2KF6A

Barnase bound to d(cgac) high pressure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf6A00
1FUSA 1RN4A 2F5WA 4GHOA 1B2XA 1AY7A 1BSAA 1I70A 2ZA4A 3AGNA 1FW7A 1BRKA 1YGWA 6RNTA 1BOXA 1BRHA 5BU4A 1RGHA 1UCLA 1LOVA 1IYYA 1B2MA 1G02A 1BRSA 1Q9EA 2F5MA 3D5GA 1LRAA 1YVSA 3SYUA 1LOYA 3WR2A 7RNTA 3AGOA 1HYFA 3KCHA 1BRNL 3Q3FA 1BNFA 1I8VA 1DETA 1RSNA 1RDSA 4J5GA 5BIRA 1BU4A 1JBSA 4BIRA 1BNIA 1BRJA 3BU4A 1I0VA 1BSCA 1R4YA 1RCLA 2KF5A 3AHSA 3AHWA 3DGYA 2KF4A 1X1YA 4BU4A 1BANA 1BNJA 1BSBA 5RNTA 1BNRA 1UCJA 1UCKA 3BIRA 2C4BA 1I2EA 2RNTA 1FZUA 1X1UA 1BUJA 2KAAA 4GSPA 1BAOA 1DE3A 3D4AA 1CH0A 1I2GA 1RLSA 1MGWA 1PY3A 2AADA 1B2UA 1I0XA 1B2ZA 7GSPA 1RCKA 1TTOA 1JBTA 1FUTA 1BSEA 1RGKA 1GSPA 2AAEA 1B21A 1PYLA 1X1XA 2SARA 1JBRA 2GSPA 6GSPA 9RNTA 3HOHA 1I3IA 1T2IA 1GMQA 3WHOA 2BU4A 1FYSA 1YNVX 3RNTA 1ZGXA 1A2PA 5HOHA 1BIRA 4HOHA 1BRIA 1TRQA 1B2SA 3D5IA 1RGAA 2KF6A 1BSDA 1B3SA 1B20A 1BGSA 1X1WA 1TRPA 5GSPA 8RNTA 1UCIA 1RN1A 1RGCA 4HAAA 1RGGA 1GOUA 1HZ1A 1LNIA 1T2HA 3A5EA 1RNTA 1B27A 1MGRA 1RHLA 1RNBA 2HOHA 1BRGA 1RGLA 2F4YA 1BVIA 4J5KA 1BNEA 1GMRA 1RGEA 1RTUA 2KF3A 3URPA 1RGFA 4RNTA 1I3FA 1C54A 1BNGA 1BNSA 2RBIA 1GOYA 1RMSA 1GOVA 2F56A 3GSPA 1LOWA 3DH2A 1AQZA 1SARA 2BIRA 1I2FA 1GMPA
chains in the Genus database with same CATH superfamily
2CX0A 4HYZA 4H61A 3EJVA 1RKYA 2H0IA 3LTCA 1OHPA 3KIIA 1B2XA 4HM7B 3V98A 3RGRA 1BSAA 1I70A 3AGNA 4LGQA 2GBWB 2K0MA 2XGNA 1N5HA 1VQK3 1YHQ3 3CD63 5CXOA 5AEWB 6RNTA 3CXC2 3G0KA 2OOVA 5BU4A 3G713 1LOVA 3I553 1G02A 5AIFA 1Q9EA 2F5MA 1IDPA 3MWZA 1YVSA 2ZHXB 3WODG 1V58A 4OK0A 1VZZA 5IG4A 1G96A 3FGYA 1SPUA 7RNTA 4XDVA 3SLUA 2IUKA 2YX9A 4ILFA 4TX4A 1YVBI 4MJDA 3V92A 3LTBA 3J7Yd 3Q3FA 2WGOA 1DETA 2FGTA 3PXMA 2RCDA 4LYLB 3G16A 1O7WB 2BMRB 3OWUA 1BU4A 3ZFZA 1EA2A 1T3BA 4HM8B 4BIRA 1VQ53 2GU3A 4N6MA 3OV4A 1E3RA 3EB8A 1BSCA 2KF5A 2OOVC 5AEUB 3GZYB 2QA43 2C10A 4R9KA 5EEOA 1L5GB 4NREA 2IYJA 4BL3A 4L8OA 4ORLA 1BSBA 4N6NB 1JV2B 3ZG5A 4EBGA 7STDA 2ML5A 3CCE3 1JZDA 1NNVA 5G2GA 3WDGB 3IPTA 1BUJA 1JNQA 1JRQA 2WOFA 5AYSC 3ROBA 1WMNA 1BAOA 3WMDA 1LVNA 2IY2A 1YJW3 2CG1A 1U5OA 2HMJB 1DE3A 4HZ9B 4Q53A 1WQLB 1PY3A 4QWTA 2KRTA 1GD4A 4HZBB 1SJWA 1TTOA 1MWSA 2E2UA 3FSDA 1CQSA 1K9M4 3B8LA 2SARA 1PYLA 2F86B 2QIYA 1JBRA 2GSPA 5AIIA 3NQYA 1QAKA 2RSXA 4LSOA 3RDEA 1T2IA 4CPKA 9RNTA 1IQ8A 1FYSA 3DXOA 4FMBA 3RNTA 1K41A 4IT7A 1VQ83 1BIRA 2JDIH 5IENA 5A0OB 1TRQA 3EQQB 3SXXA 3QK9A 1RGAA 4J9AA 5CLKA 3UNLA 3FG4A 1BGSA 3MG2A 3LOYA 1U8CB 4HM2B 1IV9A 5GSPA 1EUIC 8RNTA 1RN1A 4MEIA 1YI23 1GYBA 3D79A 3HI7A 3NBBA 4R4KA 2W9QA 3S28A 1WNHA 3F8HA 5IG3A 3AMOA 3DUKA 3O8YA 5ELUA 3OW22 1RGGA 4HJLB 1A2KA 2CWTA 4N6V0 1MWTA 1N9EA 1HZ1A 3ER7A 2XH9A 4FMDA 3DY5A 1T2HA 1US1A 2HMMB 1C7HA 3A5EA 3PYJA 2HMNB 1VQO3 1YIJ3 3N54B 1WMPA 