1JJ22

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jj2200
1K8A4 1W2B2 1M904 3I553 1NJI4 1KC84 1KD14 3CXC2 1QVG2 1VQM3 2OTL3 3G4S3 1Q814 1N8R4 1VQ63 1YIT3 3CCS3 1VQ83 1VQ43 1Q824 3CCQ3 1VQ53 3I563 1YHQ3 1YJW3 3CMA3 3CCJ3 1VQO3 1YIJ3 1K9M4 1QVF2 1VQN3 3G6E3 1Q7Y4 3CCE3 1JJ22 3G713 3CC73 2OTJ3 3CCM3 3CCV3 2QA43 1M1K4 1YJ93 1Q864 1VQL3 3CD63 3CPW2 1YJN3 1VQK3 1K734 1YI23 3CCR3 3CME3 1VQ73 1KQS2 3CCL3 1VQP3 3CC43 3OW22 3CCU3 3CC23 1S723 2QEX3 1VQ93
chains in the Genus database with same CATH superfamily
3NBJA 3IJEB 4HYZA 1CYUA 1NJI4 3FZWA 1BNGA 4KVHA 3ZFZA 5KP1A 1BRKA 1SQWA 3CXC2 5IG0A 1GOYA 1EQKA 1M9GA 1VQ83 3FF0A 3QK9A 1BSEA 4WYKA 1MNLA 1ULIB 2GEXA 2ZA4A 2L1SA 3H51A 1W7CA 2P05A 1BRGA 1JZOA 3DGNA 4OK0A 1BGSA 4L7KA 3WOEB 6STDA 1JKGA 1QAFA 2IUKA 1T5YA 2INXA 1HKXA 2GBWB 1IQ8A 1X1XA 5AEWB 5HOHA 2CK3H 5M1AA 1A2PA 1MGRA 1OGZA 4BIRA 2YFIB 4BTWA 2JQ5A 1IVXA 2CWVA 4J5GA 4J9AA 2CX1A 1VQP3 3CNXA 2KF4A 1X1WA 3M8CA 3VGNA 3CCU3 1S723 1JNQA 1GY5A 2KCDA 1KSIA 3MG3A 1K8A4 1JN5A 1RDSA 1QJGA 4N3VA 3Q3FA 1UCIA 2IY2A 1BSBA 1UGIA 3AHSA 1BNJA 4MJDA 2RGQA 2KF5A 3KSPA 2CX0A 2XFSA 1MGWA 3OWUA 3F9SA 3CCQ3 1MWUA 3Q90A 1TJDA 1D6YA 1TRPA 2XGNA 1RTUA 1FUSA 1JB2A 3FF2A 3LH4A 3OWSA 3KKGA 4CDLA 1Q7HA 1UUGB 2CW9A 3A76A 1Q7Y4 3TDGA 3X42A 3G713 2CKFB 3FSDA 3NUVA 2CC3A 1YJ93 4O2HA 1W5ZA 1I2GA 1RGAA 1AV4A 3DMCA 1O7GB 1BUQA 1RRHA 4EXRA 2CFDA 1DVCA 4GB5A 1RGLA 1SJWA 3WODG 3HIIA 3F7XA 1IVUA 1QAKA 3RGRA 5IERA 6RNTA 5AEUB 2MF7A 2W6JH 4KFEA 3SX1A 2J8XB 3LOYA 2HMMB 5STDA 2LYXA 2GU3A 2CFGA 2ML5A 3D4AA 2STDA 3NXJA 3T8UA 1LNIA 3MPHA 3GZXB 1V74A 3Q2PA 1NNVA 1YJW3 3CMA3 3PZWA 2L4VA 1TRQA 1VZZA 2MC8A 3EB8A 4FCJA 1MWRA 4HJLB 3U97A 4QWTA 1M1K4 4RBNA 3NV0A 2CFKA 4H61A 3G0KA 4RZMA 3V99A 3IPTA 2AAEA 3B8LA 1OUNA 4WP5A 5FW5A 1RGCA 2K54A 1NWWA 1UGHI 3EX9A 3LXUX 1LNHA 3T0UA 1RLSA 4N6TA 2W56B 4H3UA 4HM3B 4EBGA 1M904 1M1XB 2UUGC 3LT8A 2OCTA 5TGNA 1KD14 3NBRA 1G0TA 4JF8A 1UUWB 4JRFA 1RMSA 5EVHA 2H0HA 1TIJA 5D82A 3NM2A 4OUQA 5AIGA 4LEHA 3DM8A 3BIRA 4R9LA 3D79A 1OF5A 1V57A 5A0OB 1I2FA 3CCE3 3PGBA 4HBRA 3ER7A 1PU4A 1IQYA 3K7CA 1UUVB 1Q42A 3V98A 4BL3A 1FW7A 3JUOA 4HM5B 1G02A 1WMOA 2BO9B 3FLJA 4LGQA 1TUHA 5LC6A 2C4BA 1SIHA 2XFTA 2BNGA 1RGEA 4K1VA 2F5MA 1HZ1A 4GHOA 3F14A 3EQQB 4J5KA 4EW5A 4N6NB 4BU4A 1MOLA 1STFI 2GBXB 3ROBA 3N8BA 4KZ1A 3CU3A 1BRSA 2CH9A 4O3VA 2RSXA 3CCS3 2W03A 3H3HA 3MG1A 1W2ZA 5IW9A 3KFQC 2AADA 3SYUA 1OHPA 3G6E3 2O3OA 1GY7A 1G96A 3DH2A 3CCM3 3MG2A 1YVBI 1K41A 1IV9A 3K0ZA 5BVBA 1I70A 1RGHA 1JRQA 1NB5I 1Q40B 3GZYB 1BNEA 2KF3A 4RNTA 3S67A 1GMPA 2SBLA 3KN4A 2BHMA 3VSYA 1I0VA 2HMNB 3CC43 3OW22 3F7SA 1RSNA 1UI8A 3Q1CA 1C7HA 2CWUA 1RN7A 1BANA 1GOVA 1HU9A 4HM0B 1O7WB 1CEWI 1Q824 5I97A 4BTYA 1AR0A 1RCLA 2XF3A 5G1KA 2O9UX 3F8XA 1MWSA 3WR2A 1C54A 3FKAA 2IYJA 4HM6B 3OV4A 5BIRA 3MKIA 3LZAA 2C11A 1VQQA 2CWTA 5DREA 1AY7A 4GL6A 3B4OA 1QMAA 1ROAA 1FGTA 3DUKA 4R4KA 4MMYB 4L8PA 2C10A 1IT7A 1GD3A 1EUIC 1RGFA 1GD4A 1QALA 1W01A 3SEDA 5IENA 1E3RA 2W04A 1BVIA 2R41A 3PCSA 1DMQA 3NM7A 1W2B2 3BB9A 2K0MA 1PFPA 1AQZA 3EE1A 1CH0A 2K3DA 1FGOA 2A15A 2OTL3 1FGRA 1W6GA 3SOAA 2FNQA 2HMLB 1FGQA 1N5HA 3AMOB 4KT3B 3X3YA 3HI7A 4GSPA 3HIGA 1DYUA 1GY6A 4N6LA 4CJNA 1DE3A 5KP3A 3I0YA 3D3LA 1W6CA 2Y73A 4IIAA 3KZTA 2XEPA 3S27A 3CC73 1W4NA 1WMPA 1MWTA 4XB5A 8RNTA 1RN4A 2P09A 2WGOA 1EKMA 4NREA 3UB1A 3ZG5A 2BU4A 1DVDA 1B2UA 5CXOA 1L5GB 1AVKA 1X1YA 3RNTA 2WOFA 2Y74A 2OQEC 4LYLB 2RCDA 3EN8A 3BNEA 2GSPA 2D42A 2YX9A 3BNDA 3D5GA 2ZHXB 2Z77A 1ZGXA 5DRVA 1FUWA 1KC84 1K28A 3PYJA 4N6UA 2SARA 2RBIA 3EC9A 5EQLA 3D5IA 3JUPA 1N8R4 1GOUA 3EBTA 4N6MA 1I8VA 3EF8A 1NB3I 2RFRA 7STDA 1TP6A 1J2BA 3UL6A 1S5AA 3UJMA 1NO3A 2CHCA 2HMOB 1OGXA 4U13A 1JZDA 1NU3A 3FCSB 1UCKA 2F56A 