K7CA 1R4YA 4U13A 2H0IA 3U97A 1LQGC 3NM7A 3CCE3 1N5PA 2P09A 1SJWA 3SOAA 1DYUA 1EA2A 3OWSA 4XBTA 1FZUA 3CMA3 6GSPA 1UI7A 2E2VA 2CG0A 4FMCA 2OOVC 1LRAA 2ML5A 3NV0A 5STDA 1N8QA 4HM6B 3EE1A 1JBSA 4WFOA 8CHOA 1A2PA 2RBIA 2Y73A 1IQXA 2K3DA 2A15A 4J9AA 1BRGA 2YFLB 1YHQ3 2WO0A 4EW5A 4LZIA 3UNLA 1DE3A 2E2UA 4HBRA 1PYLA 1W6YA 6RNTA 1LOYA 3G6E3 2QGUA 3WR2A 1RCLA 1BNJA 2F86B 1IV7A 2IY2A 3DGYA 1BNFA 2OCTA 5G1LA 3RGAA 1S723 3CCU3 2KF5A 3NM2A 1RN4A 2INXA 1CYVA 1ULJB 3EBTA 3OWYA 1UUWB 4N6NB 2Z77A 3WDGB 3G16A 3NQYA 2CKFB 3T8UA 1AVKA 1GSPA 2CC3A 3JUQA 3SYUA 1CEWI 1BRSA 1G0TA 1DMQA 3EF8A 2YFIB 2CG1A 4OK0A 2KF6A 3HIGA 4XB5A 1UUVB 2O3OA 2OQEC 2CHCA 1O7GB 1RGAA 3ALAA 3D4AA 4O2HA 2BMOB 1M1K4 1KC84 7STDA 1C54A 2RNTA 3LXUX 2I9WA 4BTWA 1RRHA 2C10A 3FKAA 5CLKA 5BVBA 3HIIA 1MGWA 5ELJA 1RRLA 3QRDA 1AQZA 1FUSA 5AI1A 2OOVA 2WOFA 2AADA 2IUKA 3X42A 3PXMA 3MG2A 1MNLA 2CFGA 4KFDA 4NREA 1I0VA 1KSIA 4CPKA 3N8BA 5HOHA 3A76A 1D6ZA 4R80A 5AIHA 1GD3A 1K734 1FGTA 3IPTA 5FW5A 2HMOB 1JBRA 1TP6A 1SARA 1GOYA 3RDEA 3X3ZA 1G96A 2W56B 1LNIA 2W2CA 4N6TA 3S27A 3LT8A 5AYRB 4I5QA 1DMMA 1BVIA 1OF5B 3KKGA 3L0RA 1BU4A 1OPYA 1A67A 3B4OA 1OGZA 3S67A 1BRHA 3D9RA 1TJDA 3F8HA 1IVWA 4KFFA 1B3SA 1ZGXA 4LEHA 1QJGA 4FMAA 1YVBI 2CH9A 2CFWA 1E3RA 1I3FA 4BU4A 5BU4A 1IQ8A 1K28A 3UJMA 5RNTA 1O7MB 3HZPA 3VGNA 1VQ83 3BNBA 1I3IA 1K41A 4BL2A 2V1LA 2FNQA 3KE7A 2Q07A 1BGSA 4K1UA 2RFRA 2UGIA 4NHFA 4MMXB 1PFPA 1TIJA 2CWUA 3F9SA 3JUPA 3I0YA 3CCV3 1RNBA 2Z76A 4OUQA 2F5WA 5IG4A 4AKYA 1V58A 3JUNA 2RGQA 1Z1SA 1FGMA 3CC43 2HMKB 2XGLA 3CNMA 1RTUA 1BRNL 1I8VA 1BNIA 1SPUA 1OH0A 2FGTA 3AHWA 1TFKA 4FCMA 5A0OB 1US1A 2W04A 2YX9A 1LVNA 3EJVA 1ROAA 3I553 2H0HA 2C11A 1A90A 1YVSA 4HM1B 2D1WA 3OX9A 3U1WA 3T0UA 1Q40A 1BSEA 4FCZA 1BANA 4KT3B 1WMPA 3NX0A 5BXQA 3CCS3 5GSPA 2IMJA 2R4IA 1IQYA 2MF7A 1ZX2A 4ILFA 2HOHA 1JN5B 1IT8A 3PCRA 1NWWA 3WA3A 2BIRA 3KFQC 2L1SA 3KSED 3LTAA 4K1VA 4WHAA 1RCKA 1UGIA 1SIHA 2ML6A 1IYYA 3ECFA 1W00A 1FW7A 2ZA4A 4BTYA 2QIYA 3M8CA 3F14A 1JZOA 3SEDA 1U8CB 1R4CA 1B21A 4K61A 2LYXA 4WYKA 4LGQA 4N6OB 1CQSA 1OHSA 2Z7AA 1A2KA 3CCJ3 1CYUA 1W6GA 5LC6A 6STDA 2SARA 3QK9A 4MMZB 2BT3A 1AY7A 4FCJA 1RLSA 2XF3A 2GU3A 5FGOA 1EQKA 2BO9B 1NJI4 3AGNA 5HGRA 1IVVA 1ZO2A 2WGOA 3D79A 3B7CA 5D82A 3OWUA 4MMYB 1D6YA 3MG3A 3LT9A 3CNXA 2GSPA 2WOHA 1FUTA 3H3HA 2CWVA 1W02A 5ELUA 1BSBA
chains in the Genus database with same CATH topology
2XSOB 3JUOA 1QVG2 1QALA 2CFDA 4QWTA 5AIFA 2UX0A 3GZXB 1E97A 5JPUA 1F8NA 4I4KA 1BUQA 1QVF2 5IG5A 3D3LA 1RN7A 3EX9A 1DVDA 3CXC2 1QMAA 3LTBA 3FG1A 1PU4A 1TFOA 3GZYB 3FH1A 5IEOA 3EB8A 4K90B 5I97A 3KSPA 3CU3A 3CCR3 3HI7A 1STFI 4EV2A 1YGEA 2CFKA 1M1XB 1Q864 3MPHA 1FA3A 3WA2X 1OUNA 1W4NA 4HYZA 3I563 1GY7A 4ZM8A 3KIIA 2STDA 5AEWB 1O7HB 2K54A 1W2ZA 3J7Yd 1YIT3 2CWTA 1GY5A 4H3UA 3BNDA 3F40A 3X3XA 3NQZA 3GAXA 5IERA 4JRFA 3MSOA 1NDOB 3DM8A 1Q824 5CXOA 3F7SA 3KZTA 1AVLA 1FGQA 2HMMB 3SXXA 3CC73 3K63A 3EN1B 3NBJA 1IK3A 2HMJB 1Q7Y4 1HKXA 3DUKA 1VZZA 1N9EA 2GU1A 1N9JA 3S29A 3MHEA 1WQLB 3H51A 2HMNB 2XH9A 3OW22 5KP1A 1JRQA 3B4PA 3DGLA 1YI23 4HM0B 5JBSA 4AEQA 3WODG 1NU3A 2W0QA 5AIGA 2ZL8A 2W56A 4R9KA 1JKGB 3X3YA 