2MC8A

Nmr structure of protein rumgna_01855 from ruminococcus gnavus atcc 29149
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
GEILKELPEGFDKETVRKQAMEDIEIAQSKDYESWKSRFTKDLQSSLTEESYDSYLKILEKQGEFKEFGKCTYLGQIKDNKKYGGVIIVVKYEEGNVNYSLAYDEDMNLVSFTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title NMR structure of a protein RUMGNA_01855 from Ruminococcus gnavus ATCC 29149
rcsb
source organism Ruminococcus gnavus
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13026 DUF3887 Protein of unknown function (DUF3887)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.590 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2mc8A00
4HYZA 2MC8A
chains in the Genus database with same CATH superfamily
1K28A 1SJWA 4HM2B 3DGOA 4KT3B 3NHXA 4NHFA 5BIRA 1U8CB 2KF4A 4LZIA 1FUTA 3ROBA 2CWTA 2ZDJA 3ECFA 3HX8A 3N54B 1QAFA 3K0ZA 4HZBB 7GSPA 2H0HA 1BSEA 1M9GA 2CFGA 1DMNA 3GZYB 1RGHA 2M7OA 3X40A 1C7HA 4GHOA 2CW9A 1E3VA 2Y74A 3OX9A 3D5GA 5IF6A 1G96A 3FCSB 2P0MA 4BL3A 3WHOA 2CFKA 2CWUA 3Q3FA 1W02A 2OOVC 3IMAB 2XGNA 5D83A 1BNGA 2K0MA 3LTDA 4FMAA 4N6NB 3CCQ3 1FGMA 4OVMA 6STDA 1UI8A 1R4YA 4N6OB 3T8NA 4RNZA 1O7NB 3DGMA 5IG3A 3WODG 1DYUA 3CCS3 2OWPA 3T8UA 5G1KA 2F56A 1JV2B 3PZWA 3BU4A 3B4OA 3IJEB 5CLKA 1DE3A 1IV9A 1O7PB 3FKAA 2O9UX 1K734 3FGYA 1BNIA 1RDSA 1OHOA 2C4BA 3HI7A 2KF5A 3KE7A 4BIRA 3CCM3 2UGIA 2H0GA 4K1VA 2RSXA 5AEWB 4BTWA 1Q40A 1VQN3 2KXGA 2YFLB 4CCVA 1FYSA 1MOLA 1JN5B 2FNQA 2P05A 2WOFA 3X3XA 4CPKA 5IEPA 3CCE3 1A2KA 1YGEA 4MEIA 5EVHA 4CJNA 1M1XB 3N8BA 2PZVA 2QEX3 2HMMB 5CF1A 3B7CA 2B1XB 1R4CA 1D6YA 3DUKA 3LZAA 1BU4A 4HOHA 3KN4A 1N9EA 3JVCA 5JPPA 1YGWA 2SBLA 1AVLA 4EYCA 3G0KA 5LC7A 1JRQA 3BB9A 3A76A 1B20A 3EN1B 4NPBA 4I4KA 3UL6A 3CCU3 1GD4A 2W03A 1OGXA 5AIIA 3LH4A 3G4S3 2WGQA 4LMIA 3MYTA 4XM4A 2H0IA 5EQLA 1UCIA 1BGSA 3CNMA 2C10A 3OV4A 1D6UA 4HM0B 4N6MA 4EW5A 3G16A 4WFOA 5KP1A 3D79A 4LGQA 3BNBA 1PU4A 1TRPA 1VQ43 2OCTA 1E3RA 1BRSA 4J5GA 1CYUA 4OUQA 2P09A 1UUVB 3S5CA 1BVIA 2CFLA 3RGRA 1RN4A 3LTAA 1TP6A 3URPA 3BNDA 1K8A4 4EV5A 1CYVA 2AADA 3D9RA 2W6JH 3F8XA 5CXOA 1YIJ3 3CD63 1RCLA 3A5EA 1BNJA 3CPOA 3JUPA 3BNCA 1W6YA 1G0TA 5I97A 1HKXA 4J8TA 1IYYA 4LYLB 2GBWB 1BRHA 4L7KA 3X3ZA 3E99A 5IEOA 2JQ5A 3NBBA 3CCL3 1RRLA 3N9HA 3F8HA 2B24B 3MPHA 1S5AA 2BU4A 2CIUA 2WO0A 4KFFA 5DREA 3SX1A 1RHLA 1BAOA 1TFOA 4N3VA 1OPYA 1GSPA 1BIRA 4HM7B 1BOXA 3EQQB 2KCDA 3JUOA 3HIGA 2STDA 1VQ93 3GWRA 3CC43 3BNEA 4J5KA 3MHEA 1V74A 1MWUA 3PCSA 3KSED 7RNTA 3PS8A 1RGLA 1MNLA 2P38A 1I2GA 3SXXA 3NV0A 3IPTA 2E2TA 3X3YA 7STDA 2IMJA 3I0YA 3K63A 2BT3A 4XDVA 1JNQA 4JF8A 5HGRA 1RCKA 4WYKA 5G1LA 1JKGA 3MWZA 2CX1A 3GZBA 1KSIA 4N6LA 3I563 1RN1A 1BRGA 1LOXA 1ULJB 4XDWA 3SLUA 3HIIA 3JUNA 3VGNA 1K41A 1VQL3 1A90A 1O7WB 3EJVA 4HM8B 3ZFZA 1VQ63 1GY7A 1IQ8A 5BU4A 1JJ22 1CH0A 4G1MB 1K9M4 2OTL3 4O2HA 1YJN3 9RNTA 1Q7Y4 1AY7A 2BMQB 1LXEA 1WTHA 1UCLA 1RJOA 1Y4KA 1RNBA 2OOVA 3S29A 3CNXA 1W5ZA 2IUKA 2Z77A 1JN5A 1RGGA 4X2OA 5DRVA 1RMSA 5M1AA 1NB5I 1W6GA 3FG4A 3OXAA 2YFIB 1GMQA 1RGCA 2CFWA 2HMNB 2GEYA 2MF7A 3X41A 4AKYA 3LMLA 1TFKA 1EA2A 3UJMA 2RFRA 2XR8B 2CWVA 3NV0B 4HM4B 2ZHXB 4K90B 4MMZB 1UGHI 3GAXA 1JBRA 4IT7A 2QGUA 1RLSA 4FMBA 4O8SA 1RGAA 4WYKB 1JKGB 1OH0A 1BSDA 2JDIH 3AHWA 4ORLA 2XEPA 1RN7A 3NQYA 3AHSA 3OWUA 3G8ZA 1IDPA 1I70A 1W4NA 1GOUA 2Q07A 3KCHA 4R1KA 2AAEA 5GSPA 3FSDA 2GU1A 1B2ZA 5ELJA 3SEDA 1QALA 3MSOA 1Q824 3GSPA 1JBTA 1OHSA 1UCJA 4X2HA 5AIGA 5IG0A 1KC84 2Y73A 1STDA 1U5OA 1UCKA 2W2CA 3NM7A 4R9LA 2KRTA 1VQM3 4KVHA 1BUJA 1MGWA 1MWSA 2O3OA 1O7HB 1IVXA 2F86B 2XF3A 2KF3A 3ZG5A 4STDA 4Q53A 1CEWI 3MG2A 3CME3 1NU3A 1PYLA 1EUIC 1A2PA 4OK0A 3EHCA 1AQZA 2P0XA 3H51A 4EV2A 2BO9B 3ALAA 