2OTJ3 1FYSA 2QA43 1NDOB 1D6UA 2F99A 4RNYA 3S29A 1UCLA 3GWRA 1N5PA 2HMKB 2XGLA 4IPBA 1K734 1LOXA 3OXAA 1ZS7A 2PZVA 3CCL3 1OCVA 1ZO2A 1A2VA 3FG1A 3HK4A 3SOYA 3CC23 1LOVA 1I3IA 5AIIA 4EV5A 1BRNL 1E97A 3D9RA 1X1UA 2KF6A 4K61A 1IK3A 3L0RA 4BL2A 1VQ53 4K1UA 1TTOA 1WQLB 4STDA 3AHWA 5CF1A 2CIUA 2E2VA 1DMNA 4XM4A 4Q53A 1JBRA 1B2ZA 1AVLA 3JUNA 4HVNA 1Q40A 3CCJ3 4ORLA 1K9M4 1VQN3 3CPOA 4AKZA 1LQGC 1D6ZA 3FG4A 1US1A 1DMMA 1HYFA 2CFLA 4FCZA 3ALAA 1N9JA 2F86B 2QIYA 1B2SA 1W02A 3CPW2 4NPBA 1YVSA 1B20A 4FCMA 5IG4A 2Q07A 1FGMA 1YGEA 2FXTA 1OHSA 2H0IA 4FMCA 2YFLB 4HKVB 1O7MB 3LTCA 3SLUA 1JBSA 1A90A 4KFDA 2Z7AA 5IEOA 1LXEA 1UCJA 1BAOA 3F8HA 3K63A 3MHEA 5GSPA 3B7CA 2WGQA 3EBYA 4TX4A 2ML6A 1IV7A 2W9PA 1KWIA 4EC6A 2IUJA 2BT3A 2UGIA 3V92A 1I2EA 4N6OB 3NQYA 1VQ43 3WHOA 1GSPA 4FMAA 1RRLA 5G2GA 1RNBA 4O8SA 2OWPA 3O8YA 1VQO3 1A67A 3S5CA 2WOHA 2XSHB 3BNCA 3WA2X 2V1LA 3FG3A 1E3VA 1I0XA 3HOHA 1OACA 1IVVA 5CLKA 1WTHA 3URPA 3N9HA 3MSOA 5HGRA 1RJOA 4CCVA 4XBXA 1IQXA 1LOYA 3X41A 3JUQA 3KIIA 5JPPA 2UX0A 1VQ93 2P0XA 3AMOA 3BNBA 4ILFA 4XDWA 4O02B 4HOHA 1B2XA 4G1MB 2R4IA 5AI1A 1VQ63 5AYRB 4WFOA 3E99A 1FUTA 2GU1A 3G8ZA 2BMOB 1N8QA 4HZ9B 3PS8A 4R1KA 1EG9B 3JUMA 2FGTA 2W9QA 3PCRA 6GSPA 1T3BA 2CG0A 1TFOA 3IMAB 3VF1A 5D83A 7GSPA 3WA3A 3K9MC 2BIRA 3DY5A 4X2OA 1FZUA 3CME3 1VQ73 3DGOA 3ECFA 3JVCA 2W2CA 5CK6A 4X2HA 2M7OA 3WDGB 3LTBA 5D81A 1ASKA 1OH0A 3N54B 1IDPA 1BNSA 3LT9A 5RNTA 3LTDA 5ELUA 1B2MA 2H0GA 3UNLA 1RN1A 1UDII 2XR8B 1VQM3 1TFKA 4EYCA 3NX0A 1BRHA 1A2KA 1OHOA 3KE7A 3X40A 2Z6BA 1YHQ3 2OQEA 4FR9A 3F40A 4MEIA 9RNTA 5M18A 3S28A 1JV2B 1U8CB 3AGOA 1SIIA 1STDA 1VQL3 2IMJA 2W56A 3FH1A 3STDA 2Z76A 3CCR3 3UL5A 3GZRA 3NHXA 2ZL8A 1EEJA 4NHFA 5AIFA 1Y4KA 1O7HB 4MMXB 5EEOA 2CG1A 1LVNA 1B27A 2D1WA 3DGLA 1I3FA 2BMQB 4WHAA 4MMZB 4AKYA 1JBTA 3WOFB 2ZDJA 1YNVX 1BOXA 1LRAA 3G4S3 4EV2A 1ISKA 1ZX2A 4ZM8A 1GS3A 1WNHA 1RGKA 3LMLA 5BU4A 4FMBA 3MWZA 1GMRA 1IVWA 3OX9A 2IA7A 5G1LA 1V58A 1TU5A 7RNTA 1B21A 4OVMA 4KFFA 1JJ22 5M19A 4J8TA 5ELJA 4WYKB 4XBTA 1YJN3 1VQK3 5JBSA 2B24B 1JKGB 1GYBA 2YFJB 3X3ZA 3KCHA 1ULJB 1WMNA 1Z1SA 4HM1B 3BU4A 2KXGA 3G16A 5BXQA 1BSCA 2QEX3 1U5OA 4PEJA 5IG5A 4I4KA 5LC7A 2P38A 4DKIA 5FGOA 3BLZA 4N6V0 1BRJA 3GSPA 5CF2A 1QVG2 3EHCA 4R80A 2F98A 4AEQA 1LOWA 2F5WA 1JB5A 1YIT3 2F4YA 3A5EA 4WWUC 3B4PA 4HAAA 2BMRB 3I563 1JN5B 2QGUA 4RNZA 1QVF2 1IYYA 5IG3A 1BSDA 1O7PB 2GXFA 3CNMA 4I5QA 2XSOB 1GMQA 2WO0A 3GAXA 3EJVA 3RDEA 1CYVA 3CCV3 8CHOA 1SARA 1BU4A 4HM2B 3PXMA 3X3XA 1PY3A 1YI23 1EA2A 1RNTA 3U1WA 1KQS2 3AGNA 1BNFA 4IT7A 4K90B 5IEPA 1SPUA 3NBBA 1IU7A 3KSED 3MYTA 2OOVA 3T8NA 5JPUA 1F8NA 3I553 4HZBB 3SXXA 1RCKA 3DZLA 4L8OA 3ZG0A 3LTAA 1DETA 1T2IA 4LSOA 4HM8B 1N9EA 1RKYA 4LMIA 2E2TA 2KAAA 3WMDA 1BUJA 1YIJ3 2KRTA 1UW1A 5IF6A 2OOVC 3GZBA 1W00A 1BNIA 1O7NB 3SVAA 5KP4A 1BIRA 1Q864 4XDVA 3CD63 2I9WA 3LYGA 4HM4B 3FGYA 4BTXA 1YGWA 2HMJB 3NQZA 3RGAA 3DXOA 2PNCA 2W0QA 2E2UA 2GEYA 3GRDA 3K5TA 4FMDA 1FA3A 1JB4A 1UI7A 2JDIH 4R9KA 3NV0B 1R4YA 1T2HA 4HM7B 5AIHA 5AYSC 1Q814 4XBYA 3QRDA 1W6YA 1IT8A 2B1XB 4CPKA 2XRXB 2P0MA 3EN1B 1B3SA 2LQVA 1BRIA 1BNRA 1RHLA 2CFWA 3DGYA 3OWYA 2XH9A 1BSAA 1ROVA 3HX8A 1PYLA 1OPYA 2HOHA 4LZIA 2RNTA 1OF5B 1CQSA 1LQMB 3DGMA 3J7Yd 1RGGA 1R4CA 3HZPA 1Q9EA
chains in the Genus database with same CATH topology
