2KF6A

Barnase bound to d(cgac) high pressure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf6A00
1MGRA 1BSCA 1UCKA 3SYUA 1BVIA 1TRQA 1RGKA 3RNTA 1RSNA 1LOWA 1RN4A 3GSPA 1RCKA 1RNTA 2KF6A 1BRSA 2HOHA 1YVSA 1BNFA 1SARA 8RNTA 1R4YA 1BSBA 1BNIA 1Q9EA 1CH0A 1B2XA 1I2GA 1RMSA 1BU4A 1I0XA 3A5EA 1X1WA 4J5KA 1LRAA 1I70A 1RTUA 1B2ZA 1A2PA 4BU4A 1RGLA 3DH2A 1HZ1A 3AGOA 1JBTA 3HOHA 5BU4A 6GSPA 4GSPA 2KF4A 1FUTA 3D4AA 3WHOA 1GOVA 1PY3A 1X1XA 1I8VA 1G02A 9RNTA 1C54A 1HYFA 1T2HA 1YGWA 1BRKA 4J5GA 1LNIA 1I2EA 3Q3FA 4BIRA 4HAAA 3D5GA 5RNTA 1BUJA 1B27A 1RLSA 2AADA 1BRHA 2F56A 1GMQA 1I3FA 3DGYA 3KCHA 1X1YA 2F5MA 1FW7A 3D5IA 2SARA 1BNRA 1GOYA 1B3SA 1FUSA 1BSEA 1RCLA 1RN1A 1JBRA 4RNTA 6RNTA 1UCLA 1RGFA 1TRPA 2F5WA 5GSPA 1AY7A 1I2FA 1B21A 4GHOA 1YNVX 3URPA 2RBIA 1BNSA 1BSAA 2AAEA 1GSPA 1T2IA 3AHWA 1BRJA 5BIRA 2C4BA 1BNEA 1BNJA 1BGSA 1RGGA 1MGWA 2KF3A 1JBSA 1BRNL 1BIRA 1BANA 5HOHA 1B2UA 2BIRA 7GSPA 1GMRA 1FZUA 2RNTA 1FYSA 1RDSA 2KF5A 2F4YA 7RNTA 2ZA4A 3AHSA 2GSPA 1ZGXA 1BRIA 1TTOA 1AQZA 1B20A 1DE3A 1GOUA 1X1UA 3AGNA 1I3IA 1UCIA 1B2MA 1RGEA 1BSDA 3BU4A 1RNBA 1RHLA 1LOVA 3BIRA 1LOYA 1I0VA 1BRGA 2KAAA 1B2SA 1IYYA 1BAOA 1DETA 1RGAA 1UCJA 1RGHA 1BOXA 1BNGA 1PYLA 4HOHA 3WR2A 1GMPA 1RGCA 2BU4A
chains in the Genus database with same CATH superfamily
1WTHA 2IUJA 5D82A 1OGXA 2Z6BA 2UUGC 1UUGB 3LT9A 2W9QA 1R4CA 2P05A 1UUWB 3I553 1RCKA 1AVKA 1RNTA 4WFOA 5KP3A 2KF6A 3SX1A 4CJNA 3PCRA 4HM0B 3K0ZA 3OWYA 1AV4A 3G16A 1OF5B 1DMNA 3JUNA 1ISKA 1W02A 1W2ZA 3EE1A 3MG2A 2WOFA 1CH0A 2INXA 5KP4A 2PZVA 3DGMA 4L8OA 1NNVA 1RMSA 1BU4A 3LOYA 2FXTA 1RTUA 1VQN3 5AIGA 2CW9A 3K7CA 3SXXA 1VQM3 4BU4A 3JUMA 3DH2A 1HZ1A 1KWIA 2YFIB 1JBTA 1JZDA 3KIIA 1M904 3LT8A 1IDPA 2IA7A 2KF4A 4MEIA 4H61A 3EQQB 5I97A 1GOVA 1PY3A 3CNMA 3DZLA 3LYGA 1X1XA 3EN8A 3EN1B 3NBBA 4XB5A 1YJ93 3MG1A 1W2B2 3KSPA 1OUNA 1WQLB 2H0HA 3PYJA 4QWTA 1C54A 3T0UA 1HYFA 3V99A 3DY5A 1NDOB 4K1UA 1LNHA 4BL3A 1IQXA 4I5QA 1LNIA 2LQVA 3K63A 4J5GA 1FGTA 5IEPA 2CIUA 3CCR3 3CCS3 1NB3I 4FCZA 3UL6A 1VQ73 3OXAA 1NO3A 1BUJA 2AADA 3NUVA 1IV7A 1STDA 1BRHA 2F56A 3MG3A 3NBJA 2CHCA 1US1A 1W7CA 3KCHA 3PS8A 1D6UA 4R9KA 5G1LA 5AEWB 4ILFA 3QK9A 3WA2X 5LC6A 4PEJA 1WNHA 3MYTA 2ZDJA 3G8ZA 1PU4A 2QA43 1J2BA 1RJOA 1A67A 2W2CA 3HK4A 3NBRA 3HZPA 4MMXB 1B3SA 4CCVA 1JBRA 1D6ZA 2C10A 2Q07A 6RNTA 1Z1SA 5M19A 2W56A 2OWPA 3NM2A 3U97A 3EX9A 3OWSA 3F40A 5JPPA 1WMOA 3M8CA 4LSOA 3FG4A 4N6TA 4NREA 2O3OA 2HMNB 1BRJA 1QAKA 4HM2B 3PGBA 4L8PA 1DMQA 3Q1CA 4OK0A 5ELUA 1BUQA 3CPOA 2KF3A 1FGQA 1LOXA 2W04A 2H0GA 4N3VA 1N5PA 1BANA 1O7MB 2CKFB 3EBTA 1KSIA 2B1XB 5LC7A 1JRQA 2HMOB 4HYZA 5AYSC 1FYSA 4HVNA 3WOEB 4O3VA 1SIHA 4R4KA 2ZA4A 3F8XA 1N8R4 3B8LA 2W56B 1EQKA 3BB9A 4RNYA 5IG5A 2OQEC 2RCDA 3UNLA 2CG0A 4FMDA 4JRFA 4O2HA 2UGIA 