2O9UX 1A2VA 2BMQB 1LQGC 4HM4B 4WYKB 1BVIA 4J5KA 1UDII 1EEJA 1JB4A 1JKGA 1IV7A 4R80A 1TU5A 3ECFA 1RGFA 3NV0A 1R4CA 3G6E3 3FLJA 4RNTA 1YJ93 4IIAA 6STDA 1KC84 3WOEB 1ROVA 3KE7A 2F98A 1IT8A 2P0XA 3CNXA 3FCSB 1UCLA 1I2FA 1RN4A 1FUSA 1AVKA 1Q42A 2XSHB 2XR8B 1AV4A 2LYXA 1QJGA 1QALA 4GHOA 2CFKA 1AY7A 4N6OB 3CME3 1VQN3 4XBXA 2P38A 3JVCA 1BOXA 3OXAA 4WFOA 5BXQA 2Z76A 1FA3A 3X3XA 3EN1B 1UI7A 1W02A 3D5GA 1VQ93 3CCV3 3K63A 3CMA3 1LOYA 4FMAA 1RJOA 2H0GA 2CG0A 3N9HA 2P09A 1K8A4 1RN7A 1LQMB 3KCHA 1OH0A 3F9SA 3Q90A 2W2CA 4EV2A 1NB3I 4MMXB 3PCRA 1JN5A 1N8R4 4J5GA 3CC43 3LH4A 2WOHA 3F14A 1ZO2A 1HKXA 3PS8A 3Q2PA 1JZOA 1UW1A 3BU4A 1W6GA 1NJI4 1Z1SA 2OQEA 2K3DA 3LYGA 1I0VA 3NHXA 1R4YA 3AHSA 1T5YA 3DGYA 3CPW2 1O7PB 2KF4A 2OCTA 3F7XA 2XF3A 4K1VA 1E97A 2I9WA 1M9GA 5D82A 4BTXA 5KP3A 1ZX2A 3CC73 1SIIA 3FF0A 3CCJ3 2W03A 2Z7AA 1BNJA 4EV5A 3EHCA 1GY7A 3K9MC 3LTDA 1UCJA 3LT8A 1WTHA 3BIRA 3DZLA 3WA2X 1I2EA 3NX0A 4O3VA 2YFIB 5G1KA 1FZUA 4N6LA 3SX1A 2IA7A 1ULIB 1IK3A 1OF5B 3KN4A 1M1XB 2FNQA 1IVUA 1FGOA 1B2UA 2OQEC 3CCR3 2UGIA 3FH1A 1FGQA 1Q7HA 1GD3A 1BUQA 1DMNA 4RZMA 4DKIA 1QVG2 1OPYA 3QRDA 1E3VA 6GSPA 1YIT3 5G1LA 5CF2A 1I3IA 2WO0A 2YFLB 4OVMA 5M1AA 1YNVX 2CWUA 1ZGXA 3U97A 1A2PA 5M18A 1A67A 3MHEA 2W56A 1IVWA 4FCZA 1QMAA 1B2SA 3D5IA 1MNLA 3JUQA 3H3HA 3NUVA 2JQ5A 1W2B2 1TRPA 2GXFA 2MF7A 3JUNA 4HM0B 5AI1A 3BNDA 1UUVB 2CHCA 1W6YA 4O2HA 3L0RA 1M1K4 1AVLA 1W4NA 3DGOA 1GOUA 1FGMA 1NO3A 2XFSA 3GZBA 4XBTA 2IUJA 1J2BA 4LZIA 1MOLA 3HIGA 2P0MA 1O7GB 1OGXA 4XM4A 4LEHA 1DVCA 1STDA 1B27A 1QVF2 1MGRA 2RGQA 1RHLA 3X3ZA 2HOHA 1UGHI 3T8NA 2XEPA 1BRGA 1RGLA 3CCQ3 2CIUA 1WMOA 3HX8A 2KF3A 2OTL3 2R41A 4LMIA 3NM2A 2K54A 1BNGA 3GZXB 1BNSA 2MC8A 1GOYA 4L8PA 5LC7A 2QEX3 4J8TA 2CFGA 3M8CA 4HM1B 2GEYA 4JF8A 1AQZA 1SARA 2BIRA 3KSED 1ULJB 1OHSA 2OWPA 1Q40A 1AR0A 3NXJA 4R9LA 3EC9A 5AIHA 3LT9A 1VQ73 1Q814 3SVAA 4EXRA 4FR9A 3VSYA 1FW7A 4EW5A 3H51A 1ASKA 2H0HA 4NHFA 3S67A 2CFLA 5STDA 1IYYA 1DMMA 2BO9B 1EG9B 1CEWI 1VQL3 2PNCA 1D6YA 3A76A 3KKGA 3MG3A 1ISKA 1UUGB 1G0TA 1STFI 3CCS3 2W56B 1FGTA 1RRHA 2L1SA 1FGRA 1JB5A 4HM3B 4AKYA 3G4S3 2CK3H 3NBRA 1KSIA 3MG1A 3IJEB 5D83A 1RSNA 3UL6A 1PFPA 5KP4A 3EF8A 5BIRA 1Q7Y4 3IMAB 3E99A 3F7SA 4L7KA 1OCVA 5ELJA 1BNIA 1BRJA 3K5TA 1V57A 3LTAA 1S5AA 1RCLA 3BNCA 4H3UA 5DRVA 1OUNA 4STDA 1IQXA 4ZM8A 1NU3A 1K28A 1X1YA 4KT3B 1BANA 3JUMA 3VGNA 1K734 4HBRA 2INXA 1D6UA 1UCKA 4EC6A 1UGIA 2RNTA 1W5ZA 1IT7A 1X1UA 2F99A 5EQLA 2B24B 3GRDA 4GSPA 3B4OA 2CWVA 5KP1A 1I2GA 2BT3A 1W01A 1RLSA 3GAXA 2RFRA 4MMYB 4BTWA 2UUGC 2WGQA 3DM8A 5FGOA 3T0UA 3V99A 3OX9A 7GSPA 1YJN3 1JBTA 3OWYA 1FUTA 2HMOB 1RGKA 3I0YA 1GSPA 2AAEA 1O7NB 3AMOB 3SOYA 1DVDA 2P05A 3HOHA 5D81A 1S723 1GMQA 3F40A 4X2OA 2C11A 2BU4A 3WHOA 1TFOA 1TUHA 3FG1A 3KFQC 1IU7A 4HM5B 3WOFB 