1ULIB 1VQL3 2W03A 3DGNA 3SX1A 1QAKA 5AIIA 2GEXA 4HM5B 1OF5A 3HK4A 3NXJA 4J8TA 1GD4A 4L8PA 3VSYA 4XDWA 3NBRA 2WGQA 2XFTA 1D6UA 4AKZA 3BLZA 1SIIA 5CK6A 2BHMA 1IV9A 5IW9A 2SBLA 1IVUA 3CCL3 3DY5A 4CDLA 4MEIA 4HZBB 3JUMA 4O02B 3V92A 1WNHA 4N3VA 4KFEA 2OTJ3 1T5YA 4XBYA 4IIAA 1KWIA 1OHPA 5CF1A 3F8XA 2B1XB 5IENA 4GL6A 3WOEB 1KD14 3V99A 3B8LA 1Q814 3KN4A 4PEJA 2XFSA 3FZWA 2CK3H 4XDVA 3UB1A 1IVXA 2Y74A 4N6MA 1O7NB 4RZMA 1SQWA 5D83A 2CIUA 2GXFA 3O8YA 4HKVB 2IA7A 2B24B 3N9HA 1VQ63 1ASKA 1UI8A 2F99A 1Q42A 2IUJA 3PZWA 3N54B 3G4S3 4KVHA 3ROBA 1S5AA 3MKIA 3SOYA 1OGXA 2CW9A 2O9UX 3LZAA 3SVAA 1VQN3 1W01A 4XBXA 1JB4A 4O3VA 5G2GA 1YIJ3 1JN5A 5DREA 4L8OA 2XEPA 3NV0B 3OV4A 3Q2PA 3LH4A 4FR9A 2P05A 3VF1A 3Q1CA 1QAFA 1STDA 1AR0A 4HM3B 4STDA 2GBXB 1IDPA 1EG9B 4ORLA 1JJ22 2GBWB 1YJ93 1JNQA 3EHCA 1VQ53 4XM4A 3FF0A 1TUHA 1HU9A 4JF8A 3OXAA 1WMNA 1VQ93 3PS8A 5DRVA 3IJEB 1ROVA 3DMCA 1VQO3 3FG3A 2KCDA 3EBYA 3PGBA 3PYJA 4EYCA 3EC9A 1O7PB 2W9QA 3NBBA 4HM4B 3LYGA 5JPPA 1RJOA 1GS3A 4WWUC 3IMAB 3S28A 1NB5I 2XGNA 1OHOA 3FF2A 4N6V0 1FGOA 1LNHA 4O8SA 2PNCA 4R4KA 2LQVA 2E2TA 2HMLB 3STDA 3FCSB 4HM2B 3MYTA 4FMBA 4IPBA 4HM8B 1L5GB 2P38A 2XRXB 2BMQB 4RNYA 1RKYA 1YJN3 3DZLA 1IT7A 4RNZA 5EVHA 1GY6A 1IU7A 3HX8A 4KZ1A 3RGRA 4EBGA 1JV2B 1M904 4HM7B 4HVNA 1OACA 1NB3I 1FGRA 4R9LA 3TDGA 3E99A 1KQS2 1Y4KA 2M7OA 4HZ9B 4TX4A 3MG1A 5IG0A 1LOXA 2JDIH 2K0MA 2PZVA 3FGYA 1TU5A 2F98A 3DGOA 1DVCA 3MWZA 3X40A 3UL6A 2MC8A 4LMIA 3S5CA 3F7XA 3LMLA 2Z6BA 2QA43 2W9PA 1AV4A 3WOFB 2KRTA 3K0ZA 4MJDA 1W7CA 2D42A 3NHXA 3K9MC 2JQ5A 2QEX3 1WTHA 2CFLA 3DGMA 3K5TA 3LTCA 1OCVA 2KXGA 3CCQ3 5IF6A 4X2OA 1FUWA 3LTDA 4CCVA 1K9M4 3PCSA 4Q53A 5IG3A 1VQP3 3V98A 2RCDA 3CPOA 4HJLB 2P0XA 2GEYA 1ISKA 3T8NA 3ER7A 4H61A 1K8A4 3Q90A 3WMDA 1LXEA 3GZBA 4L7KA 3CD63 2BNGA 4R1KA 2OTL3 4X2HA 2W6JH 3G8ZA 1JKGA 4OVMA 5EQLA 1U5OA 2RSXA 2OQEA 1V74A 1N8R4 3UL5A 1VQK3 5IEPA 2OWPA 3G713 2BMRB 3BNEA 3CME3 2P0MA 4G1MB 2XR8B 1J2BA 5CF2A 1Q40B 1JB5A 1A2VA 1YJW3 4N6UA 1W5ZA 5KP3A 5LC7A 3GRDA 3FG4A 3EN8A 3LOYA 4RBNA 3GZRA 5AYSC 4EC6A 3X41A 3AMOB 5AEUB 5EEOA 1N5HA 2XSHB 3GWRA 4GB5A 3NUVA 1VQM3 1W2B2 1M9GA 3EQQB 3DXOA 1VQ43 1GYBA 1O7WB 5D81A 4EV5A 2FXTA 5KP4A 1VQ73 4EXRA 1E3VA 4N6LA 2L4VA 3G0KA 4BTXA 4WP5A 1W6CA 3CC23 3BNCA 4IT7A 4LSOA 3SLUA 4FMDA 3FLJA 1C7HA 1DMNA 1JB2A 4WYKB 5TGNA 1UW1A 3AMOA 1NO3A 3CPW2 1EKMA 1WMOA 2ZDJA 3CCM3 3JVCA 1MOLA 3FSDA 3BB9A 2YFJB 3K7CA 4U13A 3CCE3 3U97A 3NM7A 1N5PA 2P09A 1SJWA 3SOAA 1DYUA 1EA2A 3OWSA 4XBTA 3CMA3 1UI7A 2E2VA 2CG0A 4FMCA 2OOVC 2ML5A 3NV0A 5STDA 1N8QA 4HM6B 3EE1A 4WFOA 8CHOA 2Y73A 1IQXA 2A15A 4J9AA 2YFLB 1YHQ3 2WO0A 4LZIA 3UNLA 2E2UA 4HBRA 1W6YA 3G6E3 2QGUA 2F86B 1IV7A 2OCTA 3RGAA 1S723 3CCU3 3NM2A 2INXA 1CYVA 1ULJB 3EBTA 3OWYA 1UUWB 4N6NB 2Z77A 3WDGB 3G16A 3NQYA 2CKFB 3T8UA 1AVKA 2CC3A 3JUQA 1CEWI 1DMQA 3EF8A 2YFIB 2CG1A 4OK0A 3HIGA 4XB5A 1UUVB 2O3OA 2OQEC 2CHCA 1O7GB 3ALAA 4O2HA 2BMOB 1M1K4 1KC84 7STDA 3LXUX 2I9WA 4BTWA 1RRHA 2C10A 3FKAA 5CLKA 5BVBA 3HIIA 5ELJA 1RRLA 3QRDA 5AI1A 2OOVA 2WOFA 2IUKA 3X42A 3PXMA 3MG2A 1MNLA 2CFGA 4KFDA 4NREA 1KSIA 3N8BA 3A76A 1D6ZA 4R80A 5AIHA 1GD3A 1K734 1FGTA 