3CCU3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccu300
3OW22 1VQM3 1YIJ3 1YJ93 1VQ53 3I563 1QVG2 1N8R4 3CCU3 1VQL3 3CC23 3CCR3 3CD63 2QEX3 3G4S3 1Q814 1QVF2 1VQ43 3I553 1VQ73 1M904 1YI23 3CCV3 2OTJ3 1YHQ3 1Q7Y4 3CCE3 1KD14 1W2B2 3CC73 1NJI4 1Q824 3G6E3 1KQS2 2OTL3 1YJW3 3CCJ3 1VQ93 1YIT3 3CME3 1KC84 3CCM3 1S723 1M1K4 1VQP3 3CMA3 1K8A4 3CC43 3G713 1VQ63 2QA43 1VQK3 3CCQ3 1Q864 1VQ83 1YJN3 3CXC2 1K734 1VQN3 3CPW2 1K9M4 3CCS3 1JJ22 1VQO3 3CCL3
chains in the Genus database with same CATH superfamily
1NWWA 2HMJB 2XR8B 3CC23 1GMRA 2CKFB 3GZBA 3GAXA 2LQVA 1IQYA 1IVVA 1OGXA 2FXTA 1BNGA 1M904 1OF5B 2W9PA 1O7HB 3WODG 3CCE3 3BNEA 1BRHA 4AKYA 1BUQA 3CC73 5D83A 5KP4A 3LT9A 4N6V0 4HM1B 1DYUA 1I2EA 1RN7A 4EW5A 2D1WA 2RGQA 1JB5A 1B2MA 3LOYA 2XEPA 1RMSA 2W6JH 2ZL8A 5JPPA 4NHFA 4HM3B 2HMMB 5JPUA 2CG0A 1SJWA 1IYYA 3N54B 1GOYA 2CWTA 2JDIH 3H3HA 2IYJA 3HK4A 5JBSA 5AIHA 1CEWI 3JUMA 1PU4A 3AGNA 2SARA 2F99A 2OOVC 4LGQA 1LOVA 3NBJA 4LSOA 3EB8A 3CPOA 1SARA 1ISKA 1BAOA 2R4IA 3X40A 1EG9B 1FGQA 2GBXB 3PCSA 5IW9A 1I70A 3X42A 4CCVA 1UDII 1QAFA 2IMJA 3PZWA 1JB4A 4OK0A 1MGRA 1WMOA 2ZHXB 1GY6A 1OGZA 2XSOB 2KCDA 3HZPA 2C11A 1TRQA 2CX0A 1YVBI 1BOXA 1BGSA 1O7NB 1LNHA 3NQYA 1MWRA 2YFLB 1RKYA 1IVXA 2GEYA 3QK9A 4J8TA 1RDSA 1YIJ3 3SX1A 3CCU3 1RGHA 1MWTA 3KN4A 1G02A 3VF1A 2I9WA 5IG4A 1B27A 2W56B 3N8BA 1QJGA 1JBSA 1JB2A 3CNXA 5BXQA 1BNRA 1HKXA 1IK3A 1WTHA 3URPA 2ZDJA 3KE7A 1A2PA 1T3BA 3GWRA 4WYKB 1IV7A 5G2GA 4KFEA 7RNTA 2BHMA 5EVHA 3G6E3 2OTL3 1UW1A 3OWSA 3BLZA 5A0OB 5M1AA 4HBRA 3WHOA 3X3XA 4MEIA 2XGLA 1O7MB 3JUPA 1O7GB 1IV9A 3HX8A 3K63A 2WGQA 1VQQA 3Q3FA 4MMXB 1B2XA 1BNEA 3RGAA 1FGMA 5IG5A 3CXC2 2P05A 1UI7A 3CCS3 1AVLA 3HI7A 4I4KA 2L4VA 1UCIA 4J9AA 1W01A 1N8R4 3FZWA 3KKGA 1LQGC 4HM6B 1R4CA 1JNQA 1ZS7A 2STDA 2CK3H 2CFGA 2E2TA 3BU4A 2KF4A 2PZVA 3NXJA 3Q1CA 5CF2A 1Q814 2IY2A 3HIIA 1I0XA 3KIIA 3MG1A 2JQ5A 3EBYA 1RSNA 4N6OB 1TFOA 3NM7A 1IDPA 3S67A 4CPKA 2KF6A 1RN4A 1ULJB 1UUGB 1DETA 2P0MA 1AR0A 1B2SA 1GD3A 2J8XB 2HMLB 2Y73A 3GSPA 2QIYA 4G1MB 1JBRA 2WGOA 1TRPA 3D4AA 4HM4B 4WP5A 3WA3A 2V1LA 4L7KA 4R4KA 1BNIA 3CCQ3 2XSHB 4MMYB 4IT7A 5CF1A 4KT3B 4X2HA 1SPUA 3BNBA 1US1A 3T8NA 5FGOA 3WA2X 1VQO3 2Z77A 3SYUA 2O3OA 1TFKA 1GMPA 3AGOA 2KRTA 3T8UA 3EN1B 1VQM3 1JBTA 3SOAA 5G1LA 4WYKA 1IVWA 3J7Yd 1NB3I 1ROVA 2RFRA 3UNLA 4K61A 3ZG0A 2OCTA 3JUOA 1I3FA 1O7PB 5BVBA 1VQ43 7STDA 1MOLA 3WR2A 3MPHA 3Q2PA 1VZZA 4EYCA 3IJEB 5ELUA 2E2UA 4R9KA 1Q40B 4K90B 5LC7A 1I0VA 3VSYA 1I2GA 1RRLA 5IG3A 3CME3 1NU3A 3DGLA 3MSOA 3SOYA 4MMZB 1F8NA 4HAAA 1YGWA 3LZAA 3NX0A 3U97A 1CH0A 1YJN3 3LMLA 3F8HA 1E3RA 3M8CA 5I97A 3DZLA 1JJ22 1BRNL 1V74A 3I563 1QVG2 1DVDA 1FGOA 2BMOB 4XB5A 3N9HA 1B2ZA 4N6MA 5IF6A 2OQEC 1ROAA 4OVMA 1R4YA 2BIRA 1MGWA 1OPYA 1YGEA 2F86B 1NDOB 1FGRA 2W2CA 3EBTA 1RGFA 3Q90A 4HVNA 4HZBB 2KXGA 4N6LA 1V57A 6GSPA 1UGHI 2MF7A 2W03A 3KSPA 1BRGA 1BSDA 1I8VA 5CLKA 4K1VA 1VQP3 5DRVA 1BSBA 1T2IA 3GRDA 1X1WA 2QA43 3A5EA 4RZMA 4N3VA 2K0MA 4LZIA 2KAAA 2XRXB 3F40A 4WHAA 1ULIB 3T0UA 3OXAA 2IA7A 1KWIA 1QMAA 1RNBA 4HJLB 3NM2A 1G0TA 2L1SA 2CC3A 1N5HA 2D42A 1JKGA 2F4YA 2GU3A 3F8XA 4HM2B 1TP6A 4ZM8A 4STDA 1AY7A 2QGUA 2OQEA 2XH9A 3LXUX 3MHEA 6RNTA 1N8QA 2F98A 4FMAA 3LH4A 2ML5A 2Z6BA 3HIGA 4O3VA 2RBIA 1A2KA 3EJVA 1YJW3 2H0GA 5CK6A 4GHOA 2KF3A 4FMDA 1GS3A 1LVNA 1BNFA 4O02B 5GSPA 5RNTA 4FCZA 1WMPA 1K8A4 1GOUA 4X2OA 1STFI 3S29A 3DUKA 1ZX2A 1PY3A 3LYGA 3KFQC 2GXFA 2ML6A 4CDLA 2Y74A 3D9RA 3DM8A 1LOXA 2RSXA 2A15A 1OF5A 1X1YA 3FSDA 3K9MC 3RGRA 2P38A 2Z76A 4HYZA 2OOVA 2QEX3 3DGMA 1IT8A 2BT3A 1DVCA 1RNTA 5DREA 5STDA 5EEOA 1YI23 1RJOA 3CU3A 3G16A 3O8YA 2F5MA 1NJI4 2C10A 3KSED 4AEQA 3K0ZA 1NB5I 5AIIA 2SBLA 3AMOB 4OUQA 2CWVA 5FW5A 1LRAA 3KZTA 4FCMA 1S5AA 