3NM7A 2KCDA 2UX0A 1SIHA 3N8BA 3T8UA 1B3SA 3BLZA 3PCSA 1X1WA 1VQQA 1W2ZA 1JKGB 2W0QA 4N6TA 1TIJA 1RRLA 2Z6BA 3NV0B 1UCIA 4NPBA 4R1KA 5TGNA 5IG5A 2BMOB 4N3VA 3CU3A 2STDA 3B4PA 1IVVA 4CCVA 3CC23 2GBXB 2W04A 1LNIA 1W6CA 1MWRA 2Y73A 5IEOA 3HK4A 3BNBA 4X2HA 1RGEA 3SEDA 3PGBA 1YGEA 1I3FA 3X3YA 3SOAA 1C54A 1JJ22 1NDOB 2HMLB 2HMKB 1RMSA 4RBNA 4EYCA 1N5PA 5JPPA 3VF1A 2F56A 1UI8A 1LOWA 1O7HB 2BNGA 1OACA 3PZWA 1OGZA 4PEJA 5AIGA 5AYRB 3I563 3MSOA 3FF2A 2F5WA 1ZS7A 5IG0A 2QGUA 2W6JH 4O8SA 1TFKA 4WYKA 1KWIA 4RNZA 2ZA4A 2CFDA 3HZPA 1JN5B 3K7CA 4MMZB 4BL2A 5M19A 1PU4A 1BRKA 3EBTA 3LMLA 4AKZA 1NB5I 1V74A 1MWUA 1YGWA 1BRHA 3F8XA 2Z77A 1RGHA 3KZTA 3BNEA 1LXEA 2XRXB 1B2MA 2R4IA 1BRSA 2L4VA 2XSOB 3EX9A 2ML6A 1FUWA 1M904 2SBLA 1W00A 1LRAA 2BHMA 4K90B 3SYUA 4BTYA 2OTJ3 3WR2A 2W9PA 3LXUX 1A90A 1TP6A 2CKFB 3AGOA 1HYFA 2M7OA 5DREA 1BRNL 4KZ1A 1EKMA 1BNFA 3EE1A 1I8VA 1LOXA 1VQ63 1CYUA 1IVXA 2XFTA 1RDSA 1JBSA 1KQS2 5CF1A 2E2VA 1N9JA 1SQWA 3OWSA 3S27A 1EQKA 3AHWA 2ZL8A 1N8QA 2LQVA 2J8XB 3DGNA 3JUOA 4BU4A 5IEPA 3HIIA 3GZRA 4GB5A 1IQYA 1DYUA 1GS3A 4CDLA 1HU9A 1VQ43 1F8NA 4K1UA 5RNTA 1BNRA 4KFDA 2E2TA 4N6UA 3GWRA 2C4BA 3G8ZA 3CCU3 5IERA 3UJMA 4AEQA 3BB9A 2Q07A 1VQM3 3X42A 2KAAA 3DGLA 2V1LA 3TDGA 1TJDA 1CH0A 2PZVA 1D6ZA 3D4AA 4K61A 1MGWA 3EBYA 2IMJA 1OHOA 2O3OA 2AADA 3WA3A 3DGMA 1CYVA 1I0XA 4OUQA 1B2ZA 3EN8A 3UB1A 3MKIA 2D1WA 1VQP3 1RCKA 3X40A 1BSEA 4KFFA 3S29A 4HM6B 3UL5A 1B21A 1X1XA 2GEXA 3CCM3 2A15A 4KFEA 1O7MB 1Q864 3MYTA 1QAFA 4WHAA 3X41A 3FZWA 4KVHA 2KXGA 2B1XB 4I4KA 4O02B 3B7CA 5HOHA 3KSPA 3JUPA 4HOHA 2YFJB 1BRIA 1Y4KA 3CNMA 3FKAA 2Y74A 4FCMA 4G1MB 1JB2A 1OF5A 2KF6A 4WP5A 3STDA 1NWWA 1BSDA 1UUWB 3CPOA 1B20A 5IF6A 5IW9A 2ZDJA 4GL6A 4JRFA 1ROAA 3DMCA 1GY6A 3MPHA 1RGCA 4HKVB 2CC3A 2CH9A 4RNYA 4HAAA 3D9RA 3U1WA 1Q824 4XB5A 4HVNA 1DMQA 1Q40B 4XBYA 1RNTA 5BVBA 5I97A 1RNBA 3RGAA 5JPUA 1GY5A 1KD14 3ALAA 2F4YA 5EVHA 5HGRA 5LC6A 1BNEA 1GMRA 1RTUA 3URPA 3S5CA 4CJNA 4IPBA 4XDWA 1LNHA 2D42A 4WWUC 5CK6A 3FG3A 4FCJA 4FMCA 3CCL3 8CHOA 2RBIA 5JBSA 3LZAA 3Q1CA 3K0ZA 4U13A 2XGLA 1W7CA 2FXTA 3D3LA 1GOVA 2GU1A 3GSPA 3NBJA 3DH2A 2CFWA 4I5QA 2CX1A 5FW5A 2CW9A 3ZG0A 3NQZA 1GMPA
chains in the Genus database with same CATH topology
1FUSA 1RN4A 2F5WA 4GHOA 1B2XA 1AY7A 1BSAA 1I70A 2ZA4A 3AGNA 1FW7A 1BRKA 1YGWA 6RNTA 1BOXA 1BRHA 5BU4A 1RGHA 1UCLA 1LOVA 1IYYA 1B2MA 1G02A 1BRSA 1Q9EA 2F5MA 3D5GA 1LRAA 1YVSA 3SYUA 1LOYA 3WR2A 7RNTA 3AGOA 1HYFA 3KCHA 1BRNL 3Q3FA 1BNFA 1I8VA 1DETA 1RSNA 1RDSA 4J5GA 5BIRA 1BU4A 1JBSA 4BIRA 1BNIA 1BRJA 3BU4A 1I0VA 1BSCA 1R4YA 1RCLA 2KF5A 3AHSA 3AHWA 3DGYA 2KF4A 1X1YA 4BU4A 1BANA 1BNJA 1BSBA 5RNTA 1BNRA 1UCJA 1UCKA 3BIRA 2C4BA 1I2EA 2RNTA 1FZUA 1X1UA 1BUJA 2KAAA 4GSPA 1BAOA 1DE3A 3D4AA 1CH0A 1I2GA 1RLSA 1MGWA 1PY3A 