2MC8A

Nmr structure of protein rumgna_01855 from ruminococcus gnavus atcc 29149
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
GEILKELPEGFDKETVRKQAMEDIEIAQSKDYESWKSRFTKDLQSSLTEESYDSYLKILEKQGEFKEFGKCTYLGQIKDNKKYGGVIIVVKYEEGNVNYSLAYDEDMNLVSFTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of a protein RUMGNA_01855 from Ruminococcus gnavus ATCC 29149
rcsb
source organism Ruminococcus gnavus
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13026 DUF3887 Protein of unknown function (DUF3887)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.590 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2mc8A00
4HYZA 2MC8A
chains in the Genus database with same CATH superfamily
3TDGA 1PYLA 1YNVX 1LNHA 2HMJB 4EXRA 3BB9A 1O7GB 1UUVB 1Q824 1DVDA 2ZDJA 4BTYA 2Q07A 1KSIA 2QGUA 4MMZB 2CWTA 1IT8A 3SYUA 3CNXA 3N8BA 1RDSA 2XRXB 1SIIA 3PCRA 1RCKA 6STDA 5TGNA 3S67A 1BIRA 1JZOA 1NO3A 4LEHA 4N6NB 1CH0A 2HMOB 3B7CA 3S28A 1JNQA 1EEJA 4KFFA 1RKYA 1BNJA 3PZWA 1JJ22 3EF8A 1W2ZA 1YGEA 2O3OA 1UGHI 4X2HA 3LT9A 3WDGB 3CCQ3 3D5IA 2CX1A 3AHWA 3CCE3 2ZL8A 1KC84 1VQ93 1RN1A 4FMBA 1IV9A 2HMMB 3Q2PA 1LOYA 1IVVA 1ASKA 3OX9A 1DMMA 5RNTA 1K734 4GSPA 3NQZA 7STDA 2F99A 1W01A 1OHSA 3DGLA 3PCSA 4N6LA 3RGAA 3CCJ3 3UB1A 2GU3A 2W56B 2W9PA 2GXFA 3QK9A 3LTCA 1LOVA 1UDII 4DKIA 1FGTA 2PNCA 4K61A 4BIRA 1B3SA 1TFOA 2W56A 2XFSA 3NXJA 1J2BA 1Q40B 3F9SA 1FUSA 1G0TA 4NHFA 3G6E3 1KD14 1B2MA 5EVHA 1AV4A 1DMNA 3DMCA 4IPBA 3STDA 1EKMA 4N6TA 1U5OA 3HI7A 3KZTA 2ML6A 1N8QA 2A15A 5FGOA 1A67A 3ER7A 3S29A 5KP4A 1BNGA 2SARA 2CG1A 4BL3A 1W6CA 1BRNL 1BANA 4KT3B 1NU3A 1NWWA 1NJI4 2WGQA 4LZIA 1OGZA 1Z1SA 1UUGB 2HMNB 4ZM8A 1C54A 5KP3A 4MMYB 1UI8A 2LQVA 3HZPA 1UCLA 3GZXB 2P0MA 1JZDA 4KZ1A 3L0RA 2F56A 2QEX3 2B1XB 2Y74A 3KSPA 1G96A 3MG2A 4RNZA 1OCVA 2E2VA 3DZLA 1IVWA 3CME3 2KRTA 4WYKB 1OUNA 1D6ZA 1VQQA 1GOVA 2Z6BA 1RCLA 3PXMA 3WOFB 1ZX2A 2FNQA 5IG5A 3OXAA 1AVKA 4H61A 4O8SA 2CX0A 1KWIA 1RSNA 3I0YA 1JRQA 3NBJA 3K0ZA 2ZA4A 3KSED 4HZ9B 4O2HA 1GMRA 2F5MA 4J8TA 5CF2A 4RZMA 1FGMA 1FUTA 1I8VA 2KCDA 3IMAB 3NM7A 4XM4A 2CW9A 3PS8A 3A5EA 3OWSA 3MSOA 1LRAA 1VQM3 3MG3A 3NQYA 1WMPA 4WHAA 1FGRA 2O9UX 2RBIA 3G8ZA 1FGQA 4O02B 1JKGA 1QMAA 4AKZA 1BOXA 1N5PA 2CG0A 2KF3A 3DGNA 1BNEA 4LMIA 5AIGA 5IG0A 2BO9B 3CXC2 3JUOA 3Q90A 1TRQA 1GD3A 3FGYA 1I3FA 2J8XB 1VQ43 1DYUA 1TFKA 2C10A 2XFTA 3F8HA 1RN7A 2XGLA 4FCZA 1BNSA 4K90B 1CQSA 1WMOA 2WGOA 3DGYA 3LYGA 4HM8B 9RNTA 1JN5A 1EUIC 3CC23 3FF0A 3SX1A 5DRVA 1STFI 4GL6A 2GBWB 5HOHA 1A2VA 1TP6A 5AYRB 2CWUA 2CHCA 1LNIA 2F4YA 2H0IA 3D3LA 3FKAA 5M1AA 1O7NB 2RCDA 1OH0A 1OF5A 4N6UA 1EA2A 4RNTA 4N6MA 2KXGA 2Z77A 3JUPA 3CCU3 1B2SA 1VQN3 1UI7A 1W6YA 2HMLB 1FUWA 1JBTA 1N9JA 3NX0A 5BU4A 4XBXA 1W7CA 2BMOB 2C4BA 3DY5A 2V1LA 1GS3A 3JUQA 3WHOA 3WA3A 1LOWA 2CH9A 3FH1A 2FXTA 1TUHA 3GZYB 3F14A 4H3UA 1S5AA 4PEJA 1MNLA 1Q40A 1STDA 4EC6A 1N9EA 3HK4A 5EQLA 1RGCA 4HAAA 4R4KA 1RMSA 1UCKA 3U1WA 2AAEA 1FA3A 4G1MB 2CC3A 1ULJB 2PZVA 3CNMA 2HMKB 3OWUA 3ZG0A 3DM8A 3AHSA 3SOYA 3LTBA 1AQZA 2RSXA 4CCVA 3CCM3 2UGIA 1NNVA 5AEWB 4HM2B 4HM7B 1K8A4 1O7PB 3F7SA 1BRIA 1FZUA 1IU7A 3FG1A 1MGWA 3FCSB 1YJN3 1RRHA 1DETA 3F40A 1B20A 2E2UA 5CF1A 2MF7A 1SJWA 1PY3A 2H0HA 1YIJ3 1VQ63 1QAKA 4N3VA 1M1K4 3WA2X 1I0VA 4HZBB 1EQKA 2CWVA 2BU4A 3RGRA 1IYYA 5G1LA 1IQXA 1W00A 3BLZA 2W6JH 3V92A 1BGSA 4LYLB 1U8CB 1PFPA 1O7WB 3FSDA 3O8YA 5IENA 1L5GB 3ALAA 5A0OB 3D79A 3FG4A 2IUKA 4CPKA 1I3IA 1X1WA 3SEDA 1DMQA 2Z76A 1FW7A 4I5QA 4QWTA 1BRSA 1BRJA 1W2B2 1NB3I 4EV2A 3CC43 3MG1A 4XBYA 8RNTA 2D42A 4Q53A 1LQGC 4FMCA 2CK3H 2Y73A 1GY7A 2IUJA 1T5YA 1YHQ3 1Q7HA 1RN4A 3KIIA 2OWPA 3KN4A 3VGNA 1YVSA 1PU4A 3I563 3X3XA 3WODG 1RNTA 