1JJ22

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jj2200
1KC84 1YJN3 1S723 3CC43 3CMA3 3CCR3 1YJ93 1N8R4 1VQ53 1YHQ3 2OTL3 1VQO3 1KQS2 1W2B2 1VQ73 3OW22 1Q7Y4 3CCM3 1VQL3 1Q814 3CXC2 3CPW2 3G4S3 3G713 1VQ93 3CC23 3CCL3 2QA43 1VQK3 3G6E3 1K8A4 3CCU3 3CCJ3 1YJW3 1KD14 3CC73 1M904 1VQ43 2QEX3 1JJ22 3CCE3 3CME3 1M1K4 1YI23 1VQN3 1K734 1YIT3 1Q864 3I553 1QVF2 1VQ63 1YIJ3 2OTJ3 1K9M4 1QVG2 1NJI4 3I563 3CCV3 1VQM3 1Q824 1VQP3 3CD63 1VQ83 3CCS3 3CCQ3
chains in the Genus database with same CATH superfamily
1GS3A 1YJN3 3F7SA 4Q53A 4HM0B 1N8R4 3DH2A 3UNLA 3D9RA 2MC8A 3ER7A 2XRXB 5IERA 1KWIA 1TUHA 3NM7A 4N6NB 1CYVA 5IF6A 3CPW2 4KFFA 1X1UA 1OGXA 3HOHA 1DETA 3DMCA 4HYZA 5ELUA 1W6YA 5JPPA 1J2BA 3F40A 3WA2X 1M904 4FMAA 1HZ1A 4G1MB 1VQ43 5BXQA 3VGNA 4HM2B 4ORLA 1SPUA 1TP6A 4K1VA 5G2GA 1QVF2 1O7NB 1IDPA 3FLJA 3HI7A 1RHLA 2A15A 1BVIA 1M9GA 2CWVA 2P05A 3FF2A 3EBTA 3FH1A 3MG1A 1I2GA 1I0VA 2KXGA 2RFRA 3KSED 1BRJA 1OF5B 4N6OB 2AADA 5EQLA 7STDA 3S27A 4NPBA 1I70A 3EN1B 1YVSA 3OXAA 1BRNL 4LEHA 4BIRA 1TRQA 3FGYA 3NQZA 5DREA 1A90A 1K28A 1VZZA 1R4YA 3DGMA 4RNZA 1JKGB 1BSEA 1NU3A 3F8XA 3CC23 1ZO2A 1T3BA 3B4PA 4R80A 2CHCA 2YX9A 1LOXA 4EC6A 1WNHA 2BT3A 2K3DA 1AY7A 3RGRA 5IENA 3AGOA 2O3OA 1Q40B 1M1K4 4HZBB 2RBIA 3JUNA 2SBLA 1EUIC 1MWTA 3H3HA 4HJLB 3KE7A 3ZFZA 3I563 1Y4KA 1US1A 1SQWA 3CNMA 3JUOA 1RN7A 3DGOA 3RDEA 3CCS3 1GY6A 3CCQ3 3LTCA 4HBRA 3GZBA 4J8TA 1YJ93 1VQ53 1VQQA 4O3VA 3V98A 3WMDA 3X41A 3F7XA 2GBXB 2F5WA 1FUSA 1W2ZA 2RCDA 1DMNA 3JUQA 7RNTA 1VQL3 1IVWA 1OPYA 1YGEA 1IQYA 1RSNA 1RDSA 3PS8A 1VQK3 1IT7A 2XSHB 3K5TA 5KP1A 3H51A 3SXXA 1YVBI 1IQ8A 3BNCA 4OVMA 4FMBA 2CFGA 4AKZA 1GMRA 3O8YA 2QIYA 2CG0A 1BNJA 4FCZA 1YIJ3 1IU7A 3HZPA 1LNIA 2STDA 1UCLA 3ECFA 4HKVB 3SYUA 1IV9A 1BRKA 2CWTA 3B8LA 2KF6A 4ZM8A 3SX1A 1NB5I 1PYLA 3WOEB 3GAXA 4J5KA 1TU5A 1T5YA 3LTDA 1E3RA 1VQ73 1SIIA 2XH9A 3OW22 1Q7Y4 2CH9A 1CEWI 2JDIH 3GSPA 2E2VA 2XGLA 3MG2A 3EF8A 4XBXA 3WR2A 5AI1A 1A2VA 3X42A 3WHOA 2IUJA 4K90B 1JZOA 2KCDA 3T8UA 1W01A 2GU3A 2I9WA 5D83A 5I97A 2Z7AA 1U5OA 3EN8A 3EB8A 1JB4A 1TJDA 5KP4A 3I553 2LQVA 1AVKA 1I3IA 2OCTA 4BU4A 1LNHA 2OTJ3 2H0GA 3KFQC 3UB1A 4AEQA 1QVG2 1SARA 2M7OA 2PNCA 2CWUA 1FGRA 1BUJA 4BL2A 2HMMB 2Y73A 1BRIA 3CPOA 3DM8A 3LMLA 4HZ9B 4IPBA 5ELJA 1OF5A 3CCR3 3CMA3 2WOFA 8RNTA 1BUQA 3EBYA 1RKYA 1AVLA 2CW9A 1Q814 3LTAA 2QA43 1BRSA 1IV7A 1JKGA 2BMRB 2OQEC 2P09A 3LYGA 4K1UA 4XBTA 1C7HA 1V74A 4L8OA 5CLKA 1O7WB 3BNDA 3FG1A 3NM2A 1FUWA 1JJ22 1GY5A 1HKXA 4H3UA 1TTOA 2ZA4A 2Q07A 3NV0B 4N6V0 3U1WA 1RN1A 3CNXA 3B7CA 1Q40A 1UCKA 1N8QA 1FZUA 1LOWA 5AIGA 1A2KA 1UUVB 1G96A 2F4YA 5M19A 1W5ZA 3JUPA 4CJNA 1UCIA 1DMMA 5G1KA 2Z6BA 2XGNA 1WMPA 3GZYB 4MMXB 1IK3A 2D1WA 3F8HA 2CG1A 1GY7A 2C11A 2ZDJA 3VSYA 3J7Yd 2P0MA 4EBGA 3EX9A 4N6TA 4R4KA 3SLUA 1LXEA 3G0KA 2AAEA 2CIUA 5D82A 3N8BA 3HX8A 1JB2A 1FYSA 3K7CA 2HMJB 3EQQB 3ZG5A 3AHWA 4LZIA 7GSPA 1NWWA 1UGHI 2BHMA 4R9LA 1S5AA 1ISKA 1JN5A 3BIRA 1N9JA 3WA3A 3AMOB 1OGZA 2XFSA 6GSPA 1VQP3 2F56A 5IG5A 3WODG 1BSCA 3X3ZA 3MKIA 4HVNA 2KF5A 1BRGA 1I3FA 1OACA 3T8NA 3SVAA 3X3YA 2CFLA 3F14A 3D5GA 1EA2A 2KF3A 3ALAA 1I2EA 3OV4A 5AYSC 5LC7A 2WO0A 4RNYA 4CCVA 1VQ93 1V58A 2BNGA 3GZRA 3RGAA 1W02A 1DVDA 3MHEA 4EV2A 1B2XA 3Q90A 1NNVA 1O7GB 1R4CA 4K61A 1O7HB 4GL6A 4WP5A 2HMLB 3B4OA 3S29A 1EEJA 1MOLA 2L4VA 3BLZA 4TX4A 4BTXA 3CME3 4R9KA 3FCSB 1OHOA 3FSDA 2GEXA 2HMKB 1VQ63 3GWRA 2E2UA 1FGTA 4HM7B 3BU4A 1T2HA 2C4BA 2WGOA 2E2TA 3S67A 1NDOB 5M18A 4N3VA 1ASKA 4LMIA 1BOXA 2OTL3 1LVNA 2BO9B 1VQO3 5AYRB 5BIRA 1MWSA 2GEYA 1NB3I 1CQSA 3LH4A 5IEOA 3G4S3 5CF2A 3CCL3 1RMSA 1RNTA 3KIIA 6STDA 1G0TA 1A2PA 1PU4A 3RNTA 5M1AA 1JN5B 2CFDA 1GOYA 2IY2A 1CH0A 1W6GA 2IA7A 1RGFA 3NBJA 4FR9A 4XDVA 1YI23 4LGQA 2CX0A 