3NBJA 3IJEB 4HYZA 1CYUA 1NJI4 3FZWA 4KVHA 5KP1A 1SQWA 3CXC2 5IG0A 1EQKA 1M9GA 1VQ83 3FF0A 3QK9A 4WYKA 1VQ53 1MNLA 1ULIB 2GEXA 3H51A 4NREA 5I97A 1W7CA 2P05A 3DGNA 4OK0A 6STDA 4L7KA 3WOEB 1JKGA 1QAFA 2IUKA 1T5YA 2INXA 1HKXA 2GBWB 1IQ8A 5AEWB 2CK3H 1OGZA 4BTWA 2YFIB 2JQ5A 1IVXA 2CWVA 4J9AA 1VQP3 3CNXA 3CCU3 3M8CA 3VGNA 1S723 1JNQA 1GY5A 2KCDA 1KSIA 3MG3A 1K8A4 1JN5A 1QJGA 4N3VA 4MJDA 2RGQA 3KSPA 2XFSA 3OWUA 3F9SA 3CCQ3 3Q90A 2XGNA 1D6YA 3FF2A 1JB2A 3LH4A 3OWSA 3KKGA 4CDLA 1Q7Y4 2CW9A 3A76A 3TDGA 3X42A 3G713 2CKFB 3FSDA 3NUVA 2CC3A 1YJ93 4O2HA 1W5ZA 3DMCA 1AV4A 1O7GB 1BUQA 1RRHA 4EXRA 2CFDA 1DVCA 4GB5A 1SJWA 3WODG 3HIIA 3F7XA 1IVUA 1QAKA 3RGRA 5IERA 5AEUB 2MF7A 2W6JH 4KFEA 3SX1A 3LOYA 2HMMB 5STDA 2LYXA 2GU3A 2CFGA 2ML5A 3T8UA 2STDA 3NXJA 1YJW3 3CMA3 3MPHA 3GZXB 1V74A 3Q2PA 3PZWA 2L4VA 1VZZA 2MC8A 3EB8A 4FCJA 4HJLB 3U97A 4QWTA 1M1K4 4RBNA 3NV0A 2CFKA 4H61A 3G0KA 4RZMA 3V99A 3IPTA 3B8LA 1OUNA 4WP5A 5FW5A 2K54A 1NWWA 3EX9A 3LXUX 1LNHA 3T0UA 4N6TA 2W56B 4H3UA 4HM3B 4EBGA 1M904 1M1XB 3LT8A 2OCTA 5TGNA 1KD14 3NBRA 4JF8A 1UUWB 4JRFA 5EVHA 1TIJA 5D82A 3NM2A 4OUQA 5AIGA 4LEHA 3DM8A 4R9LA 1OF5A 5A0OB 3CCE3 3PGBA 4HBRA 3ER7A 1PU4A 1IQYA 3K7CA 1UUVB 1Q42A 3V98A 3JUOA 4HM5B 1WMOA 2BO9B 3FLJA 4LGQA 1TUHA 5LC6A 2XFTA 1SIHA 2BNGA 4K1VA 3F14A 3EQQB 4N6NB 1MOLA 1STFI 2GBXB 3ROBA 3N8BA 4KZ1A 3CU3A 2CH9A 4O3VA 3CCS3 2RSXA 2W03A 3H3HA 3MG1A 1W2ZA 5IW9A 3KFQC 1OHPA 3G6E3 2O3OA 1GY7A 1G96A 3CCM3 3MG2A 1K41A 1YVBI 1IV9A 3K0ZA 5BVBA 1JRQA 1NB5I 1Q40B 3GZYB 3S67A 2SBLA 3KN4A 2BHMA 3VSYA 2HMNB 3CC43 3OW22 3F7SA 1UI8A 3Q1CA 1C7HA 2CWUA 1RN7A 1HU9A 4HM0B 1O7WB 1CEWI 1Q824 4BTYA 1AR0A 2XF3A 2O9UX 3F8XA 3FKAA 4HM6B 3OV4A 3MKIA 3LZAA 2C11A 2CWTA 5DREA 4GL6A 3B4OA 1QMAA 1ROAA 1FGTA 3DUKA 4R4KA 4MMYB 4L8PA 2C10A 1IT7A 1GD3A 1GD4A 1QALA 1W01A 3SEDA 5IENA 1E3RA 2W04A 3PCSA 1DMQA 3NM7A 1W2B2 3BB9A 2K0MA 1PFPA 3EE1A 2OTL3 1FGOA 2A15A 1FGRA 1W6GA 3SOAA 2FNQA 2HMLB 3AMOB 1FGQA 1N5HA 3X3YA 3HI7A 3HIGA 1DYUA 1GY6A 5KP3A 3I0YA 3D3LA 1W6CA 2Y73A 4IIAA 3KZTA 2XEPA 3S27A 3CC73 1W4NA 1WMPA 4XB5A 2P09A 2WGOA 1EKMA 3UB1A 1DVDA 5CXOA 1L5GB 1AVKA 2WOFA 2Y74A 2OQEC 2RCDA 3EN8A 3BNEA 2YX9A 2D42A 3BNDA 4N6LA 5DRVA 2Z77A 1FUWA 1KC84 1K28A 3PYJA 4N6UA 3EC9A 5EQLA 3JUPA 1N8R4 3EBTA 4N6MA 3EF8A 1NB3I 2RFRA 7STDA 1TP6A 1J2BA 3UL6A 1S5AA 3UJMA 1NO3A 2CHCA 2HMOB 1OGXA 4U13A 1NU3A 3FCSB 2OTJ3 2QA43 1NDOB 1D6UA 2F99A 4RNYA 3S29A 3GWRA 1N5PA 2HMKB 2XGLA 4IPBA 1K734 1LOXA 3OXAA 2PZVA 3CCL3 1OCVA 1ZO2A 1A2VA 3FG1A 3HK4A 3SOYA 3CC23 4EV5A 5AIIA 1E97A 3D9RA 4K61A 1IK3A 3L0RA 4K1UA 1WQLB 4STDA 5CF1A 2CIUA 2E2VA 1DMNA 4XM4A 4Q53A 1AVLA 3JUNA 4HVNA 1Q40A 3CCJ3 4ORLA 1K9M4 1VQN3 3CPOA 4AKZA 1D6ZA 3FG4A 1US1A 1DMMA 2CFLA 4FCZA 3ALAA 1N9JA 2F86B 2QIYA 1W02A 3CPW2 4FCMA 5IG4A 2Q07A 1FGMA 1YGEA 2FXTA 1OHSA 4FMCA 4HKVB 2YFLB 3SLUA 1O7MB 3LTCA 1A90A 4KFDA 2Z7AA 5IEOA 1LXEA 3F8HA 3MHEA 3K63A 3B7CA 2WGQA 3EBYA 4TX4A 2ML6A 1IV7A 2W9PA 1KWIA 4EC6A 2IUJA 2BT3A 3V92A 4N6OB 3NQYA 1VQ43 4FMAA 1RRLA 5G2GA 4O8SA 2OWPA 3O8YA 1VQO3 1A67A 3S5CA 2WOHA 2XSHB 3BNCA 3WA2X 2V1LA 3FG3A 1E3VA 1OACA 1IVVA 5CLKA 1WTHA 3N9HA 3MSOA 5HGRA 1RJOA 4CCVA 4XBXA 1IQXA 3X41A 3JUQA 3KIIA 5JPPA 2UX0A 1VQ93 2P0XA 3AMOA 3BNBA 4XDWA 4O02B 4G1MB 2R4IA 5AI1A 1VQ63 5AYRB 4WFOA 3E99A 2GU1A 3G8ZA 2BMOB 1N8QA 4HZ9B 3PS8A 4R1KA 1EG9B 3JUMA 2FGTA 2W9QA 3PCRA 2CG0A 1TFOA 3IMAB 3VF1A 5D83A 3WA3A 3K9MC 3DY5A 4X2OA 3CME3 1VQ73 3DGOA 3ECFA 3JVCA 2W2CA 5CK6A 4X2HA 2M7OA 3WDGB 3LTBA 5D81A 1ASKA 1OH0A 3N54B 1IDPA 3LT9A 3LTDA 5ELUA 3UNLA 2XR8B 1VQM3 1TFKA 4EYCA 3NX0A 1A2KA 1OHOA 3KE7A 3X40A 2Z6BA 1YHQ3 2OQEA 4FR9A 3F40A 4MEIA 3S28A 1JV2B 1U8CB 1SIIA 1STDA 1VQL3 2IMJA 2W56A 3FH1A 3STDA 2Z76A 3CCR3 3UL5A 3GZRA 3NHXA 2ZL8A 4NHFA 5AIFA 1Y4KA 1O7HB 4MMXB 5EEOA 2CG1A 1LVNA 2D1WA 3DGLA 2BMQB 4WHAA 4MMZB 4AKYA 3WOFB 2ZDJA 3G4S3 4EV2A 1ISKA 1ZX2A 4ZM8A 1GS3A 1WNHA 3LMLA 4FMBA 3MWZA 1IVWA 3OX9A 2IA7A 1TU5A 4OVMA 4KFFA 1JJ22 4J8TA 5ELJA 4WYKB 4XBTA 1YJN3 1VQK3 5JBSA 2B24B 1JKGB 1GYBA 2YFJB 3X3ZA 1ULJB 1WMNA 1Z1SA 4HM1B 2KXGA 3G16A 5BXQA 2QEX3 1U5OA 4PEJA 5IG5A 4I4KA 5LC7A 2P38A 5FGOA 3BLZA 4N6V0 