3IPTA 5FW5A 2HMOB 1TP6A 3RDEA 3X3ZA 1G96A 2W56B 2W2CA 4N6TA 3S27A 3LT8A 5AYRB 1DMMA 1OF5B 3KKGA 3L0RA 1OPYA 1A67A 3B4OA 1OGZA 3S67A 3D9RA 3F8HA 1IVWA 4KFFA 4LEHA 1QJGA 4FMAA 1YVBI 2CH9A 2CFWA 1E3RA 1IQ8A 1K28A 3UJMA 1O7MB 3HZPA 3VGNA 1VQ83 3BNBA 1K41A 2V1LA 2FNQA 3KE7A 2Q07A 4K1UA 2RFRA 4NHFA 4MMXB 1PFPA 1TIJA 2CWUA 3F9SA 3JUPA 3I0YA 3CCV3 2Z76A 4OUQA 5IG4A 4AKYA 3JUNA 3CC43 2RGQA 1Z1SA 1FGMA 2HMKB 2XGLA 3CNMA 1SPUA 1OH0A 2FGTA 4FCMA 1TFKA 5A0OB 1US1A 2W04A 2YX9A 1LVNA 3EJVA 1ROAA 3I553 2C11A 1A90A 4HM1B 2D1WA 3OX9A 3U1WA 3T0UA 1Q40A 4FCZA 3CCS3 1WMPA 3NX0A 5BXQA 2IMJA 2R4IA 1IQYA 2MF7A 1ZX2A 1JN5B 1IT8A 3PCRA 1NWWA 3WA3A 3KFQC 4K1VA 3KSED 3LTAA 4WHAA 1SIHA 2ML6A 3ECFA 1W00A 4BTYA 2QIYA 3M8CA 3F14A 3SEDA 1U8CB 1R4CA 4K61A 2LYXA 4WYKA 4LGQA 4N6OB 1CQSA 1OHSA 2Z7AA 1A2KA 3CCJ3 1CYUA 1W6GA 5LC6A 6STDA 3QK9A 4MMZB 2BT3A 4FCJA 2XF3A 2GU3A 5FGOA 1EQKA 2BO9B 1NJI4 5HGRA 1IVVA 1ZO2A 2WGOA 5D82A 3B7CA 3OWUA 4MMYB 1D6YA 3MG3A 3LT9A 3CNXA 2WOHA 3H3HA 2CWVA 1W02A 5ELUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA 3;  1VQ9 3;  2OTJ 3;  1QVG 2;  1VQ7 3;  3I55 3;  2QEX 3;  1YI2 3;  1YIT 3;  1YJN 3;  1VQN 3;  1N8R 4;  1VQO 3;  1QVF 2;  1VQ8 3;  1KD1 4;  1VQK 3;  3CCQ 3;  3CCS 3;  1Q81 4;  1K73 4;  3G71 3;  3CXC 2;  1M90 4;  3CC2 3;  3CCJ 3;  1YIJ 3;  1KQS 2;  1K9M 4;  1VQL 3;  3CME 3;  1VQP 3;  1YHQ 3;  1Q82 4;  3CPW 2;  1YJW 3;  3CCV 3;  3CCM 3;  3G6E 3;  3CC7 3;  1M1K 4;  3CCR 3;  1NJI 4;  1KC8 4;  3CC4 3;  1Q7Y 4;  1VQ6 3;  2QA4 3;  1Q86 4;  1JJ2 2;  1S72 3;  3CCU 3;  3CCL 3;  1YJ9 3;  1K8A 4;  3CCE 3;  1W2B 2;  1VQM 3;  3I56 3;  1VQ5 3;  3G4S 3;  1VQ4 3;  3CD6 3;  3OW2 2;  2OTL 3; 
#chains in the Genus database with same CATH topology
 2XSO B;  1RGK A;  3JUO A;  1QVG 2;  1QAL A;  2CFD A;  4QWT A;  5AIF A;  2UX0 A;  5M19 A;  3GZX B;  1E97 A;  5JPU A;  1F8N A;  4I4K A;  1BUQ A;  1QVF 2;  5IG5 A;  3D3L A;  1RN7 A;  1I2E A;  3EX9 A;  3CXC 2;  1QMA A;  1DVD A;  2UUG C;  3LTB A;  3FG1 A;  1PU4 A;  1TFO A;  3GZY B;  3FH1 A;  5IEO A;  3EB8 A;  4K90 B;  5I97 A;  2BU4 A;  3KSP A;  3CU3 A;  1TRP A;  3CCR 3;  3HI7 A;  1STF I;  5G1K A;  4EV2 A;  1YGE A;  2CFK A;  1RN1 A;  1M1X B;  1X1U A;  1ZS7 A;  2KAA A;  3MPH A;  1EEJ A;  1Q86 4;  1UCJ A;  1FA3 A;  1B2S A;  3WA2 X;  1OUN A;  1W4N A;  4HYZ A;  3I56 3;  7GSP A;  1GY7 A;  4ZM8 A;  3KII A;  2STD A;  1RGE A;  5AEW B;  1JZD A;  1O7H B;  1W2Z A;  2K54 A;  2KF4 A;  2CWT A;  3J7Y d;  1GY5 A;  1EUI C;  1GOU A;  1YIT 3;  3RNT A;  4H3U A;  3BND A;  3F40 A;  1NNV A;  1B2X A;  3X3X A;  3NQZ A;  3GAX A;  5IER A;  4GSP A;  4JRF A;  3MSO A;  1NDO B;  3DM8 A;  1Q82 4;  5CXO A;  3F7S A;  3KZT A;  1LQM B;  1AVL A;  1FGQ A;  2HMM B;  3SXX A;  3CC7 3;  3K63 A;  3EN1 B;  3NBJ A;  1IK3 A;  2HMJ B;  1Q7Y 4;  1B20 A;  1HKX A;  3DUK A;  1VZZ A;  1N9E A;  2GU1 A;  1N9J A;  3ZG5 A;  3S29 A;  3MHE A;  1UCI A;  1WQL B;  3H51 A;  2HMN B;  2XH9 A;  3OW2 2;  5KP1 A;  1JRQ A;  3B4P A;  3DGL A;  1LOW A;  1YI2 3;  4HM0 B;  5JBS A;  4AEQ A;  3WOD G;  1NU3 A;  2W0Q A;  5AIG A;  2ZL8 A;  2W56 A;  4R9K A;  1Q9E A;  1JKG B;  3X3Y