2INXA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 2,6-difluorophenol
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid delta-isomerase
publication title Testing geometrical discrimination within an enzyme active site: constrained hydrogen bonding in the ketosteroid isomerase oxyanion hole.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2inxA00
3JUPA 3CPOA 2BMOB 4XM4A 3EN8A 3EQQB 1OF5A 3BB9A 2GBWB 5HGRA 4XBTA 2HMOB 3SEDA 4CDLA 5IF6A 3NM2A 1OHOA 2YFLB 4HJLB 5FW5A 3G16A 1OH0A 2A15A 1Z1SA 2GEYA 3JUMA 3MSOA 4WWUC 1NWWA 3GRDA 5CXOA 3ROBA 3F8HA 1C7HA 3D9RA 3NXJA 1ULJB 2QGUA 4WYKB 4HM7B 4OVMA 1OHPA 1JN5B 3B4PA 3OV4A 3G0KA 3M8CA 4HKVB 4K1VA 5EVHA 4L8PA 3GZRA 4L7KA 4FCJA 5JPUA 3A76A 1ZX2A 1CQSA 3FSDA 3S5CA 2GEXA 3MG3A 3T8UA 4XBXA 1GS3A 2HMJB 1Q40A 3NV0A 2RFRA 5D82A 3OX9A 3B4OA 5D81A 1JKGA 2HMKB 4J8TA 6STDA 4HM3B 3F7XA 3EJVA 3B7CA 2GXFA 3H3HA 4RZMA 5CLKA 3IPTA 1QMAA 5STDA 1VZZA 3EF8A 3OWUA 4XDWA 2CHCA 3DZLA 1E3RA 1E3VA 3OXAA 1A2KA 2IMJA 3SOYA 3STDA 1S5AA 1TP6A 3F9SA 1JB2A 1DMNA 1OGXA 3DMCA 5AEWB 1NU3A 1JB5A 1O7GB 3FF2A 3CU3A 3JUQA 3JUOA 3MG2A 4FCMA 2XSOB 1O7MB 3GZBA 1O7PB 3VGNA 2BMRB 1DMMA 3B8LA 2K54A 2OWPA 4X2HA 4STDA 3F7SA 3GWRA 5CF2A 2Z7AA 4GB5A 4LMIA 5AIGA 2YFJB 3HX8A 5D83A 2GBXB 1Q42A 2B24B 3MHEA 1O7HB 3KE7A 5IG5A 3KZTA 1W01A 2R4IA 2I9WA 4R1KA 3G8ZA 2B1XB 3I0YA 2XSHB 2Z76A 4WYKA 1O7WB 4HM2B 2QIYA 4HZBB 3F40A 1JN5A 1AR0A 3UJMA 3DUKA 1UUWB 2XRXB 5JPPA 2F86B 5KP3A 3Q90A 3HK4A 1O7NB 1ZO2A 1HKXA 1QJGA 4HM5B 3EBTA 4PEJA 3GZYB 3JUNA 3HZPA 3EHCA 4HZ9B 2PZVA 3FKAA 1ULIB 2W2CA 8CHOA 2CKFB 4N3VA 3DM8A 2BMQB 5IEPA 4HM0B 5CF1A 4XB5A 1OCVA 1W02A 3CNMA 3F14A 7STDA 4WP5A 5AIFA 3MG1A 1GY7A 4OUQA 1DMQA 3RGRA 5IG0A 3K7CA 4I4KA 4MJDA 1STDA 1W00A 1OF5B 1U5OA 3EX9A 1SJWA 4H3UA 4HVNA 1ISKA 3H51A 5IENA 4R9KA 1JB4A 1GYBA 3MKIA 1IDPA 3LZAA 2JQ5A 3WMDA 2RGQA 1NDOB 3VSYA 1GY5A 4ORLA 3K0ZA 4LEHA 4U13A 2F99A 2BNGA 4J9AA 3EN1B 5CK6A 2Z77A 5TGNA 3EC9A 2HMMB 2XR8B 5KP4A 5BVBA 5DRVA 3T8NA 3FZWA 5KP1A 3LYGA 4K1UA 2F98A 3EBYA 1K41A 5IERA 3RGAA 4HM6B 4KVHA 4X2OA 1EG9B 1OUNA 5AI1A 5AEUB 3E99A 1OHSA 3UNLA 1OPYA 3FGYA 3ECFA 4LGQA 5AIIA 5BXQA 3NUVA 1Q40B 3KSPA 3NV0B 2STDA 3KKGA 1UUVB 5IG4A 3F8XA 3DXOA 4XDVA 4L8OA 1BUQA 2INXA 4HM8B 5G2GA 5AIHA 3FLJA 2RCDA 4R9LA 1JKGB 1EA2A 1WQLB 2HMLB 3GZXB 2UX0A 1W6YA 1GY6A 3OWYA 4IIAA 4Q53A 1ASKA 5DREA 4XBYA 5IEOA 2YFIB 3BLZA 3OWSA 1TUHA 5IG3A 1E97A 1OGZA 3NBRA 3NHXA 4HM4B 3FH1A 3MYTA 3SOAA 3ER7A 2HMNB 3CNXA 4HM1B 3FF0A
chains in the Genus database with same CATH superfamily