4IIAA 2D1WA 2GEXA 4J9AA 1SIIA 3G6E3 1UDII 4H3UA 5HOHA 1BSBA 1FZUA 1GY5A 2CK3H 3DGYA 4WP5A 3CPW2 1RKYA 1BANA 1X1XA 4EXRA 1RSNA 1O7MB 1STFI 2CKFB 4XBYA 3O8YA 1B2UA 3V99A 1NWWA 4MMXB 4CDLA 4LEHA 4R80A 1V57A 2CG0A 2I9WA 2HMKB 4U13A 4HM1B 2W56B 3MKIA 5AEUB 3F40A 3FLJA 3FG1A 4DKIA 1SQWA 3DXOA 4R4KA 1VQP3 2F5WA 1PFPA 2L1SA 3AGNA 2E2UA 2HOHA 3EBTA 1A67A 3EBYA 1SIHA 1RGFA 2C11A 1ROAA 1G02A 1C54A 2GU3A 4XBXA 1QVG2 1BRJA 2E2VA 2ZL8A 1RRHA 3GRDA 2XH9A 2INXA 1RGEA 1B2SA 1RNTA 5D81A 2GXFA 1SPUA 1L5GB 4ILFA 3H3HA 2J8XB 1ISKA 4FR9A 1BNRA 3WMDA 1IVUA 1QMAA 3Q90A 1VQ83 3CXC2 1AVKA 1AR0A 1ZX2A 2A15A 2PNCA 2XRXB 3V98A 3QRDA 3CU3A 3NBJA 8CHOA 4HVNA 1GS3A 3CCR3 1YVBI 2CX0A 4XB5A 2RGQA 1RGKA 3GZXB 3EE1A 1I2EA 1I3FA 4JRFA 1FUSA 5ELUA 1IU7A 1PY3A 6RNTA 1Q864 1OF5B 1BNSA 1JZOA 1TRQA 2RNTA 1ZGXA 3EN8A 3S27A 1NO3A 3TDGA 5KP4A 6GSPA 3DGNA 5D82A 1BSAA 3U1WA 4MJDA 4R9KA 4RZMA 3OWYA 1BRIA 2ML5A 1EKMA 3CCV3 4L8OA 3V92A 5CK6A 2KF6A 2Z6BA 3BIRA 4RNTA 1WMOA 4QWTA 5IG5A 3EB8A 3LT9A 2OQEC 1OCVA 1RTUA 1W00A 2F4YA 2XSHB 2RCDA 3AGOA 5FGOA 3NUVA 2W0QA 1UUWB 2QA43 1B2MA 4GSPA 1BNEA 3ZG0A 3RGAA 2QIYA 1B2XA 1I3IA 1NB3I 3MG3A 3NX0A 3LXUX 4L8PA 3S28A 1YNVX 2CHCA 1OUNA 3CCJ3 1ULIB 1FA3A 2D42A 1LOYA 2L4VA 1EG9B 3UB1A 3FF0A 1F8NA 5BVBA 1I8VA 4FCJA 3ER7A 1IT8A 3EF8A 1TTOA 3HK4A 1Q42A 3SOYA 4BU4A 3AMOB 2XGLA 1FUWA 1NDOB 2YFJB 3KZTA 3NBRA 1I0XA 4KFEA 4AEQA 1GOYA 1JB2A 3CC73 2UUGC 3WDGB 1FGQA 1WQLB 1LVNA 1T3BA 4FMDA 1BUQA 1WMPA 4O02B 1DMMA 1B21A 3F7XA 3F14A 1LNHA 2ML6A 2Z76A 4WWUC 2CC3A 1EQKA 2WGOA 2XFSA 3F7SA 1DMQA 3K9MC 2W9PA 3Q2PA 5A0OB 4GL6A 1Q9EA 1TJDA 1VQK3 2WOHA 1IVWA 1WNHA 1FGRA 4FCZA 1M904 3MG1A 1FGTA 3SVAA 2FXTA 2LQVA 4IPBA 3VSYA 2W56A 3PGBA 1NJI4 1S723 3DGLA 3PXMA 2BHMA 1HYFA 3LOYA 1ASKA 1E97A 3VF1A 3HOHA 1FW7A 1DVCA 3WA3A 4AKZA 1UW1A 1GMRA 1KQS2 1OACA 1IVVA 1QAKA 1T2HA 3UL5A 1JB5A 1BSCA 3NXJA 1W2B2 4LSOA 1B27A 4I5QA 1YJ93 1W7CA 3EX9A 5STDA 4GB5A 2R4IA 2IUJA 2W9QA 1GY6A 2MC8A 3UNLA 2HMJB 1HU9A 3L0RA 4RBNA 5G2GA 2CFDA 3I553 4FCMA 4HBRA 3D5IA 3STDA 1JBSA 1LNIA 3BLZA 5IG4A 3D4AA 3B4PA 3G713 3CC23 3KIIA 2F5MA 4HAAA 3LTBA 3DH2A 4HKVB 1N8QA 3F9SA 5AYRB 2KAAA 1VQ73 3K5TA 2Z7AA 1IQYA 1IQXA 1QJGA 1MGRA 1GYBA 4HYZA 5LC6A 1VQO3 3GZRA 3SOAA 3RDEA 1Q814 2LYXA 1KD14 3WA2X 4PEJA 1OF5A 3FZWA 1TU5A 1I0VA 2XFTA 1UGIA 4N6TA 1ROVA 4NREA 3S67A 1B3SA 1T2IA 3JUMA 3D3LA 4KFDA 4FMCA 3WR2A 1HZ1A 1ZO2A 1LQMB 1BRKA 3PYJA 1BNFA 3LTCA 1EEJA 2F99A 1GOVA 5AIFA 4ZM8A 1M1K4 1GD3A 2YX9A 3NM2A 1YHQ3 5JPUA 1DVDA 1LQGC 2HMLB 2GSPA 1UI7A 3DZLA 3WOEB 4XBTA 5CF2A 1Q7HA 1V58A 3LT8A 4BTYA 1N8R4 5EEOA 1MWTA 1CQSA 1MWRA 1SARA 5M19A 1UUGB 4KZ1A 3WOFB 4BL2A 1D6ZA 1Q40B 2OTJ3 2GBXB 3PCRA 3NQZA 5AI1A 1N5HA 3FF2A 1O7GB 3LYGA 4WHAA 1W6CA 1X1UA 5JBSA 1YIT3 1X1WA 8RNTA 1IK3A 1WMNA 3AMOA 3X42A 1VQQA 3Q1CA 4EBGA 4RNYA 2V1LA 1IV7A 3KFQC 5BXQA 1QVF2 5AYSC 3RNTA 1YVSA 1I2FA 2W04A 4HM6B 4N6UA 5AIHA 1X1YA 2UX0A 5FW5A 5M18A 2IA7A 1JZDA 1LOVA 3DM8A 2OQEA 1IT7A 2K3DA 4K61A 5IERA 1VZZA 1KWIA 1T5YA 3DMCA 3B8LA 4H61A 5IW9A 1W01A 3HZPA 4TX4A 4EC6A 3DY5A 3KKGA 1N5PA 3KSPA 4N6V0 2R41A 1NNVA 4BTXA 3JUQA 4O3VA 3QK9A 1LOWA 1GMPA 1FGOA 1YI23 5KP3A 3SYUA 1ZS7A 2BMRB 2XSOB 1US1A 1TUHA 1A2VA 2IYJA 2CH9A 3EC9A 1JB4A 1AV4A 4K1UA 1W2ZA 5TGNA 3CMA3 2ZA4A 4HM5B 4HZ9B 2BIRA 3M8CA 4MMYB 2F98A 1DETA 3K7CA 2RBIA 1YJW3 1BRNL 2K54A 1TIJA 2FGTA 3OWSA 3FG3A 1OHPA 3OW22 3FH1A 3J7Yd 2BNGA 1J2BA 5IENA 2HMOB 2CG1A 3T0UA 1LRAA 5RNTA 1OGZA 4HJLB 1VQ53 1Z1SA 1N9JA 2IY2A 3U97A 4HM3B 2SARA 2BMOB
chains in the Genus database with same CATH topology