A;  1ULI B;  1VQL 3;  2W03 A;  3DGN A;  3SX1 A;  1QAK A;  5AII A;  2GEX A;  4HM5 B;  1OF5 A;  1CH0 A;  3HK4 A;  1RGF A;  3NXJ A;  4J8T A;  1GD4 A;  4LYL B;  4L8P A;  3VSY A;  4XDW A;  3NBR A;  2CX1 A;  1RHL A;  2WGQ A;  2XFT A;  1D6U A;  4AKZ A;  3BLZ A;  1SII A;  5CK6 A;  2BHM A;  1IV9 A;  5IW9 A;  2SBL A;  1IVU A;  3CCL 3;  3DY5 A;  4CDL A;  4MEI A;  4HZB B;  1I70 A;  5M1A A;  3JUM A;  3AHS A;  4O02 B;  3V92 A;  1RGC A;  1WNH A;  2F56 A;  4N3V A;  4KFE A;  2OTJ 3;  1T5Y A;  4XBY A;  3A5E A;  1RSN A;  1T2I A;  4IIA A;  1KWI A;  1OHP A;  5CF1 A;  3F8X A;  1BRI A;  2B1X B;  5IEN A;  4GL6 A;  3WOE B;  1KD1 4;  1DET A;  3B8L A;  3V99 A;  3KN4 A;  1Q81 4;  4PEJ A;  2XFS A;  2J8X B;  3GSP A;  3FZW A;  2CK3 H;  4XDV A;  1LOV A;  8RNT A;  3UB1 A;  1IVX A;  2Y74 A;  2AAE A;  1RGG A;  4N6M A;  1O7N B;  4RZM A;  1FYS A;  1SQW A;  5D83 A;  2CIU A;  2GXF A;  3O8Y A;  4HKV B;  2IA7 A;  2B24 B;  3N9H A;  1VQ6 3;  1ASK A;  1UI8 A;  2F99 A;  1Q42 A;  2IUJ A;  1Q7H A;  3PZW A;  3N54 B;  3G4S 3;  4KVH A;  3ROB A;  1PY3 A;  1S5A A;  3MKI A;  1OGX A;  1YNV X;  1BNE A;  2CW9 A;  2O9U X;  3SOY A;  3LZA A;  2R41 A;  3SVA A;  1X1W A;  1X1X A;  1VQN 3;  1BNR A;  1W01 A;  4XBX A;  1JB4 A;  4O3V A;  1I2F A;  5G2G A;  1YIJ 3;  1JN5 A;  5DRE A;  4L8O A;  2XEP A;  3NV0 B;  3OV4 A;  4BL3 A;  3Q2P A;  3LH4 A;  4FR9 A;  2IYJ A;  1GOV A;  2P05 A;  4RNT A;  3VF1 A;  3Q1C A;  1QAF A;  1GMR A;  2F4Y A;  1STD A;  1AR0 A;  4HM3 B;  4STD A;  1MGR A;  2GBX B;  1IDP A;  1EG9 B;  4ORL A;  1JJ2 2;  1B27 A;  2GBW B;  1YJ9 3;  1JNQ A;  1UDI I;  3EHC A;  1VQ5 3;  4XM4 A;  3FF0 A;  1TUH A;  1HU9 A;  4JF8 A;  3OXA A;  1WMN A;  1VQ9 3;  3PS8 A;  5DRV A;  3IJE B;  1ROV A;  4NPB A;  7RNT A;  3DMC A;  1VQO 3;  3FG3 A;  2KCD A;  3EBY A;  3PGB A;  3PYJ A;  4EYC A;  3EC9 A;  1O7P B;  2W9Q A;  3NBB A;  4HM4 B;  3LYG A;  4HOH A;  4BIR A;  5BIR A;  5JPP A;  1BSD A;  1RJO A;  3AGO A;  1GS3 A;  4WWU C;  4DKI A;  3IMA B;  3S28 A;  1BIR A;  1MWU A;  1NB5 I;  2XGN A;  1OHO A;  3FF2 A;  4N6V 0;  1FGO A;  1LNH A;  4O8S A;  2PNC A;  1G02 A;  4R4K A;  2LQV A;  2E2T A;  2HML B;  3STD A;  1VQQ A;  3FCS B;  4HM2 B;  3MYT A;  4J5G A;  4FMB A;  4IPB A;  4HM8 B;  1TRQ A;  1L5G B;  2P38 A;  2XRX B;  2BMQ B;  4RNY A;  1RKY A;  1YJN 3;  3DZL A;  1IT7 A;  4RNZ A;  5EVH A;  3URP A;  1GY6 A;  1IU7 A;  1HYF A;  3HX8 A;  4KZ1 A;  3RGR A;  1JV2 B;  4EBG A;  1M90 4;  4HM7 B;  1B2M A;  4HVN A;  1OAC A;  1NB3 I;  1TTO A;  1FGR A;  2H0G A;  4R9L A;  3E99 A;  3TDG A;  5M18 A;  1Y4K A;  1KQS 2;  2M7O A;  4HZ9 B;  4TX4 A;  3MG1 A;  3BU4 A;  5IG0 A;  1LOX A;  2JDI H;  2K0M A;  2PZV A;  3FGY A;  3WHO A;  1TU5 A;  1RGH A;  2F98 A;  3DGO A;  1BOX A;  4HAA A;  1T3B A;  1DVC A;  3MWZ A;  3X40 A;  1MWT A;  3UL6 A;  2ZHX B;  1GMP A;  2MC8 A;  4LMI A;  3S5C A;  3F7X A;  3LML A;  2Z6B A;  1YGW A;  2QA4 3;  2W9P A;  1AV4 A;  3WOF B;  1BUJ A;  2KRT A;  3K0Z A;  2F5M A;  4MJD A;  1W7C A;  2D42 A;  3NHX A;  3K9M C;  3KCH A;  2JQ5 A;  2QEX 3;  1WTH A;  2CFL A;  3DGM A;  3K5T A;  3LTC A;  1OCV A;  2KXG A;  3CCQ 3;  1MWR A;  