1RGHA 4N6UA 1BANA 3NV0A 3ROBA 2OWPA 3BNEA 1D6UA 5LC6A 1F8NA 1VQM3 2YFJB 2ZHXB 4QWTA 2F99A 3DUKA 3ZG0A 1W4NA 1D6YA 1RCLA 3D3LA 1OCVA 3CXC2 4BTWA 1BNRA 2XFTA 4L8PA 4GSPA 3X3XA 2W56B 1SJWA 1E97A 2IMJA 2YFLB 3SOYA 5A0OB 3PXMA 5EVHA 1UI8A 8CHOA 2L1SA 2KRTA 3D5IA 2RGQA 1EG9B 2KF4A 3JUMA 4XDWA 1BNIA 1IT8A 3LOYA 4HM1B 4OK0A 3DGLA 1B27A 2C10A 2GSPA 3G8ZA 1O7PB 1RGAA 1GMQA 3CCV3 4BL3A 4WYKB 5IG0A 3DY5A 3VF1A 3IMAB 1B2SA 3MG3A 3QRDA 3AMOA 1BNFA 2W9QA 2WOHA 1DVCA 3CCU3 1X1XA 2IYJA 3MWZA 1W7CA 4I5QA 5TGNA 3HIGA 1JRQA 1WMNA 5KP3A 4EYCA 2Z77A 1I0XA 3DXOA 4HM5B 2INXA 3FZWA 1JV2B 4JRFA 1AR0A 4L7KA 3S5CA 4I4KA 4STDA 3CCJ3 1KD14 3F9SA 4J9AA 1LQMB 1UW1A 4WWUC 4MEIA 3LXUX 2GU1A 4HM4B 1BSAA 4X2HA 5FGOA 1YIT3 1K734 1GYBA 3MPHA 2W2CA 3FF0A 1FA3A 3KN4A 2BIRA 1B2UA 1OHSA 1RGKA 2OOVA 4KFEA 5IEPA 1KSIA 1WMOA 2BMQB 2SARA 4HOHA 2H0IA 3EE1A 4RNTA 3UJMA 1IVXA 1YNVX 3URPA 1RGGA 4MMYB 1BNEA 2R41A 5BVBA 4LYLB 1I8VA 2F5MA 3OWSA 1YHQ3 1G02A 2F86B 2CFKA 2J8XB 3NBRA 1K41A 2XR8B 1B20A 3CCM3 1BAOA 4WFOA 1QALA 2HMOB 1UDII 2MF7A 3NX0A 3WOFB 3DGYA 3BNBA 1V57A 5IG4A 1YJW3 4XBYA 4ILFA 1GOUA 2CFWA 1YGWA 3I0YA 1RLSA 1ZGXA 4LSOA 4PEJA 4CPKA 2QEX3 2BMOB 3EHCA 4HM6B 1Q864 1M1XB 1EQKA 3STDA 9RNTA 2RSXA 3N54B 3NHXA 3HK4A 2O9UX 3L0RA 1LQGC 5GSPA 1X1YA 3FG3A 4BTYA 5G1LA 2XSOB 1KC84 1IVVA 1TRPA 3T0UA 1HYFA 3TDGA 1GSPA 4JF8A 1UGIA 3K63A 1ULJB 4KFDA 1ROAA 2UGIA 5AIHA 1CYUA 1I2FA 1MWUA 1U8CB 2XEPA 1BIRA 1FUTA 1ROVA 2H0HA 3NUVA 1N9EA 1D6ZA 2HOHA 4FMDA 2B24B 2R4IA 1GD4A 2FXTA 2W0QA 2W56A 3EJVA 1JBRA 4EW5A 4GB5A 2K0MA 3MYTA 1UUWB 2WGQA 5CF1A 1O7MB 3AGNA 4O8SA 1K9M4 3UL6A 4HM8B 3CD63 1AQZA 3NBBA 5JBSA 1B2ZA 2B1XB 4WYKA 1FGQA 3CU3A 3HIIA 1W2B2 3SEDA 3NXJA 1TIJA 3Q3FA 2OOVC 1RGLA 2PZVA 4H61A 5BU4A 4KT3B 3V92A 3D79A 4CDLA 1UCJA 4NREA 1Z1SA 1B3SA 5FW5A 3OWYA 4XB5A 2UX0A 3BB9A 1MGWA 3M8CA 4N6MA 1AV4A 2GXFA 1RRLA 1QJGA 4NHFA 1GD3A 2UUGC 1FGOA 1IYYA 1PFPA 4MMZB 1QMAA 3DZLA 3OWUA 1OUNA 2RNTA 4OUQA 4R1KA 1UI7A 1C54A 1BNSA 1RTUA 1MNLA 4J5GA 2OQEA 4EV5A 1ZS7A 3IJEB 5AIFA 4O02B 4DKIA 1E3VA 2W9PA 1UUGB 3KSPA 1LOYA 4XM4A 1SIHA 1HU9A 1GMPA 2P38A 3FG4A 4U13A 3V99A 1FGMA 3PCSA 1Q42A 3E99A 3G6E3 2W04A 1QAKA 1MGRA 4RZMA 3K0ZA 3LZAA 2Z76A 3KKGA 4GHOA 2QGUA 4AKYA 1MWRA 5IG3A 1DE3A 2V1LA 3SOAA 3KZTA 4RBNA 1JBSA 4IT7A 3LT8A 3GZXB 5STDA 1GOVA 3LT9A 1X1WA 1Q9EA 1OHPA 1RN4A 1STFI 2CX1A 3OX9A 1BNGA 5D81A 5EEOA 3U97A 1RNBA 1RJOA 3NQYA 1VQ83 1JNQA 1IVUA 2F98A 2JQ5A 4EXRA 1N5PA 5AEUB 5HOHA 2HMNB 1W00A 3X40A 3CC43 3A5EA 3IPTA 5RNTA 1L5GB 1LOVA 1KQS2 1LRAA 4FMCA 1BSBA 1EKMA 1DMQA 1RRHA 3D4AA 2K54A 2KAAA 2W6JH 1BSDA 1W6CA 3K9MC 3QK9A 4IIAA 2P0XA 4O2HA 2ML6A 4FCJA 3MSOA 2Y74A 3CC73 1B2MA 1ZX2A 1WTHA 1NO3A 1TFKA 1BRHA 2CC3A 2IUKA 2GBWB 2W03A 1VQN3 1T2IA 1RGEA 2FGTA 2CKFB 1PY3A 2FNQA 3PZWA 1FW7A 2ML5A 5CK6A 4FCMA 1IQXA 2BU4A 1Q824 3JVCA 3CCE3 4MJDA 3DGNA 1JB5A 1RCKA 2LYXA 1S723 1B21A 5HGRA 4HAAA 1QAFA 2YFIB 1Q7HA 3PCRA 5CXOA 1N5HA 1ULIB 1BU4A 3EC9A 1JBTA 1STDA 4HM3B 1DYUA 1RGCA 3Q1CA 1A67A 2ZL8A 3G713 2XF3A 3AHSA 5AIIA 5AEWB 3A76A 1K8A4 4N6LA 5JPUA 4KVHA 3LTBA 3S28A 2D42A 1OH0A 2CK3H 3G16A 3KCHA 3GRDA 4KZ1A 1JZDA 5IW9A 3WDGB 4WHAA 3PGBA 3N9HA 1BGSA 4X2OA 5DRVA 1NJI4 3PYJA 3UL5A 1WQLB 3FKAA 3Q2PA 6RNTA 1TFOA
chains in the Genus database with same CATH topology