3CMA3 4FMBA 1JNQA 2SBLA 1OH0A 3BU4A 1VQ43 3X3XA 2P38A 4EC6A 2O9UX 1TJDA 2XSHB 4HM5B 3MSOA 1RHLA 2CG1A 3BIRA 3CCE3 3NM7A 1S723 2KAAA 5M1AA 1BAOA 1DETA 1M1XB 3WR2A 1RGHA 1PYLA 2BNGA 2CWUA 2R4IA 1JB2A 2BU4A 3NHXA 3GWRA 1BSCA 2HMLB 3FSDA 3QRDA 2ML5A 2R41A 1BVIA 1TRQA 1S5AA 4ORLA 1ASKA 6STDA 1RGKA 4KFEA 1LOWA 1LQMB 3I563 2IMJA 2CH9A 2GEXA 3ECFA 3EB8A 1C7HA 2HOHA 1LXEA 2KXGA 4IT7A 5TGNA 1MWRA 3STDA 1YVBI 2QGUA 3PXMA 4H3UA 4J9AA 3OW22 1BNIA 1PFPA 2WGOA 1OHSA 2XR8B 5ELJA 1GY7A 2CWTA 2YFJB 2OOVA 4KFDA 4XBXA 2BT3A 3D3LA 1I0XA 1UGIA 1X1WA 3A5EA 3J7Yd 1HU9A 1I70A 1VQK3 2OTJ3 1UI7A 1A2PA 1NJI4 3I0YA 1RGLA 4HM8B 1M1K4 1TIJA 4MMYB 2A15A 1MWTA 3OWUA 3MHEA 5BU4A 6GSPA 4IPBA 2RSXA 3D4AA 4KVHA 2L4VA 2W0QA 1V57A 1VQP3 1IT7A 3F14A 4O8SA 2IYJA 1STFI 3ZG0A 3D79A 1E3VA 5A0OB 5JBSA 1ZS7A 2W03A 3S27A 2XSOB 3T8NA 4Q53A 1ROVA 1NU3A 2LYXA 3DUKA 1OACA 3CME3 4HKVB 2K0MA 1IT8A 1WMNA 2W6JH 2GXFA 1BRKA 2WOHA 3KZTA 3TDGA 3WODG 4JF8A 4J8TA 1VQ93 2FGTA 4R80A 4WYKB 3S29A 1B27A 4LEHA 1E3RA 1TFOA 1I3FA 1D6YA 3DGYA 1JKGA 4K90B 2FNQA 1TU5A 2P0XA 3CCM3 1DYUA 5IG3A 1YHQ3 4WHAA 5HGRA 1FUSA 1YJN3 4RNTA 1Q824 1JB4A 1TRPA 2Z77A 2KRTA 3UL5A 3DGNA 1UUVB 4AEQA 4AKYA 1OHPA 2XGNA 3URPA 1ROAA 5KP1A 3OV4A 1IVXA 1BSAA 3AHWA 5FGOA 4HM1B 1BGSA 1QALA 1RRLA 1JZOA 2RFRA 5AIIA 5AYRB 3EF8A 3RDEA 3JUPA 1BRNL 1JKGB 4X2OA 3CCU3 1A2VA 5G2GA 3CCJ3 1O7HB 3U1WA 1O7GB 7GSPA 2OTL3 1UI8A 2RNTA 2H0IA 3KN4A 1T5YA 4R9LA 1VZZA 1QJGA 1OGZA 3ALAA 3BNEA 1GS3A 3FCSB 2CX0A 1KC84 3OX9A 5CXOA 1ZGXA 1TP6A 1BRIA 1B20A 1DE3A 2GBXB 1MOLA 3KSED 1I3IA 8CHOA 2HMMB 1B2MA 3Q90A 1HKXA 1VQ63 4LMIA 1SIIA 1LOVA 1LQGC 3Q2PA 1LOYA 2CK3H 1I0VA 1Q42A 1CEWI 1B2SA 1G96A 3NX0A 4XM4A 3FG3A 1UW1A 5D83A 2F86B 7RNTA 1BOXA 1BNGA 1DMMA 2Y74A 4HOHA 4LYLB 3SVAA 4BTYA 4K61A 4GB5A 3SOYA 1UGHI 4FCJA 1Q864 1A2KA 1LVNA 1MGRA 1RN7A 4IIAA 1GD4A 3LZAA 2OOVC 1V58A 3EHCA 1SQWA 5EQLA 1RSNA 2MF7A 3B4PA 1RN4A 3E99A 3FLJA 1TUHA 4EXRA 3FZWA 1N8QA 1YVSA 1K28A 1SARA 2IY2A 3GRDA 2XFSA 3N8BA 3RGAA 2BMRB 5IG4A 1BSBA 2GU3A 2ML6A 3VSYA 4R1KA 4EBGA 1B2XA 2BO9B 4WWUC 2RGQA 2M7OA 3CU3A 5IEOA 4J5KA 1LRAA 1EEJA 2D42A 5CLKA 1JB5A 4EV5A 1B2ZA 2XEPA 3LTAA 1FUWA 3WOFB 3SEDA 3K5TA 3S28A 1AR0A 3EBYA 1OPYA 2E2UA 3D9RA 3F7SA 4EV2A 3G6E3 2K54A 3CNXA 3A76A 3FF2A 1FUTA 2GU1A 2IUKA 3CCQ3 4HM4B 3HX8A 2B24B 1I8VA 3CXC2 3N54B 1G02A 2CX1A 4AKZA 1U8CB 3KKGA 4I4KA 9RNTA 3WDGB 5G1KA 3S5CA 4CPKA 3K9MC 4BTWA 1KQS2 1GD3A 1W6YA 3DMCA 5M18A 2GEYA 1YGWA 5AIHA 2K3DA 1JV2B 4BIRA 5AIFA 3D5GA 2JQ5A 3CCV3 3EJVA 2F98A 5AEUB 1DVCA 3VF1A 5BXQA 1OCVA 3F8HA 1GMQA 3X41A 1X1YA 2CC3A 7STDA 4WYKA 1FW7A 4FCMA 2PNCA 2SARA 3B7CA 4L7KA 2D1WA 3F9SA 3L0RA 1BSEA 1RN1A 3GAXA 1K8A4 1K734 1ZX2A 1UCLA 4BTXA 1CYVA 1Q40A 5D81A 1AY7A 5EVHA 4GHOA 4RZMA 1YNVX 3LTCA 1EKMA 