3EE1A 1GOVA 1LXEA 3B4OA 2E2VA 1RGKA 4HOHA 3FCSB 2MC8A 1D6YA 3OWUA 1NO3A 3EQQB 1W5ZA 2IUKA 1O7WB 3NHXA 1ZO2A 3DXOA 5G1KA 2OWPA 1BNJA 1B3SA 1AQZA 3G0KA 4R80A 4FR9A 1QVF2 5AIGA 4R9LA 1GMQA 1IU7A 2C4BA 4FMBA 1W2B2 4GB5A 3F14A 2CH9A 1SIIA 4BL3A 4XBXA 1Q7HA 1QAKA 1VQ93 1QALA 1YIT3 3NV0B 4NREA 3BIRA 3MKIA 3FG1A 4BU4A 1KC84 3D3LA 1OHPA 5TGNA 1W2ZA 2P0XA 4GSPA 5BU4A 1VQK3 2BO9B 5EQLA 3E99A 4U13A 2W56A 1A90A 3LTAA 2F5WA 2CX1A 2M7OA 1UCLA 3CCL3 3OW22 2YX9A 1YJ93 5IENA 4QWTA 3SVAA 2P09A 3WMDA 5AYRB 3A76A 1EA2A 1KSIA 5M19A 1WNHA 4MJDA 1RGEA 1RGCA 3AMOA 4O8SA 3TDGA 1IQXA 3MYTA 3X3ZA 3CCV3 3JUQA 3QRDA 3EHCA 1GY7A 3UL6A 1DE3A 3RNTA 2CWUA 2ZA4A 1CQSA 4EV2A 1RGAA 3K7CA 1FUWA 1DMNA 1NNVA 1A2VA 1W6YA 5HGRA 3B4PA 4N6NB 1SIHA 4O2HA 5AEWB 1MNLA 4TX4A 2B24B 1STDA 1MWUA 2GBWB 1GY5A 1UGIA 3AHWA 4XDVA 5KP1A 1LOYA 1X1XA 2INXA 3DGYA 3FF0A 3KCHA 7GSPA 1A67A 3BNCA 1E97A 4HZ9B 3NV0A 3WOEB 5D81A 1BRSA 3DH2A 4IPBA 1VQ73 1FA3A 2CFDA 9RNTA 1YHQ3 3OX9A 3UB1A 2CFKA 1B21A 1C7HA 3H51A 1BRJA 3ALAA 1W00A 3CCJ3 3LTDA 3ROBA 1GD4A 4ILFA 2BNGA 3EF8A 1I3IA 4LMIA 2CFWA 1BSEA 4BTXA 1K734 1G96A 1FZUA 2F56A 3CPW2 2WOHA 3PXMA 4L8PA 1E3VA 3UJMA 2AADA 1V58A 4RNZA 4AKZA 5M18A 2BU4A 1RGLA 1N5PA 4EBGA 1D6UA 4EV5A 1VQL3 2GSPA 1Q40A 2PNCA 4HKVB 3S27A 1Q42A 3S28A 3CD63 4XBYA 4I5QA 3LTBA 1EKMA 3X41A 1U8CB 1IVUA 1N9EA 3OV4A 2OTJ3 1MWSA 1Q7Y4 1EEJA 2HMNB 3HOHA 1HZ1A 3GZRA 1BVIA 1I2FA 1RCKA 1RGGA 3F9SA 3PCRA 4WWUC 3V98A 1B20A 5CXOA 8RNTA 2XGNA 2H0HA 2RNTA 4LEHA 1T5YA 4RNTA 4BTYA 3IMAB 2UGIA 3RDEA 1PYLA 3DY5A 1VQN3 3WDGB 4J5GA 2FNQA 4Q53A 4R1KA 4KVHA 1OACA 2HMOB 3NUVA 4FCJA 4HM0B 4XDWA 1RTUA 3VGNA 1RLSA 1FW7A 1JZOA 1N9JA 2CIUA 1BU4A 1JN5B 3MWZA 4JRFA 3JVCA 1K28A 1TTOA 2BMQB 5LC6A 3F7XA 2W0QA 4HM5B 4WFOA 3U1WA 3ZFZA 2IUJA 1EQKA 3EC9A 1BUJA 5IEPA 2K54A 3SLUA 1JZDA 3CCM3 1BSCA 1FUSA 1HU9A 4LYLB 1M1K4 1Q9EA 1UUVB 4BTWA 2HMKB 1BNSA 3D5GA 2Z7AA 4HM8B 2LYXA 3PGBA 4KZ1A 1UCKA 3CCR3 1TU5A 3OWYA 5IERA 3FF2A 3PYJA 1YVSA 4N6TA 1OHOA 4J5KA 1AVKA 1TIJA 4KFDA 3DGNA 5BIRA 1HYFA 1OCVA 1Z1SA 1W4NA 1B2UA 4H3UA 5D82A 1WQLB 1JRQA 3L0RA 5AYSC 3S5CA 3WOFB 1KD14 2GU1A 3JUNA 2WO0A 1W6GA 3G8ZA 4IIAA 4BL2A 4RBNA 5HOHA 3I0YA 3NQZA 1BRKA 2XFTA 3ZG5A 3MG3A 1K41A 3LT8A 4H61A 4KFFA 1T2HA 4DKIA 1Y4KA 3CMA3 3CC43 1RCLA 1BANA 2RCDA 2XFSA 2AAEA 2YFJB 1VQ63 3ECFA 1VQ83 2GEXA 3STDA 1JV2B 1ASKA 1JN5A 4PEJA 1U5OA 2CFLA 3SXXA 4BIRA 3UL5A 5ELJA 4XM4A 1OH0A 1J2BA 1IT7A 3PS8A 2HOHA 1DMMA 1W7CA 1X1UA 3B8LA 3FG4A 1W6CA 1LQMB 2FGTA 3D5IA 3V99A 3G4S3 5KP3A 2K3DA 1BIRA 4GL6A 1TJDA 5AIFA 1ZGXA 4CJNA 4EC6A 3I553 1AV4A 1LOWA 6STDA 3DGOA 3DMCA 2YFIB 1OHSA 3NBBA 1RN1A 4NPBA 1FGTA 1OUNA 1BSAA 3SEDA 3GZXB 2Q07A 1KQS2 3F7SA 1CYVA 3BNDA 3CNMA 3EN8A 2WOFA 3AHSA 3FKAA 2W9QA 2KF5A 4K1UA 1S723 1PFPA 3FLJA 4FMCA 3G713 3V92A 1TUHA 1UUWB 3MG2A 1EUIC 1IQ8A 1SQWA 2O9UX 3ER7A 1UCJA 5AEUB 1VQ53 2CW9A 1C54A 1RRHA 1LNIA 3K5TA 3GZYB 1GYBA 3EX9A 3FH1A 2CG1A 1M9GA 4ORLA 1FUTA 2W04A 2UX0A 3X3YA 3LTCA 3BB9A 3FG3A 1L5GB 2BMRB 1BRIA 2R41A 2B1XB 3B7CA 4L8OA 4RNYA 1W02A 1YNVX 2UUGC 1JKGB 1Q824 5IG0A 1WMNA 1RHLA 3D79A 4HM7B 1CYUA 1M1XB 1D6ZA 1DMQA 2H0IA 2XF3A 4N6UA 5AI1A 5IEOA 4EXRA 2CHCA 3IPTA 1FYSA 1Q864 4JF8A 4XBTA 1UI8A 3FGYA 1K9M4 8CHOA 3NBRA 1GSPA
chains in the Genus database with same CATH topology