3JUPA 3LTAA 3DGYA 3I553 4WHAA 3CPOA 1BU4A 4CJNA 2CWVA 1BRGA 2BMOB 4XM4A 1DYUA 1V57A 1N9JA 1YIJ3 2O9UX 1AVLA 5G1KA 3LTCA 3EN8A 3EQQB 1OF5A 1RGAA 3AMOB 3BB9A 5M1AA 3U1WA 2GBWB 5RNTA 2WGOA 1X1XA 5HGRA 1RHLA 2BT3A 2HMOB 2GU1A 4XBTA 2QEX3 1TFKA 3UL6A 5M19A 2IY2A 1QAKA 3SEDA 3BNEA 4CDLA 4RBNA 5IF6A 1FA3A 2XF3A 3CC43 3FG1A 3NM2A 1BNRA 2BIRA 4EXRA 3MPHA 1GOUA 1YJN3 1VQ73 2AADA 4N6MA 1IV9A 4RNZA 1BVIA 1B2ZA 3U97A 1VQO3 4KT3B 2OTJ3 2Q07A 1OHOA 2CC3A 2YFLB 4HJLB 5FW5A 3G16A 1V58A 2MC8A 1OH0A 3WA3A 4KFFA 1JZDA 1IQYA 2A15A 3K9MC 4BTYA 1R4YA 1I2EA 2IA7A 4ILFA 1Z1SA 3UB1A 1RGFA 3GSPA 2GEYA 3JUMA 3MSOA 3DGMA 3Q3FA 2OCTA 4FMAA 1ROAA 4CPKA 3CPW2 3WOEB 1KC84 1W6GA 2RBIA 4EV2A 2H0HA 4WWUC 1GSPA 1NWWA 3CCL3 3GRDA 2CX1A 1GOVA 3G6E3 1D6YA 1US1A 1K734 5CXOA 2XFTA 4O3VA 3ROBA 2QA43 3F8HA 1A90A 1STFI 1C7HA 1MWTA 3D9RA 3NXJA 3KFQC 1ULJB 1WMNA 2L1SA 2QGUA 3NX0A 1G02A 3SLUA 4WYKB 2IUKA 3L0RA 1M904 2SARA 1I8VA 2D42A 1RRLA 9RNTA 2CWTA 4HM7B 4OVMA 1QAFA 1TFOA 4J5KA 3HIGA 1U8CB 1OHPA 1JN5B 3URPA 2CX0A 3B4PA 3CCS3 3OV4A 2E2TA 3FG4A 3G0KA 1V74A 1LOWA 3M8CA 4KFDA 4HKVB 1A2VA 1PYLA 3KSED 3WHOA 3X40A 3CC73 4K1VA 3V98A 5EVHA 2KRTA 3BNCA 4L8PA 3GZRA 4L7KA 4EW5A 1MGWA 2M7OA 4FCJA 2XGLA 3A76A 1ZX2A 5JPUA 3LTDA 1N8R4 1CQSA 1HU9A 2V1LA 4FCZA 3FSDA 1UI8A 3SXXA 5EEOA 4BL2A 1B27A 1RSNA 3S5CA 1PU4A 2ZL8A 1VQQA 1RGEA 2GEXA 2P09A 1G0TA 3SVAA 3MG3A 3T8UA 2W6JH 4XBXA 1GS3A 2ZDJA 4MMXB 2HMJB 1Q40A 2W56A 3NV0A 3AGOA 1RDSA 2CFWA 2CFGA 3TDGA 1CEWI 1N5PA 2RFRA 1YGWA 3OX9A 5D82A 3B4OA 1HYFA 1LOVA 5D81A 1IVUA 5ELJA 2OOVA 1GMQA 1JKGA 2HMKB 1MOLA 1NB3I 4J8TA 3O8YA 6STDA 4HM3B 1BIRA 3F7XA 3EJVA 4N6UA 3B7CA 1MGRA 2GXFA 3H3HA 4RZMA 1CYUA 4AKZA 4MMZB 1B2XA 2OQEA 5CLKA 3IPTA 4FMDA 4NHFA 4RNYA 1RCLA 4GL6A 2WO0A 1QMAA 4NPBA 5STDA 3PXMA 3ZG5A 3S29A 1VZZA 3EF8A 1NNVA 1W4NA 2C4BA 1EEJA 3V92A 3OWUA 3CCM3 4XDWA 1VQ43 1BAOA 1BSEA 2CHCA 3DZLA 1E3RA 2F4YA 4NREA 1E3VA 5ELUA 3UL5A 2H0IA 3D79A 1T5YA 3OXAA 2CFLA 4HAAA 1RTUA 1A2KA 1BRHA 3PCRA 3LTBA 2IMJA 3SOYA 1L5GB 3STDA 2BHMA 1S5AA 1TP6A 1I3IA 3KN4A 3F9SA 1JB2A 2LYXA 1DMNA 2CFDA 5LC6A 1VQ53 1SQWA 1OGXA 3DMCA 5AEWB 1I0VA 1JB5A 1NU3A 1PFPA 1O7GB 2KCDA 1BANA 1NJI4 3FF2A 3CU3A 3JUQA 3JUOA 3MG2A 4FCMA 2F5MA 1DE3A 5AYSC 2BU4A 3DGLA 2XSOB 3X41A 4JF8A 1O7MB 3GZBA 1O7PB 1OACA 2CH9A 4BU4A 3CCJ3 1R4CA 3CCQ3 3VGNA 4EC6A 3AMOA 3LXUX 2BMRB 1DMMA 1QVF2 1BSBA 1WNHA 4QWTA 1MWSA 1UUGB 1FUWA 3B8LA 1AV4A 2K54A 1LXEA 2OWPA 1IVWA 1YHQ3 1BRSA 4X2HA 4STDA 3F7SA 1FGOA 3G713 1Q814 1LOYA 3GWRA 2CG0A 2W04A 5CF2A 1GMRA 2Z7AA 5A0OB 4MEIA 1BGSA 3HOHA 4GB5A 1W2ZA 3PZWA 4LMIA 5AIGA 2Y74A 1X1UA 1UCLA 1JBRA 4EYCA 1NB5I 1B2MA 5G1LA 4DKIA 1BOXA 2YFJB 3HX8A 3LT9A 4JRFA 2AAEA 2XGNA 1ZGXA 3PCSA 5JBSA 1MWRA 5D83A 1JNQA 2GBXB 1Q42A 1D6UA 2B24B 1QVG2 3MHEA 2XH9A 1O7HB 4WFOA 3KE7A 1YVBI 5IG5A 1VQN3 1M9GA 3IMAB 3KZTA 1W01A 5HOHA 4FMCA 2KAAA 2R4IA 2I9WA 4N6TA 1T2IA 4R1KA 4BL3A 1YVSA 3G8ZA 2B1XB 3ZG0A 1JBSA 1I70A 2CWUA 2W9PA 1JRQA 3X42A 2E2UA 1EQKA 1BRIA 2P0MA 3NBBA 3I0YA 3I563 2XSHB 2Z76A 3CCU3 4WYKA 3SYUA 1VQK3 2F56A 1W6CA 1O7WB 4R80A 2KXGA 4HM2B 2QIYA 3G4S3 4HZBB 3X3ZA 3F40A 1AY7A 1VQ93 4N6NB 1JN5A 3D5GA 3CC23 1K8A4 4FR9A 1AR0A 2D1WA 2YX9A 3NQZA 1LRAA 1RCKA 4O2HA 4RNTA 3S67A 3UJMA 2WOHA 3NBJA 3DUKA 5BU4A 1UUWB 1N5HA 2UUGC 1FW7A 1YI23 3JVCA 2XRXB 2J8XB 2KF5A 5JPPA 1TJDA 1Q824 