1FGOA 2CFLA 2RBIA 1BNSA 1ULIB 3NV0A 2C4BA 1BNEA 5BIRA 1BNJA 1ZO2A 1RGGA 2XGLA 3GZXB 1MGWA 2I9WA 5AI1A 1IVWA 1JBSA 1NB5I 3BNCA 1A90A 1W4NA 5HOHA 3DGOA 4NPBA 1B2UA 1YGEA 3LMLA 4MMZB 4U13A 1SPUA 2WO0A 1FZUA 1RDSA 3CD63 2F4YA 4K1VA 2MC8A 1V74A 3NXJA 1MWUA 3CC73 1GYBA 1EG9B 1Q40B 1FGMA 2CFWA 3B4OA 3BNDA 3T8UA 1KD14 1W6CA 1TTOA 1TFKA 3JUQA 3IPTA 1FGRA 1X1UA 3O8YA 3AGNA 1K41A 1UCIA 1Y4KA 1QVG2 3IMAB 5IENA 4N6OB 3NV0B 3NQZA 1BSDA 1JN5B 1JJ22 4WP5A 1RNBA 4X2HA 3SLUA 1BRGA 1GY5A 4OUQA 1IK3A 3G4S3 1IYYA 3JVCA 1UCJA 3MPHA 4O02B 5EEOA 1NWWA 1GMPA 4DKIA 1RGCA 4RNZA 4N6NB 4XDWA 3X3ZA 1UCKA 3SYUA 1CYUA 2BMOB 3RNTA 3IJEB 2KCDA 3GSPA 4HM3B 1OHOA 1T3BA 1EA2A 2L1SA 5JPUA 1BRSA 1EUIC 1O7PB 2P0MA 3LXUX 3ROBA 3DXOA 2Z7AA 1BNFA 2J8XB 3FF0A 4HBRA 3S67A 2BHMA 8RNTA 4RBNA 1O7WB 2F99A 1R4YA 2C11A 1QAFA 2STDA 1N9JA 3N9HA 4NHFA 1IVVA 1Q9EA 3BNBA 1G0TA 3GZYB 5DREA 1I2GA 3X40A 2HMKB 3ER7A 3FG1A 1Q7Y4 1IQ8A 1VQO3 5IF6A 4KZ1A 1SJWA 1VQ83 2JDIH 3UB1A 1MNLA 3AGOA 3AMOA 4EYCA 3HOHA 3CCL3 2OCTA 4CDLA 3CPW2 1IQYA 4XBYA 4GSPA 4EW5A 3ZG5A 2ZL8A 3WHOA 4TX4A 2XRXB 2Z76A 3V92A 3SOAA 1VQQA 2HMJB 3KE7A 4LZIA 2CFDA 1Q814 1UDII 2E2VA 1QVF2 4HZ9B 3H3HA 1T2HA 3NQYA 4G1MB 4HM6B 2YX9A 2CFGA 1I2EA 3Q3FA 2QIYA 4HAAA 3DGLA 1YI23 3FGYA 5RNTA 1FA3A 1RLSA 4N6LA 3AMOB 4N6MA 5FW5A 2CFKA 1N9EA 3WMDA 1W6GA 2F5MA 4HJLB 5IW9A 3D5IA 5STDA 1W01A 1BNRA 5CK6A 3KFQC 1GOYA 1E97A 1RCLA 1CQSA 3X42A 3H51A 1IU7A 1RGFA 5DRVA 1U5OA 2F5WA 5GSPA 3UJMA 1RKYA 3LTDA 1YIT3 1I2FA 1B21A 1VQL3 5CF1A 2E2TA 1YJW3 1ULJB 3GZRA 3FH1A 1O7NB 2CWVA 3HIGA 4FR9A 4LGQA 3PZWA 2AAEA 3X3YA 1AVLA 1GSPA 1T2IA 5IERA 2UX0A 1IVUA 3MWZA 4KT3B 3EC9A 3ZFZA 1N5HA 1BIRA 2YFLB 4GL6A 4HM7B 3RGRA 1DVDA 1GY6A 2BIRA 3G713 2W9PA 1GMRA 1IV9A 4N6V0 4XBTA 2BMQB 3JUOA 1M9GA 1RRHA 2KF5A 1F8NA 3FKAA 1QMAA 3LTBA 2P09A 4MJDA 4XDVA 5CF2A 3GZBA 3VGNA 3AHSA 3MKIA 1VQ53 4OVMA 2GSPA 1YIJ3 5BVBA 1WMPA 2GBWB 4BL2A 1MWSA 2V1LA 4HZBB 1AQZA 2Y73A 4N6UA 1GOUA 4ZM8A 1RGEA 3F7XA 1L5GB 2XF3A 1OF5A 3CC43 3V98A 1Q7HA 3HIIA 1K9M4 3LH4A 4KFFA 4FMCA 3G0KA 2QEX3 3HI7A 1JN5A 3BLZA 2OQEA 3DM8A 5IG0A 2XH9A 3CC23 2ZHXB 1RGAA 1W00A 2WGQA 2XFTA 3PCSA 4FMAA 3WA3A 4STDA 1W5ZA
chains in the Genus database with same CATH topology
1MGRA 1BSCA 1UCKA 3SYUA 1BVIA 1TRQA 1RGKA 3RNTA 1RSNA 1LOWA 1RN4A 3GSPA 1RCKA 1RNTA 2KF6A 1BRSA 2HOHA 1YVSA 1BNFA 1SARA 8RNTA 1R4YA 1BSBA 1BNIA 1Q9EA 1CH0A 1B2XA 1I2GA 1RMSA 1BU4A 1I0XA 3A5EA 1X1WA 4J5KA 1LRAA 1I70A 1RTUA 1B2ZA 1A2PA 4BU4A 1RGLA 3DH2A 1HZ1A 3AGOA 1JBTA 3HOHA 5BU4A 6GSPA 4GSPA 2KF4A 1FUTA 3D4AA 3WHOA 1GOVA 1PY3A 1X1XA 1I8VA 1G02A 9RNTA 1C54A 1HYFA 1T2HA 1YGWA 1BRKA 4J5GA 1LNIA 1I2EA 3Q3FA 4BIRA 4HAAA 3D5GA 5RNTA 1BUJA 1B27A 1RLSA 2AADA 1BRHA 2F56A 1GMQA 1I3FA 3DGYA 3KCHA 1X1YA 2F5MA 1FW7A 3D5IA 