5CF2A 1QVG2 3EHCA 4R80A 2F98A 4AEQA 1JB5A 1YIT3 4WWUC 3B4PA 2BMRB 3I563 1JN5B 2QGUA 4RNZA 1QVF2 5IG3A 1O7PB 2GXFA 3CNMA 2XSOB 2WO0A 3GAXA 3EJVA 3RDEA 1CYVA 3CCV3 8CHOA 4HM2B 3X3XA 3PXMA 1YI23 1EA2A 3U1WA 1KQS2 4K90B 4IT7A 5IEPA 1SPUA 3NBBA 1IU7A 3KSED 3MYTA 2OOVA 3T8NA 5JPUA 1F8NA 3I553 4HZBB 3SXXA 3DZLA 4L8OA 3LTAA 4LSOA 4HM8B 1N9EA 1RKYA 4LMIA 2E2TA 3WMDA 1YIJ3 2KRTA 1UW1A 5IF6A 2OOVC 3GZBA 1W00A 1O7NB 3SVAA 5KP4A 3CD63 1Q864 4XDVA 2I9WA 3LYGA 4HM4B 3FGYA 4BTXA 2HMJB 3NQZA 3RGAA 3DXOA 2W0QA 2PNCA 2E2UA 2GEYA 3GRDA 3K5TA 4FMDA 1FA3A 1JB4A 1UI7A 2JDIH 4R9KA 3NV0B 4HM7B 5AIHA 5AYSC 1Q814 4XBYA 3QRDA 1W6YA 1IT8A 2B1XB 2XRXB 2P0MA 3EN1B 2LQVA 2CFWA 3OWYA 2XH9A 1ROVA 3HX8A 1OPYA 4LZIA 1OF5B 1CQSA 3DGMA 3J7Yd 1R4CA 3HZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A 4;  1W2B 2;  1M90 4;  3I55 3;  1NJI 4;  1KC8 4;  1KD1 4;  3CXC 2;  1QVG 2;  1VQM 3;  2OTL 3;  3G4S 3;  1Q81 4;  1N8R 4;  1VQ6 3;  1YIT 3;  3CCS 3;  1VQ8 3;  1VQ4 3;  1Q82 4;  3CCQ 3;  1VQ5 3;  3I56 3;  1YHQ 3;  1YJW 3;  3CMA 3;  3CCJ 3;  1VQO 3;  1YIJ 3;  1K9M 4;  1QVF 2;  1VQN 3;  3G6E 3;  1Q7Y 4;  3CCE 3;  1JJ2 2;  3G71 3;  3CC7 3;  2OTJ 3;  3CCM 3;  3CCV 3;  2QA4 3;  1M1K 4;  1YJ9 3;  1Q86 4;  1VQL 3;  3CD6 3;  3CPW 2;  1YJN 3;  1VQK 3;  1K73 4;  1YI2 3;  3CCR 3;  3CME 3;  1VQ7 3;  1KQS 2;  3CCL 3;  1VQP 3;  3CC4 3;  3OW2 2;  3CCU 3;  3CC2 3;  1S72 3;  2QEX 3;  1VQ9 3; 
#chains in the Genus database with same CATH topology
 3NBJ A;  3IJE B;  4HYZ A;  1CYU A;  1NJI 4;  3FZW A;  1BNG A;  4KVH A;  3ZFZ A;  5KP1 A;  1BRK A;  1SQW A;  3CXC 2;  5IG0 A;  1GOY A;  1EQK A;  1M9G A;  1VQ8 3;  3FF0 A;  3QK9 A;  1BSE A;  4WYK A;  1MNL A;  1ULI B;  2GEX A;  2ZA4 A;  2L1S A;  3H51 A;  1W7C A;  2P05 A;  1BRG A;  1JZO A;  3DGN A;  4OK0 A;  1BGS A;  4L7K A;  3WOE B;  6STD A;  1JKG A;  1QAF A;  2IUK A;  1T5Y A;  2INX A;  1HKX A;  2GBW B;  1IQ8 A;  1X1X A;  5AEW B;  5HOH A;  2CK3 H;  5M1A A;  1A2P A;  1MGR A;  1OGZ A;  4BIR A;  2YFI B;  4BTW A;  2JQ5 A;  1IVX A;  2CWV A;  4J5G A;  4J9A A;  2CX1 A;  1VQP 3;  3CNX A;  2KF4 A;  1X1W A;  3M8C A;  3VGN A;  3CCU 3;  1S72 3;  1JNQ A;  1GY5 A;  2KCD A;  1KSI A;  3MG3 A;  1K8A 4;  1JN5 A;  1RDS A;  1QJG A;  4N3V A;  3Q3F A;  1UCI A;  2IY2 A;  1BSB A;  1UGI A;  3AHS A;  1BNJ A;  4MJD A;  2RGQ A;  2KF5 A;  3KSP A;  2CX0 A;  2XFS A;  1MGW A;  3OWU A;  3F9S A;  3CCQ 3;  1MWU A;  3Q90 A;  1TJD A;  1D6Y A;  1TRP A;  2XGN A;  1RTU A;  1FUS A;  1JB2 A;  3FF2 A;  3LH4 A;  3OWS A;  3KKG A;  4CDL A;  1Q7H A;  1UUG B;  2CW9 A;  3A76 A;  1Q7Y 4;  3TDG A;  3X42 A;  3G71 3;  2CKF B;  3FSD A;  3NUV A;  2CC3 A;  1YJ9 3;  4O2H A;  1W5Z A;  1I2G A;  1RGA A;  1AV4 A;  3DMC A;  1O7G B;  1BUQ A;  1RRH A;  4EXR A;  2CFD A;  1DVC A;  4GB5 A;  1RGL A;  1SJW A;  3WOD G;  3HII A;  3F7X A;  1IVU A;  1QAK A;  3RGR A;  5IER A;  6RNT A;  5AEU B;  2MF7 A;  2W6J H;  4KFE A;  3SX1 A;  2J8X B;  3LOY A;  2HMM B;  5STD A;  2LYX A;  2GU3 A;  2CFG A;  2ML5 A;  3D4A A;  2STD A;  3NXJ A;  3T8U A;  1LNI A;  3MPH A;  3GZX B;  1V74 A;  3Q2P A;  1NNV A;  1YJW 3;  3CMA 3;  3PZW A;  2L4V A;  1TRQ A;  1VZZ A;  2MC8 A;  3EB8 A;  4FCJ A;  1MWR A;  4HJL B;  3U97 A;  4QWT A;  1M1K 4;  4RBN A;  3NV0 A;  2CFK A;  4H61 A;  3G0K A;  4RZM A;  3V99 A;  3IPT A;  2AAE A;  3B8L A;  1OUN A;  4WP5 A;  5FW5 A;  1RGC A;  2K54 A;  1NWW A;  1UGH I;  3EX9 A;  3LXU X;  1LNH A;  3T0U A;  1RLS A;  4N6T A;  2W56 B;  4H3U A;  4HM3 B;  4EBG A;  1M90 4;  1M1X B;  2UUG C;  3LT8 A;  2OCT A;  5TGN A;  1KD1 4;  3NBR A;  1G0T A;  4JF8 A;  1UUW B;  4JRF A;  1RMS A;  5EVH A;  2H0H A;  1TIJ A;  5D82 A;  3NM2 A;  4OUQ A;  5AIG A;  4LEH A;  3DM8 A;  