2OCTA 1IDPA 3X40A 3EC9A 4XB5A 3HIIA 3SVAA 1GMPA 3G16A 5BVBA 1RGAA 1K9M4 1AY7A 2BMQB 3MYTA 5IW9A 3GZRA 1X1XA 4ORLA 2SBLA 1G02A 1JV2B 1MWTA 1ZS7A 1JB4A 1M1XB 1YJW3 2KF6A 4K1VA 3S27A 1AR0A 3ZFZA 3WOEB 3I553 3CD63 1I70A 3BNDA 1VQ83 3K63A 4R80A 5ELJA 4MMXB 4O3VA 1NB5I 3FG3A 1JB2A 1BSAA 2BMRB 2L1SA 2GBXB 1Q864 3AMOB 1EG9B 1IT7A 5JPPA 1RRLA 2CFKA 1FGOA 5ELUA 3NM2A 5G1KA 3EE1A 3IPTA 4HM1B 2GEXA 3MHEA 2YFLB 4OUQA 2OOVC 1R4CA 3VSYA 2IMJA 3Q1CA 1JBRA 1O7HB 4J9AA 3G713 2LYXA 2W9QA 5AI1A 3LTDA 1BRHA 4XBTA 1WNHA 1TIJA 4GHOA 2QA43 3PYJA 2OQEA 1Q7Y4 1UCJA 1GOUA 2BHMA 2YFJB 3NBRA 3PGBA 2OTJ3 2RFRA 1IQ8A 1LXEA 1OGXA 4STDA 1BRGA 3JUMA 2RNTA 3CCR3 1BNFA 1D6UA 4FCMA 1JBSA 2OTL3 1GD4A 3HX8A 1AVLA 4FMAA 3LT8A 1GOYA 1GY5A 1T2IA 1YVBI 1YI23 3BNBA 3SLUA 2B24B 5BIRA 4N6OB 5AIHA 1MWUA 1ZGXA 3H51A 1WTHA 5EEOA 4AEQA 1O7MB 1CYUA 4KFDA 1YIT3 1ROAA 5AEUB 1VQK3 3GAXA 4HVNA 4BL2A 1BAOA 1SIHA 1WQLB 3CCV3 2CFGA 1GYBA 3J7Yd 5GSPA 1OACA 3EJVA 1HKXA 2W04A 3EN1B 4HM0B 3G4S3 2L4VA 1BRKA 5FW5A 3ROBA 4HM3B 3D9RA 4EW5A 1Q42A 4R1KA 1UGIA 1RJOA 5M19A 1RGEA 1RGLA 1W4NA 5AYSC 3EN8A 3K9MC 1W5ZA 2CKFB 2INXA 1ULIB 3K7CA 4J5GA 2OOVA 4EYCA 4FMDA 4HM5B 3LOYA 1IV7A 1GSPA 3AGNA 3B4PA 3FZWA 3JUNA 3X3YA 4CDLA 2KF4A 1T3BA 1R4YA 2KF5A 2GU1A 3V99A 7GSPA 3UJMA 2W0QA 4EV5A 5IG4A 1V74A 2JDIH 4BU4A 5D83A 2KAAA 1T2HA 2I9WA 3LZAA 1VQP3 4ILFA 3KFQC 1OHPA 1SPUA 4KFEA 1ISKA 1A90A 3NV0A 1K41A 3B4OA 3WMDA 3LMLA 4WYKA 4XDVA 3T8NA 1ROVA 1X1UA 1BNIA 2BIRA 2HOHA 1SARA 3LH4A 1B2UA 4HBRA 5IERA 5JBSA 1RGGA 1RNBA 3CU3A 3NV0B 1YGWA 1IK3A 4HOHA 2XH9A 2P09A 4OVMA 3HOHA 3GRDA 6RNTA 4RBNA 1IQYA 1UCIA 3CCS3 1HYFA 3IJEB 4HM6B 3CCL3 1E3VA 1BU4A 1GMQA 1LOXA 4HKVB 1HU9A 1QALA 4L7KA 5DREA 4MEIA 1TTOA 1DE3A 3FLJA 5LC7A 2P0XA 1VQO3 2UX0A 4OK0A 1SQWA 1Y4KA 3K5TA 4K1UA 2XGNA 2F86B 5KP1A 1BNRA 3F8XA 5IEPA 1UUWB 4MJDA 4GB5A 3GSPA 4JF8A 1QVF2 1KQS2 4FR9A 3CMA3 2XF3A 2BT3A 1CYVA 5I97A 3EBYA 3N54B 2IYJA 2STDA 4WP5A 2RGQA 3A76A 5JPUA 1MOLA 4EBGA 5BXQA 3RNTA 3EX9A 2W03A 3DGMA 3U97A 3URPA 3MKIA 1X1YA 2R41A 5IG3A 1GY6A 3VF1A 3CC73 2XSHB 4J5KA 1I2FA 1I2EA 1IVXA 1BSCA 2BNGA 5M18A 1BUQA 2FGTA 1JN5B 2ML5A 3H3HA 2K3DA 1MWSA 2WOHA 6GSPA 2CFDA 3OV4A 2YFIB 1RGKA 1C7HA 1WMNA 4TX4A 2ZHXB 2XSOB 3DUKA 4XDWA 3WR2A 1S723 3D4AA 3GWRA 1FYSA 5LC6A 3EHCA 2F5WA 5STDA 2GEYA 3ZG5A 1N8R4 4N6V0 8CHOA 5CK6A 1VQ73 1UW1A 3RDEA 1VQL3 3MPHA 1RTUA 2P38A 1IVUA 1M904 3OWYA 1YJ93 1TJDA 4CJNA 1NDOB 3BNEA 4NPBA 3S5CA 2C11A 1OPYA 2M7OA 4AKYA 1RGHA 3ECFA 1E97A 3KE7A 1CEWI 1MGRA 5AIIA 2CFLA 1TU5A 1B21A 3UL6A 1TRPA 1RHLA 3JVCA 5CXOA 3EB8A 1V57A 3LXUX 1RGFA 3NBBA 4L8PA 3HIGA 3AMOA 2K0MA 4R9KA 1I0XA 1V58A 5IEOA 1BSDA 1M9GA 1QAFA 2OQEC 3SXXA 1B2ZA 2IY2A 4WFOA 2AADA 2Z7AA 1VQ53 2XR8B 4I4KA 3T8UA 3EBTA 3BNCA 1RLSA 3CPOA 1I2GA 7RNTA 2K54A 3N9HA 5AIFA 1QJGA 4KVHA 4R9LA 2YX9A 3V98A 1OF5B 1A2PA 1E3RA 2D1WA 2IA7A 1BVIA 3FF2A 4FCJA 5CLKA 1BSEA 3X42A 3CPW2 1W6GA 2E2TA 2P05A 4HYZA 2H0GA 1BUJA 2GSPA 3DGOA 2F98A 3EQQB 3GZBA 3BIRA 3T0UA 3UNLA 1W02A 2JQ5A 4WWUC 4U13A 2WOFA 1BSBA 4HM4B 3M8CA 5IF6A 4L8OA 1QVG2 1F8NA 3KKGA 3DH2A 2MC8A 2UUGC 1MWRA 3LTAA 1HZ1A 4LGQA 4IIAA 3B8LA 1Q814 2CFWA 1LQMB 4JRFA 2R4IA 5D81A 4BTWA 4BTXA 3SOAA 1K28A 2W2CA 3D5GA 1US1A 1D6YA 1VZZA 4LSOA 4RNYA 1B27A 3X41A 2CIUA 1A2KA 2WO0A 3F7XA 3NUVA 1Q9EA 5G2GA 3DXOA 2QIYA 1JKGB 3UL5A 3MWZA 3NHXA 4X2OA 3G0KA 3X3ZA 1JB5A 5D82A 2XEPA 5HGRA 1ZO2A 3OW22 1OHOA 3BU4A 1DVCA 4IT7A 3AGOA 3KCHA 3Q3FA 4HJLB 3QRDA 3E99A 1LVNA 1N5HA 1B2XA 4NREA
chains in the Genus database with same CATH topology