1GMQ A;  1X1Y A;  5IF6 A;  4X2O A;  1FUW A;  3LTD A;  1RMS A;  4CCV A;  1K9M 4;  4GHO A;  3PCS A;  4Q53 A;  5IG3 A;  1VQP 3;  3V98 A;  2RCD A;  3CPO A;  4HJL B;  2P0X A;  1BSA A;  3ZG0 A;  2GEY A;  1JBT A;  1UUG B;  4CJN A;  1RDS A;  1ISK A;  3T8N A;  3ER7 A;  1BRK A;  4H61 A;  1K8A 4;  3Q90 A;  3WMD A;  1LXE A;  3GZB A;  4L7K A;  3CD6 3;  2BNG A;  4R1K A;  1RNT A;  2OTL 3;  4X2H A;  3HOH A;  1BAO A;  2W6J H;  2CX0 A;  3G8Z A;  1BSC A;  1JKG A;  4OVM A;  5EQL A;  1U5O A;  2RSX A;  2OQE A;  1HZ1 A;  1V74 A;  1N8R 4;  3UL5 A;  1VQK 3;  5IEP A;  1B2U A;  2OWP A;  2KF3 A;  9RNT A;  3G71 3;  2BMR B;  3BNE A;  3CME 3;  2P0M A;  4G1M B;  2XR8 B;  1J2B A;  5CF2 A;  1Q40 B;  1RGL A;  1JB5 A;  1A2V A;  1YJW 3;  3D5I A;  4N6U A;  1W5Z A;  1UCK A;  5KP3 A;  5LC7 A;  3GRD A;  3FG4 A;  3EN8 A;  3LOY A;  4RBN A;  3GZR A;  5AYS C;  4EC6 A;  3X41 A;  3ZFZ A;  3AMO B;  5AEU B;  5EEO A;  1N5H A;  1I2G A;  2XSH B;  3GWR A;  4GB5 A;  3NUV A;  1VQM 3;  1W2B 2;  1M9G A;  3EQQ B;  3DXO A;  1VQ4 3;  1GYB A;  1O7W B;  5D81 A;  4EV5 A;  1UGH I;  1B2Z A;  2FXT A;  5KP4 A;  1I0X A;  1VQ7 3;  4EXR A;  3DH2 A;  1E3V A;  4N6L A;  2L4V A;  1BRJ A;  3BIR A;  3G0K A;  4BTX A;  4WP5 A;  4J5K A;  1W6C A;  3CC2 3;  3BNC A;  4IT7 A;  4LSO A;  3SLU A;  4FMD A;  3FLJ A;  1C7H A;  1DMN A;  1JB2 A;  4WYK B;  5TGN A;  1UW1 A;  3AMO A;  1NO3 A;  1BNS A;  1V57 A;  3Q3F A;  1EKM A;  1WMO A;  2ZDJ A;  3D5G A;  3CPW 2;  3CCM 3;  3JVC A;  1BNG A;  1MOL A;  3FSD A;  1UCL A;  1MWS A;  3BB9 A;  1T2H A;  2C4B A;  2YFJ B;  3K7C A;  1R4Y A;  4U13 A;  2H0I A;  3U97 A;  1LQG C;  3NM7 A;  3CCE 3;  1N5P A;  2P09 A;  1SJW A;  3SOA A;  1DYU A;  1EA2 A;  3OWS A;  4XBT A;  1FZU A;  3CMA 3;  6GSP A;  1UI7 A;  2E2V A;  2CG0 A;  4FMC A;  2OOV C;  1LRA A;  2ML5 A;  3NV0 A;  5STD A;  1N8Q A;  4HM6 B;  3EE1 A;  1JBS A;  4WFO A;  8CHO A;  1A2P A;  2RBI A;  2Y73 A;  1IQX A;  2K3D A;  2A15 A;  4J9A A;  1BRG A;  2YFL B;  1YHQ 3;  2WO0 A;  4EW5 A;  4LZI A;  3UNL A;  1DE3 A;  2E2U A;  4HBR A;  1PYL A;  1W6Y A;  6RNT A;  1LOY A;  3G6E 3;  2QGU A;  3WR2 A;  1RCL A;  1BNJ A;  2F86 B;  1IV7 A;  2IY2 A;  3DGY A;  1BNF A;  2OCT A;  5G1L A;  3RGA A;  1S72 3;  3CCU 3;  2KF5 A;  3NM2 A;  1RN4 A;  2INX A;  1CYV A;  1ULJ B;  3EBT A;  3OWY A;  1UUW B;  4N6N B;  2Z77 A;  3WDG B;  3G16 A;  3NQY A;  2CKF B;  3T8U A;  1AVK A;  1GSP A;  2CC3 A;  3JUQ A;  3SYU A;  1CEW I;  1BRS A;  1G0T A;  1DMQ A;  3EF8 A;  2YFI B;  2CG1 A;  4OK0 A;  2KF6 A;  3HIG A;  4XB5 A;  1UUV B;  2O3O A;  2OQE C;  2CHC A;  1O7G B;  1RGA A;  3ALA A;  3D4A A;  4O2H A;  2BMO B;  1M1K 4;  1KC8 4;  7STD A;  1C54 A;  2RNT A;  3LXU X;  2I9W A;  4BTW A;  1RRH A;  2C10 A;  3FKA A;  5CLK A;  5BVB A;  3HII A;  1MGW A;  5ELJ A;  1RRL A;  3QRD A;  1AQZ A;  1FUS A;  5AI1 A;  2OOV A;  2WOF A;  2AAD A;  2IUK A;  3X42 A;  3PXM A;  3MG2 A;  1MNL A;  2CFG A;  4KFD A;  4NRE A;  1I0V A;  1KSI A;  4CPK A;  3N8B A;  5HOH A;  3A76 A;  1D6Z A;  4R80 A;  5AIH A;  1GD3 A;  1K73 4;  1FGT A;  3IPT A;  5FW5 A;  2HMO B;  1JBR A;  1TP6 A;  1SAR A;  1GOY A;  3RDE A;  3X3Z