1NWWA 2HMJB 2XR8B 3CC23 2CKFB 3GZBA 3GAXA 2LQVA 1IQYA 1IVVA 1OGXA 2FXTA 1M904 1OF5B 2W9PA 1O7HB 3WODG 3CCE3 3BNEA 4AKYA 1BUQA 3CC73 5D83A 5KP4A 3LT9A 4N6V0 4HM1B 1DYUA 1RN7A 2D1WA 2RGQA 1JB5A 3LOYA 2XEPA 2W6JH 2ZL8A 5JPPA 4NHFA 4HM3B 2HMMB 5JPUA 2CG0A 1SJWA 3N54B 2CWTA 2JDIH 3H3HA 3HK4A 5JBSA 5AIHA 1CEWI 3JUMA 1PU4A 2F99A 2OOVC 4LGQA 4LSOA 3NBJA 3EB8A 3CPOA 1ISKA 2R4IA 3X40A 1EG9B 1FGQA 2GBXB 3PCSA 5IW9A 3X42A 4CCVA 1QAFA 2IMJA 3PZWA 1JB4A 4OK0A 1WMOA 1GY6A 1OGZA 2XSOB 2KCDA 3HZPA 2C11A 1YVBI 1O7NB 1LNHA 3NQYA 2YFLB 1RKYA 1IVXA 2GEYA 3QK9A 4J8TA 1YIJ3 3SX1A 3CCU3 3KN4A 3VF1A 2I9WA 5IG4A 2W56B 3N8BA 1QJGA 1JB2A 3CNXA 5BXQA 1HKXA 1IK3A 1WTHA 2ZDJA 3KE7A 3GWRA 4WYKB 1IV7A 5G2GA 4KFEA 2BHMA 5EVHA 3G6E3 2OTL3 1UW1A 3OWSA 3BLZA 5A0OB 4HBRA 3X3XA 4MEIA 2XGLA 1O7MB 3JUPA 1O7GB 1IV9A 3HX8A 3K63A 2WGQA 4MMXB 3RGAA 5IG5A 1FGMA 3CXC2 2P05A 1UI7A 3CCS3 1AVLA 3HI7A 4I4KA 2L4VA 4J9AA 1W01A 1N8R4 3FZWA 3KKGA 4HM6B 1R4CA 1JNQA 2STDA 2CK3H 2CFGA 2E2TA 5CF2A 2PZVA 3NXJA 3Q1CA 1Q814 3HIIA 3KIIA 3MG1A 2JQ5A 3EBYA 4N6OB 1TFOA 3NM7A 1IDPA 3S67A 1ULJB 2P0MA 1AR0A 1GD3A 2HMLB 2Y73A 2QIYA 4G1MB 2WGOA 4WP5A 4HM4B 3WA3A 2V1LA 4L7KA 4R4KA 3CCQ3 2XSHB 4MMYB 4IT7A 5CF1A 3T8NA 4X2HA 1SPUA 3BNBA 1US1A 3WA2X 5FGOA 1VQO3 2Z77A 1VQM3 2O3OA 1TFKA 3T8UA 2KRTA 3EN1B 3SOAA 4WYKA 1IVWA 3J7Yd 1NB3I 1ROVA 2RFRA 3UNLA 4K61A 2OCTA 3JUOA 1O7PB 5BVBA 1VQ43 7STDA 1MOLA 3MPHA 3Q2PA 1VZZA 4EYCA 3IJEB 5ELUA 2E2UA 4R9KA 1Q40B 4K90B 5LC7A 3VSYA 1RRLA 5IG3A 3CME3 1NU3A 3DGLA 3MSOA 3SOYA 4MMZB 1F8NA 3LZAA 3NX0A 3U97A 1YJN3 3LMLA 3F8HA 1E3RA 3M8CA 5I97A 3DZLA 1JJ22 1V74A 3I563 1QVG2 1DVDA 1FGOA 2BMOB 4XB5A 3N9HA 4N6MA 5IF6A 2OQEC 1ROAA 4OVMA 1OPYA 1YGEA 2W2CA 2F86B 1NDOB 1FGRA 3EBTA 4HVNA 3Q90A 4HZBB 4N6LA 2KXGA 2MF7A 2W03A 3KSPA 5CLKA 4K1VA 1VQP3 5DRVA 3GRDA 2QA43 4RZMA 4N3VA 2K0MA 4LZIA 2XRXB 3F40A 4WHAA 1ULIB 3T0UA 3OXAA 2IA7A 1KWIA 1QMAA 4HJLB 3NM2A 2CC3A 1N5HA 2D42A 1JKGA 2GU3A 3F8XA 4HM2B 1TP6A 4ZM8A 4STDA 2QGUA 2OQEA 2XH9A 3LXUX 3MHEA 1N8QA 2F98A 4FMAA 3LH4A 2ML5A 2Z6BA 3HIGA 4O3VA 1A2KA 3EJVA 1YJW3 5CK6A 4FMDA 1GS3A 1LVNA 4O02B 4FCZA 1WMPA 1K8A4 3S29A 4X2OA 1STFI 3DUKA 1ZX2A 3LYGA 3KFQC 2GXFA 2ML6A 4CDLA 2Y74A 3D9RA 3DM8A 1LOXA 2RSXA 2A15A 1OF5A 3FSDA 3K9MC 3RGRA 2P38A 2Z76A 4HYZA 2OOVA 2QEX3 3DGMA 1IT8A 2BT3A 1DVCA 5DREA 5STDA 5EEOA 1YI23 1RJOA 3CU3A 3G16A 3O8YA 1NJI4 2C10A 3KSED 4AEQA 3K0ZA 1NB5I 5AIIA 2SBLA 3AMOB 4OUQA 2CWVA 5FW5A 3KZTA 4FCMA 1S5AA 3EE1A 1LXEA 3B4OA 2E2VA 2MC8A 3FCSB 1D6YA 3OWUA 1NO3A 3EQQB 1W5ZA 2IUKA 1O7WB 3NHXA 1ZO2A 3DXOA 2OWPA 4R80A 3G0KA 4FR9A 1QVF2 5AIGA 4R9LA 1IU7A 4FMBA 1W2B2 4GB5A 3F14A 2CH9A 1SIIA 4XBXA 1QAKA 1VQ93 1QALA 1YIT3 3NV0B 4NREA 3MKIA 3FG1A 1KC84 3D3LA 1OHPA 5TGNA 1W2ZA 2P0XA 1VQK3 2BO9B 5EQLA 3E99A 4U13A 2W56A 1A90A 3LTAA 2M7OA 3CCL3 3OW22 2YX9A 1YJ93 5IENA 4QWTA 3SVAA 2P09A 3WMDA 5AYRB 3A76A 1EA2A 1KSIA 1WNHA 4MJDA 3AMOA 4O8SA 3TDGA 1IQXA 3MYTA 3X3ZA 3CCV3 3JUQA 3QRDA 3EHCA 1GY7A 3UL6A 2CWUA 1CQSA 4EV2A 3K7CA 1FUWA 1DMNA 1A2VA 1W6YA 5HGRA 3B4PA 4N6NB 1SIHA 4O2HA 5AEWB 1MNLA 4TX4A 2B24B 1STDA 2GBWB 1GY5A 5KP1A 4XDVA 2INXA 1A67A 3FF0A 3BNCA 1E97A 4HZ9B 3NV0A 3WOEB 5D81A 4IPBA 1VQ73 1FA3A 2CFDA 1YHQ3 3OX9A 3UB1A 2CFKA 1C7HA 3H51A 3ALAA 1W00A 3CCJ3 3LTDA 3ROBA 1GD4A 2BNGA 3EF8A 4LMIA 2CFWA 4BTXA 1K734 1G96A 3CPW2 2WOHA 3PXMA 4L8PA 1E3VA 3UJMA 4RNZA 4AKZA 1N5PA 4EBGA 1D6UA 4EV5A 1VQL3 2PNCA 1Q40A 4HKVB 3S27A 3S28A 1Q42A 3CD63 4XBYA 3LTBA 1EKMA 3X41A 1U8CB 1IVUA 1N9EA 3OV4A 2OTJ3 1Q7Y4 2HMNB 3GZRA 4WWUC 3PCRA 3F9SA 3V98A 5CXOA 2XGNA 4LEHA 1T5YA 4BTYA 3IMAB 3RDEA 3DY5A 1VQN3 3WDGB 4R1KA 2FNQA 4Q53A 4KVHA 1OACA 2HMOB 3NUVA 4FCJA 4HM0B 4XDWA 3VGNA 1N9JA 2CIUA 1JN5B 3MWZA 4JRFA 3JVCA 1K28A 2BMQB 5LC6A 3F7XA 2W0QA 4HM5B 4WFOA 3U1WA 2IUJA 1EQKA 3EC9A 5IEPA 2K54A 3SLUA 3CCM3 1M1K4 1HU9A 1UUVB 4BTWA 2HMKB 2Z7AA 4HM8B 2LYXA 3PGBA 4KZ1A 3CCR3 1TU5A 3OWYA 5IERA 3FF2A 3PYJA 4N6TA 1OHOA 1AVKA 1TIJA 4KFDA 3DGNA 1OCVA 1W4NA 1Z1SA 4H3UA 5D82A 5AYSC 1WQLB 1JRQA 3L0RA 3S5CA 3WOFB 1KD14 2GU1A 3JUNA 2WO0A 1W6GA 3G8ZA 4IIAA 4RBNA 3I0YA 3NQZA 2XFTA 3MG3A 1K41A 3LT8A 4H61A 4KFFA 1Y4KA 