3TDGA 1LNHA 2HMJB 4EXRA 3BB9A 1O7GB 1UUVB 1Q824 1DVDA 2ZDJA 4BTYA 2Q07A 1KSIA 2QGUA 4MMZB 2CWTA 1IT8A 3CNXA 3N8BA 2XRXB 1SIIA 3PCRA 6STDA 5TGNA 3S67A 4LEHA 1NO3A 4N6NB 3B7CA 2HMOB 3S28A 1JNQA 4KFFA 1RKYA 3PZWA 1JJ22 3EF8A 1W2ZA 1YGEA 2O3OA 4X2HA 3LT9A 3WDGB 3CCQ3 3CCE3 2ZL8A 1KC84 1VQ93 4FMBA 1IV9A 2HMMB 3Q2PA 1IVVA 1ASKA 3OX9A 1DMMA 1K734 3NQZA 7STDA 2F99A 1W01A 1OHSA 3DGLA 3PCSA 4N6LA 3RGAA 3CCJ3 3UB1A 2GU3A 2W56B 2W9PA 2GXFA 3QK9A 3LTCA 1FGTA 2PNCA 4K61A 2XFSA 1TFOA 2W56A 3NXJA 1J2BA 1Q40B 3F9SA 4NHFA 3G6E3 1KD14 5EVHA 1AV4A 1DMNA 3DMCA 4IPBA 3STDA 1EKMA 4N6TA 1U5OA 3HI7A 3KZTA 2ML6A 1N8QA 2A15A 5FGOA 1A67A 3ER7A 3S29A 5KP4A 2CG1A 1W6CA 1NU3A 1NWWA 1NJI4 2WGQA 4LZIA 1OGZA 1Z1SA 2HMNB 4ZM8A 5KP3A 4MMYB 1UI8A 2LQVA 3HZPA 3GZXB 2P0MA 4KZ1A 3L0RA 2QEX3 2B1XB 2Y74A 3KSPA 1G96A 3MG2A 4RNZA 1OCVA 2E2VA 3DZLA 1IVWA 3CME3 2KRTA 4WYKB 1OUNA 1D6ZA 2Z6BA 3PXMA 3WOFB 1ZX2A 2FNQA 5IG5A 3OXAA 1AVKA 4H61A 4O8SA 1KWIA 3I0YA 1JRQA 3NBJA 3K0ZA 3KSED 4HZ9B 4O2HA 4J8TA 5CF2A 4RZMA 1FGMA 3IMAB 3NM7A 2KCDA 4XM4A 2CW9A 3PS8A 3OWSA 3MSOA 1VQM3 3MG3A 3NQYA 1WMPA 4WHAA 1FGRA 2O9UX 3G8ZA 1FGQA 4O02B 1JKGA 1QMAA 4AKZA 1N5PA 2CG0A 3DGNA 4LMIA 5IG0A 5AIGA 3CXC2 2BO9B 3JUOA 3Q90A 1GD3A 3FGYA 1VQ43 1DYUA 1TFKA 2C10A 2XFTA 3F8HA 1RN7A 2XGLA 4FCZA 4K90B 1CQSA 1WMOA 2WGOA 4HM8B 3LYGA 1JN5A 3CC23 3FF0A 3SX1A 5DRVA 1STFI 4GL6A 2GBWB 1A2VA 1TP6A 5AYRB 2CWUA 2CHCA 3D3LA 3FKAA 1O7NB 2RCDA 1OH0A 1OF5A 4N6UA 1EA2A 4N6MA 2KXGA 2Z77A 3JUPA 3CCU3 1VQN3 1UI7A 1W6YA 2HMLB 1FUWA 1N9JA 3NX0A 4XBXA 1W7CA 2BMOB 3DY5A 2V1LA 1GS3A 3JUQA 3WA3A 2CH9A 3FH1A 2FXTA 1TUHA 3GZYB 3F14A 4H3UA 1S5AA 4PEJA 1MNLA 1Q40A 1STDA 4EC6A 1N9EA 3HK4A 5EQLA 4R4KA 3U1WA 1FA3A 4G1MB 2CC3A 1ULJB 2PZVA 3CNMA 2HMKB 3OWUA 3DM8A 3SOYA 3LTBA 2RSXA 4CCVA 3CCM3 5AEWB 4HM2B 4HM7B 1K8A4 1O7PB 3F7SA 1IU7A 3FG1A 3FCSB 1YJN3 1RRHA 3F40A 2E2UA 5CF1A 2MF7A 1SJWA 1VQ63 1YIJ3 1QAKA 4N3VA 1M1K4 3WA2X 4HZBB 1EQKA 2CWVA 3RGRA 3V92A 1IQXA 1W00A 3BLZA 2W6JH 1U8CB 1PFPA 1O7WB 3FSDA 3O8YA 5IENA 1L5GB 3ALAA 5A0OB 3FG4A 2IUKA 3SEDA 1DMQA 2Z76A 4QWTA 1W2B2 1NB3I 4EV2A 3CC43 3MG1A 4XBYA 2D42A 4Q53A 4FMCA 2CK3H 2Y73A 1GY7A 2IUJA 1T5YA 1YHQ3 3KIIA 3KN4A 2OWPA 3VGNA 1PU4A 3I563 3X3XA 3WODG 2OCTA 1IDPA 3X40A 3EC9A 4XB5A 3HIIA 3SVAA 3G16A 5BVBA 1K9M4 2BMQB 3MYTA 5IW9A 3GZRA 4ORLA 2SBLA 1JV2B 1JB4A 1M1XB 1YJW3 4K1VA 3S27A 1AR0A 3I553 3WOEB 3CD63 1VQ83 3BNDA 3K63A 4R80A 5ELJA 4MMXB 4O3VA 1NB5I 3FG3A 1JB2A 2BMRB 2GBXB 1Q864 3AMOB 1EG9B 1IT7A 5JPPA 1RRLA 2CFKA 1FGOA 5ELUA 3NM2A 3EE1A 3IPTA 4HM1B 2GEXA 3MHEA 2YFLB 4OUQA 2OOVC 1R4CA 3VSYA 2IMJA 3Q1CA 1O7HB 4J9AA 3G713 2LYXA 2W9QA 5AI1A 3LTDA 4XBTA 1WNHA 1TIJA 2QA43 3PYJA 2OQEA 1Q7Y4 2YFJB 2BHMA 3NBRA 3PGBA 2OTJ3 2RFRA 1IQ8A 1LXEA 1OGXA 4STDA 3JUMA 3CCR3 1D6UA 4FCMA 2OTL3 1GD4A 3HX8A 1AVLA 4FMAA 3LT8A 1GY5A 1YVBI 1YI23 3BNBA 3SLUA 2B24B 4N6OB 5AIHA 5EEOA 3H51A 1CYUA 1WTHA 4AEQA 1O7MB 4KFDA 1YIT3 1ROAA 5AEUB 1VQK3 3GAXA 4HVNA 1SIHA 1WQLB 3CCV3 2CFGA 1GYBA 3J7Yd 1OACA 3EJVA 1HKXA 2W04A 3EN1B 4HM0B 3G4S3 2L4VA 5FW5A 3ROBA 4HM3B 3D9RA 1Q42A 4R1KA 1RJOA 1W4NA 5AYSC 3EN8A 3K9MC 1W5ZA 2CKFB 2INXA 1ULIB 3K7CA 2OOVA 4EYCA 4FMDA 4HM5B 3LOYA 1IV7A 3FZWA 3JUNA 3B4PA 3X3YA 2GU1A 3V99A 3UJMA 2W0QA 4EV5A 5IG4A 1V74A 2JDIH 5D83A 2I9WA 3LZAA 1VQP3 3KFQC 1OHPA 1SPUA 4KFEA 1ISKA 1A90A 3NV0A 1K41A 3B4OA 3WMDA 3LMLA 4WYKA 4XDVA 3T8NA 1ROVA 3LH4A 4CDLA 4HBRA 5IERA 5JBSA 3CU3A 3NV0B 1IK3A 2XH9A 2P09A 4OVMA 3GRDA 4RBNA 1IQYA 3CCS3 3IJEB 4HM6B 3CCL3 1E3VA 1LOXA 4L7KA 4HKVB 5DREA 1HU9A 1QALA 4MEIA 3FLJA 5LC7A 2P0XA 1VQO3 2UX0A 4OK0A 1SQWA 1Y4KA 3K5TA 4K1UA 2XGNA 2F86B 5KP1A 3F8XA 5IEPA 1UUWB 4MJDA 4GB5A 4JF8A 1QVF2 1KQS2 4FR9A 3CMA3 2XF3A 2BT3A 1CYVA 5I97A 3EBYA 3N54B 4WP5A 2STDA 2RGQA 3A76A 5JPUA 1MOLA 4EBGA 5BXQA 3EX9A 