1K28A 1SJWA 4HM2B 3DGOA 3NHXA 4NHFA 1U8CB 3ROBA 4LZIA 2CWTA 2ZDJA 3ECFA 3HX8A 3N54B 1QAFA 3K0ZA 4HZBB 2CFGA 1M9GA 3X40A 1DMNA 3GZYB 2M7OA 1C7HA 2CW9A 1E3VA 2Y74A 3OX9A 5IF6A 1G96A 3FCSB 2P0MA 2CFKA 2CWUA 1W02A 2OOVC 3IMAB 2XGNA 5D83A 3LTDA 2K0MA 4FMAA 4N6NB 3CCQ3 1FGMA 4OVMA 6STDA 1UI8A 4N6OB 3T8NA 4RNZA 1O7NB 3DGMA 5IG3A 3WODG 1DYUA 3CCS3 2OWPA 3T8UA 1JV2B 3PZWA 3B4OA 3IJEB 5CLKA 1IV9A 1O7PB 3FKAA 2O9UX 1K734 3FGYA 1OHOA 3HI7A 3KE7A 3CCM3 4K1VA 2RSXA 5AEWB 4BTWA 1Q40A 1VQN3 2KXGA 2YFLB 4CCVA 3X3XA 1MOLA 1JN5B 2FNQA 2P05A 2WOFA 3CCE3 5IEPA 1A2KA 1YGEA 4MEIA 5EVHA 1M1XB 3N8BA 2PZVA 2QEX3 2HMMB 5CF1A 3B7CA 2B1XB 1R4CA 1D6YA 3DUKA 3LZAA 3KN4A 1N9EA 3JVCA 5JPPA 2SBLA 1AVLA 4EYCA 3G0KA 5LC7A 1JRQA 3BB9A 3A76A 3EN1B 4I4KA 3UL6A 3CCU3 1GD4A 2W03A 1OGXA 5AIIA 3LH4A 3G4S3 2WGQA 4LMIA 3MYTA 4XM4A 5EQLA 3CNMA 2C10A 3OV4A 1D6UA 4HM0B 4N6MA 3G16A 4WFOA 5KP1A 4LGQA 3BNBA 1PU4A 1VQ43 2OCTA 1E3RA 1CYUA 4OUQA 2P09A 1UUVB 3S5CA 2CFLA 3RGRA 3LTAA 1TP6A 3BNDA 1K8A4 4EV5A 1CYVA 3D9RA 2W6JH 3F8XA 5CXOA 1YIJ3 3CD63 3CPOA 3JUPA 3BNCA 1W6YA 5I97A 1HKXA 4J8TA 2GBWB 4L7KA 3X3ZA 3E99A 5IEOA 2JQ5A 3NBBA 3CCL3 1RRLA 3N9HA 3F8HA 2B24B 3MPHA 1S5AA 2CIUA 2WO0A 4KFFA 5DREA 3SX1A 1TFOA 4N3VA 1OPYA 4HM7B 3EQQB 2KCDA 3JUOA 3HIGA 2STDA 1VQ93 3GWRA 3CC43 3BNEA 3MHEA 1V74A 3PCSA 3KSED 3PS8A 1MNLA 2P38A 3SXXA 3NV0A 3IPTA 2E2TA 3X3YA 7STDA 2IMJA 3I0YA 3K63A 2BT3A 4XDVA 1JNQA 4JF8A 5HGRA 4WYKA 1JKGA 3MWZA 3GZBA 1KSIA 4N6LA 3I563 1ULJB 1LOXA 4XDWA 3SLUA 3HIIA 3JUNA 3VGNA 1K41A 1VQL3 1A90A 1O7WB 3EJVA 4HM8B 1VQ63 1GY7A 1IQ8A 1JJ22 4G1MB 1K9M4 2OTL3 4O2HA 1YJN3 1Q7Y4 2BMQB 1LXEA 1WTHA 1Y4KA 1RJOA 2OOVA 3S29A 3CNXA 1W5ZA 2IUKA 2Z77A 1JN5A 4X2OA 5DRVA 1NB5I 1W6GA 3FG4A 3OXAA 2YFIB 2CFWA 2HMNB 2GEYA 2MF7A 3X41A 4AKYA 3LMLA 1TFKA 1EA2A 3UJMA 2RFRA 2XR8B 2CWVA 3NV0B 4HM4B 4K90B 4MMZB 3GAXA 4IT7A 2QGUA 4FMBA 4O8SA 4WYKB 1JKGB 1OH0A 2JDIH 4ORLA 2XEPA 1RN7A 3NQYA 3OWUA 3G8ZA 1IDPA 1W4NA 2Q07A 4R1KA 3FSDA 2GU1A 5ELJA 3SEDA 1QALA 3MSOA 1Q824 1OHSA 4X2HA 5AIGA 5IG0A 1KC84 2Y73A 1STDA 1U5OA 2W2CA 3NM7A 4R9LA 1VQM3 2KRTA 4KVHA 2O3OA 1O7HB 1IVXA 2F86B 2XF3A 4STDA 4Q53A 1CEWI 3MG2A 3CME3 1NU3A 4OK0A 3EHCA 2P0XA 3H51A 4EV2A 3ALAA 2BO9B 4IIAA 2D1WA 2GEXA 4J9AA 1SIIA 3G6E3 4H3UA 2CK3H 1GY5A 4WP5A 3CPW2 1RKYA 4EXRA 1O7MB 1STFI 2CKFB 4XBYA 3O8YA 3V99A 1NWWA 4MMXB 4CDLA 4LEHA 4R80A 2CG0A 2I9WA 2HMKB 4U13A 4HM1B 2W56B 3MKIA 5AEUB 3F40A 3FLJA 3FG1A 1SQWA 3DXOA 4R4KA 1VQP3 1PFPA 2E2UA 3EBTA 1A67A 3EBYA 1SIHA 2C11A 1ROAA 2GU3A 4XBXA 1QVG2 2E2VA 2ZL8A 1RRHA 3GRDA 2XH9A 2INXA 5D81A 2GXFA 1SPUA 1L5GB 3H3HA 1ISKA 4FR9A 3WMDA 1IVUA 1QMAA 3Q90A 1VQ83 3CXC2 1AVKA 1AR0A 1ZX2A 2A15A 2PNCA 2XRXB 3V98A 3QRDA 3CU3A 3NBJA 8CHOA 4HVNA 1GS3A 3CCR3 1YVBI 4XB5A 2RGQA 3GZXB 3EE1A 4JRFA 1Q864 5ELUA 1IU7A 1OF5B 3EN8A 3S27A 1NO3A 3TDGA 5KP4A 3DGNA 5D82A 3U1WA 4MJDA 4R9KA 4RZMA 3OWYA 2ML5A 1EKMA 3CCV3 4L8OA 3V92A 5CK6A 2Z6BA 1WMOA 4QWTA 5IG5A 3EB8A 3LT9A 2OQEC 1OCVA 1W00A 2XSHB 2RCDA 5FGOA 3NUVA 2W0QA 1UUWB 2QA43 3RGAA 2QIYA 1NB3I 3MG3A 3NX0A 3LXUX 4L8PA 3S28A 2CHCA 1OUNA 3CCJ3 1ULIB 1FA3A 2D42A 3UB1A 2L4VA 1EG9B 3FF0A 1F8NA 5BVBA 4FCJA 3ER7A 1IT8A 3EF8A 3SOYA 3HK4A 1Q42A 3AMOB 2XGLA 1FUWA 1NDOB 2YFJB 3KZTA 3NBRA 4AEQA 4KFEA 1JB2A 3CC73 3WDGB 1FGQA 1WQLB 1LVNA 4FMDA 1BUQA 1WMPA 4O02B 1DMMA 3F7XA 3F14A 1LNHA 2ML6A 2Z76A 4WWUC 2CC3A 1EQKA 2WGOA 2XFSA 3F7SA 1DMQA 3K9MC 2W9PA 3Q2PA 5A0OB 4GL6A 1VQK3 2WOHA 1IVWA 1WNHA 1FGRA 4FCZA 1M904 3MG1A 1FGTA 3SVAA 2FXTA 2LQVA 4IPBA 3VSYA 2W56A 3PGBA 1NJI4 1S723 3DGLA 3PXMA 2BHMA 3LOYA 1ASKA 1E97A 3VF1A 1DVCA 3WA3A 4AKZA 1UW1A 1KQS2 1OACA 1IVVA 1QAKA 3UL5A 1JB5A 3NXJA 1W2B2 4LSOA 1YJ93 1W7CA 3EX9A 5STDA 4GB5A 2R4IA 2IUJA 2W9QA 1GY6A 2MC8A 3UNLA 2HMJB 1HU9A 3L0RA 4RBNA 5G2GA 