3CMA3 3CC43 2RCDA 2XFSA 2YFJB 1VQ63 3ECFA 1VQ83 2GEXA 3STDA 1JV2B 1ASKA 1JN5A 4PEJA 1U5OA 2CFLA 3SXXA 3UL5A 5ELJA 4XM4A 1OH0A 1J2BA 1IT7A 3PS8A 1DMMA 1W7CA 3B8LA 3FG4A 1W6CA 2FGTA 3V99A 3G4S3 5KP3A 4GL6A 5AIFA 3I553 4EC6A 1AV4A 6STDA 3DGOA 3DMCA 2YFIB 1OHSA 3NBBA 1FGTA 1OUNA 3SEDA 3GZXB 2Q07A 1KQS2 3F7SA 1CYVA 3BNDA 3CNMA 3EN8A 2WOFA 3FKAA 4K1UA 2W9QA 1S723 1PFPA 3FLJA 4FMCA 3G713 3V92A 1TUHA 1UUWB 3MG2A 1IQ8A 1SQWA 2O9UX 3ER7A 5AEUB 1VQ53 2CW9A 1RRHA 3K5TA 2CG1A 3GZYB 1GYBA 3EX9A 3FH1A 1M9GA 4ORLA 2W04A 2UX0A 3X3YA 3LTCA 3BB9A 3FG3A 1L5GB 2BMRB 2B1XB 3B7CA 4L8OA 4RNYA 1W02A 1JKGB 1Q824 5IG0A 1WMNA 4HM7B 1CYUA 1M1XB 1D6ZA 1DMQA 2XF3A 5AI1A 4N6UA 5IEOA 4EXRA 2CHCA 3IPTA 1Q864 4JF8A 4XBTA 1UI8A 3FGYA 1K9M4 8CHOA 3NBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 2;  1VQM 3;  1YIJ 3;  1YJ9 3;  1VQ5 3;  3I56 3;  1QVG 2;  1N8R 4;  3CCU 3;  1VQL 3;  3CC2 3;  3CCR 3;  3CD6 3;  2QEX 3;  3G4S 3;  1Q81 4;  1QVF 2;  1VQ4 3;  3I55 3;  1VQ7 3;  1M90 4;  1YI2 3;  3CCV 3;  2OTJ 3;  1YHQ 3;  1Q7Y 4;  3CCE 3;  1KD1 4;  1W2B 2;  3CC7 3;  1NJI 4;  1Q82 4;  3G6E 3;  1KQS 2;  2OTL 3;  1YJW 3;  3CCJ 3;  1VQ9 3;  1YIT 3;  3CME 3;  1KC8 4;  3CCM 3;  1S72 3;  1M1K 4;  1VQP 3;  3CMA 3;  1K8A 4;  3CC4 3;  3G71 3;  1VQ6 3;  2QA4 3;  1VQK 3;  3CCQ 3;  1Q86 4;  1VQ8 3;  1YJN 3;  3CXC 2;  1K73 4;  1VQN 3;  3CPW 2;  1K9M 4;  3CCS 3;  1JJ2 2;  1VQO 3;  3CCL 3; 
#chains in the Genus database with same CATH topology
 1NWW A;  2HMJ B;  2XR8 B;  3CC2 3;  1GMR A;  2CKF B;  3GZB A;  3GAX A;  2LQV A;  1IQY A;  1IVV A;  1OGX A;  2FXT A;  1BNG A;  1M90 4;  1OF5 B;  2W9P A;  1O7H B;  3WOD G;  3CCE 3;  3BNE A;  1BRH A;  4AKY A;  1BUQ A;  3CC7 3;  5D83 A;  5KP4 A;  3LT9 A;  4N6V 0;  4HM1 B;  1DYU A;  1I2E A;  1RN7 A;  4EW5 A;  2D1W A;  2RGQ A;  1JB5 A;  1B2M A;  3LOY A;  2XEP A;  1RMS A;  2W6J H;  2ZL8 A;  5JPP A;  4NHF A;  4HM3 B;  2HMM B;  5JPU A;  2CG0 A;  1SJW A;  1IYY A;  3N54 B;  1GOY A;  2CWT A;  2JDI H;  3H3H A;  2IYJ A;  3HK4 A;  5JBS A;  5AIH A;  1CEW I;  3JUM A;  1PU4 A;  3AGN A;  2SAR A;  2F99 A;  2OOV C;  4LGQ A;  1LOV A;  3NBJ A;  4LSO A;  3EB8 A;  3CPO A;  1SAR A;  1ISK A;  1BAO A;  2R4I A;  3X40 A;  1EG9 B;  1FGQ A;  2GBX B;  3PCS A;  5IW9 A;  1I70 A;  3X42 A;  4CCV A;  1UDI I;  1QAF A;  2IMJ A;  3PZW A;  1JB4 A;  4OK0 A;  1MGR A;  1WMO A;  2ZHX B;  1GY6 A;  1OGZ A;  2XSO B;  2KCD A;  3HZP A;  2C11 A;  1TRQ A;  2CX0 A;  1YVB I;  1BOX A;  1BGS A;  1O7N B;  1LNH A;  3NQY A;  1MWR A;  2YFL B;  1RKY A;  1IVX A;  2GEY A;  3QK9 A;  4J8T A;  1RDS A;  1YIJ 3;  3SX1 A;  3CCU 3;  1RGH A;  1MWT A;  3KN4 A;  1G02 A;  3VF1 A;  2I9W A;  5IG4 A;  1B27 A;  2W56 B;  3N8B A;  1QJG A;  1JBS A;  1JB2 A;  3CNX A;  5BXQ A;  1BNR A;  1HKX A;  1IK3 A;  1WTH A;  3URP A;  2ZDJ A;  3KE7 A;  1A2P A;  1T3B A;  3GWR A;  4WYK B;  1IV7 A;  5G2G A;  4KFE A;  7RNT A;  2BHM A;  5EVH A;  3G6E 3;  2OTL 3;  1UW1 A;  3OWS A;  3BLZ A;  5A0O B;  5M1A A;  4HBR A;  3WHO A;  3X3X A;  4MEI A;  2XGL A;  1O7M B;  3JUP A;  1O7G B;  1IV9 A;  3HX8 A;  3K63 A;  2WGQ A;  1VQQ A;  3Q3F A;  4MMX B;  1B2X A;  1BNE A;  3RGA A;  1FGM A;  5IG5 A;  3CXC 2;  2P05 A;  1UI7 A;  3CCS 3;  1AVL A;  3HI7 A;  4I4K A;  2L4V A;  1UCI A;  4J9A A;  1W01 A;  1N8R 4;  3FZW A;  3KKG A;  1LQG C;  4HM6 B;  1R4C A;  1JNQ A;  1ZS7 A;  2STD A;  2CK3 H;  2CFG A;  2E2T A;  3BU4 A;  2KF4 A;  2PZV A;  3NXJ A;  3Q1C A;  5CF2 A;  1Q81 4;  2IY2 A;  3HII A;  1I0X A;  3KII A;  3MG1 A;  2JQ5 A;  3EBY A;  1RSN A;  4N6O B;  1TFO A;  3NM7 A;  1IDP A;  3S67 A;  4CPK A;  2KF6 A;  1RN4 A;  1ULJ B;  1UUG B;  1DET A;  2P0M A;  1AR0 A;  1B2S A;  1GD3 A;  2J8X B;  2HML B;  2Y73 