2SARA 1BNRA 1GOYA 1B3SA 1FUSA 1BSEA 1RCLA 1RN1A 1JBRA 4RNTA 6RNTA 1UCLA 1RGFA 1TRPA 2F5WA 5GSPA 1AY7A 1I2FA 1B21A 4GHOA 1YNVX 3URPA 2RBIA 1BNSA 1BSAA 2AAEA 1GSPA 1T2IA 3AHWA 1BRJA 5BIRA 2C4BA 1BNEA 1BNJA 1BGSA 1RGGA 1MGWA 2KF3A 1JBSA 1BRNL 1BIRA 1BANA 5HOHA 1B2UA 2BIRA 7GSPA 1GMRA 1FZUA 2RNTA 1FYSA 1RDSA 2KF5A 2F4YA 7RNTA 2ZA4A 3AHSA 2GSPA 1ZGXA 1BRIA 1TTOA 1AQZA 1B20A 1DE3A 1GOUA 1X1UA 3AGNA 1I3IA 1UCIA 1B2MA 1RGEA 1BSDA 3BU4A 1RNBA 1RHLA 1LOVA 3BIRA 1LOYA 1I0VA 1BRGA 2KAAA 1B2SA 1IYYA 1BAOA 1DETA 1RGAA 1UCJA 1RGHA 1BOXA 1BNGA 1PYLA 4HOHA 3WR2A 1GMPA 1RGCA 2BU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGR A;  1BSC A;  1UCK A;  3SYU A;  1BVI A;  1TRQ A;  1RGK A;  3RNT A;  1RSN A;  1LOW A;  1RN4 A;  3GSP A;  1RCK A;  1RNT A;  2KF6 A;  1BRS A;  2HOH A;  1YVS A;  1BNF A;  1SAR A;  8RNT A;  1R4Y A;  1BSB A;  1BNI A;  1Q9E A;  1CH0 A;  1B2X A;  1I2G A;  1RMS A;  1BU4 A;  1I0X A;  3A5E A;  1X1W A;  4J5K A;  1LRA A;  1I70 A;  1RTU A;  1B2Z A;  1A2P A;  4BU4 A;  1RGL A;  3DH2 A;  1HZ1 A;  3AGO A;  1JBT A;  3HOH A;  5BU4 A;  6GSP A;  4GSP A;  2KF4 A;  1FUT A;  3D4A A;  3WHO A;  1GOV A;  1PY3 A;  1X1X A;  1I8V A;  1G02 A;  9RNT A;  1C54 A;  1HYF A;  1T2H A;  1YGW A;  1BRK A;  4J5G A;  1LNI A;  1I2E A;  3Q3F A;  4BIR A;  4HAA A;  3D5G A;  5RNT A;  1BUJ A;  1B27 A;  1RLS A;  2AAD A;  1BRH A;  2F56 A;  1GMQ A;  1I3F A;  3DGY A;  3KCH A;  1X1Y A;  2F5M A;  1FW7 A;  3D5I A;  2SAR A;  1BNR A;  1GOY A;  1B3S A;  1FUS A;  1BSE A;  1RCL A;  1RN1 A;  1JBR A;  4RNT A;  6RNT A;  1UCL A;  1RGF A;  1TRP A;  2F5W A;  5GSP A;  1AY7 A;  1I2F A;  1B21 A;  4GHO A;  1YNV X;  3URP A;  2RBI A;  1BNS A;  1BSA A;  2AAE A;  1GSP A;  1T2I A;  3AHW A;  1BRJ A;  5BIR A;  2C4B A;  1BNE A;  1BNJ A;  1BGS A;  1RGG A;  1MGW A;  2KF3 A;  1JBS A;  1BRN L;  1BIR A;  1BAN A;  5HOH A;  1B2U A;  2BIR A;  7GSP A;  1GMR A;  1FZU A;  2RNT A;  1FYS A;  1RDS A;  2KF5 A;  2F4Y A;  7RNT A;  2ZA4 A;  3AHS A;  2GSP A;  1ZGX A;  1BRI A;  1TTO A;  1AQZ A;  1B20 A;  1DE3 A;  1GOU A;  1X1U A;  3AGN A;  1I3I A;  1UCI A;  1B2M A;  1RGE A;  1BSD A;  3BU4 A;  1RNB A;  1RHL A;  1LOV A;  3BIR A;  1LOY A;  1I0V A;  1BRG A;  2KAA A;  1B2S A;  1IYY A;  1BAO A;  1DET A;  1RGA A;  1UCJ A;  1RGH A;  1BOX A;  1BNG A;  1PYL A;  4HOH A;  3WR2 A;  1GMP A;  1RGC A;  2BU4 A; 
#chains in the Genus database with same CATH topology