2W03A 3DGMA 3U97A 3MKIA 5IG3A 1GY6A 3VF1A 3CC73 2XSHB 1IVXA 2BNGA 1BUQA 2FGTA 1JN5B 2ML5A 3H3HA 2WOHA 2CFDA 3OV4A 2YFIB 1S723 1C7HA 1WMNA 4TX4A 2XSOB 3DUKA 4XDWA 3GWRA 5LC6A 3EHCA 5STDA 2GEYA 1N8R4 4N6V0 8CHOA 5CK6A 1VQ73 1UW1A 3RDEA 1VQL3 3MPHA 2P38A 1IVUA 1M904 3OWYA 1YJ93 1NDOB 3BNEA 3S5CA 2C11A 1OPYA 2M7OA 4AKYA 3ECFA 1E97A 3KE7A 1CEWI 5AIIA 2CFLA 1TU5A 3UL6A 3JVCA 5CXOA 3EB8A 3LXUX 3NBBA 4L8PA 3HIGA 3AMOA 2K0MA 4R9KA 5IEOA 1M9GA 1QAFA 2OQEC 3SXXA 4WFOA 2Z7AA 1VQ53 2XR8B 4I4KA 3T8UA 3EBTA 3BNCA 3CPOA 2K54A 3N9HA 5AIFA 1QJGA 4KVHA 4R9LA 2YX9A 3V98A 1OF5B 1E3RA 2D1WA 2IA7A 3FF2A 5CLKA 4FCJA 3X42A 3CPW2 1W6GA 2E2TA 2P05A 4HYZA 3DGOA 2F98A 3EQQB 3GZBA 3T0UA 3UNLA 1W02A 2JQ5A 4WWUC 4U13A 2WOFA 4HM4B 3M8CA 5IF6A 4L8OA 1QVG2 1F8NA 3KKGA 2MC8A 3LTAA 4LGQA 4IIAA 3B8LA 1Q814 2CFWA 4JRFA 2R4IA 5D81A 4BTWA 4BTXA 3SOAA 1K28A 2W2CA 1US1A 1D6YA 1VZZA 4LSOA 4RNYA 3X41A 1A2KA 2CIUA 2WO0A 3F7XA 3NUVA 5G2GA 3DXOA 2QIYA 1JKGB 3UL5A 3MWZA 3NHXA 4X2OA 3G0KA 3X3ZA 1JB5A 5D82A 2XEPA 5HGRA 1ZO2A 3OW22 1OHOA 1DVCA 4IT7A 4HJLB 3QRDA 3E99A 1LVNA 1N5HA 4NREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYZ A;  2MC8 A; 
#chains in the Genus database with same CATH topology
 3TDG A;  1PYL A;  1YNV X;  1LNH A;  2HMJ B;  4EXR A;  3BB9 A;  1O7G B;  1UUV B;  1Q82 4;  1DVD A;  2ZDJ A;  4BTY A;  2Q07 A;  1KSI A;  2QGU A;  4MMZ B;  2CWT A;  1IT8 A;  3SYU A;  3CNX A;  3N8B A;  1RDS A;  2XRX B;  1SII A;  3PCR A;  1RCK A;  6STD A;  5TGN A;  3S67 A;  1BIR A;  1JZO A;  1NO3 A;  4LEH A;  4N6N B;  1CH0 A;  2HMO B;  3B7C A;  3S28 A;  1JNQ A;  1EEJ A;  4KFF A;  1RKY A;  1BNJ A;  3PZW A;  1JJ2 2;  3EF8 A;  1W2Z A;  1YGE A;  2O3O A;  1UGH I;  4X2H A;  3LT9 A;  3WDG B;  3CCQ 3;  3D5I A;  2CX1 A;  3AHW A;  3CCE 3;  2ZL8 A;  1KC8 4;  1VQ9 3;  1RN1 A;  4FMB A;  1IV9 A;  2HMM B;  3Q2P A;  1LOY A;  1IVV A;  1ASK A;  3OX9 A;  1DMM A;  5RNT A;  1K73 4;  4GSP A;  3NQZ A;  7STD A;  2F99 A;  1W01 A;  1OHS A;  3DGL A;  3PCS A;  4N6L A;  3RGA A;  3CCJ 3;  3UB1 A;  2GU3 A;  2W56 B;  2W9P A;  2GXF A;  3QK9 A;  3LTC A;  1LOV A;  1UDI I;  4DKI A;  1FGT A;  2PNC A;  4K61 A;  4BIR A;  1B3S A;  1TFO A;  2W56 A;  2XFS A;  3NXJ A;  1J2B A;  1Q40 B;  3F9S A;  1FUS A;  1G0T A;  4NHF A;  3G6E 3;  1KD1 4;  1B2M A;  5EVH A;  1AV4 A;  1DMN A;  3DMC A;  4IPB A;  3STD A;  1EKM A;  4N6T A;  1U5O A;  3HI7 A;  3KZT A;  2ML6 A;  1N8Q A;  2A15 A;  5FGO A;  1A67 A;  3ER7 A;  3S29 A;  5KP4 A;  1BNG A;  2SAR A;  2CG1 A;  4BL3 A;  1W6C A;  1BRN L;  1BAN A;  4KT3 B;  1NU3 A;  1NWW A;  1NJI 4;  2WGQ A;  4LZI A;  1OGZ A;  1Z1S A;  1UUG B;  2HMN B;  4ZM8 A;  1C54 A;  5KP3 A;  4MMY B;  1UI8 A;  2LQV A;  3HZP A;  1UCL A;  3GZX B;  2P0M A;  1JZD A;  4KZ1 A;  3L0R A;  2F56 A;  2QEX 3;  2B1X B;  2Y74 A;  3KSP A;  1G96 A;  3MG2 A;  4RNZ A;  1OCV A;  2E2V A;  3DZL A;  1IVW A;  3CME 3;  2KRT A;  4WYK B;  1OUN A;  1D6Z A;  1VQQ A;  1GOV A;  2Z6B A;  1RCL A;  3PXM A;  3WOF B;  1ZX2 A;  2FNQ A;  5IG5 A;  3OXA A;  1AVK A;  4H61 A;  4O8S A;  2CX0 A;  1KWI A;  1RSN A;  3I0Y A;  1JRQ A;  3NBJ A;  3K0Z A;  2ZA4 A;  3KSE D;  4HZ9 B;  4O2H A;  1GMR A;  2F5M A;  4J8T A;  5CF2 A;  4RZM A;  1FGM A;  1FUT A;  1I8V A;  2KCD A;  3IMA B;  3NM7 A;  4XM4 A;  2CW9 A;  3PS8 A;  3A5E A;  3OWS A;  3MSO A;  1LRA A;  1VQM 3;  3MG3 A;  3NQY A;  1WMP A;  4WHA A;  1FGR A;  2O9U X;  2RBI A;  3G8Z A;  1FGQ A;  4O02 B;  1JKG A;  1QMA A;  4AKZ A;  1BOX A;  1N5P A;  2CG0 A;  2KF3 A;  3DGN A;  1BNE A;  4LMI A;  5AIG A;  5IG0 A;  2BO9 B;  3CXC 2;  3JUO A;  3Q90 A;  1TRQ A;  1GD3 A;  3FGY A;  1I3F A;  2J8X B;  1VQ4 3;  1DYU A;  1TFK