2AADA 1B2UA 1I0XA 1B2ZA 7GSPA 1RCKA 1TTOA 1JBTA 1FUTA 1BSEA 1RGKA 1GSPA 2AAEA 1B21A 1PYLA 1X1XA 2SARA 1JBRA 2GSPA 6GSPA 9RNTA 3HOHA 1I3IA 1T2IA 1GMQA 3WHOA 2BU4A 1FYSA 1YNVX 3RNTA 1ZGXA 1A2PA 5HOHA 1BIRA 4HOHA 1BRIA 1TRQA 1B2SA 3D5IA 1RGAA 2KF6A 1BSDA 1B3SA 1B20A 1BGSA 1X1WA 1TRPA 5GSPA 8RNTA 1UCIA 1RN1A 1RGCA 4HAAA 1RGGA 1GOUA 1HZ1A 1LNIA 1T2HA 3A5EA 1RNTA 1B27A 1MGRA 1RHLA 1RNBA 2HOHA 1BRGA 1RGLA 2F4YA 1BVIA 4J5KA 1BNEA 1GMRA 1RGEA 1RTUA 2KF3A 3URPA 1RGFA 4RNTA 1I3FA 1C54A 1BNGA 1BNSA 2RBIA 1GOYA 1RMSA 1GOVA 2F56A 3GSPA 1LOWA 3DH2A 1AQZA 1SARA 2BIRA 1I2FA 1GMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUS A;  1RN4 A;  2F5W A;  4GHO A;  1B2X A;  1AY7 A;  1BSA A;  1I70 A;  2ZA4 A;  3AGN A;  1FW7 A;  1BRK A;  1YGW A;  6RNT A;  1BOX A;  1BRH A;  5BU4 A;  1RGH A;  1UCL A;  1LOV A;  1IYY A;  1B2M A;  1G02 A;  1BRS A;  1Q9E A;  2F5M A;  3D5G A;  1LRA A;  1YVS A;  3SYU A;  1LOY A;  3WR2 A;  7RNT A;  3AGO A;  1HYF A;  3KCH A;  1BRN L;  3Q3F A;  1BNF A;  1I8V A;  1DET A;  1RSN A;  1RDS A;  4J5G A;  5BIR A;  1BU4 A;  1JBS A;  4BIR A;  1BNI A;  1BRJ A;  3BU4 A;  1I0V A;  1BSC A;  1R4Y A;  1RCL A;  2KF5 A;  3AHS A;  3AHW A;  3DGY A;  2KF4 A;  1X1Y A;  4BU4 A;  1BAN A;  1BNJ A;  1BSB A;  5RNT A;  1BNR A;  1UCJ A;  1UCK A;  3BIR A;  2C4B A;  1I2E A;  2RNT A;  1FZU A;  1X1U A;  1BUJ A;  2KAA A;  4GSP A;  1BAO A;  1DE3 A;  3D4A A;  1CH0 A;  1I2G A;  1RLS A;  1MGW A;  1PY3 A;  2AAD A;  1B2U A;  1I0X A;  1B2Z A;  7GSP A;  1RCK A;  1TTO A;  1JBT A;  1FUT A;  1BSE A;  1RGK A;  1GSP A;  2AAE A;  1B21 A;  1PYL A;  1X1X A;  2SAR A;  1JBR A;  2GSP A;  6GSP A;  9RNT A;  3HOH A;  1I3I A;  1T2I A;  1GMQ A;  3WHO A;  2BU4 A;  1FYS A;  1YNV X;  3RNT A;  1ZGX A;  1A2P A;  5HOH A;  1BIR A;  4HOH A;  1BRI A;  1TRQ A;  1B2S A;  3D5I A;  1RGA A;  2KF6 A;  1BSD A;  1B3S A;  1B20 A;  1BGS A;  1X1W A;  1TRP A;  5GSP A;  8RNT A;  1UCI A;  1RN1 A;  1RGC A;  4HAA A;  1RGG A;  1GOU A;  1HZ1 A;  1LNI A;  1T2H A;  3A5E A;  1RNT A;  1B27 A;  1MGR A;  1RHL A;  1RNB A;  2HOH A;  1BRG A;  1RGL A;  2F4Y A;  1BVI A;  4J5K A;  1BNE A;  1GMR A;  1RGE A;  1RTU A;  2KF3 A;  3URP A;  1RGF A;  4RNT A;  1I3F A;  1C54 A;  1BNG A;  1BNS A;  2RBI A;  1GOY A;  1RMS A;  1GOV A;  2F56 A;  3GSP A;  1LOW A;  3DH2 A;  1AQZ A;  1SAR A;  2BIR A;  1I2F A;  1GMP A; 
#chains in the Genus database with same CATH topology