3BIR A;  4R9L A;  3D79 A;  1OF5 A;  1V57 A;  5A0O B;  1I2F A;  3CCE 3;  3PGB A;  4HBR A;  3ER7 A;  1PU4 A;  1IQY A;  3K7C A;  1UUV B;  1Q42 A;  3V98 A;  4BL3 A;  1FW7 A;  3JUO A;  4HM5 B;  1G02 A;  1WMO A;  2BO9 B;  3FLJ A;  4LGQ A;  1TUH A;  5LC6 A;  2C4B A;  1SIH A;  2XFT A;  2BNG A;  1RGE A;  4K1V A;  2F5M A;  1HZ1 A;  4GHO A;  3F14 A;  3EQQ B;  4J5K A;  4EW5 A;  4N6N B;  4BU4 A;  1MOL A;  1STF I;  2GBX B;  3ROB A;  3N8B A;  4KZ1 A;  3CU3 A;  1BRS A;  2CH9 A;  4O3V A;  2RSX A;  3CCS 3;  2W03 A;  3H3H A;  3MG1 A;  1W2Z A;  5IW9 A;  3KFQ C;  2AAD A;  3SYU A;  1OHP A;  3G6E 3;  2O3O A;  1GY7 A;  1G96 A;  3DH2 A;  3CCM 3;  3MG2 A;  1YVB I;  1K41 A;  1IV9 A;  3K0Z A;  5BVB A;  1I70 A;  1RGH A;  1JRQ A;  1NB5 I;  1Q40 B;  3GZY B;  1BNE A;  2KF3 A;  4RNT A;  3S67 A;  1GMP A;  2SBL A;  3KN4 A;  2BHM A;  3VSY A;  1I0V A;  2HMN B;  3CC4 3;  3OW2 2;  3F7S A;  1RSN A;  1UI8 A;  3Q1C A;  1C7H A;  2CWU A;  1RN7 A;  1BAN A;  1GOV A;  1HU9 A;  4HM0 B;  1O7W B;  1CEW I;  1Q82 4;  5I97 A;  4BTY A;  1AR0 A;  1RCL A;  2XF3 A;  5G1K A;  2O9U X;  3F8X A;  1MWS A;  3WR2 A;  1C54 A;  3FKA A;  2IYJ A;  4HM6 B;  3OV4 A;  5BIR A;  3MKI A;  3LZA A;  2C11 A;  1VQQ A;  2CWT A;  5DRE A;  1AY7 A;  4GL6 A;  3B4O A;  1QMA A;  1ROA A;  1FGT A;  3DUK A;  4R4K A;  4MMY B;  4L8P A;  2C10 A;  1IT7 A;  1GD3 A;  1EUI C;  1RGF A;  1GD4 A;  1QAL A;  1W01 A;  3SED A;  5IEN A;  1E3R A;  2W04 A;  1BVI A;  2R41 A;  3PCS A;  1DMQ A;  3NM7 A;  1W2B 2;  3BB9 A;  2K0M A;  1PFP A;  1AQZ A;  3EE1 A;  1CH0 A;  2K3D A;  1FGO A;  2A15 A;  2OTL 3;  1FGR A;  1W6G A;  3SOA A;  2FNQ A;  2HML B;  1FGQ A;  1N5H A;  3AMO B;  4KT3 B;  3X3Y A;  3HI7 A;  4GSP A;  3HIG A;  1DYU A;  1GY6 A;  4N6L A;  4CJN A;  1DE3 A;  5KP3 A;  3I0Y A;  3D3L A;  1W6C A;  2Y73 A;  4IIA A;  3KZT A;  2XEP A;  3S27 A;  3CC7 3;  1W4N A;  1WMP A;  1MWT A;  4XB5 A;  8RNT A;  1RN4 A;  2P09 A;  2WGO A;  1EKM A;  4NRE A;  3UB1 A;  3ZG5 A;  2BU4 A;  1DVD A;  1B2U A;  5CXO A;  1L5G B;  1AVK A;  1X1Y A;  3RNT A;  2WOF A;  2Y74 A;  2OQE C;  4LYL B;  2RCD A;  3EN8 A;  3BNE A;  2GSP A;  2D42 A;  2YX9 A;  3BND A;  3D5G A;  2ZHX B;  2Z77 A;  1ZGX A;  5DRV A;  1FUW A;  1KC8 4;  1K28 A;  3PYJ A;  4N6U A;  2SAR A;  2RBI A;  3EC9 A;  5EQL A;  3D5I A;  3JUP A;  1N8R 4;  1GOU A;  3EBT A;  4N6M A;  1I8V A;  3EF8 A;  1NB3 I;  2RFR A;  7STD A;  1TP6 A;  1J2B A;  3UL6 A;  1S5A A;  3UJM A;  1NO3 A;  2CHC A;  2HMO B;  1OGX A;  4U13 A;  1JZD A;  1NU3 A;  3FCS B;  1UCK A;  2F56 A;  2OTJ 3;  1FYS A;  2QA4 3;  1NDO B;  1D6U A;  2F99 A;  4RNY A;  3S29 A;  1UCL A;  3GWR A;  1N5P A;  2HMK B;  2XGL A;  4IPB A;  1K73 4;  1LOX A;  3OXA A;  1ZS7 A;  2PZV A;  3CCL 3;  1OCV A;  1ZO2 A;  1A2V A;  3FG1 A;  3HK4 A;  3SOY A;  3CC2 3;  1LOV A;  1I3I A;  5AII A;  4EV5 A;  1BRN L;  1E97 A;  3D9R A;  1X1U A;  2KF6 A;  4K61 A;  1IK3 A;  3L0R A;  4BL2 A;  1VQ5 3;  4K1U A;  1TTO A;  1WQL B;  4STD A;  3AHW A;  5CF1 A;  2CIU A;  2E2V A;  1DMN A;  4XM4 A;  4Q53 A;  1JBR A;  1B2Z A;  1AVL A;  3JUN A;  4HVN A;  1Q40 A;  3CCJ 3;  4ORL A;  1K9M 4;  1VQN 3;  3CPO A;  4AKZ A;  1LQG C;  1D6Z A;  3FG4 A;  1US1 A;  1DMM A;  1HYF A;  2CFL A;  4FCZ A;  3ALA A;  1N9J A;  2F86 B;  2QIY A;  1B2S A;  1W02 A;  3CPW 2;  4NPB A;  1YVS A;  1B20 A;  4FCM A;  5IG4 A;  2Q07 A;  1FGM A;  1YGE A;  2FXT A;  1OHS A;  2H0I A;  4FMC A;  2YFL B;  4HKV B;  1O7M B;  3LTC A;  3SLU A;  1JBS A;  1A90 A;  4KFD A;  2Z7A A;  5IEO A;  1LXE A;  1UCJ A;  1BAO A;  3F8H A;  3K63 A;  3MHE A;  5GSP A;  3B7C A;  2WGQ A;  3EBY A;  4TX4 A;  2ML6 A;  1IV7 A;  2W9P A;  1KWI A;  4EC6 A;  2IUJ A;  2BT3 A;  2UGI A;  3V92 A;  1I2E A;  4N6O B;  3NQY