A;  3GSP A;  2QIY A;  4G1M B;  1JBR A;  2WGO A;  1TRP A;  3D4A A;  4HM4 B;  4WP5 A;  3WA3 A;  2V1L A;  4L7K A;  4R4K A;  1BNI A;  3CCQ 3;  2XSH B;  4MMY B;  4IT7 A;  5CF1 A;  4KT3 B;  4X2H A;  1SPU A;  3BNB A;  1US1 A;  3T8N A;  5FGO A;  3WA2 X;  1VQO 3;  2Z77 A;  3SYU A;  2O3O A;  1TFK A;  1GMP A;  3AGO A;  2KRT A;  3T8U A;  3EN1 B;  1VQM 3;  1JBT A;  3SOA A;  5G1L A;  4WYK A;  1IVW A;  3J7Y d;  1NB3 I;  1ROV A;  2RFR A;  3UNL A;  4K61 A;  3ZG0 A;  2OCT A;  3JUO A;  1I3F A;  1O7P B;  5BVB A;  1VQ4 3;  7STD A;  1MOL A;  3WR2 A;  3MPH A;  3Q2P A;  1VZZ A;  4EYC A;  3IJE B;  5ELU A;  2E2U A;  4R9K A;  1Q40 B;  4K90 B;  5LC7 A;  1I0V A;  3VSY A;  1I2G A;  1RRL A;  5IG3 A;  3CME 3;  1NU3 A;  3DGL A;  3MSO A;  3SOY A;  4MMZ B;  1F8N A;  4HAA A;  1YGW A;  3LZA A;  3NX0 A;  3U97 A;  1CH0 A;  1YJN 3;  3LML A;  3F8H A;  1E3R A;  3M8C A;  5I97 A;  3DZL A;  1JJ2 2;  1BRN L;  1V74 A;  3I56 3;  1QVG 2;  1DVD A;  1FGO A;  2BMO B;  4XB5 A;  3N9H A;  1B2Z A;  4N6M A;  5IF6 A;  2OQE C;  1ROA A;  4OVM A;  1R4Y A;  2BIR A;  1MGW A;  1OPY A;  1YGE A;  2F86 B;  1NDO B;  1FGR A;  2W2C A;  3EBT A;  1RGF A;  3Q90 A;  4HVN A;  4HZB B;  2KXG A;  4N6L A;  1V57 A;  6GSP A;  1UGH I;  2MF7 A;  2W03 A;  3KSP A;  1BRG A;  1BSD A;  1I8V A;  5CLK A;  4K1V A;  1VQP 3;  5DRV A;  1BSB A;  1T2I A;  3GRD A;  1X1W A;  2QA4 3;  3A5E A;  4RZM A;  4N3V A;  2K0M A;  4LZI A;  2KAA A;  2XRX B;  3F40 A;  4WHA A;  1ULI B;  3T0U A;  3OXA A;  2IA7 A;  1KWI A;  1QMA A;  1RNB A;  4HJL B;  3NM2 A;  1G0T A;  2L1S A;  2CC3 A;  1N5H A;  2D42 A;  1JKG A;  2F4Y A;  2GU3 A;  3F8X A;  4HM2 B;  1TP6 A;  4ZM8 A;  4STD A;  1AY7 A;  2QGU A;  2OQE A;  2XH9 A;  3LXU X;  3MHE A;  6RNT A;  1N8Q A;  2F98 A;  4FMA A;  3LH4 A;  2ML5 A;  2Z6B A;  3HIG A;  4O3V A;  2RBI A;  1A2K A;  3EJV A;  1YJW 3;  2H0G A;  5CK6 A;  4GHO A;  2KF3 A;  4FMD A;  1GS3 A;  1LVN A;  1BNF A;  4O02 B;  5GSP A;  5RNT A;  4FCZ A;  1WMP A;  1K8A 4;  1GOU A;  4X2O A;  1STF I;  3S29 A;  3DUK A;  1ZX2 A;  1PY3 A;  3LYG A;  3KFQ C;  2GXF A;  2ML6 A;  4CDL A;  2Y74 A;  3D9R A;  3DM8 A;  1LOX A;  2RSX A;  2A15 A;  1OF5 A;  1X1Y A;  3FSD A;  3K9M C;  3RGR A;  2P38 A;  2Z76 A;  4HYZ A;  2OOV A;  2QEX 3;  3DGM A;  1IT8 A;  2BT3 A;  1DVC A;  1RNT A;  5DRE A;  5STD A;  5EEO A;  1YI2 3;  1RJO A;  3CU3 A;  3G16 A;  3O8Y A;  2F5M A;  1NJI 4;  2C10 A;  3KSE D;  4AEQ A;  3K0Z A;  1NB5 I;  5AII A;  2SBL A;  3AMO B;  4OUQ A;  2CWV A;  5FW5 A;  1LRA A;  3KZT A;  4FCM A;  1S5A A;  3EE1 A;  1GOV A;  1LXE A;  3B4O A;  2E2V A;  1RGK A;  4HOH A;  3FCS B;  2MC8 A;  1D6Y A;  3OWU A;  1NO3 A;  3EQQ B;  1W5Z A;  2IUK A;  1O7W B;  3NHX A;  1ZO2 A;  3DXO A;  5G1K A;  2OWP A;  1BNJ A;  1B3S A;  1AQZ A;  3G0K A;  4R80 A;  4FR9 A;  1QVF 2;  5AIG A;  4R9L A;  1GMQ A;  1IU7 A;  2C4B A;  4FMB A;  1W2B 2;  4GB5 A;  3F14 A;  2CH9 A;  1SII A;  4BL3 A;  4XBX A;  1Q7H A;  1QAK A;  1VQ9 3;  1QAL A;  1YIT 3;  3NV0 B;  4NRE A;  3BIR A;  3MKI A;  3FG1 A;  4BU4 A;  1KC8 4;  3D3L A;  1OHP A;  5TGN A;  1W2Z A;  2P0X A;  4GSP A;  5BU4 A;  1VQK 3;  2BO9 B;  5EQL A;  3E99 A;  4U13 A;  2W56 A;  1A90 A;  3LTA A;  2F5W A;  2CX1 A;  2M7O A;  1UCL A;  3CCL 3;  3OW2 2;  2YX9 A;  1YJ9 3;  5IEN A;  4QWT A;  3SVA A;  2P09 A;  3WMD A;  5AYR B;  3A76 A;  1EA2 A;  1KSI A;  5M19 A;  1WNH A;  4MJD A;  1RGE A;  1RGC A;  3AMO A;  4O8S A;  3TDG A;  1IQX A;  3MYT A;  3X3Z A;  3CCV 3;  3JUQ A;  3QRD A;  3EHC A;  1GY7 A;  3UL6 A;  1DE3 A;  3RNT A;  2CWU A;  2ZA4 A;  1CQS A;  4EV2 A;  1RGA A;  3K7C A;  1FUW A;  1DMN A;  1NNV A;  1A2V A;  1W6Y A;  5HGR A;  3B4P A;  4N6N B;  1SIH A;  4O2H A;  5AEW B;  1MNL A;  4TX4 A;  2B24 