2F86B 1RNBA 5KP3A 3Q90A 1KQS2 3HK4A 3VF1A 1TIJA 1DVCA 1ROVA 1O7NB 1X1WA 2W9QA 1AQZA 4BTWA 3LOYA 2Y73A 1ZO2A 2PNCA 1HKXA 1QJGA 4HM5B 3X3XA 5BIRA 1FGTA 3CCR3 1VQM3 1Y4KA 1TTOA 4G1MB 1BSAA 1FYSA 1RN7A 2GSPA 3EBTA 2C11A 2R41A 3K63A 4PEJA 3GZYB 3JUNA 1PY3A 3HZPA 3PYJA 4AKYA 3RDEA 3EHCA 4HZ9B 2PZVA 3FKAA 1ULIB 1YIT3 2W2CA 1Q7Y4 8CHOA 2XFSA 3N54B 3PGBA 6RNTA 1VQP3 1SIHA 1BRKA 2CKFB 5FGOA 1FGQA 3NQYA 1ZS7A 4N3VA 1BUJA 3DM8A 3N9HA 3EE1A 4K90B 3BNDA 2BMQB 2Z6BA 4GSPA 1QALA 4HM0B 4IPBA 5IEPA 5CF1A 1S723 1B2SA 3T0UA 1BNSA 3GAXA 5IW9A 4XB5A 1RGGA 1OCVA 1W02A 3CNMA 3QK9A 5EQLA 1N9EA 1AVKA 1RGKA 1UCIA 3MWZA 2CIUA 3F14A 1M1K4 2ZHXB 1M1XB 1FGRA 5LC7A 7STDA 1FGMA 1IV7A 4WP5A 1LOXA 1VQ63 3N8BA 5AIFA 4N6OB 1Q7HA 3MG1A 1GY7A 4OUQA 1DMQA 1BRJA 2MF7A 1I0XA 4K61A 4LZIA 3RGRA 4O8SA 7GSPA 1RN4A 3D5IA 1TU5A 2W03A 5IG0A 5AYRB 1WMOA 3CXC2 3K7CA 5I97A 1LNHA 1BNFA 2W0QA 1UGIA 1UW1A 4KZ1A 4I4KA 2KF3A 4J5GA 2HOHA 4MJDA 3QRDA 2P05A 1STDA 3CMA3 1BNJA 1IVXA 1W00A 3ZFZA 1OF5B 1UCJA 1U5OA 4BIRA 3EX9A 1RGHA 1SJWA 1NO3A 3DGNA 1SIIA 4H3UA 4HVNA 1B20A 4MMYB 1EUIC 3X3YA 1CYVA 1IK3A 2CK3H 3H51A 1ISKA 1DVDA 1FZUA 2SBLA 5IENA 4R9KA 1JB4A 3HIIA 3WOFB 1GYBA 3MKIA 1HZ1A 1IDPA 1VQL3 3KCHA 8RNTA 5GSPA 1BNEA 3RNTA 1GMPA 1YGEA 1D6ZA 2OTL3 1X1YA 3LZAA 2O3OA 2JQ5A 4N6LA 1YNVX 3D3LA 1F8NA 3SX1A 2GU3A 1UI7A 3WMDA 1JJ22 1JV2B 1Q9EA 1BNIA 3S28A 2RGQA 2FXTA 3EB8A 1G96A 1NDOB 1GY5A 4ORLA 3FCSB 3VSYA 3WODG 5M18A 1A2PA 1GOYA 2XEPA 1LNIA 3K0ZA 2IYJA 2ML6A 3LH4A 4LEHA 4BTXA 2LQVA 1J2BA 1IVVA 4U13A 1WMPA 2F99A 1IT8A 1KD14 1RMSA 2BNGA 4J9AA 4LYLB 1A67A 2E2VA 3EN1B 5CK6A 1W7CA 3S27A 3FG3A 3DH2A 1SARA 2CFKA 1IQXA 4HBRA 1FUSA 4R4KA 3A5EA 3BIRA 2Z77A 3WR2A 5TGNA 3EC9A 2HMMB 3K5TA 4KFEA 1B2UA 2XR8B 5KP4A 1KWIA 2P38A 5BVBA 2FNQA 1C54A 1RKYA 1RRHA 1TRPA 2BO9B 5DRVA 3WA2X 4IT7A 1TRQA 3T8NA 1I2GA 3FZWA 5KP1A 4HOHA 3LYGA 4K1UA 2F98A 3EBYA 1K41A 4H61A 4N6V0 1BSDA 1VQ83 2KF4A 1EKMA 3BNBA 5IERA 1IT7A 2ZA4A 3RGAA 1K9M4 3PS8A 1DETA 1W5ZA 4HM6B 1BSCA 4KVHA 3D4AA 4X2OA 1Q864 1B21A 1JBTA 1EG9B 1OUNA 5AI1A 5AEUB 4O02B 1LQMB 3CCV3 1WTHA 2ML5A 1UDII 3E99A 1IU7A 1CH0A 1OHSA 1T3BA 1OPYA 2C10A 3IJEB 3FGYA 2K3DA 4GHOA 2JDIH 3UNLA 3ECFA 4LGQA 1W2B2 1LVNA 1B3SA 3AGNA 1I3FA 3DGOA 1LQGC 3NM7A 5AIIA 2UGIA 2WOFA 5BXQA 3NUVA 1Q40B 2W56B 3KSPA 3NV0B 2STDA 4HYZA 3KKGA 1UUVB 6GSPA 1SPUA 3F8XA 1I2FA 2FGTA 3DXOA 4XDVA 5IG4A 3CD63 3BU4A 4L8OA 3OW22 1BUQA 2INXA 4I5QA 4HM8B 1MWUA 1RN1A 4ZM8A 1RGLA 1RNTA 3WDGB 5G2GA 3CME3 1BNGA 5AIHA 4FMBA 3DY5A 3CCE3 3FLJA 2RCDA 2RNTA 4R9LA 1IQ8A 1EA2A 1JKGB 1WQLB 1GD3A 2WGQA 3HI7A 1IYYA 4CCVA 2HMLB 1RGCA 1FUTA 3LMLA 1UGHI 2CW9A 3AHSA 2CG1A 3GZXB 7RNTA 2UX0A 1W6YA 1GY6A 1K28A 4LSOA 3OWYA 4IIAA 4EBGA 2P0XA 2K0MA 4Q53A 4TX4A 2IUJA 2RSXA 1ASKA 4AEQA 5DREA 3LT8A 4XBYA 5IEOA 3Q1CA 1BRNL 2OOVC 2YFIB 4OK0A 3BLZA 3OWSA 1TUHA 3KIIA 1MNLA 4EV5A 5IG3A 1UCKA 1E97A 1N8QA 1OGZA 2H0GA 3NBRA 3J7Yd 2L4VA 3NHXA 4HM4B 2OQEC 1JZOA 3AHWA 2F5WA 3ALAA 1KSIA 2KF6A 3Q2PA 3FH1A 3MYTA 1YJ93 3SOAA 3ER7A 1T2HA 2HMNB 3CNXA 3V99A 4HM1B 1GD4A 3FF0A 1YJW3 1RJOA 1RLSA