A;  2C10 A;  2XFT A;  3F8H A;  1RN7 A;  2XGL A;  4FCZ A;  1BNS A;  4K90 B;  1CQS A;  1WMO A;  2WGO A;  3DGY A;  3LYG A;  4HM8 B;  9RNT A;  1JN5 A;  1EUI C;  3CC2 3;  3FF0 A;  3SX1 A;  5DRV A;  1STF I;  4GL6 A;  2GBW B;  5HOH A;  1A2V A;  1TP6 A;  5AYR B;  2CWU A;  2CHC A;  1LNI A;  2F4Y A;  2H0I A;  3D3L A;  3FKA A;  5M1A A;  1O7N B;  2RCD A;  1OH0 A;  1OF5 A;  4N6U A;  1EA2 A;  4RNT A;  4N6M A;  2KXG A;  2Z77 A;  3JUP A;  3CCU 3;  1B2S A;  1VQN 3;  1UI7 A;  1W6Y A;  2HML B;  1FUW A;  1JBT A;  1N9J A;  3NX0 A;  5BU4 A;  4XBX A;  1W7C A;  2BMO B;  2C4B A;  3DY5 A;  2V1L A;  1GS3 A;  3JUQ A;  3WHO A;  3WA3 A;  1LOW A;  2CH9 A;  3FH1 A;  2FXT A;  1TUH A;  3GZY B;  3F14 A;  4H3U A;  1S5A A;  4PEJ A;  1MNL A;  1Q40 A;  1STD A;  4EC6 A;  1N9E A;  3HK4 A;  5EQL A;  1RGC A;  4HAA A;  4R4K A;  1RMS A;  1UCK A;  3U1W A;  2AAE A;  1FA3 A;  4G1M B;  2CC3 A;  1ULJ B;  2PZV A;  3CNM A;  2HMK B;  3OWU A;  3ZG0 A;  3DM8 A;  3AHS A;  3SOY A;  3LTB A;  1AQZ A;  2RSX A;  4CCV A;  3CCM 3;  2UGI A;  1NNV A;  5AEW B;  4HM2 B;  4HM7 B;  1K8A 4;  1O7P B;  3F7S A;  1BRI A;  1FZU A;  1IU7 A;  3FG1 A;  1MGW A;  3FCS B;  1YJN 3;  1RRH A;  1DET A;  3F40 A;  1B20 A;  2E2U A;  5CF1 A;  2MF7 A;  1SJW A;  1PY3 A;  2H0H A;  1YIJ 3;  1VQ6 3;  1QAK A;  4N3V A;  1M1K 4;  3WA2 X;  1I0V A;  4HZB B;  1EQK A;  2CWV A;  2BU4 A;  3RGR A;  1IYY A;  5G1L A;  1IQX A;  1W00 A;  3BLZ A;  2W6J H;  3V92 A;  1BGS A;  4LYL B;  1U8C B;  1PFP A;  1O7W B;  3FSD A;  3O8Y A;  5IEN A;  1L5G B;  3ALA A;  5A0O B;  3D79 A;  3FG4 A;  2IUK A;  4CPK A;  1I3I A;  1X1W A;  3SED A;  1DMQ A;  2Z76 A;  1FW7 A;  4I5Q A;  4QWT A;  1BRS A;  1BRJ A;  1W2B 2;  1NB3 I;  4EV2 A;  3CC4 3;  3MG1 A;  4XBY A;  8RNT A;  2D42 A;  4Q53 A;  1LQG C;  4FMC A;  2CK3 H;  2Y73 A;  1GY7 A;  2IUJ A;  1T5Y A;  1YHQ 3;  1Q7H A;  1RN4 A;  3KII A;  2OWP A;  3KN4 A;  3VGN A;  1YVS A;  1PU4 A;  3I56 3;  3X3X A;  3WOD G;  1RNT A;  2OCT A;  1IDP A;  3X40 A;  3EC9 A;  4XB5 A;  3HII A;  3SVA A;  1GMP A;  3G16 A;  5BVB A;  1RGA A;  1K9M 4;  1AY7 A;  2BMQ B;  3MYT A;  5IW9 A;  3GZR A;  1X1X A;  4ORL A;  2SBL A;  1G02 A;  1JV2 B;  1MWT A;  1ZS7 A;  1JB4 A;  1M1X B;  1YJW 3;  2KF6 A;  4K1V A;  3S27 A;  1AR0 A;  3ZFZ A;  3WOE B;  3I55 3;  3CD6 3;  1I70 A;  3BND A;  1VQ8 3;  3K63 A;  4R80 A;  5ELJ A;  4MMX B;  4O3V A;  1NB5 I;  3FG3 A;  1JB2 A;  1BSA A;  2BMR B;  2L1S A;  2GBX B;  1Q86 4;  3AMO B;  1EG9 B;  1IT7 A;  5JPP A;  1RRL A;  2CFK A;  1FGO A;  5ELU A;  3NM2 A;  5G1K A;  3EE1 A;  3IPT A;  4HM1 B;  2GEX A;  3MHE A;  2YFL B;  4OUQ A;  2OOV C;  1R4C A;  3VSY A;  2IMJ A;  3Q1C A;  1JBR A;  1O7H B;  4J9A A;  3G71 3;  2LYX A;  2W9Q A;  5AI1 A;  3LTD A;  1BRH A;  4XBT A;  1WNH A;  1TIJ A;  4GHO A;  2QA4 3;  3PYJ A;  2OQE A;  1Q7Y 4;  1UCJ A;  1GOU A;  2BHM A;  2YFJ B;  3NBR A;  3PGB A;  2OTJ 3;  2RFR A;  1IQ8 A;  1LXE A;  1OGX A;  4STD A;  1BRG A;  3JUM A;  2RNT A;  3CCR 3;  1BNF A;  1D6U A;  4FCM A;  1JBS A;  2OTL 3;  1GD4 A;  3HX8 A;  1AVL A;  4FMA A;  3LT8 A;  1GOY A;  1GY5 A;  1T2I A;  1YVB I;  1YI2 3;  3BNB A;  3SLU A;  2B24 B;  5BIR A;  4N6O B;  5AIH A;  1MWU A;  1ZGX A;  3H51 A;  1WTH A;  5EEO A;  4AEQ A;  1O7M B;  1CYU A;  4KFD A;  1YIT 3;  1ROA A;  5AEU B;  1VQK 3;  3GAX A;  4HVN A;  4BL2 A;  1BAO A;  1SIH A;  1WQL B;  3CCV 3;  2CFG A;  1GYB A;  3J7Y d;  5GSP A;  1OAC A;  3EJV A;  1HKX A;  2W04 A;  3EN1 B;  4HM0 B;  3G4S 3;  2L4V A;  1BRK A;  5FW5 A;  3ROB A;  4HM3 B;  3D9R A;  4EW5 A;  1Q42 A;  4R1K A;  1UGI A;  1RJO A;  5M19 A;  1RGE A;  1RGL A;  1W4N A;  5AYS C;  3EN8 A;  3K9M C;  1W5Z A;  2CKF B;  2INX