1GS3A 1YJN3 3F7SA 4Q53A 4HM0B 1N8R4 3UNLA 3D9RA 2MC8A 3ER7A 2XRXB 5IERA 1KWIA 1TUHA 3NM7A 4N6NB 1CYVA 5IF6A 3CPW2 4KFFA 1OGXA 4HYZA 3DMCA 5ELUA 1J2BA 1W6YA 5JPPA 3F40A 3WA2X 1M904 4FMAA 4G1MB 1VQ43 5BXQA 3VGNA 4HM2B 4ORLA 1SPUA 1TP6A 4K1VA 5G2GA 1QVF2 1O7NB 1IDPA 3FLJA 3HI7A 2A15A 5FGOA 3FF2A 1M9GA 2CWVA 2P05A 3FH1A 3EBTA 3MG1A 2KXGA 2RFRA 3KSED 1OF5B 4N6OB 5EQLA 7STDA 3S27A 3EN1B 3OXAA 4LEHA 3FGYA 3NQZA 5DREA 1A90A 1K28A 1VZZA 3DGMA 4RNZA 1JKGB 1NU3A 3F8XA 3CC23 1ZO2A 3B4PA 4R80A 2CHCA 2YX9A 1LOXA 4EC6A 1WNHA 2BT3A 3RGRA 5IENA 2O3OA 1Q40B 1M1K4 4HZBB 3JUNA 2SBLA 3H3HA 4HJLB 3KE7A 3I563 1Y4KA 1US1A 1SQWA 3CNMA 3JUOA 1RN7A 3DGOA 3RDEA 3CCS3 1GY6A 3CCQ3 3LTCA 4HBRA 3GZBA 4J8TA 1YJ93 1VQ53 4O3VA 3V98A 3WMDA 3X41A 3F7XA 2GBXB 3JUQA 1W2ZA 2RCDA 1DMNA 1VQL3 1IVWA 1OPYA 1YGEA 1IQYA 3PS8A 1VQK3 1IT7A 2XSHB 3K5TA 5KP1A 3H51A 3SXXA 1YVBI 1IQ8A 3BNCA 4OVMA 4FMBA 2CFGA 4AKZA 3O8YA 2QIYA 2CG0A 4FCZA 1YIJ3 1IU7A 3HZPA 2STDA 3ECFA 4HKVB 1IV9A 2CWTA 3B8LA 4ZM8A 3SX1A 1NB5I 3WOEB 3GAXA 1TU5A 1T5YA 3LTDA 1E3RA 1VQ73 1SIIA 2XH9A 3OW22 1Q7Y4 2CH9A 1CEWI 2JDIH 3X42A 2E2VA 2XGLA 3MG2A 3EF8A 4XBXA 5AI1A 1A2VA 2IUJA 4K90B 2KCDA 3T8UA 1W01A 2GU3A 2I9WA 5D83A 5I97A 2Z7AA 1U5OA 3EN8A 3EB8A 1JB4A 5KP4A 3I553 2LQVA 1AVKA 2OCTA 1LNHA 2OTJ3 3KFQC 3UB1A 4AEQA 1QVG2 2M7OA 2PNCA 2CWUA 1FGRA 2HMMB 2Y73A 3DM8A 3CPOA 3LMLA 4HZ9B 4IPBA 5ELJA 3CCR3 1OF5A 3CMA3 2WOFA 1BUQA 3EBYA 1RKYA 1AVLA 2CW9A 1Q814 3LTAA 2QA43 1JKGA 1IV7A 2BMRB 2OQEC 4K1UA 2P09A 3LYGA 4XBTA 5CLKA 1C7HA 1V74A 4L8OA 3CCU3 1O7WB 3BNDA 3FG1A 3NM2A 1FUWA 1JJ22 1GY5A 1HKXA 4H3UA 2Q07A 3NV0B 4N6V0 3U1WA 3CNXA 3B7CA 1Q40A 1N8QA 5AIGA 1A2KA 1UUVB 1G96A 1W5ZA 3JUPA 1DMMA 2Z6BA 2XGNA 1WMPA 3GZYB 4MMXB 1IK3A 2D1WA 3F8HA 2CG1A 1GY7A 2C11A 2ZDJA 3VSYA 3J7Yd 2P0MA 4EBGA 3EX9A 4N6TA 4R4KA 3SLUA 1LXEA 3G0KA 2CIUA 5D82A 3N8BA 3HX8A 1JB2A 3K7CA 2HMJB 3EQQB 4LZIA 1NWWA 2BHMA 4R9LA 1S5AA 1ISKA 1JN5A 1N9JA 3WA3A 3AMOB 1OGZA 2XFSA 1VQP3 5IG5A 3WODG 3X3ZA 3MKIA 4HVNA 3T8NA 1OACA 3X3YA 3SVAA 2CFLA 3F14A 1EA2A 3OV4A 3ALAA 5AYSC 5LC7A 2WO0A 4RNYA 4CCVA 1VQ93 2BNGA 3GZRA 3RGAA 1W02A 1DVDA 3MHEA 4EV2A 3Q90A 1O7GB 1R4CA 4K61A 1O7HB 4GL6A 4WP5A 2HMLB 3B4OA 3S29A 4TX4A 1MOLA 2L4VA 3BLZA 4BTXA 3CME3 4R9KA 3FCSB 1OHOA 3FSDA 2GEXA 2HMKB 1VQ63 3GWRA 2E2UA 1FGTA 4HM7B 2WGOA 2E2TA 3S67A 1NDOB 4N3VA 1ASKA 4LMIA 2OTL3 1LVNA 2BO9B 1VQO3 5AYRB 2GEYA 1NB3I 1CQSA 3LH4A 5IEOA 3G4S3 5CF2A 3CCL3 3KIIA 6STDA 1PU4A 1JN5B 2CFDA 3CCE3 1W6GA 2IA7A 3NBJA 1YI23 4FR9A 4XDVA 4LGQA 4N6UA 3NV0A 1VQM3 3ROBA 2OWPA 3BNEA 1D6UA 5LC6A 1F8NA 2YFJB 4QWTA 2F99A 3DUKA 1W4NA 1D6YA 3D3LA 1OCVA 3CXC2 4BTWA 2XFTA 4L8PA 3X3XA 2W56B 1SJWA 1E97A 2IMJA 2YFLB 3SOYA 5A0OB 3PXMA 5EVHA 1UI8A 8CHOA 2KRTA 2RGQA 1EG9B 3JUMA 4XDWA 1IT8A 3LOYA 4HM1B 4OK0A 3DGLA 2C10A 3G8ZA 1O7PB 3CCV3 4WYKB 5IG0A 3DY5A 3VF1A 3IMAB 3MG3A 3QRDA 3AMOA 2W9QA 2WOHA 1DVCA 3MWZA 1W7CA 5TGNA 3HIGA 1JRQA 1WMNA 5KP3A 4EYCA 2Z77A 3DXOA 4HM5B 2INXA 3FZWA 1JV2B 4JRFA 1AR0A 4L7KA 3S5CA 4I4KA 4STDA 3CCJ3 1KD14 3F9SA 4J9AA 1UW1A 4WWUC 4MEIA 3LXUX 2GU1A 4HM4B 4X2HA 1K734 1YIT3 1GYBA 3MPHA 2W2CA 3FF0A 1FA3A 3KN4A 1OHSA 5IEPA 2OOVA 4KFEA 1KSIA 1WMOA 2BMQB 3UJMA 3EE1A 1IVXA 4MMYB 5BVBA 3OWSA 1YHQ3 2F86B 2CFKA 3NBRA 1K41A 2XR8B 3CCM3 4WFOA 1QALA 2HMOB 2MF7A 3NX0A 3WOFB 3BNBA 1YJW3 5IG4A 4XBYA 2CFWA 3I0YA 2QEX3 4LSOA 4PEJA 2BMOB 3EHCA 4HM6B 1Q864 1M1XB 1EQKA 3STDA 2RSXA 3N54B 3NHXA 3HK4A 2O9UX 3L0RA 3FG3A 4BTYA 2XSOB 1KC84 1IVVA 3T0UA 3TDGA 4JF8A 3K63A 1ULJB 4KFDA 1ROAA 1CYUA 5AIHA 1U8CB 2XEPA 1ROVA 3NUVA 1N9EA 1D6ZA 4FMDA 2B24B 2R4IA 1GD4A 2FXTA 2W0QA 2W56A 3EJVA 4GB5A 2K0MA 3MYTA 1UUWB 2WGQA 5CF1A 1O7MB 4O8SA 1K9M4 3UL6A 4HM8B 3CD63 3NBBA 5JBSA 2B1XB 4WYKA 1FGQA 3CU3A 3HIIA 1W2B2 3SEDA 3NXJA 1TIJA 2OOVC 2PZVA 4H61A 3V92A 4CDLA 4NREA 1Z1SA 5FW5A 3OWYA 4XB5A 2UX0A 3BB9A 4N6MA 3M8CA 1AV4A 2GXFA 1RRLA 1QJGA 4NHFA 1GD3A 1FGOA 1PFPA 4MMZB 1QMAA 3DZLA 3OWUA 1OUNA 4OUQA 4R1KA 1UI7A 2OQEA 1MNLA 4EV5A 3IJEB 5AIFA 4O02B 1E3VA 2W9PA 3KSPA 4XM4A 1SIHA 1HU9A 2P38A 4U13A 3FG4A 3V99A 1FGMA 3PCSA 1Q42A 3E99A 3G6E3 2W04A 1QAKA 4RZMA 3K0ZA 3LZAA 2Z76A 3KKGA 