 1WTH A;  2IUJ A;  5D82 A;  1OGX A;  2Z6B A;  2UUG C;  1UUG B;  3LT9 A;  2W9Q A;  1R4C A;  2P05 A;  1UUW B;  3I55 3;  1RCK A;  1AVK A;  1RNT A;  4WFO A;  5KP3 A;  2KF6 A;  3SX1 A;  4CJN A;  3PCR A;  4HM0 B;  3K0Z A;  3OWY A;  1AV4 A;  3G16 A;  1OF5 B;  1DMN A;  3JUN A;  1ISK A;  1W02 A;  1W2Z A;  3EE1 A;  3MG2 A;  2WOF A;  1CH0 A;  2INX A;  5KP4 A;  2PZV A;  3DGM A;  4L8O A;  1NNV A;  1RMS A;  1BU4 A;  3LOY A;  2FXT A;  1RTU A;  1VQN 3;  5AIG A;  2CW9 A;  3K7C A;  3SXX A;  1VQM 3;  4BU4 A;  3JUM A;  3DH2 A;  1HZ1 A;  1KWI A;  2YFI B;  1JBT A;  1JZD A;  3KII A;  1M90 4;  3LT8 A;  1IDP A;  2IA7 A;  2KF4 A;  4MEI A;  4H61 A;  3EQQ B;  5I97 A;  1GOV A;  1PY3 A;  3CNM A;  3DZL A;  3LYG A;  1X1X A;  3EN8 A;  3EN1 B;  3NBB A;  4XB5 A;  1YJ9 3;  3MG1 A;  1W2B 2;  3KSP A;  1OUN A;  1WQL B;  2H0H A;  3PYJ A;  4QWT A;  1C54 A;  3T0U A;  1HYF A;  3V99 A;  3DY5 A;  1NDO B;  4K1U A;  1LNH A;  4BL3 A;  1IQX A;  4I5Q A;  1LNI A;  2LQV A;  3K63 A;  4J5G A;  1FGT A;  5IEP A;  2CIU A;  3CCR 3;  3CCS 3;  1NB3 I;  4FCZ A;  3UL6 A;  1VQ7 3;  3OXA A;  1NO3 A;  1BUJ A;  2AAD A;  3NUV A;  1IV7 A;  1STD A;  1BRH A;  2F56 A;  3MG3 A;  3NBJ A;  2CHC A;  1US1 A;  1W7C A;  3KCH A;  3PS8 A;  1D6U A;  4R9K A;  5G1L A;  5AEW B;  4ILF A;  3QK9 A;  3WA2 X;  5LC6 A;  4PEJ A;  1WNH A;  3MYT A;  2ZDJ A;  3G8Z A;  1PU4 A;  2QA4 3;  1J2B A;  1RJO A;  1A67 A;  2W2C A;  3HK4 A;  3NBR A;  3HZP A;  4MMX B;  1B3S A;  4CCV A;  1JBR A;  1D6Z A;  2C10 A;  2Q07 A;  6RNT A;  1Z1S A;  5M19 A;  2W56 A;  2OWP A;  3NM2 A;  3U97 A;  3EX9 A;  3OWS A;  3F40 A;  5JPP A;  1WMO A;  3M8C A;  4LSO A;  3FG4 A;  4N6T A;  4NRE A;  2O3O A;  2HMN B;  1BRJ A;  1QAK A;  4HM2 B;  3PGB A;  4L8P A;  1DMQ A;  3Q1C A;  4OK0 A;  5ELU A;  1BUQ A;  3CPO A;  2KF3 A;  1FGQ A;  1LOX A;  2W04 A;  2H0G A;  4N3V A;  1N5P A;  1BAN A;  1O7M B;  2CKF B;  3EBT A;  1KSI A;  2B1X B;  5LC7 A;  1JRQ A;  2HMO B;  4HYZ A;  5AYS C;  1FYS A;  4HVN A;  3WOE B;  4O3V A;  1SIH A;  4R4K A;  2ZA4 A;  3F8X A;  1N8R 4;  3B8L A;  2W56 B;  1EQK A;  3BB9 A;  4RNY A;  5IG5 A;  2OQE C;  2RCD A;  3UNL A;  2CG0 A;  4FMD A;  4JRF A;  4O2H A;  2UGI A;  3CMA 3;  4FMB A;  1JNQ A;  2SBL A;  1OH0 A;  3BU4 A;  1VQ4 3;  3X3X A;  2P38 A;  4EC6 A;  2O9U X;  1TJD A;  2XSH B;  4HM5 B;  3MSO A;  1RHL A;  2CG1 A;  3BIR A;  3CCE 3;  3NM7 A;  1S72 3;  2KAA A;  5M1A A;  1BAO A;  1DET A;  1M1X B;  3WR2 A;  1RGH A;  1PYL A;  2BNG A;  2CWU A;  2R4I A;  1JB2 A;  2BU4 A;  3NHX A;  3GWR A;  1BSC A;  2HML B;  3FSD A;  3QRD A;  2ML5 A;  2R41 A;  1BVI A;  1TRQ A;  1S5A A;  4ORL A;  1ASK A;  6STD A;  1RGK A;  4KFE A;  1LOW A;  1LQM B;  3I56 3;  2IMJ A;  2CH9 A;  2GEX A;  3ECF A;  3EB8 A;  1C7H A;  2HOH A;  1LXE A;  2KXG A;  4IT7 A;  5TGN A;  1MWR A;  3STD A;  1YVB I;  2QGU A;  3PXM A;  4H3U A;  4J9A A;  3OW2 2;  1BNI A;  1PFP A;  2WGO A;  1OHS A;  2XR8 B;  5ELJ A;  1GY7 A;  2CWT A;  2YFJ B;  2OOV A;  4KFD A;  4XBX A;  2BT3 A;  3D3L A;  1I0X A;  1UGI A;  1X1W A;  3A5E A;  3J7Y d;  1HU9 A;  1I70 A;  1VQK 3;  2OTJ 3;  1UI7 A;  1A2P A;  1NJI 