B;  1STD A;  1MWU A;  2GBW B;  1GY5 A;  1UGI A;  3AHW A;  4XDV A;  5KP1 A;  1LOY A;  1X1X A;  2INX A;  3DGY A;  3FF0 A;  3KCH A;  7GSP A;  1A67 A;  3BNC A;  1E97 A;  4HZ9 B;  3NV0 A;  3WOE B;  5D81 A;  1BRS A;  3DH2 A;  4IPB A;  1VQ7 3;  1FA3 A;  2CFD A;  9RNT A;  1YHQ 3;  3OX9 A;  3UB1 A;  2CFK A;  1B21 A;  1C7H A;  3H51 A;  1BRJ A;  3ALA A;  1W00 A;  3CCJ 3;  3LTD A;  3ROB A;  1GD4 A;  4ILF A;  2BNG A;  3EF8 A;  1I3I A;  4LMI A;  2CFW A;  1BSE A;  4BTX A;  1K73 4;  1G96 A;  1FZU A;  2F56 A;  3CPW 2;  2WOH A;  3PXM A;  4L8P A;  1E3V A;  3UJM A;  2AAD A;  1V58 A;  4RNZ A;  4AKZ A;  5M18 A;  2BU4 A;  1RGL A;  1N5P A;  4EBG A;  1D6U A;  4EV5 A;  1VQL 3;  2GSP A;  1Q40 A;  2PNC A;  4HKV B;  3S27 A;  1Q42 A;  3S28 A;  3CD6 3;  4XBY A;  4I5Q A;  3LTB A;  1EKM A;  3X41 A;  1U8C B;  1IVU A;  1N9E A;  3OV4 A;  2OTJ 3;  1MWS A;  1Q7Y 4;  1EEJ A;  2HMN B;  3HOH A;  1HZ1 A;  3GZR A;  1BVI A;  1I2F A;  1RCK A;  1RGG A;  3F9S A;  3PCR A;  4WWU C;  3V98 A;  1B20 A;  5CXO A;  8RNT A;  2XGN A;  2H0H A;  2RNT A;  4LEH A;  1T5Y A;  4RNT A;  4BTY A;  3IMA B;  2UGI A;  3RDE A;  1PYL A;  3DY5 A;  1VQN 3;  3WDG B;  4J5G A;  2FNQ A;  4Q53 A;  4R1K A;  4KVH A;  1OAC A;  2HMO B;  3NUV A;  4FCJ A;  4HM0 B;  4XDW A;  1RTU A;  3VGN A;  1RLS A;  1FW7 A;  1JZO A;  1N9J A;  2CIU A;  1BU4 A;  1JN5 B;  3MWZ A;  4JRF A;  3JVC A;  1K28 A;  1TTO A;  2BMQ B;  5LC6 A;  3F7X A;  2W0Q A;  4HM5 B;  4WFO A;  3U1W A;  3ZFZ A;  2IUJ A;  1EQK A;  3EC9 A;  1BUJ A;  5IEP A;  2K54 A;  3SLU A;  1JZD A;  3CCM 3;  1BSC A;  1FUS A;  1HU9 A;  4LYL B;  1M1K 4;  1Q9E A;  1UUV B;  4BTW A;  2HMK B;  1BNS A;  3D5G A;  2Z7A A;  4HM8 B;  2LYX A;  3PGB A;  4KZ1 A;  1UCK A;  3CCR 3;  1TU5 A;  3OWY A;  5IER A;  3FF2 A;  3PYJ A;  1YVS A;  4N6T A;  1OHO A;  4J5K A;  1AVK A;  1TIJ A;  4KFD A;  3DGN A;  5BIR A;  1HYF A;  1OCV A;  1Z1S A;  1W4N A;  1B2U A;  4H3U A;  5D82 A;  1WQL B;  1JRQ A;  3L0R A;  5AYS C;  3S5C A;  3WOF B;  1KD1 4;  2GU1 A;  3JUN A;  2WO0 A;  1W6G A;  3G8Z A;  4IIA A;  4BL2 A;  4RBN A;  5HOH A;  3I0Y A;  3NQZ A;  1BRK A;  2XFT A;  3ZG5 A;  3MG3 A;  1K41 A;  3LT8 A;  4H61 A;  4KFF A;  1T2H A;  4DKI A;  1Y4K A;  3CMA 3;  3CC4 3;  1RCL A;  1BAN A;  2RCD A;  2XFS A;  2AAE A;  2YFJ B;  1VQ6 3;  3ECF A;  1VQ8 3;  2GEX A;  3STD A;  1JV2 B;  1ASK A;  1JN5 A;  4PEJ A;  1U5O A;  2CFL A;  3SXX A;  4BIR A;  3UL5 A;  5ELJ A;  4XM4 A;  1OH0 A;  1J2B A;  1IT7 A;  3PS8 A;  2HOH A;  1DMM A;  1W7C A;  1X1U A;  3B8L A;  3FG4 A;  1W6C A;  1LQM B;  2FGT A;  3D5I A;  3V99 A;  3G4S 3;  5KP3 A;  2K3D A;  1BIR A;  4GL6 A;  1TJD A;  5AIF A;  1ZGX A;  4CJN A;  4EC6 A;  3I55 3;  1AV4 A;  1LOW A;  6STD A;  3DGO A;  3DMC A;  2YFI B;  1OHS A;  3NBB A;  1RN1 A;  4NPB A;  1FGT A;  1OUN A;  1BSA A;  3SED A;  3GZX B;  2Q07 A;  1KQS 2;  3F7S A;  1CYV A;  3BND A;  3CNM A;  3EN8 A;  2WOF A;  3AHS A;  3FKA A;  2W9Q A;  2KF5 A;  4K1U A;  1S72 3;  1PFP A;  3FLJ A;  4FMC A;  3G71 3;  3V92 A;  1TUH A;  1UUW B;  3MG2 A;  1EUI C;  1IQ8 A;  1SQW A;  2O9U X;  3ER7 A;  1UCJ A;  5AEU B;  1VQ5 3;  2CW9 A;  1C54 A;  1RRH A;  1LNI A;  3K5T A;  3GZY B;  1GYB A;  3EX9 A;  3FH1 A;  2CG1 A;  1M9G A;  4ORL A;  1FUT A;  2W04 A;  2UX0 A;  3X3Y A;  3LTC A;  3BB9 A;  3FG3 A;  1L5G B;  2BMR B;  1BRI A;  2R41 A;  2B1X B;  3B7C A;  4L8O A;  4RNY A;  1W02 A;  1YNV X;  2UUG C;  1JKG B;  1Q82 4;  5IG0 A;  1WMN A;  1RHL A;  3D79 A;  4HM7 B;  1CYU A;  1M1X B;  1D6Z A;  1DMQ A;  2H0I A;  2XF3 A;  4N6U A;  5AI1 A;  5IEO A;  4EXR A;  2CHC A;  3IPT A;  1FYS A;  1Q86 4;  4JF8 A;  4XBT A;  1UI8 A;  3FGY A;  1K9M 4;  8CHO A;  3NBR A;  1GSP A; 
#chains in the Genus database with same CATH homology