2QGUA 4AKYA 5IG3A 2V1LA 3SOAA 3KZTA 4RBNA 4IT7A 3LT8A 3GZXB 5STDA 3LT9A 1OHPA 3OX9A 1STFI 5D81A 5EEOA 3U97A 1RJOA 3NQYA 1VQ83 1JNQA 1IVUA 2F98A 2JQ5A 4EXRA 1N5PA 5AEUB 3CC43 2HMNB 1W00A 3X40A 3IPTA 1L5GB 1KQS2 4FMCA 1EKMA 1DMQA 1RRHA 2K54A 2W6JH 1W6CA 3K9MC 3QK9A 4IIAA 2P0XA 4O2HA 2ML6A 4FCJA 3MSOA 2Y74A 3CC73 1ZX2A 1WTHA 1NO3A 1TFKA 2CC3A 2IUKA 2GBWB 2W03A 1VQN3 2FGTA 2CKFB 2FNQA 3PZWA 2ML5A 5CK6A 4FCMA 1IQXA 1Q824 3JVCA 4MJDA 3DGNA 1JB5A 2LYXA 1S723 5HGRA 1QAFA 2YFIB 3PCRA 5CXOA 1N5HA 1ULIB 3EC9A 1A67A 1STDA 4HM3B 1DYUA 3Q1CA 2ZL8A 3G713 2XF3A 5AIIA 5AEWB 3A76A 1K8A4 4N6LA 5JPUA 4KVHA 3LTBA 3S28A 2D42A 1OH0A 2CK3H 3G16A 3GRDA 4KZ1A 5IW9A 3WDGB 4WHAA 3PGBA 3N9HA 4X2OA 5DRVA 1NJI4 3PYJA 3UL5A 1WQLB 3FKAA 3Q2PA 1TFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 4;  1YJN 3;  1S72 3;  3CC4 3;  3CMA 3;  3CCR 3;  1YJ9 3;  1N8R 4;  1VQ5 3;  1YHQ 3;  2OTL 3;  1VQO 3;  1KQS 2;  1W2B 2;  1VQ7 3;  3OW2 2;  1Q7Y 4;  3CCM 3;  1VQL 3;  1Q81 4;  3CXC 2;  3CPW 2;  3G4S 3;  3G71 3;  1VQ9 3;  3CC2 3;  3CCL 3;  2QA4 3;  1VQK 3;  3G6E 3;  1K8A 4;  3CCU 3;  3CCJ 3;  1YJW 3;  1KD1 4;  3CC7 3;  1M90 4;  1VQ4 3;  2QEX 3;  1JJ2 2;  3CCE 3;  3CME 3;  1M1K 4;  1YI2 3;  1VQN 3;  1K73 4;  1YIT 3;  1Q86 4;  3I55 3;  1QVF 2;  1VQ6 3;  1YIJ 3;  2OTJ 3;  1K9M 4;  1QVG 2;  1NJI 4;  3I56 3;  3CCV 3;  1VQM 3;  1Q82 4;  1VQP 3;  3CD6 3;  1VQ8 3;  3CCS 3;  3CCQ 3; 
#chains in the Genus database with same CATH topology
 1GS3 A;  1YJN 3;  3F7S A;  4Q53 A;  4HM0 B;  1N8R 4;  3DH2 A;  3UNL A;  3D9R A;  2MC8 A;  3ER7 A;  2XRX B;  5IER A;  1KWI A;  1TUH A;  3NM7 A;  4N6N B;  1CYV A;  5IF6 A;  3CPW 2;  4KFF A;  1X1U A;  1OGX A;  3HOH A;  1DET A;  3DMC A;  4HYZ A;  5ELU A;  1W6Y A;  5JPP A;  1J2B A;  3F40 A;  3WA2 X;  1M90 4;  4FMA A;  1HZ1 A;  4G1M B;  1VQ4 3;  5BXQ A;  3VGN A;  4HM2 B;  4ORL A;  1SPU A;  1TP6 A;  4K1V A;  5G2G A;  1QVF 2;  1O7N B;  1IDP A;  3FLJ A;  3HI7 A;  1RHL A;  2A15 A;  1BVI A;  1M9G A;  2CWV A;  2P05 A;  3FF2 A;  3EBT A;  3FH1 A;  3MG1 A;  1I2G A;  1I0V A;  2KXG A;  2RFR A;  3KSE D;  1BRJ A;  1OF5 B;  4N6O B;  2AAD A;  5EQL A;  7STD A;  3S27 A;  4NPB A;  1I70 A;  3EN1 B;  1YVS A;  3OXA A;  1BRN L;  4LEH A;  4BIR A;  1TRQ A;  3FGY A;  3NQZ A;  5DRE A;  1A90 A;  1K28 A;  1VZZ A;  1R4Y A;  3DGM A;  4RNZ A;  1JKG B;  1BSE A;  1NU3 A;  3F8X A;  3CC2 3;  1ZO2 A;  1T3B A;  3B4P A;  4R80 A;  2CHC A;  2YX9 A;  1LOX A;  4EC6 A;  1WNH A;  2BT3 A;  2K3D A;  1AY7 A;  3RGR A;  5IEN A;  3AGO A;  2O3O A;  1Q40 B;  1M1K 4;  4HZB B;  2RBI A;  3JUN A;  2SBL A;  1EUI C;  1MWT A;  3H3H A;  4HJL B;  3KE7 A;  3ZFZ A;  3I56 3;  1Y4K A;  1US1 A;  1SQW A;  3CNM A;  3JUO A;  1RN7 A;  3DGO A;  3RDE A;  3CCS 3;  1GY6 A;  3CCQ 3;  3LTC A;  4HBR A;  3GZB A;  4J8T A;  1YJ9 3;  1VQ5 3;  1VQQ A;  4O3V A;  3V98 A;  3WMD A;  3X41 A;  3F7X A;  2GBX B;  2F5W A;  1FUS A;  1W2Z A;  2RCD A;  1DMN A;  3JUQ A;  7RNT A;  1VQL 3;  1IVW A;  1OPY A;  1YGE A;  1IQY A;  1RSN A;  1RDS A;  3PS8 A;  1VQK 3;  1IT7 A;  2XSH B;  3K5T A;  5KP1 A;  3H51 A;  3SXX A;  1YVB I;  1IQ8 A;  3BNC A;  4OVM A;  4FMB A;  2CFG A;  4AKZ A;  1GMR A;  3O8Y A;  2QIY A;  2CG0 A;  1BNJ A;  4FCZ A;  1YIJ 3;  1IU7 A;  3HZP A;  1LNI A;  2STD A;  1UCL A;  3ECF A;  4HKV B;  3SYU A;  1IV9 A;  1BRK A;  2CWT A;  3B8L A;  2KF6 A;  4ZM8 A;  3SX1 A;  1NB5 I;  1PYL A;  3WOE B;  3GAX A;  4J5K A;  1TU5 A;  1T5Y A;  3LTD A;  1E3R A;  1VQ7 3;  1SII A;  2XH9 A;  3OW2 2;  1Q7Y 4;  2CH9 A;  1CEW I;  2JDI H;  3GSP A;  2E2V A;  2XGL A;  3MG2 A;  3EF8 A;  4XBX A;  3WR2 A;  5AI1 A;  1A2V A;  3X42 A;  3WHO A;  2IUJ A;  4K90 B;  1JZO A;  2KCD A;  3T8U A;  1W01 A;  