A;  1VQ4 3;  3WHO A;  1GSP A;  4FMA A;  1RRL A;  5G2G A;  1RNB A;  4O8S A;  2OWP A;  3O8Y A;  1VQO 3;  1A67 A;  3S5C A;  2WOH A;  2XSH B;  3BNC A;  3WA2 X;  2V1L A;  3FG3 A;  1E3V A;  1I0X A;  3HOH A;  1OAC A;  1IVV A;  5CLK A;  1WTH A;  3URP A;  3N9H A;  3MSO A;  5HGR A;  1RJO A;  4CCV A;  4XBX A;  1IQX A;  1LOY A;  3X41 A;  3JUQ A;  3KII A;  5JPP A;  2UX0 A;  1VQ9 3;  2P0X A;  3AMO A;  3BNB A;  4ILF A;  4XDW A;  4O02 B;  4HOH A;  1B2X A;  4G1M B;  2R4I A;  5AI1 A;  1VQ6 3;  5AYR B;  4WFO A;  3E99 A;  1FUT A;  2GU1 A;  3G8Z A;  2BMO B;  1N8Q A;  4HZ9 B;  3PS8 A;  4R1K A;  1EG9 B;  3JUM A;  2FGT A;  2W9Q A;  3PCR A;  6GSP A;  1T3B A;  2CG0 A;  1TFO A;  3IMA B;  3VF1 A;  5D83 A;  7GSP A;  3WA3 A;  3K9M C;  2BIR A;  3DY5 A;  4X2O A;  1FZU A;  3CME 3;  1VQ7 3;  3DGO A;  3ECF A;  3JVC A;  2W2C A;  5CK6 A;  4X2H A;  2M7O A;  3WDG B;  3LTB A;  5D81 A;  1ASK A;  1OH0 A;  3N54 B;  1IDP A;  1BNS A;  3LT9 A;  5RNT A;  3LTD A;  5ELU A;  1B2M A;  2H0G A;  3UNL A;  1RN1 A;  1UDI I;  2XR8 B;  1VQM 3;  1TFK A;  4EYC A;  3NX0 A;  1BRH A;  1A2K A;  1OHO A;  3KE7 A;  3X40 A;  2Z6B A;  1YHQ 3;  2OQE A;  4FR9 A;  3F40 A;  4MEI A;  9RNT A;  5M18 A;  3S28 A;  1JV2 B;  1U8C B;  3AGO A;  1SII A;  1STD A;  1VQL 3;  2IMJ A;  2W56 A;  3FH1 A;  3STD A;  2Z76 A;  3CCR 3;  3UL5 A;  3GZR A;  3NHX A;  2ZL8 A;  1EEJ A;  4NHF A;  5AIF A;  1Y4K A;  1O7H B;  4MMX B;  5EEO A;  2CG1 A;  1LVN A;  1B27 A;  2D1W A;  3DGL A;  1I3F A;  2BMQ B;  4WHA A;  4MMZ B;  4AKY A;  1JBT A;  3WOF B;  2ZDJ A;  1YNV X;  1BOX A;  1LRA A;  3G4S 3;  4EV2 A;  1ISK A;  1ZX2 A;  4ZM8 A;  1GS3 A;  1WNH A;  1RGK A;  3LML A;  5BU4 A;  4FMB A;  3MWZ A;  1GMR A;  1IVW A;  3OX9 A;  2IA7 A;  5G1L A;  1V58 A;  1TU5 A;  7RNT A;  1B21 A;  4OVM A;  4KFF A;  1JJ2 2;  5M19 A;  4J8T A;  5ELJ A;  4WYK B;  4XBT A;  1YJN 3;  1VQK 3;  5JBS A;  2B24 B;  1JKG B;  1GYB A;  2YFJ B;  3X3Z A;  3KCH A;  1ULJ B;  1WMN A;  1Z1S A;  4HM1 B;  3BU4 A;  2KXG A;  3G16 A;  5BXQ A;  1BSC A;  2QEX 3;  1U5O A;  4PEJ A;  5IG5 A;  4I4K A;  5LC7 A;  2P38 A;  4DKI A;  5FGO A;  3BLZ A;  4N6V 0;  1BRJ A;  3GSP A;  5CF2 A;  1QVG 2;  3EHC A;  4R80 A;  2F98 A;  4AEQ A;  1LOW A;  2F5W A;  1JB5 A;  1YIT 3;  2F4Y A;  3A5E A;  4WWU C;  3B4P A;  4HAA A;  2BMR B;  3I56 3;  1JN5 B;  2QGU A;  4RNZ A;  1QVF 2;  1IYY A;  5IG3 A;  1BSD A;  1O7P B;  2GXF A;  3CNM A;  4I5Q A;  2XSO B;  1GMQ A;  2WO0 A;  3GAX A;  3EJV A;  3RDE A;  1CYV A;  3CCV 3;  8CHO A;  1SAR A;  1BU4 A;  4HM2 B;  3PXM A;  3X3X A;  1PY3 A;  1YI2 3;  1EA2 A;  1RNT A;  3U1W A;  1KQS 2;  3AGN A;  1BNF A;  4IT7 A;  4K90 B;  5IEP A;  1SPU A;  3NBB A;  1IU7 A;  3KSE D;  3MYT A;  2OOV A;  3T8N A;  5JPU A;  1F8N A;  3I55 3;  4HZB B;  3SXX A;  1RCK A;  3DZL A;  4L8O A;  3ZG0 A;  3LTA A;  1DET A;  1T2I A;  4LSO A;  4HM8 B;  1N9E A;  1RKY A;  4LMI A;  2E2T A;  2KAA A;  3WMD A;  1BUJ A;  1YIJ 3;  2KRT A;  1UW1 A;  5IF6 A;  2OOV C;  3GZB A;  1W00 A;  1BNI A;  1O7N B;  3SVA A;  5KP4 A;  1BIR A;  1Q86 4;  4XDV A;  3CD6 3;  2I9W A;  3LYG A;  4HM4 B;  3FGY A;  4BTX A;  1YGW A;  2HMJ B;  3NQZ A;  3RGA A;  3DXO A;  2PNC A;  2W0Q A;  2E2U A;  2GEY A;  3GRD A;  3K5T A;  4FMD A;  1FA3 A;  1JB4 A;  1UI7 A;  2JDI H;  4R9K A;  3NV0 B;  1R4Y A;  1T2H A;  4HM7 B;  5AIH A;  5AYS C;  1Q81 4;  4XBY A;  3QRD A;  1W6Y A;  1IT8 A;  2B1X B;  4CPK A;  2XRX B;  2P0M A;  3EN1 B;  1B3S A;  2LQV A;  1BRI A;  1BNR A;  1RHL A;  2CFW A;  3DGY A;  3OWY A;  2XH9 A;  1BSA A;  1ROV A;  3HX8 A;  1PYL A;  1OPY A;  2HOH A;  4LZI A;  2RNT A;  1OF5 B;  1CQS A;  1LQM B;  3DGM A;  3J7Y d;  1RGG A;  1R4C A;  3HZP A;  1Q9E A; 
#chains in the Genus database with same CATH homology