 1NWW A;  2HMJ B;  2XR8 B;  3CC2 3;  2CKF B;  3GZB A;  3GAX A;  2LQV A;  1IQY A;  1IVV A;  1OGX A;  2FXT A;  1M90 4;  1OF5 B;  2W9P A;  1O7H B;  3WOD G;  3CCE 3;  3BNE A;  4AKY A;  1BUQ A;  3CC7 3;  5D83 A;  5KP4 A;  3LT9 A;  4N6V 0;  4HM1 B;  1DYU A;  1RN7 A;  2D1W A;  2RGQ A;  1JB5 A;  3LOY A;  2XEP A;  2W6J H;  2ZL8 A;  5JPP A;  4NHF A;  4HM3 B;  2HMM B;  5JPU A;  2CG0 A;  1SJW A;  3N54 B;  2CWT A;  2JDI H;  3H3H A;  3HK4 A;  5JBS A;  5AIH A;  1CEW I;  3JUM A;  1PU4 A;  2F99 A;  2OOV C;  4LGQ A;  4LSO A;  3NBJ A;  3EB8 A;  3CPO A;  1ISK A;  2R4I A;  3X40 A;  1EG9 B;  1FGQ A;  2GBX B;  3PCS A;  5IW9 A;  3X42 A;  4CCV A;  1QAF A;  2IMJ A;  3PZW A;  1JB4 A;  4OK0 A;  1WMO A;  1GY6 A;  1OGZ A;  2XSO B;  2KCD A;  3HZP A;  2C11 A;  1YVB I;  1O7N B;  1LNH A;  3NQY A;  2YFL B;  1RKY A;  1IVX A;  2GEY A;  3QK9 A;  4J8T A;  1YIJ 3;  3SX1 A;  3CCU 3;  3KN4 A;  3VF1 A;  2I9W A;  5IG4 A;  2W56 B;  3N8B A;  1QJG A;  1JB2 A;  3CNX A;  5BXQ A;  1HKX A;  1IK3 A;  1WTH A;  2ZDJ A;  3KE7 A;  3GWR A;  4WYK B;  1IV7 A;  5G2G A;  4KFE A;  2BHM A;  5EVH A;  3G6E 3;  2OTL 3;  1UW1 A;  3OWS A;  3BLZ A;  5A0O B;  4HBR A;  3X3X A;  4MEI A;  2XGL A;  1O7M B;  3JUP A;  1O7G B;  1IV9 A;  3HX8 A;  3K63 A;  2WGQ A;  4MMX B;  3RGA A;  5IG5 A;  1FGM A;  3CXC 2;  2P05 A;  1UI7 A;  3CCS 3;  1AVL A;  3HI7 A;  4I4K A;  2L4V A;  4J9A A;  1W01 A;  1N8R 4;  3FZW A;  3KKG A;  4HM6 B;  1R4C A;  1JNQ A;  2STD A;  2CK3 H;  2CFG A;  2E2T A;  5CF2 A;  2PZV A;  3NXJ A;  3Q1C A;  1Q81 4;  3HII A;  3KII A;  3MG1 A;  2JQ5 A;  3EBY A;  4N6O B;  1TFO A;  3NM7 A;  1IDP A;  3S67 A;  1ULJ B;  2P0M A;  1AR0 A;  1GD3 A;  2HML B;  2Y73 A;  2QIY A;  4G1M B;  2WGO A;  4WP5 A;  4HM4 B;  3WA3 A;  2V1L A;  4L7K A;  4R4K A;  3CCQ 3;  2XSH B;  4MMY B;  4IT7 A;  5CF1 A;  3T8N A;  4X2H A;  1SPU A;  3BNB A;  1US1 A;  3WA2 X;  5FGO A;  1VQO 3;  2Z77 A;  1VQM 3;  2O3O A;  1TFK A;  3T8U A;  2KRT A;  3EN1 B;  3SOA A;  4WYK A;  1IVW A;  3J7Y d;  1NB3 I;  1ROV A;  2RFR A;  3UNL A;  4K61 A;  2OCT A;  3JUO A;  1O7P B;  5BVB A;  1VQ4 3;  7STD A;  1MOL A;  3MPH A;  3Q2P A;  1VZZ A;  4EYC A;  3IJE B;  5ELU A;  2E2U A;  4R9K A;  1Q40 B;  4K90 B;  5LC7 A;  3VSY A;  1RRL A;  5IG3 A;  3CME 3;  1NU3 A;  3DGL A;  3MSO A;  3SOY A;  4MMZ B;  1F8N A;  3LZA A;  3NX0 A;  3U97 A;  1YJN 3;  3LML A;  3F8H A;  1E3R A;  3M8C A;  5I97 A;  3DZL A;  1JJ2 2;  1V74 A;  3I56 3;  1QVG 2;  1DVD A;  1FGO A;  2BMO B;  4XB5 A;  3N9H A;  4N6M A;  5IF6 A;  2OQE C;  1ROA A;  4OVM A;  1OPY A;  1YGE A;  2W2C A;  2F86 B;  1NDO B;  1FGR A;  3EBT A;  4HVN A;  3Q90 A;  4HZB B;  4N6L A;  2KXG A;  2MF7 A;  2W03 A;  3KSP A;  5CLK A;  4K1V A;  1VQP 3;  5DRV A;  3GRD A;  2QA4 3;  4RZM A;  4N3V A;  2K0M A;  4LZI A;  2XRX B;  3F40 A;  4WHA A;  1ULI B;  3T0U A;  3OXA A;  2IA7 A;  1KWI A;  1QMA A;  4HJL B;  3NM2 A;  2CC3 A;  1N5H A;  2D42 A;  1JKG A;  2GU3 A;  3F8X A;  4HM2 B;  1TP6 A;  4ZM8 A;  4STD A;  2QGU A;  2OQE A;  2XH9 A;  3LXU X;  3MHE A;  1N8Q A;  2F98 A;  4FMA A;  3LH4 A;  2ML5 A;  2Z6B A;  3HIG A;  4O3V A;  1A2K A;  3EJV A;  1YJW 3;  5CK6 A;  4FMD A;  1GS3 A;  1LVN A;  4O02 B;  4FCZ A;  1WMP A;  1K8A 4;  3S29 A;  4X2O A;  1STF I;  3DUK A;  1ZX2 A;  3LYG A;  3KFQ C;  2GXF A;  2ML6 A;  4CDL A;  2Y74 A;  3D9R A;  3DM8 A;  1LOX A;  2RSX A;  2A15 A;  1OF5 A;  3FSD A;  3K9M C;  3RGR A;  2P38 A;  2Z76 A;  4HYZ A;  2OOV A;  2QEX 3;  3DGM A;  1IT8 A;  2BT3 A;  1DVC A;  5DRE A;  5STD A;  5EEO A;  1YI2 3;  1RJO A;  3CU3 A;  3G16 A;  3O8Y A;  1NJI 4;  2C10 A;  3KSE D;  4AEQ A;  3K0Z A;  1NB5 I;  5AII A;  2SBL A;  3AMO B;  4OUQ A;  2CWV A;  5FW5 A;  3KZT A;  