 2CX0 A;  4HYZ A;  4H61 A;  3EJV A;  1RKY A;  2H0I A;  3LTC A;  1OHP A;  3KII A;  1B2X A;  4HM7 B;  3V98 A;  3RGR A;  1BSA A;  1I70 A;  3AGN A;  4LGQ A;  2GBW B;  2K0M A;  2XGN A;  1N5H A;  1VQK 3;  1YHQ 3;  3CD6 3;  5CXO A;  5AEW B;  6RNT A;  3CXC 2;  3G0K A;  2OOV A;  5BU4 A;  3G71 3;  1LOV A;  3I55 3;  1G02 A;  5AIF A;  1Q9E A;  2F5M A;  1IDP A;  3MWZ A;  1YVS A;  2ZHX B;  3WOD G;  1V58 A;  4OK0 A;  1VZZ A;  5IG4 A;  1G96 A;  3FGY A;  1SPU A;  7RNT A;  4XDV A;  3SLU A;  2IUK A;  2YX9 A;  4ILF A;  4TX4 A;  1YVB I;  4MJD A;  3V92 A;  3LTB A;  3J7Y d;  3Q3F A;  2WGO A;  1DET A;  2FGT A;  3PXM A;  2RCD A;  4LYL B;  3G16 A;  1O7W B;  2BMR B;  3OWU A;  1BU4 A;  3ZFZ A;  1EA2 A;  1T3B A;  4HM8 B;  4BIR A;  1VQ5 3;  2GU3 A;  4N6M A;  3OV4 A;  1E3R A;  3EB8 A;  1BSC A;  2KF5 A;  2OOV C;  5AEU B;  3GZY B;  2QA4 3;  2C10 A;  4R9K A;  5EEO A;  1L5G B;  4NRE A;  2IYJ A;  4BL3 A;  4L8O A;  4ORL A;  1BSB A;  4N6N B;  1JV2 B;  3ZG5 A;  4EBG A;  7STD A;  2ML5 A;  3CCE 3;  1JZD A;  1NNV A;  5G2G A;  3WDG B;  3IPT A;  1BUJ A;  1JNQ A;  1JRQ A;  2WOF A;  5AYS C;  3ROB A;  1WMN A;  1BAO A;  3WMD A;  1LVN A;  2IY2 A;  1YJW 3;  2CG1 A;  1U5O A;  2HMJ B;  1DE3 A;  4HZ9 B;  4Q53 A;  1WQL B;  1PY3 A;  4QWT A;  2KRT A;  1GD4 A;  4HZB B;  1SJW A;  1TTO A;  1MWS A;  2E2U A;  3FSD A;  1CQS A;  1K9M 4;  3B8L A;  2SAR A;  1PYL A;  2F86 B;  2QIY A;  1JBR A;  2GSP A;  5AII A;  3NQY A;  1QAK A;  2RSX A;  4LSO A;  3RDE A;  1T2I A;  4CPK A;  9RNT A;  1IQ8 A;  1FYS A;  3DXO A;  4FMB A;  3RNT A;  1K41 A;  4IT7 A;  1VQ8 3;  1BIR A;  2JDI H;  5IEN A;  5A0O B;  1TRQ A;  3EQQ B;  3SXX A;  3QK9 A;  1RGA A;  4J9A A;  5CLK A;  3UNL A;  3FG4 A;  1BGS A;  3MG2 A;  3LOY A;  1U8C B;  4HM2 B;  1IV9 A;  5GSP A;  1EUI C;  8RNT A;  1RN1 A;  4MEI A;  1YI2 3;  1GYB A;  3D79 A;  3HI7 A;  3NBB A;  4R4K A;  2W9Q A;  3S28 A;  1WNH A;  3F8H A;  5IG3 A;  3AMO A;  3DUK A;  3O8Y A;  5ELU A;  3OW2 2;  1RGG A;  4HJL B;  1A2K A;  2CWT A;  4N6V 0;  1MWT A;  1N9E A;  1HZ1 A;  3ER7 A;  2XH9 A;  4FMD A;  3DY5 A;  1T2H A;  1US1 A;  2HMM B;  1C7H A;  3A5E A;  3PYJ A;  2HMN B;  1VQO 3;  1YIJ 3;  3N54 B;  1WMP A;  2O9U X;  1A2V A;  2BMQ B;  1LQG C;  4HM4 B;  4WYK B;  1BVI A;  4J5K A;  1UDI I;  1EEJ A;  1JB4 A;  1JKG A;  1IV7 A;  4R80 A;  1TU5 A;  3ECF A;  1RGF A;  3NV0 A;  1R4C A;  3G6E 3;  3FLJ A;  4RNT A;  1YJ9 3;  4IIA A;  6STD A;  1KC8 4;  3WOE B;  1ROV A;  3KE7 A;  2F98 A;  1IT8 A;  2P0X A;  3CNX A;  3FCS B;  1UCL A;  1I2F A;  1RN4 A;  1FUS A;  1AVK A;  1Q42 A;  2XSH B;  2XR8 B;  1AV4 A;  2LYX A;  1QJG A;  1QAL A;  4GHO A;  2CFK A;  1AY7 A;  4N6O B;  3CME 3;  1VQN 3;  4XBX A;  2P38 A;  3JVC A;  1BOX A;  3OXA A;  4WFO A;  5BXQ A;  2Z76 A;  1FA3 A;  3X3X A;  3EN1 B;  1UI7 A;  1W02 A;  3D5G A;  1VQ9 3;  3CCV 3;  3K63 A;  3CMA 3;  1LOY A;  4FMA A;  1RJO A;  2H0G A;  2CG0 A;  3N9H A;  2P09 A;  1K8A 4;  1RN7 A;  1LQM B;  3KCH A;  1OH0 A;  3F9S A;  3Q90 A;  2W2C A;  4EV2 A;  1NB3 I;  4MMX B;  3PCR A;  1JN5 A;  1N8R 4;  4J5G A;  3CC4 3;  3LH4 A;  2WOH A;  3F14 A;  1ZO2 A;  1HKX