2GU3 A;  2I9W A;  5D83 A;  5I97 A;  2Z7A A;  1U5O A;  3EN8 A;  3EB8 A;  1JB4 A;  1TJD A;  5KP4 A;  3I55 3;  2LQV A;  1AVK A;  1I3I A;  2OCT A;  4BU4 A;  1LNH A;  2OTJ 3;  2H0G A;  3KFQ C;  3UB1 A;  4AEQ A;  1QVG 2;  1SAR A;  2M7O A;  2PNC A;  2CWU A;  1FGR A;  1BUJ A;  4BL2 A;  2HMM B;  2Y73 A;  1BRI A;  3CPO A;  3DM8 A;  3LML A;  4HZ9 B;  4IPB A;  5ELJ A;  1OF5 A;  3CCR 3;  3CMA 3;  2WOF A;  8RNT A;  1BUQ A;  3EBY A;  1RKY A;  1AVL A;  2CW9 A;  1Q81 4;  3LTA A;  2QA4 3;  1BRS A;  1IV7 A;  1JKG A;  2BMR B;  2OQE C;  2P09 A;  3LYG A;  4K1U A;  4XBT A;  1C7H A;  1V74 A;  4L8O A;  5CLK A;  1O7W B;  3BND A;  3FG1 A;  3NM2 A;  1FUW A;  1JJ2 2;  1GY5 A;  1HKX A;  4H3U A;  1TTO A;  2ZA4 A;  2Q07 A;  3NV0 B;  4N6V 0;  3U1W A;  1RN1 A;  3CNX A;  3B7C A;  1Q40 A;  1UCK A;  1N8Q A;  1FZU A;  1LOW A;  5AIG A;  1A2K A;  1UUV B;  1G96 A;  2F4Y A;  5M19 A;  1W5Z A;  3JUP A;  4CJN A;  1UCI A;  1DMM A;  5G1K A;  2Z6B A;  2XGN A;  1WMP A;  3GZY B;  4MMX B;  1IK3 A;  2D1W A;  3F8H A;  2CG1 A;  1GY7 A;  2C11 A;  2ZDJ A;  3VSY A;  3J7Y d;  2P0M A;  4EBG A;  3EX9 A;  4N6T A;  4R4K A;  3SLU A;  1LXE A;  3G0K A;  2AAE A;  2CIU A;  5D82 A;  3N8B A;  3HX8 A;  1JB2 A;  1FYS A;  3K7C A;  2HMJ B;  3EQQ B;  3ZG5 A;  3AHW A;  4LZI A;  7GSP A;  1NWW A;  1UGH I;  2BHM A;  4R9L A;  1S5A A;  1ISK A;  1JN5 A;  3BIR A;  1N9J A;  3WA3 A;  3AMO B;  1OGZ A;  2XFS A;  6GSP A;  1VQP 3;  2F56 A;  5IG5 A;  3WOD G;  1BSC A;  3X3Z A;  3MKI A;  4HVN A;  2KF5 A;  1BRG A;  1I3F A;  1OAC A;  3T8N A;  3SVA A;  3X3Y A;  2CFL A;  3F14 A;  3D5G A;  1EA2 A;  2KF3 A;  3ALA A;  1I2E A;  3OV4 A;  5AYS C;  5LC7 A;  2WO0 A;  4RNY A;  4CCV A;  1VQ9 3;  1V58 A;  2BNG A;  3GZR A;  3RGA A;  1W02 A;  1DVD A;  3MHE A;  4EV2 A;  1B2X A;  3Q90 A;  1NNV A;  1O7G B;  1R4C A;  4K61 A;  1O7H B;  4GL6 A;  4WP5 A;  2HML B;  3B4O A;  3S29 A;  1EEJ A;  1MOL A;  2L4V A;  3BLZ A;  4TX4 A;  4BTX A;  3CME 3;  4R9K A;  3FCS B;  1OHO A;  3FSD A;  2GEX A;  2HMK B;  1VQ6 3;  3GWR A;  2E2U A;  1FGT A;  4HM7 B;  3BU4 A;  1T2H A;  2C4B A;  2WGO A;  2E2T A;  3S67 A;  1NDO B;  5M18 A;  4N3V A;  1ASK A;  4LMI A;  1BOX A;  2OTL 3;  1LVN A;  2BO9 B;  1VQO 3;  5AYR B;  5BIR A;  1MWS A;  2GEY A;  1NB3 I;  1CQS A;  3LH4 A;  5IEO A;  3G4S 3;  5CF2 A;  3CCL 3;  1RMS A;  1RNT A;  3KII A;  6STD A;  1G0T A;  1A2P A;  1PU4 A;  3RNT A;  5M1A A;  1JN5 B;  2CFD A;  1GOY A;  2IY2 A;  1CH0 A;  1W6G A;  2IA7 A;  1RGF A;  3NBJ A;  4FR9 A;  4XDV A;  1YI2 3;  4LGQ A;  2CX0 A;  1RGH A;  4N6U A;  1BAN A;  3NV0 A;  3ROB A;  2OWP A;  3BNE A;  1D6U A;  5LC6 A;  1F8N A;  1VQM 3;  2YFJ B;  2ZHX B;  4QWT A;  2F99 A;  3DUK A;  3ZG0 A;  1W4N A;  1D6Y A;  1RCL A;  3D3L A;  1OCV A;  3CXC 2;  4BTW A;  1BNR A;  2XFT A;  4L8P A;  4GSP A;  3X3X A;  2W56 B;  1SJW A;  1E97 A;  2IMJ A;  2YFL B;  3SOY A;  5A0O B;  3PXM A;  5EVH A;  1UI8 A;  8CHO A;  2L1S A;  2KRT A;  3D5I A;  2RGQ A;  1EG9 B;  2KF4 A;  3JUM A;  4XDW A;  1BNI A;  1IT8 A;  3LOY A;  4HM1 B;  4OK0 A;  3DGL A;  1B27 A;  2C10 A;  2GSP A;  3G8Z A;  1O7P B;  1RGA A;  1GMQ A;  3CCV 3;  4BL3 A;  4WYK B;  5IG0 A;  3DY5 A;  3VF1 A;  3IMA B;  1B2S A;  3MG3 A;  3QRD A;  3AMO A;  1BNF A;  2W9Q A;  2WOH A;  1DVC A;  3CCU 3;  1X1X A;  2IYJ A;  3MWZ A;  1W7C A;  4I5Q A;  5TGN A;  3HIG A;  1JRQ A;  1WMN A;  5KP3 A;  4EYC A;  2Z77 A;  1I0X A;  3DXO A;  4HM5 B;  2INX A;  3FZW A;  1JV2 B;  4JRF A;  1AR0 A;  4L7K A;  3S5C A;  4I4K A;  4STD A;  3CCJ 3;  1KD1 4;  3F9S A;  4J9A A;  1LQM B;  1UW1 A;  4WWU C;  4MEI A;  3LXU X;  2GU1 A;  4HM4 B;  1BSA A;  4X2H A;  5FGO A;  1YIT 3;  1K73 4;  1GYB A;  3MPH A;  2W2C A;  3FF0 A;  1FA3 A;  3KN4 A;  2BIR