chains in the Genus database with same CATH topology
3JUPA 3LTAA 3I553 4WHAA 3CPOA 2CWVA 2BMOB 4XM4A 1DYUA 1YIJ3 1N9JA 2O9UX 1AVLA 3LTCA 3EN8A 3EQQB 1OF5A 3AMOB 3BB9A 3U1WA 2GBWB 2WGOA 5HGRA 2BT3A 4XBTA 2HMOB 2GU1A 2QEX3 1TFKA 3UL6A 3SEDA 1QAKA 3BNEA 4CDLA 4RBNA 5IF6A 1FA3A 2XF3A 3CC43 3FG1A 3NM2A 4EXRA 3MPHA 1YJN3 1VQ73 4N6MA 1IV9A 4RNZA 3U97A 1VQO3 2OTJ3 2Q07A 1OHOA 2CC3A 2YFLB 4HJLB 5FW5A 3G16A 2MC8A 1OH0A 3WA3A 4KFFA 1IQYA 2A15A 3K9MC 4BTYA 2IA7A 1Z1SA 3UB1A 2GEYA 3JUMA 3MSOA 3DGMA 4FMAA 2OCTA 3CPW2 1ROAA 1KC84 3WOEB 1W6GA 4EV2A 4WWUC 1NWWA 3CCL3 3GRDA 3G6E3 1D6YA 1US1A 1K734 5CXOA 2XFTA 4O3VA 3ROBA 2QA43 3F8HA 1A90A 1STFI 1C7HA 3D9RA 3NXJA 3KFQC 1ULJB 1WMNA 2QGUA 3NX0A 3SLUA 4WYKB 2IUKA 3L0RA 1M904 2D42A 1RRLA 2CWTA 4HM7B 4OVMA 1QAFA 1TFOA 3HIGA 1U8CB 1OHPA 1JN5B 3B4PA 3CCS3 3OV4A 2E2TA 3FG4A 3G0KA 1V74A 3M8CA 4KFDA 4HKVB 1A2VA 3KSED 3X40A 3CC73 4K1VA 3V98A 5EVHA 2KRTA 3BNCA 4L8PA 3GZRA 4L7KA 2M7OA 4FCJA 2XGLA 3A76A 1ZX2A 5JPUA 3LTDA 1N8R4 1CQSA 1HU9A 2V1LA 4FCZA 3FSDA 1UI8A 3SXXA 5EEOA 3S5CA 1PU4A 2ZL8A 2GEXA 2P09A 3SVAA 3MG3A 3T8UA 2W6JH 4XBXA 1GS3A 2ZDJA 4MMXB 2HMJB 1Q40A 2W56A 3NV0A 2CFWA 2CFGA 3TDGA 1CEWI 1N5PA 2RFRA 5D82A 3OX9A 3B4OA 5D81A 1IVUA 5ELJA 2OOVA 1JKGA 2HMKB 1MOLA 1NB3I 4J8TA 3O8YA 6STDA 4HM3B 3F7XA 3EJVA 4N6UA 3B7CA 2GXFA 3H3HA 4RZMA 1CYUA 4AKZA 4MMZB 2OQEA 5CLKA 3IPTA 4FMDA 4NHFA 4RNYA 4GL6A 2WO0A 1QMAA 5STDA 3PXMA 3S29A 1VZZA 3EF8A 1W4NA 3V92A 3OWUA 3CCM3 4XDWA 1VQ43 2CHCA 3DZLA 1E3RA 4NREA 1E3VA 5ELUA 3UL5A 1T5YA 3OXAA 2CFLA 1A2KA 3PCRA 3LTBA 2IMJA 3SOYA 1L5GB 3STDA 2BHMA 1S5AA 1TP6A 3KN4A 3F9SA 1JB2A 2LYXA 1DMNA 2CFDA 5LC6A 1VQ53 1SQWA 1OGXA 3DMCA 5AEWB 1NU3A 1JB5A 2KCDA 1PFPA 1O7GB 1NJI4 3FF2A 3CU3A 3JUQA 3JUOA 3MG2A 4FCMA 5AYSC 3DGLA 2XSOB 3X41A 4JF8A 1O7MB 3GZBA 1O7PB 1OACA 2CH9A 3CCJ3 1R4CA 3CCQ3 3VGNA 4EC6A 3AMOA 3LXUX 2BMRB 1DMMA 1QVF2 1WNHA 4QWTA 1FUWA 3B8LA 1AV4A 2K54A 1LXEA 2OWPA 1IVWA 1YHQ3 1Q814 4X2HA 4STDA 3F7SA 1FGOA 3G713 3GWRA 2CG0A 2W04A 5CF2A 2Z7AA 5A0OB 4MEIA 4GB5A 4LMIA 1W2ZA 3PZWA 5AIGA 2Y74A 4EYCA 1NB5I 2YFJB 3HX8A 3LT9A 4JRFA 2XGNA 3PCSA 5JBSA 5D83A 1JNQA 2GBXB 1Q42A 1D6UA 2B24B 1QVG2 3MHEA 2XH9A 1O7HB 4WFOA 3KE7A 1YVBI 5IG5A 1VQN3 1M9GA 3IMAB 3KZTA 1W01A 4FMCA 4N6TA 2R4IA 2I9WA 4R1KA 3G8ZA 2B1XB 2CWUA 2W9PA 1JRQA 3X42A 2E2UA 1EQKA 2P0MA 3NBBA 3I0YA 3I563 2XSHB 2Z76A 3CCU3 4WYKA 1VQK3 1W6CA 1O7WB 4R80A 2KXGA 4HM2B 2QIYA 3G4S3 4HZBB 3X3ZA 3F40A 1VQ93 4N6NB 1JN5A 3CC23 1K8A4 4FR9A 1AR0A 2D1WA 2YX9A 3NQZA 4O2HA 3UJMA 3J7Yd 3S67A 2WOHA 3NBJA 3DUKA 1UUWB 1N5HA 1YI23 3JVCA 2XRXB 5JPPA 1Q824 2F86B 5KP3A 3Q90A 1KQS2 3HK4A 3VF1A 1TIJA 1DVCA 1ROVA 1O7NB 2W9QA 4BTWA 3LOYA 2Y73A 1ZO2A 2PNCA 1HKXA 1QJGA 4HM5B 3X3XA 3CCR3 1FGTA 1VQM3 1Y4KA 4G1MB 1RN7A 3K63A 3EBTA 2C11A 4PEJA 3GZYB 3JUNA 3HZPA 