A;  1G96 A;  2W56 B;  1LNI A;  2W2C A;  4N6T A;  3S27 A;  3LT8 A;  5AYR B;  4I5Q A;  1DMM A;  1BVI A;  1OF5 B;  3KKG A;  3L0R A;  1BU4 A;  1OPY A;  1A67 A;  3B4O A;  1OGZ A;  3S67 A;  1BRH A;  3D9R A;  1TJD A;  3F8H A;  1IVW A;  4KFF A;  1B3S A;  1ZGX A;  4LEH A;  1QJG A;  4FMA A;  1YVB I;  2CH9 A;  2CFW A;  1E3R A;  1I3F A;  4BU4 A;  5BU4 A;  1IQ8 A;  1K28 A;  3UJM A;  5RNT A;  1O7M B;  3HZP A;  3VGN A;  1VQ8 3;  3BNB A;  1I3I A;  1K41 A;  4BL2 A;  2V1L A;  2FNQ A;  3KE7 A;  2Q07 A;  1BGS A;  4K1U A;  2RFR A;  2UGI A;  4NHF A;  4MMX B;  1PFP A;  1TIJ A;  2CWU A;  3F9S A;  3JUP A;  3I0Y A;  3CCV 3;  1RNB A;  2Z76 A;  4OUQ A;  2F5W A;  5IG4 A;  4AKY A;  1V58 A;  3JUN A;  2RGQ A;  1Z1S A;  1FGM A;  3CC4 3;  2HMK B;  2XGL A;  3CNM A;  1RTU A;  1BRN L;  1I8V A;  1BNI A;  1SPU A;  1OH0 A;  2FGT A;  3AHW A;  1TFK A;  4FCM A;  5A0O B;  1US1 A;  2W04 A;  2YX9 A;  1LVN A;  3EJV A;  1ROA A;  3I55 3;  2H0H A;  2C11 A;  1A90 A;  1YVS A;  4HM1 B;  2D1W A;  3OX9 A;  3U1W A;  3T0U A;  1Q40 A;  1BSE A;  4FCZ A;  1BAN A;  4KT3 B;  1WMP A;  3NX0 A;  5BXQ A;  3CCS 3;  5GSP A;  2IMJ A;  2R4I A;  1IQY A;  2MF7 A;  1ZX2 A;  4ILF A;  2HOH A;  1JN5 B;  1IT8 A;  3PCR A;  1NWW A;  3WA3 A;  2BIR A;  3KFQ C;  2L1S A;  3KSE D;  3LTA A;  4K1V A;  4WHA A;  1RCK A;  1UGI A;  1SIH A;  2ML6 A;  1IYY A;  3ECF A;  1W00 A;  1FW7 A;  2ZA4 A;  4BTY A;  2QIY A;  3M8C A;  3F14 A;  1JZO A;  3SED A;  1U8C B;  1R4C A;  1B21 A;  4K61 A;  2LYX A;  4WYK A;  4LGQ A;  4N6O B;  1CQS A;  1OHS A;  2Z7A A;  1A2K A;  3CCJ 3;  1CYU A;  1W6G A;  5LC6 A;  6STD A;  2SAR A;  3QK9 A;  4MMZ B;  2BT3 A;  1AY7 A;  4FCJ A;  1RLS A;  2XF3 A;  2GU3 A;  5FGO A;  1EQK A;  2BO9 B;  1NJI 4;  3AGN A;  5HGR A;  1IVV A;  1ZO2 A;  2WGO A;  3D79 A;  3B7C A;  5D82 A;  3OWU A;  4MMY B;  1D6Y A;  3MG3 A;  3LT9 A;  3CNX A;  2GSP A;  2WOH A;  1FUT A;  3H3H A;  2CWV A;  1W02 A;  5ELU A;  1BSB A; 
#chains in the Genus database with same CATH homology
 2XSO B;  3JUO A;  1QVG 2;  1QAL A;  2CFD A;  4QWT A;  5AIF A;  2UX0 A;  3GZX B;  1E97 A;  5JPU A;  1F8N A;  4I4K A;  1BUQ A;  1QVF 2;  5IG5 A;  3D3L A;  1RN7 A;  3EX9 A;  1DVD A;  3CXC 2;  1QMA A;  3LTB A;  3FG1 A;  1PU4 A;  1TFO A;  3GZY B;  3FH1 A;  5IEO A;  3EB8 A;  4K90 B;  5I97 A;  3KSP A;  3CU3 A;  3CCR 3;  3HI7 A;  1STF I;  4EV2 A;  1YGE A;  2CFK A;  1M1X B;  1Q86 4;  3MPH A;  1FA3 A;  3WA2 X;  1OUN A;  1W4N A;  4HYZ A;  3I56 3;  1GY7 A;  4ZM8 A;  3KII A;  2STD A;  5AEW B;  1O7H B;  2K54 A;  1W2Z A;  3J7Y d;  1YIT 3;  2CWT A;  1GY5 A;  4H3U A;  3BND A;  3F40 A;  3X3X A;  3NQZ A;  3GAX A;  5IER A;  4JRF A;  3MSO A;  1NDO B;  3DM8 A;  1Q82 4;  5CXO A;  3F7S A;  3KZT A;  1AVL A;  1FGQ A;  2HMM B;  3SXX A;  3CC7 3;  3K63 A;  3EN1 B;  3NBJ A;  1IK3 A;  2HMJ B;  1Q7Y 4;  1HKX A;  3DUK A;  1VZZ A;  1N9E A;  2GU1 A;  1N9J A;  3S29 A;  3MHE A;  1WQL B;  3H51 A;  2HMN B;  2XH9 A;  3OW2 2;  5KP1 A;  1JRQ A;  3B4P A;  3DGL A;  1YI2 3;  4HM0 B;  5JBS A;  4AEQ A;  3WOD G;  1NU3 A;  2W0Q A;  5AIG A;  2ZL8 A;  2W56 A;  4R9K A;  1JKG B;  3X3Y A;  1ULI B;  1VQL 3;  2W03 