A;  3PS8 A;  3Q2P A;  1JZO A;  1UW1 A;  3BU4 A;  1W6G A;  1NJI 4;  1Z1S A;  2OQE A;  2K3D A;  3LYG A;  1I0V A;  3NHX A;  1R4Y A;  3AHS A;  1T5Y A;  3DGY A;  3CPW 2;  1O7P B;  2KF4 A;  2OCT A;  3F7X A;  2XF3 A;  4K1V A;  1E97 A;  2I9W A;  1M9G A;  5D82 A;  4BTX A;  5KP3 A;  1ZX2 A;  3CC7 3;  1SII A;  3FF0 A;  3CCJ 3;  2W03 A;  2Z7A A;  1BNJ A;  4EV5 A;  3EHC A;  1GY7 A;  3K9M C;  3LTD A;  1UCJ A;  3LT8 A;  1WTH A;  3BIR A;  3DZL A;  3WA2 X;  1I2E A;  3NX0 A;  4O3V A;  2YFI B;  5G1K A;  1FZU A;  4N6L A;  3SX1 A;  2IA7 A;  1ULI B;  1IK3 A;  1OF5 B;  3KN4 A;  1M1X B;  2FNQ A;  1IVU A;  1FGO A;  1B2U A;  2OQE C;  3CCR 3;  2UGI A;  3FH1 A;  1FGQ A;  1Q7H A;  1GD3 A;  1BUQ A;  1DMN A;  4RZM A;  4DKI A;  1QVG 2;  1OPY A;  3QRD A;  1E3V A;  6GSP A;  1YIT 3;  5G1L A;  5CF2 A;  1I3I A;  2WO0 A;  2YFL B;  4OVM A;  5M1A A;  1YNV X;  2CWU A;  1ZGX A;  3U97 A;  1A2P A;  5M18 A;  1A67 A;  3MHE A;  2W56 A;  1IVW A;  4FCZ A;  1QMA A;  1B2S A;  3D5I A;  1MNL A;  3JUQ A;  3H3H A;  3NUV A;  2JQ5 A;  1W2B 2;  1TRP A;  2GXF A;  2MF7 A;  3JUN A;  4HM0 B;  5AI1 A;  3BND A;  1UUV B;  2CHC A;  1W6Y A;  4O2H A;  3L0R A;  1M1K 4;  1AVL A;  1W4N A;  3DGO A;  1GOU A;  1FGM A;  1NO3 A;  2XFS A;  3GZB A;  4XBT A;  2IUJ A;  1J2B A;  4LZI A;  1MOL A;  3HIG A;  2P0M A;  1O7G B;  1OGX A;  4XM4 A;  4LEH A;  1DVC A;  1STD A;  1B27 A;  1QVF 2;  1MGR A;  2RGQ A;  1RHL A;  3X3Z A;  2HOH A;  1UGH I;  3T8N A;  2XEP A;  1BRG A;  1RGL A;  3CCQ 3;  2CIU A;  1WMO A;  3HX8 A;  2KF3 A;  2OTL 3;  2R41 A;  4LMI A;  3NM2 A;  2K54 A;  1BNG A;  3GZX B;  1BNS A;  2MC8 A;  1GOY A;  4L8P A;  5LC7 A;  2QEX 3;  4J8T A;  2CFG A;  3M8C A;  4HM1 B;  2GEY A;  4JF8 A;  1AQZ A;  1SAR A;  2BIR A;  3KSE D;  1ULJ B;  1OHS A;  2OWP A;  1Q40 A;  1AR0 A;  3NXJ A;  4R9L A;  3EC9 A;  5AIH A;  3LT9 A;  1VQ7 3;  1Q81 4;  3SVA A;  4EXR A;  4FR9 A;  3VSY A;  1FW7 A;  4EW5 A;  3H51 A;  1ASK A;  2H0H A;  4NHF A;  3S67 A;  2CFL A;  5STD A;  1IYY A;  1DMM A;  2BO9 B;  1EG9 B;  1CEW I;  1VQL 3;  2PNC A;  1D6Y A;  3A76 A;  3KKG A;  3MG3 A;  1ISK A;  1UUG B;  1G0T A;  1STF I;  3CCS 3;  2W56 B;  1FGT A;  1RRH A;  2L1S A;  1FGR A;  1JB5 A;  4HM3 B;  4AKY A;  3G4S 3;  2CK3 H;  3NBR A;  1KSI A;  3MG1 A;  3IJE B;  5D83 A;  1RSN A;  3UL6 A;  1PFP A;  5KP4 A;  3EF8 A;  5BIR A;  1Q7Y 4;  3IMA B;  3E99 A;  3F7S A;  4L7K A;  1OCV A;  5ELJ A;  1BNI A;  1BRJ A;  3K5T A;  1V57 A;  3LTA A;  1S5A A;  1RCL A;  3BNC A;  4H3U A;  5DRV A;  1OUN A;  4STD A;  1IQX A;  4ZM8 A;  1NU3 A;  1K28 A;  1X1Y A;  4KT3 B;  1BAN A;  3JUM A;  3VGN A;  1K73 4;  4HBR A;  2INX A;  1D6U A;  1UCK A;  4EC6 A;  1UGI A;  2RNT A;  1W5Z A;  1IT7 A;  1X1U A;  2F99 A;  5EQL A;  2B24 B;  3GRD A;  4GSP A;  3B4O A;  