3PYJA 3RDEA 3EHCA 4HZ9B 2PZVA 3FKAA 1ULIB 1YIT3 2W2CA 1Q7Y4 8CHOA 2XFSA 3N54B 3PGBA 1VQP3 1SIHA 2CKFB 5FGOA 1FGQA 3NQYA 4N3VA 3DM8A 3N9HA 3EE1A 4K90B 3BNDA 2BMQB 2Z6BA 5IEPA 1QALA 4HM0B 4IPBA 1S723 5CF1A 3T0UA 3GAXA 5IW9A 4XB5A 1OCVA 1W02A 3CNMA 3QK9A 5EQLA 1N9EA 1AVKA 3MWZA 2CIUA 3F14A 1M1K4 1M1XB 1FGRA 5LC7A 7STDA 1FGMA 1IV7A 4WP5A 1LOXA 1VQ63 3N8BA 5AIFA 4N6OB 3MG1A 1GY7A 4OUQA 1DMQA 4LZIA 2MF7A 4K61A 3RGRA 4O8SA 1TU5A 2W03A 5IG0A 5AYRB 1WMOA 3CXC2 3K7CA 5I97A 1LNHA 2W0QA 1UW1A 4KZ1A 4I4KA 4MJDA 3QRDA 2P05A 1STDA 3CMA3 1IVXA 1W00A 1OF5B 1U5OA 3EX9A 1SJWA 1NO3A 3DGNA 1SIIA 4H3UA 4HVNA 4MMYB 3X3YA 1CYVA 1IK3A 2CK3H 3H51A 1ISKA 1DVDA 2SBLA 5IENA 4R9KA 1JB4A 3HIIA 3WOFB 1GYBA 3MKIA 1VQL3 1IDPA 1YGEA 1D6ZA 2OTL3 3LZAA 2O3OA 2JQ5A 4N6LA 3D3LA 1F8NA 3SX1A 2GU3A 1UI7A 3WMDA 1JJ22 1JV2B 3S28A 2RGQA 2FXTA 3EB8A 1G96A 1NDOB 1GY5A 4ORLA 3FCSB 3VSYA 3WODG 2XEPA 3K0ZA 2ML6A 3LH4A 4LEHA 4BTXA 2LQVA 1J2BA 1IVVA 4U13A 1WMPA 2F99A 1IT8A 1KD14 2BNGA 4J9AA 1A67A 2E2VA 3EN1B 5CK6A 1W7CA 3S27A 3FG3A 2CFKA 1IQXA 4HBRA 4R4KA 2Z77A 5TGNA 3EC9A 2HMMB 3K5TA 4KFEA 2XR8B 5KP4A 1KWIA 2P38A 5BVBA 2FNQA 1RKYA 1RRHA 2BO9B 5DRVA 3WA2X 4IT7A 3T8NA 3FZWA 5KP1A 3LYGA 4K1UA 2F98A 3EBYA 1K41A 4H61A 4N6V0 1VQ83 1EKMA 3BNBA 5IERA 1IT7A 3RGAA 1K9M4 3PS8A 1W5ZA 4HM6B 4KVHA 4X2OA 1Q864 1EG9B 1OUNA 5AI1A 5AEUB 4O02B 3CCV3 1WTHA 2ML5A 3E99A 1IU7A 1OHSA 3IJEB 3UNLA 1OPYA 2C10A 4AKYA 3FGYA 2JDIH 1W2B2 3ECFA 4LGQA 1LVNA 3DGOA 5AIIA 3NM7A 2WOFA 5BXQA 3NUVA 2W56B 1Q40B 3KSPA 3NV0B 2STDA 4HYZA 3KKGA 1UUVB 5IG4A 1SPUA 3F8XA 2FGTA 3DXOA 4XDVA 3CD63 4L8OA 3OW22 1BUQA 2INXA 4HM8B 4ZM8A 3WDGB 5G2GA 3CME3 5AIHA 4FMBA 3DY5A 3CCE3 3FLJA 2RCDA 4R9LA 1IQ8A 1EA2A 1JKGB 1WQLB 1GD3A 2WGQA 3HI7A 4CCVA 2HMLB 3LMLA 2CW9A 2CG1A 3GZXB 2UX0A 1W6YA 1GY6A 1K28A 4LSOA 3OWYA 4IIAA 4EBGA 2P0XA 2K0MA 4Q53A 4TX4A 2IUJA 2RSXA 1ASKA 4AEQA 5DREA 3LT8A 4XBYA 5IEOA 3Q1CA 2OOVC 2YFIB 4OK0A 3BLZA 3OWSA 1TUHA 3KIIA 1MNLA 4EV5A 5IG3A 1E97A 1N8QA 1OGZA 3NBRA 2L4VA 3NHXA 4HM4B 2OQEC 3ALAA 1KSIA 3Q2PA 3FH1A 3MYTA 1YJ93 3SOAA 3ER7A 2HMNB 3CNXA 3V99A 4HM1B 1GD4A 3FF0A 1YJW3 1RJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUP A;  3CPO A;  2BMO B;  4XM4 A;  3EN8 A;  3EQQ B;  1OF5 A;  3BB9 A;  2GBW B;  5HGR A;  4XBT A;  2HMO B;  3SED A;  4CDL A;  5IF6 A;  3NM2 A;  1OHO A;  2YFL B;  4HJL B;  5FW5 A;  3G16 A;  1OH0 A;  2A15 A;  1Z1S A;  2GEY A;  3JUM A;  3MSO A;  4WWU C;  1NWW A;  3GRD A;  5CXO A;  3ROB A;  3F8H A;  1C7H A;  3D9R A;  3NXJ A;  1ULJ B;  2QGU A;  4WYK B;  4HM7 B;  4OVM A;  1OHP A;  1JN5 B;  3B4P A;  3OV4 A;  3G0K A;  3M8C A;  4HKV B;  4K1V A;  5EVH A;  4L8P A;  3GZR A;  4L7K A;  4FCJ A;  5JPU A;  3A76 A;  1ZX2 A;  1CQS A;  3FSD A;  3S5C A;  2GEX A;  3MG3 A;  3T8U A;  4XBX A;  1GS3 A;  2HMJ B;  1Q40 A;  3NV0 A;  2RFR A;  5D82 A;  3OX9 A;  3B4O A;  5D81 A;  1JKG A;  2HMK B;  4J8T A;  6STD A;  4HM3 B;  3F7X A;  3EJV A;  