2CFDA 3I553 4FCMA 4HBRA 3STDA 3BLZA 5IG4A 3CC23 3B4PA 3G713 3KIIA 3LTBA 4HKVB 1N8QA 3F9SA 5AYRB 1VQ73 3K5TA 2Z7AA 1IQYA 1IQXA 1QJGA 1GYBA 4HYZA 5LC6A 1VQO3 3GZRA 3SOAA 3RDEA 1Q814 2LYXA 1KD14 3WA2X 4PEJA 1OF5A 3FZWA 1TU5A 2XFTA 4N6TA 1ROVA 4NREA 3S67A 3JUMA 3D3LA 4KFDA 4FMCA 1ZO2A 3PYJA 3LTCA 2F99A 5AIFA 4ZM8A 1M1K4 1GD3A 2YX9A 3NM2A 1YHQ3 5JPUA 1DVDA 2HMLB 3DZLA 3WOEB 1UI7A 4XBTA 5CF2A 4BTYA 3LT8A 1N8R4 5EEOA 1CQSA 4KZ1A 3WOFB 1D6ZA 1Q40B 2OTJ3 2GBXB 3PCRA 3NQZA 5AI1A 1N5HA 3FF2A 1O7GB 3LYGA 4WHAA 1W6CA 5JBSA 1YIT3 1IK3A 1WMNA 3AMOA 3X42A 4EBGA 3Q1CA 4RNYA 2V1LA 1IV7A 3KFQC 5BXQA 1QVF2 5AYSC 4N6UA 2W04A 4HM6B 5AIHA 2UX0A 5FW5A 2IA7A 3DM8A 2OQEA 1IT7A 4K61A 5IERA 1VZZA 1KWIA 1T5YA 3DMCA 3B8LA 4H61A 5IW9A 1W01A 3HZPA 4TX4A 4EC6A 3DY5A 3KKGA 1N5PA 3KSPA 4N6V0 4BTXA 3JUQA 4O3VA 3QK9A 1FGOA 1YI23 5KP3A 2BMRB 2XSOB 1US1A 1TUHA 1A2VA 2CH9A 3EC9A 1JB4A 1AV4A 4K1UA 1W2ZA 5TGNA 3CMA3 4HM5B 4HZ9B 3M8CA 4MMYB 2F98A 3K7CA 1YJW3 2K54A 1TIJA 2FGTA 3OWSA 3FG3A 1OHPA 3OW22 3FH1A 3J7Yd 2BNGA 1J2BA 5IENA 2HMOB 2CG1A 3T0UA 1OGZA 4HJLB 1VQ53 1Z1SA 1N9JA 3U97A 4HM3B 2BMOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYZ A;  2MC8 A; 
#chains in the Genus database with same CATH topology
 1K28 A;  1SJW A;  4HM2 B;  3DGO A;  4KT3 B;  3NHX A;  4NHF A;  5BIR A;  1U8C B;  2KF4 A;  4LZI A;  1FUT A;  3ROB A;  2CWT A;  2ZDJ A;  3ECF A;  3HX8 A;  3N54 B;  1QAF A;  3K0Z A;  4HZB B;  7GSP A;  2H0H A;  1BSE A;  1M9G A;  2CFG A;  1DMN A;  3GZY B;  1RGH A;  2M7O A;  3X40 A;  1C7H A;  4GHO A;  2CW9 A;  1E3V A;  2Y74 A;  3OX9 A;  3D5G A;  5IF6 A;  1G96 A;  3FCS B;  2P0M A;  4BL3 A;  3WHO A;  2CFK A;  2CWU A;  3Q3F A;  1W02 A;  2OOV C;  3IMA B;  2XGN A;  5D83 A;  1BNG A;  2K0M A;  3LTD A;  4FMA A;  4N6N B;  3CCQ 3;  1FGM A;  4OVM A;  6STD A;  1UI8 A;  1R4Y A;  4N6O B;  3T8N A;  4RNZ A;  1O7N B;  3DGM A;  5IG3 A;  3WOD G;  1DYU A;  3CCS 3;  2OWP A;  3T8U A;  5G1K A;  2F56 A;  1JV2 B;  3PZW A;  3BU4 A;  3B4O A;  3IJE B;  5CLK A;  1DE3 A;  1IV9 A;  1O7P B;  3FKA A;  2O9U X;  1K73 4;  3FGY A;  1BNI A;  1RDS A;  1OHO A;  2C4B A;  3HI7 A;  2KF5 A;  3KE7 A;  4BIR A;  3CCM 3;  2UGI A;  2H0G A;  4K1V A;  2RSX A;  5AEW B;  4BTW A;  1Q40 A;  1VQN 3;  2KXG A;  2YFL B;  4CCV A;  1FYS A;  1MOL A;  1JN5 B;  2FNQ A;  2P05 A;  2WOF A;  3X3X A;  4CPK A;  5IEP A;  3CCE 3;  1A2K A;  1YGE A;  4MEI A;  5EVH A;  4CJN A;  1M1X B;  3N8B A;  2PZV A;  2QEX 3;  2HMM B;  5CF1 A;  3B7C A;  2B1X B;  1R4C A;  1D6Y A;  3DUK A;  3LZA A;  1BU4 A;  4HOH A;  3KN4 A;  1N9E A;  3JVC A;  5JPP A;  1YGW A;  2SBL A;  1AVL A;  4EYC A;  3G0K A;  5LC7 A;  1JRQ A;  3BB9 A;  3A76 A;  1B20 A;  3EN1 B;  4NPB A;  4I4K A;  3UL6 A;  3CCU 3;  1GD4 A;  2W03 A;  1OGX A;  5AII A;  3LH4 A;  3G4S 3;  2WGQ A;  4LMI A;  3MYT A;  4XM4 A;  2H0I A;  5EQL A;  1UCI A;  1BGS A;  3CNM A;  2C10 A;  3OV4 A;  1D6U A;  4HM0 B;  4N6M A;  4EW5 A;  3G16 A;  4WFO A;  5KP1 A;  3D79 A;  4LGQ A;  3BNB A;  1PU4 A;  1TRP A;  1VQ4 3;  2OCT A;  1E3R A;  1BRS A;  4J5G A;  1CYU A;  4OUQ A;  2P09 A;  1UUV B;  3S5C A;  1BVI A;  2CFL A;  3RGR A;  1RN4 A;  3LTA A;  1TP6 A;  3URP A;  3BND A;  1K8A 4;  4EV5 A;  1CYV A;  2AAD A;  3D9R A;  2W6J H;  3F8X A;  5CXO A;  1YIJ 3;  3CD6 3;  1RCL A;  3A5E A;  1BNJ A;  3CPO A;  3JUP A;  3BNC A;  1W6Y A;  1G0T A;  5I97 A;  1HKX A;  4J8T A;  1IYY A;  4LYL B;  2GBW B;  1BRH A;  4L7K A;  3X3Z A;  3E99 A;  5IEO A;  2JQ5 A;  3NBB A;  3CCL 3;  1RRL A;  3N9H A;  3F8H A;  2B24 B;  3MPH A;  1S5A A;  2BU4 A;  2CIU A;  2WO0 A;  4KFF A;  5DRE A;  3SX1 A;  1RHL A;  1BAO A;  1TFO A;  4N3V A;  1OPY A;  1GSP A;  1BIR