A;  3DGN A;  3SX1 A;  1QAK A;  5AII A;  2GEX A;  4HM5 B;  1OF5 A;  3HK4 A;  3NXJ A;  4J8T A;  1GD4 A;  4L8P A;  3VSY A;  4XDW A;  3NBR A;  2WGQ A;  2XFT A;  1D6U A;  4AKZ A;  3BLZ A;  1SII A;  5CK6 A;  2BHM A;  1IV9 A;  5IW9 A;  2SBL A;  1IVU A;  3CCL 3;  3DY5 A;  4CDL A;  4MEI A;  4HZB B;  3JUM A;  4O02 B;  3V92 A;  1WNH A;  4N3V A;  4KFE A;  2OTJ 3;  1T5Y A;  4XBY A;  4IIA A;  1KWI A;  1OHP A;  5CF1 A;  3F8X A;  2B1X B;  5IEN A;  4GL6 A;  3WOE B;  1KD1 4;  3V99 A;  3B8L A;  1Q81 4;  3KN4 A;  4PEJ A;  2XFS A;  3FZW A;  2CK3 H;  4XDV A;  3UB1 A;  1IVX A;  2Y74 A;  4N6M A;  1O7N B;  4RZM A;  1SQW A;  5D83 A;  2CIU A;  2GXF A;  3O8Y A;  4HKV B;  2IA7 A;  2B24 B;  3N9H A;  1VQ6 3;  1ASK A;  1UI8 A;  2F99 A;  1Q42 A;  2IUJ A;  3PZW A;  3N54 B;  3G4S 3;  4KVH A;  3ROB A;  1S5A A;  3MKI A;  3SOY A;  1OGX A;  2CW9 A;  2O9U X;  3LZA A;  3SVA A;  1VQN 3;  1W01 A;  4XBX A;  1JB4 A;  4O3V A;  5G2G A;  1YIJ 3;  1JN5 A;  5DRE A;  4L8O A;  2XEP A;  3NV0 B;  3OV4 A;  3Q2P A;  3LH4 A;  4FR9 A;  2P05 A;  3VF1 A;  3Q1C A;  1QAF A;  1STD A;  1AR0 A;  4HM3 B;  4STD A;  2GBX B;  1IDP A;  1EG9 B;  4ORL A;  1JJ2 2;  2GBW B;  1YJ9 3;  1JNQ A;  3EHC A;  1VQ5 3;  4XM4 A;  3FF0 A;  1TUH A;  1HU9 A;  4JF8 A;  3OXA A;  1WMN A;  1VQ9 3;  3PS8 A;  5DRV A;  3IJE B;  1ROV A;  3DMC A;  1VQO 3;  3FG3 A;  2KCD A;  3EBY A;  3PGB A;  3PYJ A;  4EYC A;  3EC9 A;  1O7P B;  2W9Q A;  3NBB A;  4HM4 B;  3LYG A;  5JPP A;  1RJO A;  1GS3 A;  4WWU C;  3IMA B;  3S28 A;  1NB5 I;  2XGN A;  1OHO A;  3FF2 A;  4N6V 0;  1FGO A;  1LNH A;  4O8S A;  2PNC A;  4R4K A;  2LQV A;  2E2T A;  2HML B;  3STD A;  3FCS B;  4HM2 B;  3MYT A;  4FMB A;  4IPB A;  4HM8 B;  1L5G B;  2P38 A;  2XRX B;  2BMQ B;  4RNY A;  1RKY A;  1YJN 3;  3DZL A;  1IT7 A;  4RNZ A;  5EVH A;  1GY6 A;  1IU7 A;  3HX8 A;  4KZ1 A;  3RGR A;  4EBG A;  1JV2 B;  1M90 4;  4HM7 B;  4HVN A;  1OAC A;  1NB3 I;  1FGR A;  4R9L A;  3TDG A;  3E99 A;  1KQS 2;  1Y4K A;  2M7O A;  4HZ9 B;  4TX4 A;  3MG1 A;  5IG0 A;  1LOX A;  2JDI H;  2K0M A;  2PZV A;  3FGY A;  1TU5 A;  2F98 A;  3DGO A;  1DVC A;  3MWZ A;  3X40 A;  3UL6 A;  2MC8 A;  4LMI A;  3S5C A;  3F7X A;  3LML A;  2Z6B A;  2QA4 3;  2W9P A;  1AV4 A;  3WOF B;  2KRT A;  3K0Z A;  4MJD A;  1W7C A;  2D42 A;  3NHX A;  3K9M C;  2JQ5 A;  2QEX 3;  1WTH A;  2CFL A;  3DGM A;  3K5T A;  3LTC A;  1OCV A;  2KXG A;  3CCQ 3;  5IF6 A;  4X2O A;  1FUW A;  3LTD A;  4CCV A;  1K9M 4;  3PCS A;  4Q53 A;  5IG3 A;  1VQP 3;  3V98 A;  2RCD A;  3CPO A;  4HJL B;  2P0X A;  2GEY A;  1ISK A;  3T8N A;  3ER7 A;  4H61 A;  1K8A 4;  3Q90 A;  3WMD A;  1LXE A;  3GZB A;  4L7K A;  3CD6 3;  2BNG A;  4R1K A;  2OTL 3;  4X2H A;  2W6J H;  3G8Z A;  1JKG A;  4OVM A;  5EQL A;  1U5O A;  2RSX A;  2OQE A;  1V74 A;  1N8R 4;  3UL5 A;  1VQK 3;  5IEP A;  2OWP A;  3G71 3;  2BMR B;  3BNE A;  3CME 3;  2P0M A;  4G1M B;  2XR8 B;  1J2B A;  5CF2 A;  1Q40 B;  1JB5 A;  1A2V A;  1YJW 3;  4N6U A;  1W5Z A;  5KP3 A;  5LC7 A;  3GRD A;  3FG4 A;  3EN8 A;  3LOY A;  4RBN A;  3GZR A;  5AYS C;  4EC6 A;  3X41 A;  3AMO B;  5AEU B;  5EEO A;  1N5H A;  2XSH B;  3GWR A;  