3B7C A;  2GXF A;  3H3H A;  4RZM A;  5CLK A;  3IPT A;  1QMA A;  5STD A;  1VZZ A;  3EF8 A;  3OWU A;  4XDW A;  2CHC A;  3DZL A;  1E3R A;  1E3V A;  3OXA A;  1A2K A;  2IMJ A;  3SOY A;  3STD A;  1S5A A;  1TP6 A;  3F9S A;  1JB2 A;  1DMN A;  1OGX A;  3DMC A;  5AEW B;  1NU3 A;  1JB5 A;  1O7G B;  3FF2 A;  3CU3 A;  3JUQ A;  3JUO A;  3MG2 A;  4FCM A;  2XSO B;  1O7M B;  3GZB A;  1O7P B;  3VGN A;  2BMR B;  1DMM A;  3B8L A;  2K54 A;  2OWP A;  4X2H A;  4STD A;  3F7S A;  3GWR A;  5CF2 A;  2Z7A A;  4GB5 A;  4LMI A;  5AIG A;  2YFJ B;  3HX8 A;  5D83 A;  2GBX B;  1Q42 A;  2B24 B;  3MHE A;  1O7H B;  3KE7 A;  5IG5 A;  3KZT A;  1W01 A;  2R4I A;  2I9W A;  4R1K A;  3G8Z A;  2B1X B;  3I0Y A;  2XSH B;  2Z76 A;  4WYK A;  1O7W B;  4HM2 B;  2QIY A;  4HZB B;  3F40 A;  1JN5 A;  1AR0 A;  3UJM A;  3DUK A;  1UUW B;  2XRX B;  5JPP A;  2F86 B;  5KP3 A;  3Q90 A;  3HK4 A;  1O7N B;  1ZO2 A;  1HKX A;  1QJG A;  4HM5 B;  3EBT A;  4PEJ A;  3GZY B;  3JUN A;  3HZP A;  3EHC A;  4HZ9 B;  2PZV A;  3FKA A;  1ULI B;  2W2C A;  8CHO A;  2CKF B;  4N3V A;  3DM8 A;  2BMQ B;  5IEP A;  4HM0 B;  5CF1 A;  4XB5 A;  1OCV A;  1W02 A;  3CNM A;  3F14 A;  7STD A;  4WP5 A;  5AIF A;  3MG1 A;  1GY7 A;  4OUQ A;  1DMQ A;  3RGR A;  5IG0 A;  3K7C A;  4I4K A;  4MJD A;  1STD A;  1W00 A;  1OF5 B;  1U5O A;  3EX9 A;  1SJW A;  4H3U A;  4HVN A;  1ISK A;  3H51 A;  5IEN A;  4R9K A;  1JB4 A;  1GYB A;  3MKI A;  1IDP A;  3LZA A;  2JQ5 A;  3WMD A;  2RGQ A;  1NDO B;  3VSY A;  1GY5 A;  4ORL A;  3K0Z A;  4LEH A;  4U13 A;  2F99 A;  2BNG A;  4J9A A;  3EN1 B;  5CK6 A;  2Z77 A;  5TGN A;  3EC9 A;  2HMM B;  2XR8 B;  5KP4 A;  5BVB A;  5DRV A;  3T8N A;  3FZW A;  5KP1 A;  3LYG A;  4K1U A;  2F98 A;  3EBY A;  1K41 A;  5IER A;  3RGA A;  4HM6 B;  4KVH A;  4X2O A;  1EG9 B;  1OUN A;  5AI1 A;  5AEU B;  3E99 A;  1OHS A;  3UNL A;  1OPY A;  3FGY A;  3ECF A;  4LGQ A;  5AII A;  5BXQ A;  3NUV A;  1Q40 B;  3KSP A;  3NV0 B;  2STD A;  3KKG A;  1UUV B;  5IG4 A;  3F8X A;  3DXO A;  4XDV A;  4L8O A;  1BUQ A;  2INX A;  4HM8 B;  5G2G A;  5AIH A;  3FLJ A;  2RCD A;  4R9L A;  1JKG B;  1EA2 A;  1WQL B;  2HML B;  3GZX B;  2UX0 A;  1W6Y A;  1GY6 A;  3OWY A;  4IIA A;  4Q53 A;  1ASK A;  5DRE A;  4XBY A;  5IEO A;  2YFI B;  3BLZ A;  3OWS A;  1TUH A;  5IG3 A;  1E97 A;  1OGZ A;  3NBR A;  3NHX A;  4HM4 B;  3FH1 A;  3MYT A;  3SOA A;  3ER7 A;  2HMN B;  3CNX A;  4HM1 B;  3FF0 A; 
#chains in the Genus database with same CATH topology
 3JUP A;  3LTA A;  3DGY A;  3I55 3;  4WHA A;  3CPO A;  1BU4 A;  4CJN A;  2CWV A;  1BRG A;  2BMO B;  4XM4 A;  1DYU A;  1V57 A;  1N9J A;  1YIJ 3;  2O9U X;  1AVL A;  5G1K A;  3LTC A;  3EN8 A;  3EQQ B;  1OF5 A;  1RGA A;  3AMO B;  3BB9 A;  5M1A A;  3U1W A;  2GBW B;  5RNT A;  2WGO A;  1X1X A;  5HGR A;  1RHL A;  2BT3 A;  2HMO B;  2GU1 A;  4XBT A;  2QEX 3;  1TFK A;  3UL6 A;  5M19 A;  2IY2 A;  1QAK A;  3SED A;  3BNE A;  4CDL A;  4RBN A;  5IF6 A;  1FA3 A;  2XF3 