A;  4HM7 B;  1BOX A;  3EQQ B;  2KCD A;  3JUO A;  3HIG A;  2STD A;  1VQ9 3;  3GWR A;  3CC4 3;  3BNE A;  4J5K A;  3MHE A;  1V74 A;  1MWU A;  3PCS A;  3KSE D;  7RNT A;  3PS8 A;  1RGL A;  1MNL A;  2P38 A;  1I2G A;  3SXX A;  3NV0 A;  3IPT A;  2E2T A;  3X3Y A;  7STD A;  2IMJ A;  3I0Y A;  3K63 A;  2BT3 A;  4XDV A;  1JNQ A;  4JF8 A;  5HGR A;  1RCK A;  4WYK A;  5G1L A;  1JKG A;  3MWZ A;  2CX1 A;  3GZB A;  1KSI A;  4N6L A;  3I56 3;  1RN1 A;  1BRG A;  1LOX A;  1ULJ B;  4XDW A;  3SLU A;  3HII A;  3JUN A;  3VGN A;  1K41 A;  1VQL 3;  1A90 A;  1O7W B;  3EJV A;  4HM8 B;  3ZFZ A;  1VQ6 3;  1GY7 A;  1IQ8 A;  5BU4 A;  1JJ2 2;  1CH0 A;  4G1M B;  1K9M 4;  2OTL 3;  4O2H A;  1YJN 3;  9RNT A;  1Q7Y 4;  1AY7 A;  2BMQ B;  1LXE A;  1WTH A;  1UCL A;  1RJO A;  1Y4K A;  1RNB A;  2OOV A;  3S29 A;  3CNX A;  1W5Z A;  2IUK A;  2Z77 A;  1JN5 A;  1RGG A;  4X2O A;  5DRV A;  1RMS A;  5M1A A;  1NB5 I;  1W6G A;  3FG4 A;  3OXA A;  2YFI B;  1GMQ A;  1RGC A;  2CFW A;  2HMN B;  2GEY A;  2MF7 A;  3X41 A;  4AKY A;  3LML A;  1TFK A;  1EA2 A;  3UJM A;  2RFR A;  2XR8 B;  2CWV A;  3NV0 B;  4HM4 B;  2ZHX B;  4K90 B;  4MMZ B;  1UGH I;  3GAX A;  1JBR A;  4IT7 A;  2QGU A;  1RLS A;  4FMB A;  4O8S A;  1RGA A;  4WYK B;  1JKG B;  1OH0 A;  1BSD A;  2JDI H;  3AHW A;  4ORL A;  2XEP A;  1RN7 A;  3NQY A;  3AHS A;  3OWU A;  3G8Z A;  1IDP A;  1I70 A;  1W4N A;  1GOU A;  2Q07 A;  3KCH A;  4R1K A;  2AAE A;  5GSP A;  3FSD A;  2GU1 A;  1B2Z A;  5ELJ A;  3SED A;  1QAL A;  3MSO A;  1Q82 4;  3GSP A;  1JBT A;  1OHS A;  1UCJ A;  4X2H A;  5AIG A;  5IG0 A;  1KC8 4;  2Y73 A;  1STD A;  1U5O A;  1UCK A;  2W2C A;  3NM7 A;  4R9L A;  2KRT A;  1VQM 3;  4KVH A;  1BUJ A;  1MGW A;  1MWS A;  2O3O A;  1O7H B;  1IVX A;  2F86 B;  2XF3 A;  2KF3 A;  3ZG5 A;  4STD A;  4Q53 A;  1CEW I;  3MG2 A;  3CME 3;  1NU3 A;  1PYL A;  1EUI C;  1A2P A;  4OK0 A;  3EHC A;  1AQZ A;  2P0X A;  3H51 A;  4EV2 A;  2BO9 B;  3ALA A;  4IIA A;  2D1W A;  2GEX A;  4J9A A;  1SII A;  3G6E 3;  1UDI I;  4H3U A;  5HOH A;  1BSB A;  1FZU A;  1GY5 A;  2CK3 H;  3DGY A;  4WP5 A;  3CPW 2;  1RKY A;  1BAN A;  1X1X A;  4EXR A;  1RSN A;  1O7M B;  1STF I;  2CKF B;  4XBY A;  3O8Y A;  1B2U A;  3V99 A;  1NWW A;  4MMX B;  4CDL A;  4LEH A;  4R80 A;  1V57 A;  2CG0 A;  2I9W A;  2HMK B;  4U13 A;  4HM1 B;  2W56 B;  3MKI A;  5AEU B;  3F40 A;  3FLJ A;  3FG1 A;  4DKI A;  1SQW A;  3DXO A;  4R4K A;  1VQP 3;  2F5W A;  1PFP A;  2L1S A;  3AGN A;  2E2U A;  2HOH A;  3EBT A;  1A67 A;  3EBY A;  1SIH A;  1RGF A;  2C11 A;  1ROA A;  1G02 A;  1C54 A;  2GU3 A;  4XBX A;  1QVG 2;  1BRJ A;  2E2V A;  2ZL8 A;  1RRH A;  3GRD A;  2XH9 A;  2INX A;  1RGE A;  1B2S A;  1RNT A;  5D81 A;  2GXF A;  1SPU A;  1L5G B;  4ILF A;  3H3H A;  2J8X B;  1ISK A;  4FR9 A;  1BNR A;  3WMD A;  1IVU A;  1QMA A;  3Q90 A;  1VQ8 3;  3CXC 2;  1AVK A;  1AR0 A;  1ZX2 A;  2A15 A;  2PNC A;  2XRX B;  3V98 A;  3QRD A;  3CU3 A;  3NBJ A;  8CHO A;  4HVN A;  1GS3 A;  3CCR 3;  1YVB I;  2CX0 A;  4XB5 A;  2RGQ A;  1RGK A;  3GZX B;  3EE1 A;  1I2E A;  1I3F A;  4JRF A;  1FUS A;  5ELU A;  1IU7 A;  1PY3 A;  6RNT A;  1Q86 4;  1OF5 B;  1BNS A;  1JZO A;  1TRQ A;  2RNT A;  1ZGX A;  3EN8 A;  3S27 A;  1NO3 A;  3TDG A;  5KP4 A;  6GSP A;  3DGN A;  5D82 A;  1BSA A;  3U1W A;  4MJD A;  4R9K A;  4RZM A;  3OWY A;  1BRI A;  2ML5 A;  1EKM A;  3CCV 3;  4L8O A;  3V92 A;  5CK6 A;  2KF6 A;  2Z6B A;  3BIR A;  4RNT A;  1WMO A;  4QWT A;  5IG5 A;  3EB8 A;  3LT9 A;  2OQE C;  1OCV A;  1RTU A;  1W00 A;  2F4Y A;  2XSH B;  2RCD A;  3AGO A;  5FGO A;  3NUV A;  2W0Q A;  1UUW B;  2QA4 3;  1B2M A;  4GSP A;  1BNE A;  3ZG0 A;  3RGA A;  2QIY A;  1B2X A;  1I3I