A;  1B2U A;  1OHS A;  1RGK A;  2OOV A;  4KFE A;  5IEP A;  1KSI A;  1WMO A;  2BMQ B;  2SAR A;  4HOH A;  2H0I A;  3EE1 A;  4RNT A;  3UJM A;  1IVX A;  1YNV X;  3URP A;  1RGG A;  4MMY B;  1BNE A;  2R41 A;  5BVB A;  4LYL B;  1I8V A;  2F5M A;  3OWS A;  1YHQ 3;  1G02 A;  2F86 B;  2CFK A;  2J8X B;  3NBR A;  1K41 A;  2XR8 B;  1B20 A;  3CCM 3;  1BAO A;  4WFO A;  1QAL A;  2HMO B;  1UDI I;  2MF7 A;  3NX0 A;  3WOF B;  3DGY A;  3BNB A;  1V57 A;  5IG4 A;  1YJW 3;  4XBY A;  4ILF A;  1GOU A;  2CFW A;  1YGW A;  3I0Y A;  1RLS A;  1ZGX A;  4LSO A;  4PEJ A;  4CPK A;  2QEX 3;  2BMO B;  3EHC A;  4HM6 B;  1Q86 4;  1M1X B;  1EQK A;  3STD A;  9RNT A;  2RSX A;  3N54 B;  3NHX A;  3HK4 A;  2O9U X;  3L0R A;  1LQG C;  5GSP A;  1X1Y A;  3FG3 A;  4BTY A;  5G1L A;  2XSO B;  1KC8 4;  1IVV A;  1TRP A;  3T0U A;  1HYF A;  3TDG A;  1GSP A;  4JF8 A;  1UGI A;  3K63 A;  1ULJ B;  4KFD A;  1ROA A;  2UGI A;  5AIH A;  1CYU A;  1I2F A;  1MWU A;  1U8C B;  2XEP A;  1BIR A;  1FUT A;  1ROV A;  2H0H A;  3NUV A;  1N9E A;  1D6Z A;  2HOH A;  4FMD A;  2B24 B;  2R4I A;  1GD4 A;  2FXT A;  2W0Q A;  2W56 A;  3EJV A;  1JBR A;  4EW5 A;  4GB5 A;  2K0M A;  3MYT A;  1UUW B;  2WGQ A;  5CF1 A;  1O7M B;  3AGN A;  4O8S A;  1K9M 4;  3UL6 A;  4HM8 B;  3CD6 3;  1AQZ A;  3NBB A;  5JBS A;  1B2Z A;  2B1X B;  4WYK A;  1FGQ A;  3CU3 A;  3HII A;  1W2B 2;  3SED A;  3NXJ A;  1TIJ A;  3Q3F A;  2OOV C;  1RGL A;  2PZV A;  4H61 A;  5BU4 A;  4KT3 B;  3V92 A;  3D79 A;  4CDL A;  1UCJ A;  4NRE A;  1Z1S A;  1B3S A;  5FW5 A;  3OWY A;  4XB5 A;  2UX0 A;  3BB9 A;  1MGW A;  3M8C A;  4N6M A;  1AV4 A;  2GXF A;  1RRL A;  1QJG A;  4NHF A;  1GD3 A;  2UUG C;  1FGO A;  1IYY A;  1PFP A;  4MMZ B;  1QMA A;  3DZL A;  3OWU A;  1OUN A;  2RNT A;  4OUQ A;  4R1K A;  1UI7 A;  1C54 A;  1BNS A;  1RTU A;  1MNL A;  4J5G A;  2OQE A;  4EV5 A;  1ZS7 A;  3IJE B;  5AIF A;  4O02 B;  4DKI A;  1E3V A;  2W9P A;  1UUG B;  3KSP A;  1LOY A;  4XM4 A;  1SIH A;  1HU9 A;  1GMP A;  2P38 A;  3FG4 A;  4U13 A;  3V99 A;  1FGM A;  3PCS A;  1Q42 A;  3E99 A;  3G6E 3;  2W04 A;  1QAK A;  1MGR A;  4RZM A;  3K0Z A;  3LZA A;  2Z76 A;  3KKG A;  4GHO A;  2QGU A;  4AKY A;  1MWR A;  5IG3 A;  1DE3 A;  2V1L A;  3SOA A;  3KZT A;  4RBN A;  1JBS A;  4IT7 A;  3LT8 A;  3GZX B;  5STD A;  1GOV A;  3LT9 A;  1X1W A;  1Q9E A;  1OHP A;  1RN4 A;  1STF I;  2CX1 A;  3OX9 A;  1BNG A;  5D81 A;  5EEO A;  3U97 A;  1RNB A;  1RJO A;  3NQY A;  1VQ8 3;  1JNQ A;  1IVU A;  2F98 A;  2JQ5 A;  4EXR A;  1N5P A;  5AEU B;  5HOH A;  2HMN B;  1W00 A;  3X40 A;  3CC4 3;  3A5E A;  3IPT A;  5RNT A;  1L5G B;  1LOV A;  1KQS 2;  1LRA A;  4FMC A;  1BSB A;  1EKM A;  1DMQ A;  1RRH A;  3D4A A;  2K54 A;  2KAA A;  2W6J H;  1BSD A;  1W6C A;  3K9M C;  3QK9 A;  4IIA A;  2P0X A;  4O2H A;  2ML6 A;  4FCJ A;  3MSO A;  2Y74 A;  3CC7 3;  1B2M A;  1ZX2 A;  1WTH A;  1NO3 A;  1TFK A;  1BRH A;  2CC3 A;  2IUK A;  2GBW B;  2W03 A;  1VQN 3;  1T2I A;  1RGE A;  2FGT A;  2CKF B;  1PY3 A;  2FNQ A;  3PZW A;  1FW7 A;  2ML5 A;  5CK6 A;  4FCM A;  1IQX A;  2BU4 A;  1Q82 4;  3JVC A;  3CCE 3;  4MJD A;  3DGN A;  1JB5 A;  1RCK A;  2LYX A;  1S72 3;  1B21 A;  5HGR A;  4HAA A;  1QAF A;  2YFI B;  1Q7H A;  3PCR A;  5CXO A;  1N5H A;  1ULI B;  1BU4 A;  3EC9 A;  1JBT A;  1STD A;  4HM3 B;  1DYU A;  1RGC A;  3Q1C A;  1A67 A;  2ZL8 A;  3G71 3;  2XF3 A;  3AHS A;  5AII A;  5AEW B;  3A76 A;  1K8A 4;  4N6L A;  5JPU A;  4KVH A;  3LTB A;  3S28 A;  2D42 A;  1OH0 A;  2CK3 H;  3G16 A;  3KCH A;  3GRD A;  4KZ1 A;  1JZD A;  5IW9 A;  3WDG B;  4WHA A;  3PGB A;  3N9H A;  1BGS A;  4X2O A;  5DRV A;  1NJI 4;  3PYJ A;  3UL5 A;  1WQL B;  3FKA A;  3Q2P A;  6RNT A;  1TFO A; 
#chains in the Genus database with same CATH homology