A;  3CC4 3;  3FG1 A;  3NM2 A;  1BNR A;  2BIR A;  4EXR A;  3MPH A;  1GOU A;  1YJN 3;  1VQ7 3;  2AAD A;  4N6M A;  1IV9 A;  4RNZ A;  1BVI A;  1B2Z A;  3U97 A;  1VQO 3;  4KT3 B;  2OTJ 3;  2Q07 A;  1OHO A;  2CC3 A;  2YFL B;  4HJL B;  5FW5 A;  3G16 A;  1V58 A;  2MC8 A;  1OH0 A;  3WA3 A;  4KFF A;  1JZD A;  1IQY A;  2A15 A;  3K9M C;  4BTY A;  1R4Y A;  1I2E A;  2IA7 A;  4ILF A;  1Z1S A;  3UB1 A;  1RGF A;  3GSP A;  2GEY A;  3JUM A;  3MSO A;  3DGM A;  3Q3F A;  2OCT A;  4FMA A;  1ROA A;  4CPK A;  3CPW 2;  3WOE B;  1KC8 4;  1W6G A;  2RBI A;  4EV2 A;  2H0H A;  4WWU C;  1GSP A;  1NWW A;  3CCL 3;  3GRD A;  2CX1 A;  1GOV A;  3G6E 3;  1D6Y A;  1US1 A;  1K73 4;  5CXO A;  2XFT A;  4O3V A;  3ROB A;  2QA4 3;  3F8H A;  1A90 A;  1STF I;  1C7H A;  1MWT A;  3D9R A;  3NXJ A;  3KFQ C;  1ULJ B;  1WMN A;  2L1S A;  2QGU A;  3NX0 A;  1G02 A;  3SLU A;  4WYK B;  2IUK A;  3L0R A;  1M90 4;  2SAR A;  1I8V A;  2D42 A;  1RRL A;  9RNT A;  2CWT A;  4HM7 B;  4OVM A;  1QAF A;  1TFO A;  4J5K A;  3HIG A;  1U8C B;  1OHP A;  1JN5 B;  3URP A;  2CX0 A;  3B4P A;  3CCS 3;  3OV4 A;  2E2T A;  3FG4 A;  3G0K A;  1V74 A;  1LOW A;  3M8C A;  4KFD A;  4HKV B;  1A2V A;  1PYL A;  3KSE D;  3WHO A;  3X40 A;  3CC7 3;  4K1V A;  3V98 A;  5EVH A;  2KRT A;  3BNC A;  4L8P A;  3GZR A;  4L7K A;  4EW5 A;  1MGW A;  2M7O A;  4FCJ A;  2XGL A;  3A76 A;  1ZX2 A;  5JPU A;  3LTD A;  1N8R 4;  1CQS A;  1HU9 A;  2V1L A;  4FCZ A;  3FSD A;  1UI8 A;  3SXX A;  5EEO A;  4BL2 A;  1B27 A;  1RSN A;  3S5C A;  1PU4 A;  2ZL8 A;  1VQQ A;  1RGE A;  2GEX A;  2P09 A;  1G0T A;  3SVA A;  3MG3 A;  3T8U A;  2W6J H;  4XBX A;  1GS3 A;  2ZDJ A;  4MMX B;  2HMJ B;  1Q40 A;  2W56 A;  3NV0 A;  3AGO A;  1RDS A;  2CFW A;  2CFG A;  3TDG A;  1CEW I;  1N5P A;  2RFR A;  1YGW A;  3OX9 A;  5D82 A;  3B4O A;  1HYF A;  1LOV A;  5D81 A;  1IVU A;  5ELJ A;  2OOV A;  1GMQ A;  1JKG A;  2HMK B;  1MOL A;  1NB3 I;  4J8T A;  3O8Y A;  6STD A;  4HM3 B;  1BIR A;  3F7X A;  3EJV A;  4N6U A;  3B7C A;  1MGR A;  2GXF A;  3H3H A;  4RZM A;  1CYU A;  4AKZ A;  4MMZ B;  1B2X A;  2OQE A;  5CLK A;  3IPT A;  4FMD A;  4NHF A;  4RNY A;  1RCL A;  4GL6 A;  2WO0 A;  1QMA A;  4NPB A;  5STD A;  3PXM A;  3ZG5 A;  3S29 A;  1VZZ A;  3EF8 A;  1NNV A;  1W4N A;  2C4B A;  1EEJ A;  3V92 A;  3OWU A;  3CCM 3;  4XDW A;  1VQ4 3;  1BAO A;  1BSE A;  2CHC A;  3DZL A;  1E3R A;  2F4Y A;  4NRE A;  1E3V A;  5ELU A;  3UL5 A;  2H0I A;  3D79 A;  1T5Y A;  3OXA A;  2CFL A;  4HAA A;  1RTU A;  1A2K A;  1BRH A;  3PCR A;  3LTB A;  2IMJ A;  3SOY A;  1L5G B;  3STD A;  2BHM A;  1S5A A;  1TP6 A;  1I3I A;  3KN4 A;  3F9S A;  1JB2 A;  2LYX A;  1DMN A;  2CFD A;  5LC6 A;  1VQ5 3;  1SQW A;  1OGX A;  3DMC A;  5AEW B;  1I0V A;  1JB5 A;  1NU3 A;  1PFP A;  1O7G B;  2KCD A;  1BAN A;  1NJI 4;  3FF2 A;  3CU3 A;  3JUQ A;  3JUO A;  3MG2 A;  4FCM A;  2F5M A;  1DE3 A;  5AYS C;  2BU4 A;  3DGL A;  2XSO B;  3X41 A;  4JF8 A;  1O7M B;  3GZB A;  