A;  1ULI B;  3K7C A;  4J5G A;  2OOV A;  4EYC A;  4FMD A;  4HM5 B;  3LOY A;  1IV7 A;  1GSP A;  3AGN A;  3B4P A;  3FZW A;  3JUN A;  3X3Y A;  4CDL A;  2KF4 A;  1T3B A;  1R4Y A;  2KF5 A;  2GU1 A;  3V99 A;  7GSP A;  3UJM A;  2W0Q A;  4EV5 A;  5IG4 A;  1V74 A;  2JDI H;  4BU4 A;  5D83 A;  2KAA A;  1T2H A;  2I9W A;  3LZA A;  1VQP 3;  4ILF A;  3KFQ C;  1OHP A;  1SPU A;  4KFE A;  1ISK A;  1A90 A;  3NV0 A;  1K41 A;  3B4O A;  3WMD A;  3LML A;  4WYK A;  4XDV A;  3T8N A;  1ROV A;  1X1U A;  1BNI A;  2BIR A;  2HOH A;  1SAR A;  3LH4 A;  1B2U A;  4HBR A;  5IER A;  5JBS A;  1RGG A;  1RNB A;  3CU3 A;  3NV0 B;  1YGW A;  1IK3 A;  4HOH A;  2XH9 A;  2P09 A;  4OVM A;  3HOH A;  3GRD A;  6RNT A;  4RBN A;  1IQY A;  1UCI A;  3CCS 3;  1HYF A;  3IJE B;  4HM6 B;  3CCL 3;  1E3V A;  1BU4 A;  1GMQ A;  1LOX A;  4HKV B;  1HU9 A;  1QAL A;  4L7K A;  5DRE A;  4MEI A;  1TTO A;  1DE3 A;  3FLJ A;  5LC7 A;  2P0X A;  1VQO 3;  2UX0 A;  4OK0 A;  1SQW A;  1Y4K A;  3K5T A;  4K1U A;  2XGN A;  2F86 B;  5KP1 A;  1BNR A;  3F8X A;  5IEP A;  1UUW B;  4MJD A;  4GB5 A;  3GSP A;  4JF8 A;  1QVF 2;  1KQS 2;  4FR9 A;  3CMA 3;  2XF3 A;  2BT3 A;  1CYV A;  5I97 A;  3EBY A;  3N54 B;  2IYJ A;  2STD A;  4WP5 A;  2RGQ A;  3A76 A;  5JPU A;  1MOL A;  4EBG A;  5BXQ A;  3RNT A;  3EX9 A;  2W03 A;  3DGM A;  3U97 A;  3URP A;  3MKI A;  1X1Y A;  2R41 A;  5IG3 A;  1GY6 A;  3VF1 A;  3CC7 3;  2XSH B;  4J5K A;  1I2F A;  1I2E A;  1IVX A;  1BSC A;  2BNG A;  5M18 A;  1BUQ A;  2FGT A;  1JN5 B;  2ML5 A;  3H3H A;  2K3D A;  1MWS A;  2WOH A;  6GSP A;  2CFD A;  3OV4 A;  2YFI B;  1RGK A;  1C7H A;  1WMN A;  4TX4 A;  2ZHX B;  2XSO B;  3DUK A;  4XDW A;  3WR2 A;  1S72 3;  3D4A A;  3GWR A;  1FYS A;  5LC6 A;  3EHC A;  2F5W A;  5STD A;  2GEY A;  3ZG5 A;  1N8R 4;  4N6V 0;  8CHO A;  5CK6 A;  1VQ7 3;  1UW1 A;  3RDE A;  1VQL 3;  3MPH A;  1RTU A;  2P38 A;  1IVU A;  1M90 4;  3OWY A;  1YJ9 3;  1TJD A;  4CJN A;  1NDO B;  3BNE A;  4NPB A;  3S5C A;  2C11 A;  1OPY A;  2M7O A;  4AKY A;  1RGH A;  3ECF A;  1E97 A;  3KE7 A;  1CEW I;  1MGR A;  5AII A;  2CFL A;  1TU5 A;  1B21 A;  3UL6 A;  1TRP A;  1RHL A;  3JVC A;  5CXO A;  3EB8 A;  1V57 A;  3LXU X;  1RGF A;  3NBB A;  4L8P A;  3HIG A;  3AMO A;  2K0M A;  4R9K A;  1I0X A;  1V58 A;  5IEO A;  1BSD A;  1M9G A;  1QAF A;  2OQE C;  3SXX A;  1B2Z A;  2IY2 A;  4WFO A;  2AAD A;  2Z7A A;  1VQ5 3;  2XR8 B;  4I4K A;  3T8U A;  3EBT A;  3BNC A;  1RLS A;  3CPO A;  1I2G A;  7RNT A;  2K54 A;  3N9H A;  5AIF A;  1QJG A;  4KVH A;  4R9L A;  2YX9 A;  3V98 A;  1OF5 B;  1A2P A;  1E3R A;  2D1W A;  2IA7 A;  1BVI A;  3FF2 A;  4FCJ A;  5CLK A;  1BSE A;  3X42 A;  3CPW 2;  1W6G A;  2E2T A;  2P05 A;  4HYZ A;  2H0G A;  1BUJ A;  2GSP A;  3DGO A;  2F98 A;  3EQQ B;  3GZB A;  3BIR A;  3T0U A;  3UNL A;  1W02 A;  2JQ5 A;  4WWU C;  4U13 A;  2WOF A;  1BSB A;  4HM4 B;  3M8C A;  5IF6 A;  4L8O A;  1QVG 2;  1F8N A;  3KKG A;  3DH2 A;  2MC8 A;  2UUG C;  1MWR A;  3LTA A;  1HZ1 A;  4LGQ A;  4IIA A;  3B8L A;  1Q81 4;  2CFW A;  1LQM B;  4JRF A;  2R4I A;  5D81 A;  4BTW A;  4BTX A;  3SOA A;  1K28 A;  2W2C A;  3D5G A;  1US1 A;  1D6Y A;  1VZZ A;  4LSO A;  4RNY A;  1B27 A;  3X41 A;  2CIU A;  1A2K A;  2WO0 A;  3F7X A;  3NUV A;  1Q9E A;  5G2G A;  3DXO A;  2QIY A;  1JKG B;  3UL5 A;  3MWZ A;  3NHX A;  4X2O A;  3G0K A;  3X3Z A;  1JB5 A;  5D82 A;  2XEP A;  5HGR A;  1ZO2 A;  3OW2 2;  1OHO A;  3BU4 A;  1DVC A;  4IT7 A;  3AGO A;  3KCH A;  3Q3F A;  4HJL B;  3QRD A;  3E99 A;  1LVN A;  1N5H A;  1B2X A;  4NRE A; 
#chains in the Genus database with same CATH homology