4GB5 A;  3NUV A;  1VQM 3;  1W2B 2;  1M9G A;  3EQQ B;  3DXO A;  1VQ4 3;  1GYB A;  1O7W B;  5D81 A;  4EV5 A;  2FXT A;  5KP4 A;  1VQ7 3;  4EXR A;  1E3V A;  4N6L A;  2L4V A;  3G0K A;  4BTX A;  4WP5 A;  1W6C A;  3CC2 3;  3BNC A;  4IT7 A;  4LSO A;  3SLU A;  4FMD A;  3FLJ A;  1C7H A;  1DMN A;  1JB2 A;  4WYK B;  5TGN A;  1UW1 A;  3AMO A;  1NO3 A;  3CPW 2;  1EKM A;  1WMO A;  2ZDJ A;  3CCM 3;  3JVC A;  1MOL A;  3FSD A;  3BB9 A;  2YFJ B;  3K7C A;  4U13 A;  3CCE 3;  3U97 A;  3NM7 A;  1N5P A;  2P09 A;  1SJW A;  3SOA A;  1DYU A;  1EA2 A;  3OWS A;  4XBT A;  3CMA 3;  1UI7 A;  2E2V A;  2CG0 A;  4FMC A;  2OOV C;  2ML5 A;  3NV0 A;  5STD A;  1N8Q A;  4HM6 B;  3EE1 A;  4WFO A;  8CHO A;  2Y73 A;  1IQX A;  2A15 A;  4J9A A;  2YFL B;  1YHQ 3;  2WO0 A;  4LZI A;  3UNL A;  2E2U A;  4HBR A;  1W6Y A;  3G6E 3;  2QGU A;  2F86 B;  1IV7 A;  2OCT A;  3RGA A;  1S72 3;  3CCU 3;  3NM2 A;  2INX A;  1CYV A;  1ULJ B;  3EBT A;  3OWY A;  1UUW B;  4N6N B;  2Z77 A;  3WDG B;  3G16 A;  3NQY A;  2CKF B;  3T8U A;  1AVK A;  2CC3 A;  3JUQ A;  1CEW I;  1DMQ A;  3EF8 A;  2YFI B;  2CG1 A;  4OK0 A;  3HIG A;  4XB5 A;  1UUV B;  2O3O A;  2OQE C;  2CHC A;  1O7G B;  3ALA A;  4O2H A;  2BMO B;  1M1K 4;  1KC8 4;  7STD A;  3LXU X;  2I9W A;  4BTW A;  1RRH A;  2C10 A;  3FKA A;  5CLK A;  5BVB A;  3HII A;  5ELJ A;  1RRL A;  3QRD A;  5AI1 A;  2OOV A;  2WOF A;  2IUK A;  3X42 A;  3PXM A;  3MG2 A;  1MNL A;  2CFG A;  4KFD A;  4NRE A;  1KSI A;  3N8B A;  3A76 A;  1D6Z A;  4R80 A;  5AIH A;  1GD3 A;  1K73 4;  1FGT A;  3IPT A;  5FW5 A;  2HMO B;  1TP6 A;  3RDE A;  3X3Z A;  1G96 A;  2W56 B;  2W2C A;  4N6T A;  3S27 A;  3LT8 A;  5AYR B;  1DMM A;  1OF5 B;  3KKG A;  3L0R A;  1OPY A;  1A67 A;  3B4O A;  1OGZ A;  3S67 A;  3D9R A;  3F8H A;  1IVW A;  4KFF A;  4LEH A;  1QJG A;  4FMA A;  1YVB I;  2CH9 A;  2CFW A;  1E3R A;  1IQ8 A;  1K28 A;  3UJM A;  1O7M B;  3HZP A;  3VGN A;  1VQ8 3;  3BNB A;  1K41 A;  2V1L A;  2FNQ A;  3KE7 A;  2Q07 A;  4K1U A;  2RFR A;  4NHF A;  4MMX B;  1PFP A;  1TIJ A;  2CWU A;  3F9S A;  3JUP A;  3I0Y A;  3CCV 3;  2Z76 A;  4OUQ A;  5IG4 A;  4AKY A;  3JUN A;  3CC4 3;  2RGQ A;  1Z1S A;  1FGM A;  2HMK B;  2XGL A;  3CNM A;  1SPU A;  1OH0 A;  2FGT A;  4FCM A;  1TFK A;  5A0O B;  1US1 A;  2W04 A;  2YX9 A;  1LVN A;  3EJV A;  1ROA A;  3I55 3;  2C11 A;  1A90 A;  4HM1 B;  2D1W A;  3OX9 A;  3U1W A;  3T0U A;  1Q40 A;  4FCZ A;  3CCS 3;  1WMP A;  3NX0 A;  5BXQ A;  2IMJ A;  2R4I A;  1IQY A;  2MF7 A;  1ZX2 A;  1JN5 B;  1IT8 A;  3PCR A;  1NWW A;  3WA3 A;  3KFQ C;  4K1V A;  3KSE D;  3LTA A;  4WHA A;  1SIH A;  2ML6 A;  3ECF A;  1W00 A;  4BTY A;  2QIY A;  3M8C A;  3F14 A;  3SED A;  1U8C B;  1R4C A;  4K61 A;  2LYX A;  4WYK A;  4LGQ A;  4N6O B;  1CQS A;  1OHS A;  2Z7A A;  1A2K A;  3CCJ 3;  1CYU A;  1W6G A;  5LC6 A;  6STD A;  3QK9 A;  4MMZ B;  2BT3 A;  4FCJ A;  2XF3 A;  2GU3 A;  5FGO A;  1EQK A;  2BO9 B;  1NJI 4;  5HGR A;  1IVV A;  1ZO2 A;  2WGO A;  5D82 A;  3B7C A;  3OWU A;  4MMY B;  1D6Y A;  3MG3 A;  3LT9 A;  3CNX A;  2WOH A;  3H3H A;  2CWV A;  1W02 A;  5ELU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...