4;  3I0Y A;  1RGL A;  4HM8 B;  1M1K 4;  1TIJ A;  4MMY B;  2A15 A;  1MWT A;  3OWU A;  3MHE A;  5BU4 A;  6GSP A;  4IPB A;  2RSX A;  3D4A A;  4KVH A;  2L4V A;  2W0Q A;  1V57 A;  1VQP 3;  1IT7 A;  3F14 A;  4O8S A;  2IYJ A;  1STF I;  3ZG0 A;  3D79 A;  1E3V A;  5A0O B;  5JBS A;  1ZS7 A;  2W03 A;  3S27 A;  2XSO B;  3T8N A;  4Q53 A;  1ROV A;  1NU3 A;  2LYX A;  3DUK A;  1OAC A;  3CME 3;  4HKV B;  2K0M A;  1IT8 A;  1WMN A;  2W6J H;  2GXF A;  1BRK A;  2WOH A;  3KZT A;  3TDG A;  3WOD G;  4JF8 A;  4J8T A;  1VQ9 3;  2FGT A;  4R80 A;  4WYK B;  3S29 A;  1B27 A;  4LEH A;  1E3R A;  1TFO A;  1I3F A;  1D6Y A;  3DGY A;  1JKG A;  4K90 B;  2FNQ A;  1TU5 A;  2P0X A;  3CCM 3;  1DYU A;  5IG3 A;  1YHQ 3;  4WHA A;  5HGR A;  1FUS A;  1YJN 3;  4RNT A;  1Q82 4;  1JB4 A;  1TRP A;  2Z77 A;  2KRT A;  3UL5 A;  3DGN A;  1UUV B;  4AEQ A;  4AKY A;  1OHP A;  2XGN A;  3URP A;  1ROA A;  5KP1 A;  3OV4 A;  1IVX A;  1BSA A;  3AHW A;  5FGO A;  4HM1 B;  1BGS A;  1QAL A;  1RRL A;  1JZO A;  2RFR A;  5AII A;  5AYR B;  3EF8 A;  3RDE A;  3JUP A;  1BRN L;  1JKG B;  4X2O A;  3CCU 3;  1A2V A;  5G2G A;  3CCJ 3;  1O7H B;  3U1W A;  1O7G B;  7GSP A;  2OTL 3;  1UI8 A;  2RNT A;  2H0I A;  3KN4 A;  1T5Y A;  4R9L A;  1VZZ A;  1QJG A;  1OGZ A;  3ALA A;  3BNE A;  1GS3 A;  3FCS B;  2CX0 A;  1KC8 4;  3OX9 A;  5CXO A;  1ZGX A;  1TP6 A;  1BRI A;  1B20 A;  1DE3 A;  2GBX B;  1MOL A;  3KSE D;  1I3I A;  8CHO A;  2HMM B;  1B2M A;  3Q90 A;  1HKX A;  1VQ6 3;  4LMI A;  1SII A;  1LOV A;  1LQG C;  3Q2P A;  1LOY A;  2CK3 H;  1I0V A;  1Q42 A;  1CEW I;  1B2S A;  1G96 A;  3NX0 A;  4XM4 A;  3FG3 A;  1UW1 A;  5D83 A;  2F86 B;  7RNT A;  1BOX A;  1BNG A;  1DMM A;  2Y74 A;  4HOH A;  4LYL B;  3SVA A;  4BTY A;  4K61 A;  4GB5 A;  3SOY A;  1UGH I;  4FCJ A;  1Q86 4;  1A2K A;  1LVN A;  1MGR A;  1RN7 A;  4IIA A;  1GD4 A;  3LZA A;  2OOV C;  1V58 A;  3EHC A;  1SQW A;  5EQL A;  1RSN A;  2MF7 A;  3B4P A;  1RN4 A;  3E99 A;  3FLJ A;  1TUH A;  4EXR A;  3FZW A;  1N8Q A;  1YVS A;  1K28 A;  1SAR A;  2IY2 A;  3GRD A;  2XFS A;  3N8B A;  3RGA A;  2BMR B;  5IG4 A;  1BSB A;  2GU3 A;  2ML6 A;  3VSY A;  4R1K A;  4EBG A;  1B2X A;  2BO9 B;  4WWU C;  2RGQ A;  2M7O A;  3CU3 A;  5IEO A;  4J5K A;  1LRA A;  1EEJ A;  2D42 A;  5CLK A;  1JB5 A;  4EV5 A;  1B2Z A;  2XEP A;  3LTA A;  1FUW A;  3WOF B;  3SED A;  3K5T A;  3S28 A;  1AR0 A;  3EBY A;  1OPY A;  2E2U A;  3D9R A;  3F7S A;  4EV2 A;  3G6E 3;  2K54 A;  3CNX A;  3A76 A;  3FF2 A;  1FUT A;  2GU1 A;  2IUK A;  3CCQ 3;  4HM4 B;  3HX8 A;  2B24 B;  1I8V A;  3CXC 2;  3N54 B;  1G02 A;  2CX1 A;  4AKZ A;  1U8C B;  3KKG A;  4I4K A;  9RNT A;  3WDG B;  5G1K A;  3S5C A;  4CPK A;  3K9M C;  4BTW A;  1KQS 2;  1GD3 A;  1W6Y A;  3DMC A;  5M18 A;  2GEY A;  1YGW A;  5AIH A;  