2CWV A;  5KP1 A;  1I2G A;  2BT3 A;  1W01 A;  1RLS A;  3GAX A;  2RFR A;  4MMY B;  4BTW A;  2UUG C;  2WGQ A;  3DM8 A;  5FGO A;  3T0U A;  3V99 A;  3OX9 A;  7GSP A;  1YJN 3;  1JBT A;  3OWY A;  1FUT A;  2HMO B;  1RGK A;  3I0Y A;  1GSP A;  2AAE A;  1O7N B;  3AMO B;  3SOY A;  1DVD A;  2P05 A;  3HOH A;  5D81 A;  1S72 3;  1GMQ A;  3F40 A;  4X2O A;  2C11 A;  2BU4 A;  3WHO A;  1TFO A;  1TUH A;  3FG1 A;  3KFQ C;  1IU7 A;  4HM5 B;  3WOF B;  3NM7 A;  2KCD A;  2UX0 A;  1SIH A;  3N8B A;  3T8U A;  1B3S A;  3BLZ A;  3PCS A;  1X1W A;  1VQQ A;  1W2Z A;  1JKG B;  2W0Q A;  4N6T A;  1TIJ A;  1RRL A;  2Z6B A;  3NV0 B;  1UCI A;  4NPB A;  4R1K A;  5TGN A;  5IG5 A;  2BMO B;  4N3V A;  3CU3 A;  2STD A;  3B4P A;  1IVV A;  4CCV A;  3CC2 3;  2GBX B;  2W04 A;  1LNI A;  1W6C A;  1MWR A;  2Y73 A;  5IEO A;  3HK4 A;  3BNB A;  4X2H A;  1RGE A;  3SED A;  3PGB A;  1YGE A;  1I3F A;  3X3Y A;  3SOA A;  1C54 A;  1JJ2 2;  1NDO B;  2HML B;  2HMK B;  1RMS A;  4RBN A;  4EYC A;  1N5P A;  5JPP A;  3VF1 A;  2F56 A;  1UI8 A;  1LOW A;  1O7H B;  2BNG A;  1OAC A;  3PZW A;  1OGZ A;  4PEJ A;  5AIG A;  5AYR B;  3I56 3;  3MSO A;  3FF2 A;  2F5W A;  1ZS7 A;  5IG0 A;  2QGU A;  2W6J H;  4O8S A;  1TFK A;  4WYK A;  1KWI A;  4RNZ A;  2ZA4 A;  2CFD A;  3HZP A;  1JN5 B;  3K7C A;  4MMZ B;  4BL2 A;  5M19 A;  1PU4 A;  1BRK A;  3EBT A;  3LML A;  4AKZ A;  1NB5 I;  1V74 A;  1MWU A;  1YGW A;  1BRH A;  3F8X A;  2Z77 A;  1RGH A;  3KZT A;  3BNE A;  1LXE A;  2XRX B;  1B2M A;  2R4I A;  1BRS A;  2L4V A;  2XSO B;  3EX9 A;  2ML6 A;  1FUW A;  1M90 4;  2SBL A;  1W00 A;  1LRA A;  2BHM A;  4K90 B;  3SYU A;  4BTY A;  2OTJ 3;  3WR2 A;  2W9P A;  3LXU X;  1A90 A;  1TP6 A;  2CKF B;  3AGO A;  1HYF A;  2M7O A;  5DRE A;  1BRN L;  4KZ1 A;  1EKM A;  1BNF A;  3EE1 A;  1I8V A;  1LOX A;  1VQ6 3;  1CYU A;  1IVX A;  2XFT A;  1RDS A;  1JBS A;  1KQS 2;  5CF1 A;  2E2V A;  1N9J A;  1SQW A;  3OWS A;  3S27 A;  1EQK A;  3AHW A;  2ZL8 A;  1N8Q A;  2LQV A;  2J8X B;  3DGN A;  3JUO A;  4BU4 A;  5IEP A;  3HII A;  3GZR A;  4GB5 A;  1IQY A;  1DYU A;  1GS3 A;  4CDL A;  1HU9 A;  1VQ4 3;  1F8N A;  4K1U A;  5RNT A;  1BNR A;  4KFD A;  2E2T A;  4N6U A;  3GWR A;  2C4B A;  3G8Z A;  3CCU 3;  5IER A;  3UJM A;  4AEQ A;  3BB9 A;  2Q07 A;  1VQM 3;  3X42 A;  2KAA A;  3DGL A;  2V1L A;  3TDG A;  1TJD A;  1CH0 A;  2PZV A;  1D6Z A;  3D4A A;  4K61 A;  1MGW A;  3EBY A;  2IMJ A;  1OHO A;  2O3O A;  2AAD A;  3WA3 A;  3DGM A;  1CYV A;  1I0X A;  4OUQ A;  1B2Z A;  3EN8 A;  3UB1 A;  3MKI A;  2D1W A;  1VQP 3;  1RCK A;  3X40 A;  1BSE A;  4KFF A;  3S29 A;  4HM6 B;  3UL5 A;  1B21 A;  1X1X A;  2GEX A;  3CCM 3;  2A15 A;  4KFE A;  1O7M B;  1Q86 4;  3MYT A;  1QAF A;  4WHA A;  3X41 A;  3FZW A;  4KVH A;  2KXG A;  2B1X B;  4I4K A;  4O02 