 3TDG A;  1LNH A;  2HMJ B;  4EXR A;  3BB9 A;  1O7G B;  1UUV B;  1Q82 4;  1DVD A;  2ZDJ A;  4BTY A;  2Q07 A;  1KSI A;  2QGU A;  4MMZ B;  2CWT A;  1IT8 A;  3CNX A;  3N8B A;  2XRX B;  1SII A;  3PCR A;  6STD A;  5TGN A;  3S67 A;  4LEH A;  1NO3 A;  4N6N B;  3B7C A;  2HMO B;  3S28 A;  1JNQ A;  4KFF A;  1RKY A;  3PZW A;  1JJ2 2;  3EF8 A;  1W2Z A;  1YGE A;  2O3O A;  4X2H A;  3LT9 A;  3WDG B;  3CCQ 3;  3CCE 3;  2ZL8 A;  1KC8 4;  1VQ9 3;  4FMB A;  1IV9 A;  2HMM B;  3Q2P A;  1IVV A;  1ASK A;  3OX9 A;  1DMM A;  1K73 4;  3NQZ A;  7STD A;  2F99 A;  1W01 A;  1OHS A;  3DGL A;  3PCS A;  4N6L A;  3RGA A;  3CCJ 3;  3UB1 A;  2GU3 A;  2W56 B;  2W9P A;  2GXF A;  3QK9 A;  3LTC A;  1FGT A;  2PNC A;  4K61 A;  2XFS A;  1TFO A;  2W56 A;  3NXJ A;  1J2B A;  1Q40 B;  3F9S A;  4NHF A;  3G6E 3;  1KD1 4;  5EVH A;  1AV4 A;  1DMN A;  3DMC A;  4IPB A;  3STD A;  1EKM A;  4N6T A;  1U5O A;  3HI7 A;  3KZT A;  2ML6 A;  1N8Q A;  2A15 A;  5FGO A;  1A67 A;  3ER7 A;  3S29 A;  5KP4 A;  2CG1 A;  1W6C A;  1NU3 A;  1NWW A;  1NJI 4;  2WGQ A;  4LZI A;  1OGZ A;  1Z1S A;  2HMN B;  4ZM8 A;  5KP3 A;  4MMY B;  1UI8 A;  2LQV A;  3HZP A;  3GZX B;  2P0M A;  4KZ1 A;  3L0R A;  2QEX 3;  2B1X B;  2Y74 A;  3KSP A;  1G96 A;  3MG2 A;  4RNZ A;  1OCV A;  2E2V A;  3DZL A;  1IVW A;  3CME 3;  2KRT A;  4WYK B;  1OUN A;  1D6Z A;  2Z6B A;  3PXM A;  3WOF B;  1ZX2 A;  2FNQ A;  5IG5 A;  3OXA A;  1AVK A;  4H61 A;  4O8S A;  1KWI A;  3I0Y A;  1JRQ A;  3NBJ A;  3K0Z A;  3KSE D;  4HZ9 B;  4O2H A;  4J8T A;  5CF2 A;  4RZM A;  1FGM A;  3IMA B;  3NM7 A;  2KCD A;  4XM4 A;  2CW9 A;  3PS8 A;  3OWS A;  3MSO A;  1VQM 3;  3MG3 A;  3NQY A;  1WMP A;  4WHA A;  1FGR A;  2O9U X;  3G8Z A;  1FGQ A;  4O02 B;  1JKG A;  1QMA A;  4AKZ A;  1N5P A;  2CG0 A;  3DGN A;  4LMI A;  5IG0 A;  5AIG A;  3CXC 2;  2BO9 B;  3JUO A;  3Q90 A;  1GD3 A;  3FGY A;  1VQ4 3;  1DYU A;  1TFK A;  2C10 A;  2XFT A;  3F8H A;  1RN7 A;  2XGL A;  4FCZ A;  4K90 B;  1CQS A;  1WMO A;  2WGO A;  4HM8 B;  3LYG A;  1JN5 A;  3CC2 3;  3FF0 A;  3SX1 A;  5DRV A;  1STF I;  4GL6 A;  2GBW B;  1A2V A;  1TP6 A;  5AYR B;  2CWU A;  2CHC A;  3D3L A;  3FKA A;  1O7N B;  2RCD A;  1OH0 A;  1OF5 A;  4N6U A;  1EA2 A;  4N6M A;  2KXG A;  2Z77 A;  3JUP A;  3CCU 3;  1VQN 3;  1UI7 A;  1W6Y A;  2HML B;  1FUW A;  1N9J A;  3NX0 A;  4XBX A;  1W7C A;  2BMO B;  3DY5 A;  2V1L A;  1GS3 A;  3JUQ A;  3WA3 A;  2CH9 A;  3FH1 A;  2FXT A;  1TUH A;  3GZY B;  3F14 A;  4H3U A;  1S5A A;  4PEJ A;  1MNL A;  1Q40 A;  1STD A;  4EC6 A;  1N9E A;  3HK4 A;  5EQL A;  4R4K A;  3U1W A;  1FA3 A;  4G1M B;  2CC3 A;  1ULJ B;  2PZV A;  3CNM A;  2HMK B;  3OWU A;  3DM8 A;  3SOY A;  3LTB A;  2RSX A;  4CCV A;  3CCM 3;  5AEW B;  4HM2 B;  4HM7 B;  1K8A 4;  1O7P B;  3F7S A;  1IU7 A;  3FG1 A;  3FCS B;  1YJN 3;  1RRH A;  3F40 A;  2E2U A;  5CF1 A;  2MF7 A;  1SJW A;  1VQ6 3;  1YIJ 3;  1QAK A;  4N3V A;  1M1K 4;  3WA2 X;  4HZB B;  1EQK A;  2CWV A;  3RGR A;  3V92 A;  1IQX A;  1W00 A;  3BLZ A;  2W6J H;  1U8C B;  1PFP A;  1O7W B;  3FSD A;  3O8Y A;  5IEN A;  1L5G B;  3ALA A;  5A0O B;  3FG4 A;  2IUK A;  3SED A;  1DMQ A;  2Z76 A;  4QWT A;  1W2B 2;  1NB3 I;  4EV2 A;  3CC4 3;  3MG1 A;  4XBY A;  2D42 A;  4Q53 A;  4FMC A;  2CK3 H;  2Y73 A;  1GY7 A;  2IUJ A;  1T5Y A;  1YHQ 3;  3KII A;  3KN4 A;  2OWP A;  3VGN A;  1PU4 A;  3I56 3;  3X3X A;  3WOD G;  2OCT A;  1IDP A;  3X40 A;  3EC9 A;  4XB5 A;  3HII A;  3SVA A;  3G16 A;  5BVB A;  1K9M 4;  2BMQ B;  3MYT A;  5IW9 A;  3GZR A;  4ORL A;  2SBL A;  1JV2 B;  1JB4 A;  1M1X B;  1YJW 3;  4K1V A;  3S27 A;  1AR0 A;  3I55 3;  3WOE B;  3CD6 3;  1VQ8 3;  3BND A;  3K63 A;  4R80 A;  5ELJ A;  4MMX B;  4O3V A;  1NB5 I;  3FG3 A;  1JB2 A;  2BMR B;  2GBX B;  1Q86 4;  3AMO B;  1EG9 