A;  1NB3 I;  3MG3 A;  3NX0 A;  3LXU X;  4L8P A;  3S28 A;  1YNV X;  2CHC A;  1OUN A;  3CCJ 3;  1ULI B;  1FA3 A;  2D42 A;  1LOY A;  2L4V A;  1EG9 B;  3UB1 A;  3FF0 A;  1F8N A;  5BVB A;  1I8V A;  4FCJ A;  3ER7 A;  1IT8 A;  3EF8 A;  1TTO A;  3HK4 A;  1Q42 A;  3SOY A;  4BU4 A;  3AMO B;  2XGL A;  1FUW A;  1NDO B;  2YFJ B;  3KZT A;  3NBR A;  1I0X A;  4KFE A;  4AEQ A;  1GOY A;  1JB2 A;  3CC7 3;  2UUG C;  3WDG B;  1FGQ A;  1WQL B;  1LVN A;  1T3B A;  4FMD A;  1BUQ A;  1WMP A;  4O02 B;  1DMM A;  1B21 A;  3F7X A;  3F14 A;  1LNH A;  2ML6 A;  2Z76 A;  4WWU C;  2CC3 A;  1EQK A;  2WGO A;  2XFS A;  3F7S A;  1DMQ A;  3K9M C;  2W9P A;  3Q2P A;  5A0O B;  4GL6 A;  1Q9E A;  1TJD A;  1VQK 3;  2WOH A;  1IVW A;  1WNH A;  1FGR A;  4FCZ A;  1M90 4;  3MG1 A;  1FGT A;  3SVA A;  2FXT A;  2LQV A;  4IPB A;  3VSY A;  2W56 A;  3PGB A;  1NJI 4;  1S72 3;  3DGL A;  3PXM A;  2BHM A;  1HYF A;  3LOY A;  1ASK A;  1E97 A;  3VF1 A;  3HOH A;  1FW7 A;  1DVC A;  3WA3 A;  4AKZ A;  1UW1 A;  1GMR A;  1KQS 2;  1OAC A;  1IVV A;  1QAK A;  1T2H A;  3UL5 A;  1JB5 A;  1BSC A;  3NXJ A;  1W2B 2;  4LSO A;  1B27 A;  4I5Q A;  1YJ9 3;  1W7C A;  3EX9 A;  5STD A;  4GB5 A;  2R4I A;  2IUJ A;  2W9Q A;  1GY6 A;  2MC8 A;  3UNL A;  2HMJ B;  1HU9 A;  3L0R A;  4RBN A;  5G2G A;  2CFD A;  3I55 3;  4FCM A;  4HBR A;  3D5I A;  3STD A;  1JBS A;  1LNI A;  3BLZ A;  5IG4 A;  3D4A A;  3B4P A;  3G71 3;  3CC2 3;  3KII A;  2F5M A;  4HAA A;  3LTB A;  3DH2 A;  4HKV B;  1N8Q A;  3F9S A;  5AYR B;  2KAA A;  1VQ7 3;  3K5T A;  2Z7A A;  1IQY A;  1IQX A;  1QJG A;  1MGR A;  1GYB A;  4HYZ A;  5LC6 A;  1VQO 3;  3GZR A;  3SOA A;  3RDE A;  1Q81 4;  2LYX A;  1KD1 4;  3WA2 X;  4PEJ A;  1OF5 A;  3FZW A;  1TU5 A;  1I0V A;  2XFT A;  1UGI A;  4N6T A;  1ROV A;  4NRE A;  3S67 A;  1B3S A;  1T2I A;  3JUM A;  3D3L A;  4KFD A;  4FMC A;  3WR2 A;  1HZ1 A;  1ZO2 A;  1LQM B;  1BRK A;  3PYJ A;  1BNF A;  3LTC A;  1EEJ A;  2F99 A;  1GOV A;  5AIF A;  4ZM8 A;  1M1K 4;  1GD3 A;  2YX9 A;  3NM2 A;  1YHQ 3;  5JPU A;  1DVD A;  1LQG C;  2HML B;  2GSP A;  1UI7 A;  3DZL A;  3WOE B;  4XBT A;  5CF2 A;  1Q7H A;  1V58 A;  3LT8 A;  4BTY A;  1N8R 4;  5EEO A;  1MWT A;  1CQS A;  1MWR A;  1SAR A;  5M19 A;  1UUG B;  4KZ1 A;  3WOF B;  4BL2 A;  1D6Z A;  1Q40 B;  2OTJ 3;  2GBX B;  3PCR A;  3NQZ A;  5AI1 A;  1N5H A;  3FF2 A;  1O7G B;  3LYG A;  4WHA A;  1W6C A;  1X1U A;  5JBS A;  1YIT 3;  1X1W A;  8RNT A;  1IK3 A;  1WMN A;  3AMO A;  3X42 A;  1VQQ A;  3Q1C A;  4EBG A;  4RNY A;  2V1L A;  1IV7 A;  3KFQ C;  5BXQ A;  1QVF 2;  5AYS C;  3RNT A;  1YVS A;  1I2F A;  2W04 A;  4HM6 B;  4N6U A;  5AIH A;  1X1Y A;  2UX0 A;  5FW5 A;  5M18 A;  2IA7 A;  1JZD A;  1LOV A;  3DM8 A;  2OQE A;  1IT7 A;  2K3D A;  4K61 A;  5IER A;  1VZZ A;  1KWI A;  1T5Y A;  3DMC A;  3B8L A;  4H61 A;  5IW9 A;  1W01 A;  3HZP A;  4TX4 A;  4EC6 A;  3DY5 A;  3KKG A;  1N5P A;  3KSP A;  4N6V 0;  2R41 A;  1NNV A;  4BTX A;  3JUQ A;  4O3V A;  3QK9 A;  1LOW A;  1GMP A;  1FGO A;  1YI2 3;  5KP3 A;  3SYU A;  1ZS7 A;  2BMR B;  2XSO B;  1US1 A;  1TUH A;  1A2V A;  2IYJ A;  2CH9 A;  3EC9 A;  1JB4 A;  1AV4 A;  4K1U A;  1W2Z A;  5TGN A;  3CMA 3;  2ZA4 A;  4HM5 B;  4HZ9 B;  2BIR A;  3M8C A;  4MMY B;  2F98 A;  1DET A;  3K7C A;  2RBI A;  1YJW 3;  1BRN L;  2K54 A;  1TIJ A;  2FGT A;  3OWS A;  3FG3 A;  1OHP A;  3OW2 2;  3FH1 A;  3J7Y d;  2BNG A;  1J2B A;  5IEN A;  2HMO B;  2CG1 A;  3T0U A;  1LRA A;  5RNT A;  1OGZ A;  4HJL B;  1VQ5 3;  1Z1S A;  1N9J A;  2IY2 A;  3U97 A;  4HM3 B;  2SAR A;  2BMO B; 
#chains in the Genus database with same CATH homology