 3NBJ A;  3IJE B;  4HYZ A;  1CYU A;  1NJI 4;  3FZW A;  4KVH A;  5KP1 A;  1SQW A;  3CXC 2;  5IG0 A;  1EQK A;  1M9G A;  1VQ8 3;  3FF0 A;  3QK9 A;  4WYK A;  1VQ5 3;  1MNL A;  1ULI B;  2GEX A;  3H51 A;  4NRE A;  5I97 A;  1W7C A;  2P05 A;  3DGN A;  4OK0 A;  6STD A;  4L7K A;  3WOE B;  1JKG A;  1QAF A;  2IUK A;  1T5Y A;  2INX A;  1HKX A;  2GBW B;  1IQ8 A;  5AEW B;  2CK3 H;  1OGZ A;  4BTW A;  2YFI B;  2JQ5 A;  1IVX A;  2CWV A;  4J9A A;  1VQP 3;  3CNX A;  3CCU 3;  3M8C A;  3VGN A;  1S72 3;  1JNQ A;  1GY5 A;  2KCD A;  1KSI A;  3MG3 A;  1K8A 4;  1JN5 A;  1QJG A;  4N3V A;  4MJD A;  2RGQ A;  3KSP A;  2XFS A;  3OWU A;  3F9S A;  3CCQ 3;  3Q90 A;  2XGN A;  1D6Y A;  3FF2 A;  1JB2 A;  3LH4 A;  3OWS A;  3KKG A;  4CDL A;  1Q7Y 4;  2CW9 A;  3A76 A;  3TDG A;  3X42 A;  3G71 3;  2CKF B;  3FSD A;  3NUV A;  2CC3 A;  1YJ9 3;  4O2H A;  1W5Z A;  3DMC A;  1AV4 A;  1O7G B;  1BUQ A;  1RRH A;  4EXR A;  2CFD A;  1DVC A;  4GB5 A;  1SJW A;  3WOD G;  3HII A;  3F7X A;  1IVU A;  1QAK A;  3RGR A;  5IER A;  5AEU B;  2MF7 A;  2W6J H;  4KFE A;  3SX1 A;  3LOY A;  2HMM B;  5STD A;  2LYX A;  2GU3 A;  2CFG A;  2ML5 A;  3T8U A;  2STD A;  3NXJ A;  1YJW 3;  3CMA 3;  3MPH A;  3GZX B;  1V74 A;  3Q2P A;  3PZW A;  2L4V A;  1VZZ A;  2MC8 A;  3EB8 A;  4FCJ A;  4HJL B;  3U97 A;  4QWT A;  1M1K 4;  4RBN A;  3NV0 A;  2CFK A;  4H61 A;  3G0K A;  4RZM A;  3V99 A;  3IPT A;  3B8L A;  1OUN A;  4WP5 A;  5FW5 A;  2K54 A;  1NWW A;  3EX9 A;  3LXU X;  1LNH A;  3T0U A;  4N6T A;  2W56 B;  4H3U A;  4HM3 B;  4EBG A;  1M90 4;  1M1X B;  3LT8 A;  2OCT A;  5TGN A;  1KD1 4;  3NBR A;  4JF8 A;  1UUW B;  4JRF A;  5EVH A;  1TIJ A;  5D82 A;  3NM2 A;  4OUQ A;  5AIG A;  4LEH A;  3DM8 A;  4R9L A;  1OF5 A;  5A0O B;  3CCE 3;  3PGB A;  4HBR A;  3ER7 A;  1PU4 A;  1IQY A;  3K7C A;  1UUV B;  1Q42 A;  3V98 A;  3JUO A;  4HM5 B;  1WMO A;  2BO9 B;  3FLJ A;  4LGQ A;  1TUH A;  5LC6 A;  2XFT A;  1SIH A;  2BNG A;  4K1V A;  3F14 A;  3EQQ B;  4N6N B;  1MOL A;  1STF I;  2GBX B;  3ROB A;  3N8B A;  4KZ1 A;  3CU3 A;  2CH9 A;  4O3V A;  3CCS 3;  2RSX A;  2W03 A;  3H3H A;  3MG1 A;  1W2Z A;  5IW9 A;  3KFQ C;  1OHP A;  3G6E 3;  2O3O A;  1GY7 A;  1G96 A;  3CCM 3;  3MG2 A;  1K41 A;  1YVB I;  1IV9 A;  3K0Z A;  5BVB A;  1JRQ A;  1NB5 I;  1Q40 B;  3GZY B;  3S67 A;  2SBL A;  3KN4 A;  2BHM A;  3VSY A;  2HMN B;  3CC4 3;  3OW2 2;  3F7S A;  1UI8 A;  3Q1C A;  1C7H A;  2CWU A;  1RN7 A;  1HU9 A;  4HM0 B;  1O7W B;  1CEW I;  1Q82 4;  4BTY A;  1AR0 A;  2XF3 A;  2O9U X;  3F8X A;  3FKA A;  4HM6 B;  3OV4 A;  3MKI A;  3LZA A;  2C11 A;  2CWT A;  5DRE A;  4GL6 A;  3B4O A;  1QMA A;  1ROA A;  1FGT A;  3DUK A;  4R4K A;  4MMY B;  4L8P A;  2C10 A;  1IT7 A;  1GD3 A;  1GD4 A;  1QAL A;  1W01 A;  3SED A;  5IEN A;  1E3R A;  2W04 A;  3PCS A;  1DMQ A;  3NM7 A;  1W2B 2;  3BB9 A;  2K0M A;  1PFP A;  3EE1 A;  2OTL 3;  1FGO A;  2A15 A;  1FGR A;  1W6G A;  3SOA A;  2FNQ A;  2HML B;  3AMO B;  1FGQ A;  1N5H A;  3X3Y A;  3HI7 A;  3HIG A;  1DYU A;  1GY6 A;  5KP3 A;  3I0Y A;  3D3L A;  1W6C A;  2Y73 A;  4IIA A;  3KZT A;  2XEP A;  3S27 A;  3CC7 3;  1W4N A;  1WMP A;  4XB5 A;  2P09 A;  2WGO A;  1EKM A;  3UB1 A;  1DVD A;  5CXO A;  1L5G B;  1AVK A;  2WOF A;  2Y74 A;  2OQE C;  2RCD A;  3EN8 A;  3BNE A;  2YX9 A;  2D42 A;  3BND A;  4N6L A;  5DRV A;  2Z77 A;  1FUW A;  1KC8 4;  1K28 A;  3PYJ A;  4N6U A;  3EC9 A;  5EQL A;  3JUP A;  1N8R 4;  3EBT A;  4N6M A;  3EF8 A;  1NB3 I;  2RFR A;  7STD A;  1TP6 A;  1J2B A;  3UL6 A;  1S5A A;  3UJM A;  1NO3 A;  2CHC A;  2HMO B;  1OGX A;  4U13 A;  1NU3 A;  3FCS B;  2OTJ 3;  2QA4 3;  1NDO B;  1D6U A;  2F99 A;  4RNY A;  3S29 A;  3GWR A;  1N5P A;  2HMK B;  2XGL A;  4IPB A;  