B;  1IT7 A;  5JPP A;  1RRL A;  2CFK A;  1FGO A;  5ELU A;  3NM2 A;  3EE1 A;  3IPT A;  4HM1 B;  2GEX A;  3MHE A;  2YFL B;  4OUQ A;  2OOV C;  1R4C A;  3VSY A;  2IMJ A;  3Q1C A;  1O7H B;  4J9A A;  3G71 3;  2LYX A;  2W9Q A;  5AI1 A;  3LTD A;  4XBT A;  1WNH A;  1TIJ A;  2QA4 3;  3PYJ A;  2OQE A;  1Q7Y 4;  2YFJ B;  2BHM A;  3NBR A;  3PGB A;  2OTJ 3;  2RFR A;  1IQ8 A;  1LXE A;  1OGX A;  4STD A;  3JUM A;  3CCR 3;  1D6U A;  4FCM A;  2OTL 3;  1GD4 A;  3HX8 A;  1AVL A;  4FMA A;  3LT8 A;  1GY5 A;  1YVB I;  1YI2 3;  3BNB A;  3SLU A;  2B24 B;  4N6O B;  5AIH A;  5EEO A;  3H51 A;  1CYU A;  1WTH A;  4AEQ A;  1O7M B;  4KFD A;  1YIT 3;  1ROA A;  5AEU B;  1VQK 3;  3GAX A;  4HVN A;  1SIH A;  1WQL B;  3CCV 3;  2CFG A;  1GYB A;  3J7Y d;  1OAC A;  3EJV A;  1HKX A;  2W04 A;  3EN1 B;  4HM0 B;  3G4S 3;  2L4V A;  5FW5 A;  3ROB A;  4HM3 B;  3D9R A;  1Q42 A;  4R1K A;  1RJO A;  1W4N A;  5AYS C;  3EN8 A;  3K9M C;  1W5Z A;  2CKF B;  2INX A;  1ULI B;  3K7C A;  2OOV A;  4EYC A;  4FMD A;  4HM5 B;  3LOY A;  1IV7 A;  3FZW A;  3JUN A;  3B4P A;  3X3Y A;  2GU1 A;  3V99 A;  3UJM A;  2W0Q A;  4EV5 A;  5IG4 A;  1V74 A;  2JDI H;  5D83 A;  2I9W A;  3LZA A;  1VQP 3;  3KFQ C;  1OHP A;  1SPU A;  4KFE A;  1ISK A;  1A90 A;  3NV0 A;  1K41 A;  3B4O A;  3WMD A;  3LML A;  4WYK A;  4XDV A;  3T8N A;  1ROV A;  3LH4 A;  4CDL A;  4HBR A;  5IER A;  5JBS A;  3CU3 A;  3NV0 B;  1IK3 A;  2XH9 A;  2P09 A;  4OVM A;  3GRD A;  4RBN A;  1IQY A;  3CCS 3;  3IJE B;  4HM6 B;  3CCL 3;  1E3V A;  1LOX A;  4L7K A;  4HKV B;  5DRE A;  1HU9 A;  1QAL A;  4MEI A;  3FLJ A;  5LC7 A;  2P0X A;  1VQO 3;  2UX0 A;  4OK0 A;  1SQW A;  1Y4K A;  3K5T A;  4K1U A;  2XGN A;  2F86 B;  5KP1 A;  3F8X A;  5IEP A;  1UUW B;  4MJD A;  4GB5 A;  4JF8 A;  1QVF 2;  1KQS 2;  4FR9 A;  3CMA 3;  2XF3 A;  2BT3 A;  1CYV A;  5I97 A;  3EBY A;  3N54 B;  4WP5 A;  2STD A;  2RGQ A;  3A76 A;  5JPU A;  1MOL A;  4EBG A;  5BXQ A;  3EX9 A;  2W03 A;  3DGM A;  3U97 A;  3MKI A;  5IG3 A;  1GY6 A;  3VF1 A;  3CC7 3;  2XSH B;  1IVX A;  2BNG A;  1BUQ A;  2FGT A;  1JN5 B;  2ML5 A;  3H3H A;  2WOH A;  2CFD A;  3OV4 A;  2YFI B;  1S72 3;  1C7H A;  1WMN A;  4TX4 A;  2XSO B;  3DUK A;  4XDW A;  3GWR A;  5LC6 A;  3EHC A;  5STD A;  2GEY A;  1N8R 4;  4N6V 0;  8CHO A;  5CK6 A;  1VQ7 3;  1UW1 A;  3RDE A;  1VQL 3;  3MPH A;  2P38 A;  1IVU A;  1M90 4;  3OWY A;  1YJ9 3;  1NDO B;  3BNE A;  3S5C A;  2C11 A;  1OPY A;  2M7O A;  4AKY A;  3ECF A;  1E97 A;  3KE7 A;  1CEW I;  5AII A;  2CFL A;  1TU5 A;  3UL6 A;  3JVC A;  5CXO A;  3EB8 A;  3LXU X;  3NBB A;  4L8P A;  3HIG A;  3AMO A;  2K0M A;  4R9K A;  5IEO A;  1M9G A;  1QAF A;  2OQE C;  3SXX A;  4WFO A;  2Z7A A;  1VQ5 3;  2XR8 B;  4I4K A;  3T8U A;  3EBT A;  3BNC A;  3CPO A;  2K54 A;  3N9H A;  5AIF A;  1QJG A;  4KVH A;  4R9L A;  2YX9 A;  3V98 A;  1OF5 B;  1E3R A;  2D1W A;  2IA7 A;  3FF2 A;  5CLK A;  4FCJ A;  3X42 A;  3CPW 2;  1W6G A;  2E2T A;  2P05 A;  4HYZ A;  3DGO A;  2F98 A;  3EQQ B;  3GZB A;  3T0U A;  3UNL A;  1W02 A;  2JQ5 A;  4WWU C;  4U13 A;  2WOF A;  4HM4 B;  3M8C A;  5IF6 A;  4L8O A;  1QVG 2;  1F8N A;  3KKG A;  2MC8 A;  3LTA A;  4LGQ A;  4IIA A;  3B8L A;  1Q81 4;  2CFW A;  4JRF A;  2R4I A;  5D81 A;  4BTW A;  4BTX A;  3SOA A;  1K28 A;  2W2C A;  1US1 A;  1D6Y A;  1VZZ A;  4LSO A;  4RNY A;  3X41 A;  1A2K A;  2CIU A;  2WO0 A;  3F7X A;  3NUV A;  5G2G A;  3DXO A;  2QIY A;  1JKG B;  3UL5 A;  3MWZ A;  3NHX A;  4X2O A;  3G0K A;  3X3Z A;  1JB5 A;  5D82 A;  2XEP A;  5HGR A;  1ZO2 A;  3OW2 2;  1OHO A;  1DVC A;  4IT7 A;  4HJL B;  3QRD A;  3E99 A;  1LVN A;  1N5H A;  4NRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...