 1K28 A;  1SJW A;  4HM2 B;  3DGO A;  3NHX A;  4NHF A;  1U8C B;  3ROB A;  4LZI A;  2CWT A;  2ZDJ A;  3ECF A;  3HX8 A;  3N54 B;  1QAF A;  3K0Z A;  4HZB B;  2CFG A;  1M9G A;  3X40 A;  1DMN A;  3GZY B;  2M7O A;  1C7H A;  2CW9 A;  1E3V A;  2Y74 A;  3OX9 A;  5IF6 A;  1G96 A;  3FCS B;  2P0M A;  2CFK A;  2CWU A;  1W02 A;  2OOV C;  3IMA B;  2XGN A;  5D83 A;  3LTD A;  2K0M A;  4FMA A;  4N6N B;  3CCQ 3;  1FGM A;  4OVM A;  6STD A;  1UI8 A;  4N6O B;  3T8N A;  4RNZ A;  1O7N B;  3DGM A;  5IG3 A;  3WOD G;  1DYU A;  3CCS 3;  2OWP A;  3T8U A;  1JV2 B;  3PZW A;  3B4O A;  3IJE B;  5CLK A;  1IV9 A;  1O7P B;  3FKA A;  2O9U X;  1K73 4;  3FGY A;  1OHO A;  3HI7 A;  3KE7 A;  3CCM 3;  4K1V A;  2RSX A;  5AEW B;  4BTW A;  1Q40 A;  1VQN 3;  2KXG A;  2YFL B;  4CCV A;  3X3X A;  1MOL A;  1JN5 B;  2FNQ A;  2P05 A;  2WOF A;  3CCE 3;  5IEP A;  1A2K A;  1YGE A;  4MEI A;  5EVH A;  1M1X B;  3N8B A;  2PZV A;  2QEX 3;  2HMM B;  5CF1 A;  3B7C A;  2B1X B;  1R4C A;  1D6Y A;  3DUK A;  3LZA A;  3KN4 A;  1N9E A;  3JVC A;  5JPP A;  2SBL A;  1AVL A;  4EYC A;  3G0K A;  5LC7 A;  1JRQ A;  3BB9 A;  3A76 A;  3EN1 B;  4I4K A;  3UL6 A;  3CCU 3;  1GD4 A;  2W03 A;  1OGX A;  5AII A;  3LH4 A;  3G4S 3;  2WGQ A;  4LMI A;  3MYT A;  4XM4 A;  5EQL A;  3CNM A;  2C10 A;  3OV4 A;  1D6U A;  4HM0 B;  4N6M A;  3G16 A;  4WFO A;  5KP1 A;  4LGQ A;  3BNB A;  1PU4 A;  1VQ4 3;  2OCT A;  1E3R A;  1CYU A;  4OUQ A;  2P09 A;  1UUV B;  3S5C A;  2CFL A;  3RGR A;  3LTA A;  1TP6 A;  3BND A;  1K8A 4;  4EV5 A;  1CYV A;  3D9R A;  2W6J H;  3F8X A;  5CXO A;  1YIJ 3;  3CD6 3;  3CPO A;  3JUP A;  3BNC A;  1W6Y A;  5I97 A;  1HKX A;  4J8T A;  2GBW B;  4L7K A;  3X3Z A;  3E99 A;  5IEO A;  2JQ5 A;  3NBB A;  3CCL 3;  1RRL A;  3N9H A;  3F8H A;  2B24 B;  3MPH A;  1S5A A;  2CIU A;  2WO0 A;  4KFF A;  5DRE A;  3SX1 A;  1TFO A;  4N3V A;  1OPY A;  4HM7 B;  3EQQ B;  2KCD A;  3JUO A;  3HIG A;  2STD A;  1VQ9 3;  3GWR A;  3CC4 3;  3BNE A;  3MHE A;  1V74 A;  3PCS A;  3KSE D;  3PS8 A;  1MNL A;  2P38 A;  3SXX A;  3NV0 A;  3IPT A;  2E2T A;  3X3Y A;  7STD A;  2IMJ A;  3I0Y A;  3K63 A;  2BT3 A;  4XDV A;  1JNQ A;  4JF8 A;  5HGR A;  4WYK A;  1JKG A;  3MWZ A;  3GZB A;  1KSI A;  4N6L A;  3I56 3;  1ULJ B;  1LOX A;  4XDW A;  3SLU A;  3HII A;  3JUN A;  3VGN A;  1K41 A;  1VQL 3;  1A90 A;  1O7W B;  3EJV A;  4HM8 B;  1VQ6 3;  1GY7 A;  1IQ8 A;  1JJ2 2;  4G1M B;  1K9M 4;  2OTL 3;  4O2H A;  1YJN 3;  1Q7Y 4;  2BMQ B;  1LXE A;  1WTH A;  1Y4K A;  1RJO A;  2OOV A;  3S29 A;  3CNX A;  1W5Z A;  2IUK A;  2Z77 A;  1JN5 A;  4X2O A;  5DRV A;  1NB5 I;  1W6G A;  3FG4 A;  3OXA A;  2YFI B;  2CFW A;  2HMN B;  2GEY A;  2MF7 A;  3X41 A;  4AKY A;  3LML A;  1TFK A;  1EA2 A;  3UJM A;  2RFR A;  2XR8 B;  2CWV A;  3NV0 B;  4HM4 B;  4K90 B;  4MMZ B;  3GAX A;  4IT7 A;  2QGU A;  4FMB A;  4O8S A;  4WYK B;  1JKG B;  1OH0 A;  2JDI H;  4ORL A;  2XEP A;  1RN7 A;  3NQY A;  3OWU A;  3G8Z A;  1IDP A;  1W4N A;  2Q07 A;  4R1K A;  3FSD A;  2GU1 A;  5ELJ A;  3SED A;  1QAL A;  3MSO A;  1Q82 4;  1OHS A;  4X2H A;  5AIG A;  5IG0 A;  1KC8 4;  2Y73 A;  1STD A;  1U5O A;  2W2C A;  3NM7 A;  4R9L A;  1VQM 3;  2KRT A;  4KVH A;  2O3O A;  1O7H B;  1IVX A;  2F86 B;  2XF3 A;  4STD A;  4Q53 A;  1CEW I;  3MG2 A;  3CME 3;  1NU3 A;  4OK0 A;  3EHC A;  2P0X A;  3H51 A;  4EV2 A;  3ALA A;  2BO9 B;  4IIA A;  2D1W A;  2GEX A;  4J9A A;  1SII A;  3G6E 3;  4H3U A;  2CK3 H;  1GY5 A;  4WP5 A;  3CPW 2;  1RKY A;  4EXR A;  1O7M B;  1STF I;  2CKF B;  4XBY A;  3O8Y A;  3V99 A;  1NWW A;  4MMX B;  4CDL A;  4LEH A;  4R80 A;  2CG0 A;  2I9W A;  2HMK B;  4U13 A;  4HM1 B;  2W56 B;  3MKI A;  5AEU B;  3F40 A;  3FLJ A;  3FG1 A;  1SQW A;  3DXO A;  4R4K A;  1VQP 3;  1PFP A;  2E2U A;  3EBT A;  1A67 