 1GS3 A;  1YJN 3;  3F7S A;  4Q53 A;  4HM0 B;  1N8R 4;  3UNL A;  3D9R A;  2MC8 A;  3ER7 A;  2XRX B;  5IER A;  1KWI A;  1TUH A;  3NM7 A;  4N6N B;  1CYV A;  5IF6 A;  3CPW 2;  4KFF A;  1OGX A;  4HYZ A;  3DMC A;  5ELU A;  1J2B A;  1W6Y A;  5JPP A;  3F40 A;  3WA2 X;  1M90 4;  4FMA A;  4G1M B;  1VQ4 3;  5BXQ A;  3VGN A;  4HM2 B;  4ORL A;  1SPU A;  1TP6 A;  4K1V A;  5G2G A;  1QVF 2;  1O7N B;  1IDP A;  3FLJ A;  3HI7 A;  2A15 A;  5FGO A;  3FF2 A;  1M9G A;  2CWV A;  2P05 A;  3FH1 A;  3EBT A;  3MG1 A;  2KXG A;  2RFR A;  3KSE D;  1OF5 B;  4N6O B;  5EQL A;  7STD A;  3S27 A;  3EN1 B;  3OXA A;  4LEH A;  3FGY A;  3NQZ A;  5DRE A;  1A90 A;  1K28 A;  1VZZ A;  3DGM A;  4RNZ A;  1JKG B;  1NU3 A;  3F8X A;  3CC2 3;  1ZO2 A;  3B4P A;  4R80 A;  2CHC A;  2YX9 A;  1LOX A;  4EC6 A;  1WNH A;  2BT3 A;  3RGR A;  5IEN A;  2O3O A;  1Q40 B;  1M1K 4;  4HZB B;  3JUN A;  2SBL A;  3H3H A;  4HJL B;  3KE7 A;  3I56 3;  1Y4K A;  1US1 A;  1SQW A;  3CNM A;  3JUO A;  1RN7 A;  3DGO A;  3RDE A;  3CCS 3;  1GY6 A;  3CCQ 3;  3LTC A;  4HBR A;  3GZB A;  4J8T A;  1YJ9 3;  1VQ5 3;  4O3V A;  3V98 A;  3WMD A;  3X41 A;  3F7X A;  2GBX B;  3JUQ A;  1W2Z A;  2RCD A;  1DMN A;  1VQL 3;  1IVW A;  1OPY A;  1YGE A;  1IQY A;  3PS8 A;  1VQK 3;  1IT7 A;  2XSH B;  3K5T A;  5KP1 A;  3H51 A;  3SXX A;  1YVB I;  1IQ8 A;  3BNC A;  4OVM A;  4FMB A;  2CFG A;  4AKZ A;  3O8Y A;  2QIY A;  2CG0 A;  4FCZ A;  1YIJ 3;  1IU7 A;  3HZP A;  2STD A;  3ECF A;  4HKV B;  1IV9 A;  2CWT A;  3B8L A;  4ZM8 A;  3SX1 A;  1NB5 I;  3WOE B;  3GAX A;  1TU5 A;  1T5Y A;  3LTD A;  1E3R A;  1VQ7 3;  1SII A;  2XH9 A;  3OW2 2;  1Q7Y 4;  2CH9 A;  1CEW I;  2JDI H;  3X42 A;  2E2V A;  2XGL A;  3MG2 A;  3EF8 A;  4XBX A;  5AI1 A;  1A2V A;  2IUJ A;  4K90 B;  2KCD A;  3T8U A;  1W01 A;  2GU3 A;  2I9W A;  5D83 A;  5I97 A;  2Z7A A;  1U5O A;  3EN8 A;  3EB8 A;  1JB4 A;  5KP4 A;  3I55 3;  2LQV A;  1AVK A;  2OCT A;  1LNH A;  2OTJ 3;  3KFQ C;  3UB1 A;  4AEQ A;  1QVG 2;  2M7O A;  2PNC A;  2CWU A;  1FGR A;  2HMM B;  2Y73 A;  3DM8 A;  3CPO A;  3LML A;  4HZ9 B;  4IPB A;  5ELJ A;  3CCR 3;  1OF5 A;  3CMA 3;  2WOF A;  1BUQ A;  3EBY A;  1RKY A;  1AVL A;  2CW9 A;  1Q81 4;  3LTA A;  2QA4 3;  1JKG A;  1IV7 A;  2BMR B;  2OQE C;  4K1U A;  2P09 A;  3LYG A;  4XBT A;  5CLK A;  1C7H A;  1V74 A;  4L8O A;  3CCU 3;  1O7W B;  3BND A;  3FG1 A;  3NM2 A;  1FUW A;  1JJ2 2;  1GY5 A;  1HKX A;  4H3U A;  2Q07 A;  3NV0 B;  4N6V 0;  3U1W A;  3CNX A;  3B7C A;  1Q40 A;  1N8Q A;  5AIG A;  1A2K A;  1UUV B;  1G96 A;  1W5Z A;  3JUP A;  1DMM A;  2Z6B A;  2XGN A;  1WMP A;  3GZY B;  4MMX B;  1IK3 A;  2D1W A;  3F8H A;  2CG1 A;  1GY7 A;  2C11 A;  2ZDJ A;  3VSY A;  3J7Y d;  2P0M A;  4EBG A;  3EX9 A;  4N6T A;  4R4K A;  3SLU A;  1LXE A;  3G0K A;  2CIU A;  5D82 A;  3N8B A;  3HX8 A;  1JB2 A;  3K7C A;  2HMJ B;  3EQQ B;  4LZI A;  1NWW A;  2BHM A;  4R9L A;  1S5A A;  1ISK A;  1JN5 A;  1N9J A;  3WA3 A;  3AMO B;  1OGZ A;  2XFS A;  1VQP 3;  5IG5 A;  3WOD G;  3X3Z A;  3MKI A;  4HVN A;  3T8N A;  1OAC A;  3X3Y A;  3SVA A;  2CFL A;  3F14 A;  1EA2 A;  3OV4 A;  3ALA A;  5AYS C;  5LC7 A;  2WO0 A;  4RNY A;  4CCV A;  1VQ9 3;  2BNG A;  3GZR A;  3RGA A;  1W02 A;  1DVD A;  3MHE A;  4EV2 A;  3Q90 A;  1O7G B;  1R4C A;  4K61 A;  1O7H B;  4GL6 A;  4WP5 A;  2HML B;  3B4O A;  3S29 A;  4TX4 A;  1MOL A;  2L4V A;  3BLZ A;  4BTX A;  3CME 3;  4R9K A;  3FCS B;  1OHO A;  3FSD A;  2GEX A;  2HMK B;  1VQ6 3;  3GWR A;  2E2U A;  1FGT A;  4HM7 B;  2WGO A;  2E2T A;  3S67 A;  1NDO B;  4N3V A;  1ASK A;  4LMI A;  2OTL 3;  1LVN A;  2BO9 B;  1VQO 3;  5AYR B;  2GEY A;  1NB3 I;  1CQS A;  3LH4 A;  5IEO A;  3G4S 3;  5CF2 A;  3CCL 3;  3KII A;  6STD A;  