4FCM A;  1S5A A;  3EE1 A;  1LXE A;  3B4O A;  2E2V A;  2MC8 A;  3FCS B;  1D6Y A;  3OWU A;  1NO3 A;  3EQQ B;  1W5Z A;  2IUK A;  1O7W B;  3NHX A;  1ZO2 A;  3DXO A;  2OWP A;  4R80 A;  3G0K A;  4FR9 A;  1QVF 2;  5AIG A;  4R9L A;  1IU7 A;  4FMB A;  1W2B 2;  4GB5 A;  3F14 A;  2CH9 A;  1SII A;  4XBX A;  1QAK A;  1VQ9 3;  1QAL A;  1YIT 3;  3NV0 B;  4NRE A;  3MKI A;  3FG1 A;  1KC8 4;  3D3L A;  1OHP A;  5TGN A;  1W2Z A;  2P0X A;  1VQK 3;  2BO9 B;  5EQL A;  3E99 A;  4U13 A;  2W56 A;  1A90 A;  3LTA A;  2M7O A;  3CCL 3;  3OW2 2;  2YX9 A;  1YJ9 3;  5IEN A;  4QWT A;  3SVA A;  2P09 A;  3WMD A;  5AYR B;  3A76 A;  1EA2 A;  1KSI A;  1WNH A;  4MJD A;  3AMO A;  4O8S A;  3TDG A;  1IQX A;  3MYT A;  3X3Z A;  3CCV 3;  3JUQ A;  3QRD A;  3EHC A;  1GY7 A;  3UL6 A;  2CWU A;  1CQS A;  4EV2 A;  3K7C A;  1FUW A;  1DMN A;  1A2V A;  1W6Y A;  5HGR A;  3B4P A;  4N6N B;  1SIH A;  4O2H A;  5AEW B;  1MNL A;  4TX4 A;  2B24 B;  1STD A;  2GBW B;  1GY5 A;  5KP1 A;  4XDV A;  2INX A;  1A67 A;  3FF0 A;  3BNC A;  1E97 A;  4HZ9 B;  3NV0 A;  3WOE B;  5D81 A;  4IPB A;  1VQ7 3;  1FA3 A;  2CFD A;  1YHQ 3;  3OX9 A;  3UB1 A;  2CFK A;  1C7H A;  3H51 A;  3ALA A;  1W00 A;  3CCJ 3;  3LTD A;  3ROB A;  1GD4 A;  2BNG A;  3EF8 A;  4LMI A;  2CFW A;  4BTX A;  1K73 4;  1G96 A;  3CPW 2;  2WOH A;  3PXM A;  4L8P A;  1E3V A;  3UJM A;  4RNZ A;  4AKZ A;  1N5P A;  4EBG A;  1D6U A;  4EV5 A;  1VQL 3;  2PNC A;  1Q40 A;  4HKV B;  3S27 A;  3S28 A;  1Q42 A;  3CD6 3;  4XBY A;  3LTB A;  1EKM A;  3X41 A;  1U8C B;  1IVU A;  1N9E A;  3OV4 A;  2OTJ 3;  1Q7Y 4;  2HMN B;  3GZR A;  4WWU C;  3PCR A;  3F9S A;  3V98 A;  5CXO A;  2XGN A;  4LEH A;  1T5Y A;  4BTY A;  3IMA B;  3RDE A;  3DY5 A;  1VQN 3;  3WDG B;  4R1K A;  2FNQ A;  4Q53 A;  4KVH A;  1OAC A;  2HMO B;  3NUV A;  4FCJ A;  4HM0 B;  4XDW A;  3VGN A;  1N9J A;  2CIU A;  1JN5 B;  3MWZ A;  4JRF A;  3JVC A;  1K28 A;  2BMQ B;  5LC6 A;  3F7X A;  2W0Q A;  4HM5 B;  4WFO A;  3U1W A;  2IUJ A;  1EQK A;  3EC9 A;  5IEP A;  2K54 A;  3SLU A;  3CCM 3;  1M1K 4;  1HU9 A;  1UUV B;  4BTW A;  2HMK B;  2Z7A A;  4HM8 B;  2LYX A;  3PGB A;  4KZ1 A;  3CCR 3;  1TU5 A;  3OWY A;  5IER A;  3FF2 A;  3PYJ A;  4N6T A;  1OHO A;  1AVK A;  1TIJ A;  4KFD A;  3DGN A;  1OCV A;  1W4N A;  1Z1S A;  4H3U A;  5D82 A;  5AYS C;  1WQL B;  1JRQ A;  3L0R A;  3S5C A;  3WOF B;  1KD1 4;  2GU1 A;  3JUN A;  2WO0 A;  1W6G A;  3G8Z A;  4IIA A;  4RBN A;  3I0Y A;  3NQZ A;  2XFT A;  3MG3 A;  1K41 A;  3LT8 A;  4H61 A;  4KFF A;  1Y4K A;  3CMA 3;  3CC4 3;  2RCD A;  2XFS A;  2YFJ B;  1VQ6 3;  3ECF A;  1VQ8 3;  2GEX A;  3STD A;  1JV2 B;  1ASK A;  1JN5 A;  4PEJ A;  1U5O A;  2CFL A;  3SXX A;  3UL5 A;  5ELJ A;  4XM4 A;  1OH0 A;  1J2B A;  1IT7 A;  3PS8 A;  1DMM A;  1W7C A;  3B8L A;  3FG4 A;  1W6C A;  2FGT A;  3V99 A;  3G4S 3;  5KP3 A;  4GL6 A;  5AIF A;  3I55 3;  4EC6 A;  1AV4 A;  6STD A;  3DGO A;  3DMC A;  2YFI B;  1OHS A;  3NBB A;  1FGT A;  1OUN A;  3SED A;  3GZX B;  2Q07 A;  1KQS 2;  3F7S A;  1CYV A;  3BND A;  3CNM A;  3EN8 A;  2WOF A;  3FKA A;  4K1U A;  2W9Q A;  1S72 3;  1PFP A;  3FLJ A;  4FMC A;  3G71 3;  3V92 A;  1TUH A;  1UUW B;  3MG2 A;  1IQ8 A;  1SQW A;  2O9U X;  3ER7 A;  5AEU B;  1VQ5 3;  2CW9 A;  1RRH A;  3K5T A;  2CG1 A;  3GZY B;  1GYB A;  3EX9 A;  3FH1 A;  1M9G A;  4ORL A;  2W04 A;  2UX0 A;  3X3Y A;  3LTC A;  3BB9 A;  3FG3 A;  1L5G B;  2BMR B;  2B1X B;  3B7C A;  4L8O A;  4RNY A;  1W02 A;  1JKG B;  1Q82 4;  5IG0 A;  1WMN A;  4HM7 B;  1CYU A;  1M1X B;  1D6Z A;  1DMQ A;  2XF3 A;  5AI1 A;  4N6U A;  5IEO A;  4EXR A;  2CHC A;  3IPT A;  1Q86 4;  4JF8 A;  4XBT A;  1UI8 A;  3FGY A;  1K9M 4;  8CHO A;  3NBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...