A;  3EBY A;  1SIH A;  2C11 A;  1ROA A;  2GU3 A;  4XBX A;  1QVG 2;  2E2V A;  2ZL8 A;  1RRH A;  3GRD A;  2XH9 A;  2INX A;  5D81 A;  2GXF A;  1SPU A;  1L5G B;  3H3H A;  1ISK A;  4FR9 A;  3WMD A;  1IVU A;  1QMA A;  3Q90 A;  1VQ8 3;  3CXC 2;  1AVK A;  1AR0 A;  1ZX2 A;  2A15 A;  2PNC A;  2XRX B;  3V98 A;  3QRD A;  3CU3 A;  3NBJ A;  8CHO A;  4HVN A;  1GS3 A;  3CCR 3;  1YVB I;  4XB5 A;  2RGQ A;  3GZX B;  3EE1 A;  4JRF A;  1Q86 4;  5ELU A;  1IU7 A;  1OF5 B;  3EN8 A;  3S27 A;  1NO3 A;  3TDG A;  5KP4 A;  3DGN A;  5D82 A;  3U1W A;  4MJD A;  4R9K A;  4RZM A;  3OWY A;  2ML5 A;  1EKM A;  3CCV 3;  4L8O A;  3V92 A;  5CK6 A;  2Z6B A;  1WMO A;  4QWT A;  5IG5 A;  3EB8 A;  3LT9 A;  2OQE C;  1OCV A;  1W00 A;  2XSH B;  2RCD A;  5FGO A;  3NUV A;  2W0Q A;  1UUW B;  2QA4 3;  3RGA A;  2QIY A;  1NB3 I;  3MG3 A;  3NX0 A;  3LXU X;  4L8P A;  3S28 A;  2CHC A;  1OUN A;  3CCJ 3;  1ULI B;  1FA3 A;  2D42 A;  3UB1 A;  2L4V A;  1EG9 B;  3FF0 A;  1F8N A;  5BVB A;  4FCJ A;  3ER7 A;  1IT8 A;  3EF8 A;  3SOY A;  3HK4 A;  1Q42 A;  3AMO B;  2XGL A;  1FUW A;  1NDO B;  2YFJ B;  3KZT A;  3NBR A;  4AEQ A;  4KFE A;  1JB2 A;  3CC7 3;  3WDG B;  1FGQ A;  1WQL B;  1LVN A;  4FMD A;  1BUQ A;  1WMP A;  4O02 B;  1DMM A;  3F7X A;  3F14 A;  1LNH A;  2ML6 A;  2Z76 A;  4WWU C;  2CC3 A;  1EQK A;  2WGO A;  2XFS A;  3F7S A;  1DMQ A;  3K9M C;  2W9P A;  3Q2P A;  5A0O B;  4GL6 A;  1VQK 3;  2WOH A;  1IVW A;  1WNH A;  1FGR A;  4FCZ A;  1M90 4;  3MG1 A;  1FGT A;  3SVA A;  2FXT A;  2LQV A;  4IPB A;  3VSY A;  2W56 A;  3PGB A;  1NJI 4;  1S72 3;  3DGL A;  3PXM A;  2BHM A;  3LOY A;  1ASK A;  1E97 A;  3VF1 A;  1DVC A;  3WA3 A;  4AKZ A;  1UW1 A;  1KQS 2;  1OAC A;  1IVV A;  1QAK A;  3UL5 A;  1JB5 A;  3NXJ A;  1W2B 2;  4LSO A;  1YJ9 3;  1W7C A;  3EX9 A;  5STD A;  4GB5 A;  2R4I A;  2IUJ A;  2W9Q A;  1GY6 A;  2MC8 A;  3UNL A;  2HMJ B;  1HU9 A;  3L0R A;  4RBN A;  5G2G A;  2CFD A;  3I55 3;  4FCM A;  4HBR A;  3STD A;  3BLZ A;  5IG4 A;  3CC2 3;  3B4P A;  3G71 3;  3KII A;  3LTB A;  4HKV B;  1N8Q A;  3F9S A;  5AYR B;  1VQ7 3;  3K5T A;  2Z7A A;  1IQY A;  1IQX A;  1QJG A;  1GYB A;  4HYZ A;  5LC6 A;  1VQO 3;  3GZR A;  3SOA A;  3RDE A;  1Q81 4;  2LYX A;  1KD1 4;  3WA2 X;  4PEJ A;  1OF5 A;  3FZW A;  1TU5 A;  2XFT A;  4N6T A;  1ROV A;  4NRE A;  3S67 A;  3JUM A;  3D3L A;  4KFD A;  4FMC A;  1ZO2 A;  3PYJ A;  3LTC A;  2F99 A;  5AIF A;  4ZM8 A;  1M1K 4;  1GD3 A;  2YX9 A;  3NM2 A;  1YHQ 3;  5JPU A;  1DVD A;  2HML B;  3DZL A;  3WOE B;  1UI7 A;  4XBT A;  5CF2 A;  4BTY A;  3LT8 A;  1N8R 4;  5EEO A;  1CQS A;  4KZ1 A;  3WOF B;  1D6Z A;  1Q40 B;  2OTJ 3;  2GBX B;  3PCR A;  3NQZ A;  5AI1 A;  1N5H A;  3FF2 A;  1O7G B;  3LYG A;  4WHA A;  1W6C A;  5JBS A;  1YIT 3;  1IK3 A;  1WMN A;  3AMO A;  3X42 A;  4EBG A;  3Q1C A;  4RNY A;  2V1L A;  1IV7 A;  3KFQ C;  5BXQ A;  1QVF 2;  5AYS C;  4N6U A;  2W04 A;  4HM6 B;  5AIH A;  2UX0 A;  5FW5 A;  2IA7 A;  3DM8 A;  2OQE A;  1IT7 A;  4K61 A;  5IER A;  1VZZ A;  1KWI A;  1T5Y A;  3DMC A;  3B8L A;  4H61 A;  5IW9 A;  1W01 A;  3HZP A;  4TX4 A;  4EC6 A;  3DY5 A;  3KKG A;  1N5P A;  3KSP A;  4N6V 0;  4BTX A;  3JUQ A;  4O3V A;  3QK9 A;  1FGO A;  1YI2 3;  5KP3 A;  2BMR B;  2XSO B;  1US1 A;  1TUH A;  1A2V A;  2CH9 A;  3EC9 A;  1JB4 A;  1AV4 A;  4K1U A;  1W2Z A;  5TGN A;  3CMA 3;  4HM5 B;  4HZ9 B;  3M8C A;  4MMY B;  2F98 A;  3K7C A;  1YJW 3;  2K54 A;  1TIJ A;  2FGT A;  3OWS A;  3FG3 A;  1OHP A;  3OW2 2;  3FH1 A;  3J7Y d;  2BNG A;  1J2B A;  5IEN A;  2HMO B;  2CG1 A;  3T0U A;  1OGZ A;  4HJL B;  1VQ5 3;  1Z1S A;  1N9J A;  3U97 A;  4HM3 B;  2BMO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...