2K3D A;  1JV2 B;  4BIR A;  5AIF A;  3D5G A;  2JQ5 A;  3CCV 3;  3EJV A;  2F98 A;  5AEU B;  1DVC A;  3VF1 A;  5BXQ A;  1OCV A;  3F8H A;  1GMQ A;  3X41 A;  1X1Y A;  2CC3 A;  7STD A;  4WYK A;  1FW7 A;  4FCM A;  2PNC A;  2SAR A;  3B7C A;  4L7K A;  2D1W A;  3F9S A;  3L0R A;  1BSE A;  1RN1 A;  3GAX A;  1K8A 4;  1K73 4;  1ZX2 A;  1UCL A;  4BTX A;  1CYV A;  1Q40 A;  5D81 A;  1AY7 A;  5EVH A;  4GHO A;  4RZM A;  1YNV X;  3LTC A;  1EKM A;  1FGO A;  2CFL A;  2RBI A;  1BNS A;  1ULI B;  3NV0 A;  2C4B A;  1BNE A;  5BIR A;  1BNJ A;  1ZO2 A;  1RGG A;  2XGL A;  3GZX B;  1MGW A;  2I9W A;  5AI1 A;  1IVW A;  1JBS A;  1NB5 I;  3BNC A;  1A90 A;  1W4N A;  5HOH A;  3DGO A;  4NPB A;  1B2U A;  1YGE A;  3LML A;  4MMZ B;  4U13 A;  1SPU A;  2WO0 A;  1FZU A;  1RDS A;  3CD6 3;  2F4Y A;  4K1V A;  2MC8 A;  1V74 A;  3NXJ A;  1MWU A;  3CC7 3;  1GYB A;  1EG9 B;  1Q40 B;  1FGM A;  2CFW A;  3B4O A;  3BND A;  3T8U A;  1KD1 4;  1W6C A;  1TTO A;  1TFK A;  3JUQ A;  3IPT A;  1FGR A;  1X1U A;  3O8Y A;  3AGN A;  1K41 A;  1UCI A;  1Y4K A;  1QVG 2;  3IMA B;  5IEN A;  4N6O B;  3NV0 B;  3NQZ A;  1BSD A;  1JN5 B;  1JJ2 2;  4WP5 A;  1RNB A;  4X2H A;  3SLU A;  1BRG A;  1GY5 A;  4OUQ A;  1IK3 A;  3G4S 3;  1IYY A;  3JVC A;  1UCJ A;  3MPH A;  4O02 B;  5EEO A;  1NWW A;  1GMP A;  4DKI A;  1RGC A;  4RNZ A;  4N6N B;  4XDW A;  3X3Z A;  1UCK A;  3SYU A;  1CYU A;  2BMO B;  3RNT A;  3IJE B;  2KCD A;  3GSP A;  4HM3 B;  1OHO A;  1T3B A;  1EA2 A;  2L1S A;  5JPU A;  1BRS A;  1EUI C;  1O7P B;  2P0M A;  3LXU X;  3ROB A;  3DXO A;  2Z7A A;  1BNF A;  2J8X B;  3FF0 A;  4HBR A;  3S67 A;  2BHM A;  8RNT A;  4RBN A;  1O7W B;  2F99 A;  1R4Y A;  2C11 A;  1QAF A;  2STD A;  1N9J A;  3N9H A;  4NHF A;  1IVV A;  1Q9E A;  3BNB A;  1G0T A;  3GZY B;  5DRE A;  1I2G A;  3X40 A;  2HMK B;  3ER7 A;  3FG1 A;  1Q7Y 4;  1IQ8 A;  1VQO 3;  5IF6 A;  4KZ1 A;  1SJW A;  1VQ8 3;  2JDI H;  3UB1 A;  1MNL A;  3AGO A;  3AMO A;  4EYC A;  3HOH A;  3CCL 3;  2OCT A;  4CDL A;  3CPW 2;  1IQY A;  4XBY A;  4GSP A;  4EW5 A;  3ZG5 A;  2ZL8 A;  3WHO A;  4TX4 A;  2XRX B;  2Z76 A;  3V92 A;  3SOA A;  1VQQ A;  2HMJ B;  3KE7 A;  4LZI A;  2CFD A;  1Q81 4;  1UDI I;  2E2V A;  1QVF 2;  4HZ9 B;  3H3H A;  1T2H A;  3NQY A;  4G1M B;  4HM6 B;  2YX9 A;  2CFG A;  1I2E A;  3Q3F A;  2QIY A;  4HAA A;  3DGL A;  1YI2 3;  3FGY A;  5RNT A;  1FA3 A;  1RLS A;  4N6L A;  3AMO B;  4N6M A;  5FW5 A;  2CFK A;  1N9E A;  3WMD A;  1W6G A;  2F5M A;  4HJL B;  5IW9 A;  3D5I A;  5STD A;  1W01 A;  1BNR A;  5CK6 A;  3KFQ C;  1GOY A;  1E97 A;  1RCL A;  1CQS A;  3X42 A;  3H51 A;  1IU7 A;  1RGF A;  5DRV A;  1U5O A;  2F5W A;  5GSP A;  3UJM A;  1RKY A;  3LTD A;  1YIT 3;  1I2F A;  1B21 A;  1VQL 3;  5CF1 A;  2E2T A;  1YJW 3;  1ULJ B;  3GZR A;  3FH1 