B;  3B7C A;  5HOH A;  3KSP A;  3JUP A;  4HOH A;  2YFJ B;  1BRI A;  1Y4K A;  3CNM A;  3FKA A;  2Y74 A;  4FCM A;  4G1M B;  1JB2 A;  1OF5 A;  2KF6 A;  4WP5 A;  3STD A;  1NWW A;  1BSD A;  1UUW B;  3CPO A;  1B20 A;  5IF6 A;  5IW9 A;  2ZDJ A;  4GL6 A;  4JRF A;  1ROA A;  3DMC A;  1GY6 A;  3MPH A;  1RGC A;  4HKV B;  2CC3 A;  2CH9 A;  4RNY A;  4HAA A;  3D9R A;  3U1W A;  1Q82 4;  4XB5 A;  4HVN A;  1DMQ A;  1Q40 B;  4XBY A;  1RNT A;  5BVB A;  5I97 A;  1RNB A;  3RGA A;  5JPU A;  1GY5 A;  1KD1 4;  3ALA A;  2F4Y A;  5EVH A;  5HGR A;  5LC6 A;  1BNE A;  1GMR A;  1RTU A;  3URP A;  3S5C A;  4CJN A;  4IPB A;  4XDW A;  1LNH A;  2D42 A;  4WWU C;  5CK6 A;  3FG3 A;  4FCJ A;  4FMC A;  3CCL 3;  8CHO A;  2RBI A;  5JBS A;  3LZA A;  3Q1C A;  3K0Z A;  4U13 A;  2XGL A;  1W7C A;  2FXT A;  3D3L A;  1GOV A;  2GU1 A;  3GSP A;  3NBJ A;  3DH2 A;  2CFW A;  4I5Q A;  2CX1 A;  5FW5 A;  2CW9 A;  3ZG0 A;  3NQZ A;  1GMP A; 
#chains in the Genus database with same CATH homology
 1FUS A;  1RN4 A;  2F5W A;  4GHO A;  1B2X A;  1AY7 A;  1BSA A;  1I70 A;  2ZA4 A;  3AGN A;  1FW7 A;  1BRK A;  1YGW A;  6RNT A;  1BOX A;  1BRH A;  5BU4 A;  1RGH A;  1UCL A;  1LOV A;  1IYY A;  1B2M A;  1G02 A;  1BRS A;  1Q9E A;  2F5M A;  3D5G A;  1LRA A;  1YVS A;  3SYU A;  1LOY A;  3WR2 A;  7RNT A;  3AGO A;  1HYF A;  3KCH A;  1BRN L;  3Q3F A;  1BNF A;  1I8V A;  1DET A;  1RSN A;  1RDS A;  4J5G A;  5BIR A;  1BU4 A;  1JBS A;  4BIR A;  1BNI A;  1BRJ A;  3BU4 A;  1I0V A;  1BSC A;  1R4Y A;  1RCL A;  2KF5 A;  3AHS A;  3AHW A;  3DGY A;  2KF4 A;  1X1Y A;  4BU4 A;  1BAN A;  1BNJ A;  1BSB A;  5RNT A;  1BNR A;  1UCJ A;  1UCK A;  3BIR A;  2C4B A;  1I2E A;  2RNT A;  1FZU A;  1X1U A;  1BUJ A;  2KAA A;  4GSP A;  1BAO A;  1DE3 A;  3D4A A;  1CH0 A;  1I2G A;  1RLS A;  1MGW A;  1PY3 A;  2AAD A;  1B2U A;  1I0X A;  1B2Z A;  7GSP A;  1RCK A;  1TTO A;  1JBT A;  1FUT A;  1BSE A;  1RGK A;  1GSP A;  2AAE A;  1B21 A;  1PYL A;  1X1X A;  2SAR A;  1JBR A;  2GSP A;  6GSP A;  9RNT A;  3HOH A;  1I3I A;  1T2I A;  1GMQ A;  3WHO A;  2BU4 A;  1FYS A;  1YNV X;  3RNT A;  1ZGX A;  1A2P A;  5HOH A;  1BIR A;  4HOH A;  1BRI A;  1TRQ A;  1B2S A;  3D5I A;  1RGA A;  2KF6 A;  1BSD A;  1B3S A;  1B20 A;  1BGS A;  1X1W A;  1TRP A;  5GSP A;  8RNT A;  1UCI A;  1RN1 A;  1RGC A;  4HAA A;  1RGG A;  1GOU A;  1HZ1 A;  1LNI A;  1T2H A;  3A5E A;  1RNT A;  1B27 A;  1MGR A;  1RHL A;  1RNB A;  2HOH A;  1BRG A;  1RGL A;  2F4Y A;  1BVI A;  4J5K A;  1BNE A;  1GMR A;  1RGE A;  1RTU A;  2KF3 A;  3URP A;  1RGF A;  4RNT A;  1I3F A;  1C54 A;  1BNG A;  1BNS A;  2RBI A;  1GOY A;  1RMS A;  1GOV A;  2F56 A;  3GSP A;  1LOW A;  3DH2 A;  1AQZ A;  1SAR A;  2BIR A;  1I2F A;  1GMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...