1PU4 A;  1JN5 B;  2CFD A;  3CCE 3;  1W6G A;  2IA7 A;  3NBJ A;  1YI2 3;  4FR9 A;  4XDV A;  4LGQ A;  4N6U A;  3NV0 A;  1VQM 3;  3ROB A;  2OWP A;  3BNE A;  1D6U A;  5LC6 A;  1F8N A;  2YFJ B;  4QWT A;  2F99 A;  3DUK A;  1W4N A;  1D6Y A;  3D3L A;  1OCV A;  3CXC 2;  4BTW A;  2XFT A;  4L8P A;  3X3X A;  2W56 B;  1SJW A;  1E97 A;  2IMJ A;  2YFL B;  3SOY A;  5A0O B;  3PXM A;  5EVH A;  1UI8 A;  8CHO A;  2KRT A;  2RGQ A;  1EG9 B;  3JUM A;  4XDW A;  1IT8 A;  3LOY A;  4HM1 B;  4OK0 A;  3DGL A;  2C10 A;  3G8Z A;  1O7P B;  3CCV 3;  4WYK B;  5IG0 A;  3DY5 A;  3VF1 A;  3IMA B;  3MG3 A;  3QRD A;  3AMO A;  2W9Q A;  2WOH A;  1DVC A;  3MWZ A;  1W7C A;  5TGN A;  3HIG A;  1JRQ A;  1WMN A;  5KP3 A;  4EYC A;  2Z77 A;  3DXO A;  4HM5 B;  2INX A;  3FZW A;  1JV2 B;  4JRF A;  1AR0 A;  4L7K A;  3S5C A;  4I4K A;  4STD A;  3CCJ 3;  1KD1 4;  3F9S A;  4J9A A;  1UW1 A;  4WWU C;  4MEI A;  3LXU X;  2GU1 A;  4HM4 B;  4X2H A;  1K73 4;  1YIT 3;  1GYB A;  3MPH A;  2W2C A;  3FF0 A;  1FA3 A;  3KN4 A;  1OHS A;  5IEP A;  2OOV A;  4KFE A;  1KSI A;  1WMO A;  2BMQ B;  3UJM A;  3EE1 A;  1IVX A;  4MMY B;  5BVB A;  3OWS A;  1YHQ 3;  2F86 B;  2CFK A;  3NBR A;  1K41 A;  2XR8 B;  3CCM 3;  4WFO A;  1QAL A;  2HMO B;  2MF7 A;  3NX0 A;  3WOF B;  3BNB A;  1YJW 3;  5IG4 A;  4XBY A;  2CFW A;  3I0Y A;  2QEX 3;  4LSO A;  4PEJ A;  2BMO B;  3EHC A;  4HM6 B;  1Q86 4;  1M1X B;  1EQK A;  3STD A;  2RSX A;  3N54 B;  3NHX A;  3HK4 A;  2O9U X;  3L0R A;  3FG3 A;  4BTY A;  2XSO B;  1KC8 4;  1IVV A;  3T0U A;  3TDG A;  4JF8 A;  3K63 A;  1ULJ B;  4KFD A;  1ROA A;  1CYU A;  5AIH A;  1U8C B;  2XEP A;  1ROV A;  3NUV A;  1N9E A;  1D6Z A;  4FMD A;  2B24 B;  2R4I A;  1GD4 A;  2FXT A;  2W0Q A;  2W56 A;  3EJV A;  4GB5 A;  2K0M A;  3MYT A;  1UUW B;  2WGQ A;  5CF1 A;  1O7M B;  4O8S A;  1K9M 4;  3UL6 A;  4HM8 B;  3CD6 3;  3NBB A;  5JBS A;  2B1X B;  4WYK A;  1FGQ A;  3CU3 A;  3HII A;  1W2B 2;  3SED A;  3NXJ A;  1TIJ A;  2OOV C;  2PZV A;  4H61 A;  3V92 A;  4CDL A;  4NRE A;  1Z1S A;  5FW5 A;  3OWY A;  4XB5 A;  2UX0 A;  3BB9 A;  4N6M A;  3M8C A;  1AV4 A;  2GXF A;  1RRL A;  1QJG A;  4NHF A;  1GD3 A;  1FGO A;  1PFP A;  4MMZ B;  1QMA A;  3DZL A;  3OWU A;  1OUN A;  4OUQ A;  4R1K A;  1UI7 A;  2OQE A;  1MNL A;  4EV5 A;  3IJE B;  5AIF A;  4O02 B;  1E3V A;  2W9P A;  3KSP A;  4XM4 A;  1SIH A;  1HU9 A;  2P38 A;  4U13 A;  3FG4 A;  3V99 A;  1FGM A;  3PCS A;  1Q42 A;  3E99 A;  3G6E 3;  2W04 A;  1QAK A;  4RZM A;  3K0Z A;  3LZA A;  2Z76 A;  3KKG A;  2QGU A;  4AKY A;  5IG3 A;  2V1L A;  3SOA A;  3KZT A;  4RBN A;  4IT7 A;  3LT8 A;  3GZX B;  5STD A;  3LT9 A;  1OHP A;  3OX9 A;  1STF I;  5D81 A;  5EEO A;  3U97 A;  1RJO A;  3NQY A;  1VQ8 3;  1JNQ A;  1IVU A;  2F98 A;  2JQ5 A;  4EXR A;  1N5P A;  5AEU B;  3CC4 3;  2HMN B;  1W00 A;  3X40 A;  3IPT A;  1L5G B;  1KQS 2;  4FMC A;  1EKM A;  1DMQ A;  1RRH A;  2K54 A;  2W6J H;  1W6C A;  3K9M C;  3QK9 A;  4IIA A;  2P0X A;  4O2H A;  2ML6 A;  4FCJ A;  3MSO A;  2Y74 A;  3CC7 3;  1ZX2 A;  1WTH A;  1NO3 A;  1TFK A;  2CC3 A;  2IUK A;  2GBW B;  2W03 A;  1VQN 3;  2FGT A;  2CKF B;  2FNQ A;  3PZW A;  2ML5 A;  5CK6 A;  4FCM A;  1IQX A;  1Q82 4;  3JVC A;  4MJD A;  3DGN A;  1JB5 A;  2LYX A;  1S72 3;  5HGR A;  1QAF A;  2YFI B;  3PCR A;  5CXO A;  1N5H A;  1ULI B;  3EC9 A;  1A67 A;  1STD A;  4HM3 B;  1DYU A;  3Q1C A;  2ZL8 A;  3G71 3;  2XF3 A;  5AII A;  5AEW B;  3A76 A;  1K8A 4;  4N6L A;  5JPU A;  4KVH A;  3LTB A;  3S28 A;  2D42 A;  1OH0 A;  2CK3 H;  3G16 A;  3GRD A;  4KZ1 A;  5IW9 A;  3WDG B;  4WHA A;  3PGB A;  3N9H A;  4X2O A;  5DRV A;  1NJI 4;  3PYJ A;  3UL5 A;  1WQL B;  3FKA A;  3Q2P A;  1TFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...