A;  1O7N B;  2CWV A;  3HIG A;  4FR9 A;  4LGQ A;  3PZW A;  2AAE A;  3X3Y A;  1AVL A;  1GSP A;  1T2I A;  5IER A;  2UX0 A;  1IVU A;  3MWZ A;  4KT3 B;  3EC9 A;  3ZFZ A;  1N5H A;  1BIR A;  2YFL B;  4GL6 A;  4HM7 B;  3RGR A;  1DVD A;  1GY6 A;  2BIR A;  3G71 3;  2W9P A;  1GMR A;  1IV9 A;  4N6V 0;  4XBT A;  2BMQ B;  3JUO A;  1M9G A;  1RRH A;  2KF5 A;  1F8N A;  3FKA A;  1QMA A;  3LTB A;  2P09 A;  4MJD A;  4XDV A;  5CF2 A;  3GZB A;  3VGN A;  3AHS A;  3MKI A;  1VQ5 3;  4OVM A;  2GSP A;  1YIJ 3;  5BVB A;  1WMP A;  2GBW B;  4BL2 A;  1MWS A;  2V1L A;  4HZB B;  1AQZ A;  2Y73 A;  4N6U A;  1GOU A;  4ZM8 A;  1RGE A;  3F7X A;  1L5G B;  2XF3 A;  1OF5 A;  3CC4 3;  3V98 A;  1Q7H A;  3HII A;  1K9M 4;  3LH4 A;  4KFF A;  4FMC A;  3G0K A;  2QEX 3;  3HI7 A;  1JN5 A;  3BLZ A;  2OQE A;  3DM8 A;  5IG0 A;  2XH9 A;  3CC2 3;  2ZHX B;  1RGA A;  1W00 A;  2WGQ A;  2XFT A;  3PCS A;  4FMA A;  3WA3 A;  4STD A;  1W5Z A; 
#chains in the Genus database with same CATH homology
 1MGR A;  1BSC A;  1UCK A;  3SYU A;  1BVI A;  1TRQ A;  1RGK A;  3RNT A;  1RSN A;  1LOW A;  1RN4 A;  3GSP A;  1RCK A;  1RNT A;  2KF6 A;  1BRS A;  2HOH A;  1YVS A;  1BNF A;  1SAR A;  8RNT A;  1R4Y A;  1BSB A;  1BNI A;  1Q9E A;  1CH0 A;  1B2X A;  1I2G A;  1RMS A;  1BU4 A;  1I0X A;  3A5E A;  1X1W A;  4J5K A;  1LRA A;  1I70 A;  1RTU A;  1B2Z A;  1A2P A;  4BU4 A;  1RGL A;  3DH2 A;  1HZ1 A;  3AGO A;  1JBT A;  3HOH A;  5BU4 A;  6GSP A;  4GSP A;  2KF4 A;  1FUT A;  3D4A A;  3WHO A;  1GOV A;  1PY3 A;  1X1X A;  1I8V A;  1G02 A;  9RNT A;  1C54 A;  1HYF A;  1T2H A;  1YGW A;  1BRK A;  4J5G A;  1LNI A;  1I2E A;  3Q3F A;  4BIR A;  4HAA A;  3D5G A;  5RNT A;  1BUJ A;  1B27 A;  1RLS A;  2AAD A;  1BRH A;  2F56 A;  1GMQ A;  1I3F A;  3DGY A;  3KCH A;  1X1Y A;  2F5M A;  1FW7 A;  3D5I A;  2SAR A;  1BNR A;  1GOY A;  1B3S A;  1FUS A;  1BSE A;  1RCL A;  1RN1 A;  1JBR A;  4RNT A;  6RNT A;  1UCL A;  1RGF A;  1TRP A;  2F5W A;  5GSP A;  1AY7 A;  1I2F A;  1B21 A;  4GHO A;  1YNV X;  3URP A;  2RBI A;  1BNS A;  1BSA A;  2AAE A;  1GSP A;  1T2I A;  3AHW A;  1BRJ A;  5BIR A;  2C4B A;  1BNE A;  1BNJ A;  1BGS A;  1RGG A;  1MGW A;  2KF3 A;  1JBS A;  1BRN L;  1BIR A;  1BAN A;  5HOH A;  1B2U A;  2BIR A;  7GSP A;  1GMR A;  1FZU A;  2RNT A;  1FYS A;  1RDS A;  2KF5 A;  2F4Y A;  7RNT A;  2ZA4 A;  3AHS A;  2GSP A;  1ZGX A;  1BRI A;  1TTO A;  1AQZ A;  1B20 A;  1DE3 A;  1GOU A;  1X1U A;  3AGN A;  1I3I A;  1UCI A;  1B2M A;  1RGE A;  1BSD A;  3BU4 A;  1RNB A;  1RHL A;  1LOV A;  3BIR A;  1LOY A;  1I0V A;  1BRG A;  2KAA A;  1B2S A;  1IYY A;  1BAO A;  1DET A;  1RGA A;  1UCJ A;  1RGH A;  1BOX A;  1BNG A;  1PYL A;  4HOH A;  3WR2 A;  1GMP A;  1RGC A;  2BU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...