1K73 4;  1LOX A;  3OXA A;  2PZV A;  3CCL 3;  1OCV A;  1ZO2 A;  1A2V A;  3FG1 A;  3HK4 A;  3SOY A;  3CC2 3;  4EV5 A;  5AII A;  1E97 A;  3D9R A;  4K61 A;  1IK3 A;  3L0R A;  4K1U A;  1WQL B;  4STD A;  5CF1 A;  2CIU A;  2E2V A;  1DMN A;  4XM4 A;  4Q53 A;  1AVL A;  3JUN A;  4HVN A;  1Q40 A;  3CCJ 3;  4ORL A;  1K9M 4;  1VQN 3;  3CPO A;  4AKZ A;  1D6Z A;  3FG4 A;  1US1 A;  1DMM A;  2CFL A;  4FCZ A;  3ALA A;  1N9J A;  2F86 B;  2QIY A;  1W02 A;  3CPW 2;  4FCM A;  5IG4 A;  2Q07 A;  1FGM A;  1YGE A;  2FXT A;  1OHS A;  4FMC A;  4HKV B;  2YFL B;  3SLU A;  1O7M B;  3LTC A;  1A90 A;  4KFD A;  2Z7A A;  5IEO A;  1LXE A;  3F8H A;  3MHE A;  3K63 A;  3B7C A;  2WGQ A;  3EBY A;  4TX4 A;  2ML6 A;  1IV7 A;  2W9P A;  1KWI A;  4EC6 A;  2IUJ A;  2BT3 A;  3V92 A;  4N6O B;  3NQY A;  1VQ4 3;  4FMA A;  1RRL A;  5G2G A;  4O8S A;  2OWP A;  3O8Y A;  1VQO 3;  1A67 A;  3S5C A;  2WOH A;  2XSH B;  3BNC A;  3WA2 X;  2V1L A;  3FG3 A;  1E3V A;  1OAC A;  1IVV A;  5CLK A;  1WTH A;  3N9H A;  3MSO A;  5HGR A;  1RJO A;  4CCV A;  4XBX A;  1IQX A;  3X41 A;  3JUQ A;  3KII A;  5JPP A;  2UX0 A;  1VQ9 3;  2P0X A;  3AMO A;  3BNB A;  4XDW A;  4O02 B;  4G1M B;  2R4I A;  5AI1 A;  1VQ6 3;  5AYR B;  4WFO A;  3E99 A;  2GU1 A;  3G8Z A;  2BMO B;  1N8Q A;  4HZ9 B;  3PS8 A;  4R1K A;  1EG9 B;  3JUM A;  2FGT A;  2W9Q A;  3PCR A;  2CG0 A;  1TFO A;  3IMA B;  3VF1 A;  5D83 A;  3WA3 A;  3K9M C;  3DY5 A;  4X2O A;  3CME 3;  1VQ7 3;  3DGO A;  3ECF A;  3JVC A;  2W2C A;  5CK6 A;  4X2H A;  2M7O A;  3WDG B;  3LTB A;  5D81 A;  1ASK A;  1OH0 A;  3N54 B;  1IDP A;  3LT9 A;  3LTD A;  5ELU A;  3UNL A;  2XR8 B;  1VQM 3;  1TFK A;  4EYC A;  3NX0 A;  1A2K A;  1OHO A;  3KE7 A;  3X40 A;  2Z6B A;  1YHQ 3;  2OQE A;  4FR9 A;  3F40 A;  4MEI A;  3S28 A;  1JV2 B;  1U8C B;  1SII A;  1STD A;  1VQL 3;  2IMJ A;  2W56 A;  3FH1 A;  3STD A;  2Z76 A;  3CCR 3;  3UL5 A;  3GZR A;  3NHX A;  2ZL8 A;  4NHF A;  5AIF A;  1Y4K A;  1O7H B;  4MMX B;  5EEO A;  2CG1 A;  1LVN A;  2D1W A;  3DGL A;  2BMQ B;  4WHA A;  4MMZ B;  4AKY A;  3WOF B;  2ZDJ A;  3G4S 3;  4EV2 A;  1ISK A;  1ZX2 A;  4ZM8 A;  1GS3 A;  1WNH A;  3LML A;  4FMB A;  3MWZ A;  1IVW A;  3OX9 A;  2IA7 A;  1TU5 A;  4OVM A;  4KFF A;  1JJ2 2;  4J8T A;  5ELJ A;  4WYK B;  4XBT A;  1YJN 3;  1VQK 3;  5JBS A;  2B24 B;  1JKG B;  1GYB A;  2YFJ B;  3X3Z A;  1ULJ B;  1WMN A;  1Z1S A;  4HM1 B;  2KXG A;  3G16 A;  5BXQ A;  2QEX 3;  1U5O A;  4PEJ A;  5IG5 A;  4I4K A;  5LC7 A;  2P38 A;  5FGO A;  3BLZ A;  4N6V 0;  5CF2 A;  1QVG 2;  3EHC A;  4R80 A;  2F98 A;  4AEQ A;  1JB5 A;  1YIT 3;  4WWU C;  3B4P A;  2BMR B;  3I56 3;  1JN5 B;  2QGU A;  4RNZ A;  1QVF 2;  5IG3 A;  1O7P B;  2GXF A;  3CNM A;  2XSO B;  2WO0 A;  3GAX A;  3EJV A;  3RDE A;  1CYV A;  3CCV 3;  8CHO A;  4HM2 B;  3X3X A;  3PXM A;  1YI2 3;  1EA2 A;  3U1W A;  1KQS 2;  4K90 B;  4IT7 A;  5IEP A;  1SPU A;  3NBB A;  1IU7 A;  3KSE D;  3MYT A;  2OOV A;  3T8N A;  5JPU A;  1F8N A;  3I55 3;  4HZB B;  3SXX A;  3DZL A;  4L8O A;  3LTA A;  4LSO A;  4HM8 B;  1N9E A;  1RKY A;  4LMI A;  2E2T A;  3WMD A;  1YIJ 3;  2KRT A;  1UW1 A;  5IF6 A;  2OOV C;  3GZB A;  1W00 A;  1O7N B;  3SVA A;  5KP4 A;  3CD6 3;  1Q86 4;  4XDV A;  2I9W A;  3LYG A;  4HM4 B;  3FGY A;  4BTX A;  2HMJ B;  3NQZ A;  3RGA A;  3DXO A;  2W0Q A;  2PNC A;  2E2U A;  2GEY A;  3GRD A;  3K5T A;  4FMD A;  1FA3 A;  1JB4 A;  1UI7 A;  2JDI H;  4R9K A;  3NV0 B;  4HM7 B;  5AIH A;  5AYS C;  1Q81 4;  4XBY A;  3QRD A;  1W6Y A;  1IT8 A;  2B1X B;  2XRX B;  2P0M A;  3EN1 B;  2LQV A;  2CFW A;  3OWY A;  2XH9 A;  1ROV A;  3HX8 A;  1OPY A;  4LZI A;  1OF5 B;  1CQS A;  3DGM A;  3J7Y d;  1R4C A;  3HZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...