1O7P B;  1OAC A;  2CH9 A;  4BU4 A;  3CCJ 3;  1R4C A;  3CCQ 3;  3VGN A;  4EC6 A;  3AMO A;  3LXU X;  2BMR B;  1DMM A;  1QVF 2;  1BSB A;  1WNH A;  4QWT A;  1MWS A;  1UUG B;  1FUW A;  3B8L A;  1AV4 A;  2K54 A;  1LXE A;  2OWP A;  1IVW A;  1YHQ 3;  1BRS A;  4X2H A;  4STD A;  3F7S A;  1FGO A;  3G71 3;  1Q81 4;  1LOY A;  3GWR A;  2CG0 A;  2W04 A;  5CF2 A;  1GMR A;  2Z7A A;  5A0O B;  4MEI A;  1BGS A;  3HOH A;  4GB5 A;  1W2Z A;  3PZW A;  4LMI A;  5AIG A;  2Y74 A;  1X1U A;  1UCL A;  1JBR A;  4EYC A;  1NB5 I;  1B2M A;  5G1L A;  4DKI A;  1BOX A;  2YFJ B;  3HX8 A;  3LT9 A;  4JRF A;  2AAE A;  2XGN A;  1ZGX A;  3PCS A;  5JBS A;  1MWR A;  5D83 A;  1JNQ A;  2GBX B;  1Q42 A;  1D6U A;  2B24 B;  1QVG 2;  3MHE A;  2XH9 A;  1O7H B;  4WFO A;  3KE7 A;  1YVB I;  5IG5 A;  1VQN 3;  1M9G A;  3IMA B;  3KZT A;  1W01 A;  5HOH A;  4FMC A;  2KAA A;  2R4I A;  2I9W A;  4N6T A;  1T2I A;  4R1K A;  4BL3 A;  1YVS A;  3G8Z A;  2B1X B;  3ZG0 A;  1JBS A;  1I70 A;  2CWU A;  2W9P A;  1JRQ A;  3X42 A;  2E2U A;  1EQK A;  1BRI A;  2P0M A;  3NBB A;  3I0Y A;  3I56 3;  2XSH B;  2Z76 A;  3CCU 3;  4WYK A;  3SYU A;  1VQK 3;  2F56 A;  1W6C A;  1O7W B;  4R80 A;  2KXG A;  4HM2 B;  2QIY A;  3G4S 3;  4HZB B;  3X3Z A;  3F40 A;  1AY7 A;  1VQ9 3;  4N6N B;  1JN5 A;  3D5G A;  3CC2 3;  1K8A 4;  4FR9 A;  1AR0 A;  2D1W A;  2YX9 A;  3NQZ A;  1LRA A;  1RCK A;  4O2H A;  4RNT A;  3S67 A;  3UJM A;  2WOH A;  3NBJ A;  3DUK A;  5BU4 A;  1UUW B;  1N5H A;  2UUG C;  1FW7 A;  1YI2 3;  3JVC A;  2XRX B;  2J8X B;  2KF5 A;  5JPP A;  1TJD A;  1Q82 4;  2F86 B;  1RNB A;  5KP3 A;  3Q90 A;  1KQS 2;  3HK4 A;  3VF1 A;  1TIJ A;  1DVC A;  1ROV A;  1O7N B;  1X1W A;  2W9Q A;  1AQZ A;  4BTW A;  3LOY A;  2Y73 A;  1ZO2 A;  2PNC A;  1HKX A;  1QJG A;  4HM5 B;  3X3X A;  5BIR A;  1FGT A;  3CCR 3;  1VQM 3;  1Y4K A;  1TTO A;  4G1M B;  1BSA A;  1FYS A;  1RN7 A;  2GSP A;  3EBT A;  2C11 A;  2R41 A;  3K63 A;  4PEJ A;  3GZY B;  3JUN A;  1PY3 A;  3HZP A;  3PYJ A;  4AKY A;  3RDE A;  3EHC A;  4HZ9 B;  2PZV A;  3FKA A;  1ULI B;  1YIT 3;  2W2C A;  1Q7Y 4;  8CHO A;  2XFS A;  3N54 B;  3PGB A;  6RNT A;  1VQP 3;  1SIH A;  1BRK A;  2CKF B;  5FGO A;  1FGQ A;  3NQY A;  1ZS7 A;  4N3V A;  1BUJ A;  3DM8 A;  3N9H A;  3EE1 A;  4K90 B;  3BND A;  2BMQ B;  2Z6B A;  4GSP A;  1QAL A;  4HM0 B;  4IPB A;  5IEP A;  5CF1 A;  1S72 3;  1B2S A;  3T0U A;  1BNS A;  3GAX A;  5IW9 A;  4XB5 A;  1RGG A;  1OCV A;  1W02 A;  3CNM A;  3QK9 A;  5EQL A;  1N9E A;  1AVK A;  1RGK A;  1UCI A;  3MWZ A;  2CIU A;  3F14 A;  1M1K 4;  2ZHX B;  1M1X B;  1FGR A;  5LC7 A;  7STD A;  1FGM A;  1IV7 A;  4WP5 A;  1LOX A;  1VQ6 3;  3N8B A;  5AIF A;  4N6O B;  1Q7H A;  3MG1 A;  1GY7 A;  4OUQ A;  1DMQ A;  1BRJ A;  2MF7 A;  1I0X A;  4K61 A;  4LZI A;  3RGR A;  4O8S A;  7GSP A;  1RN4 A;  3D5I A;  1TU5 A;  2W03 A;  5IG0 A;  5AYR B;  1WMO A;  3CXC 2;  3K7C A;  5I97 A;  1LNH A;  1BNF A;  2W0Q A;  1UGI A;  1UW1 A;  4KZ1 A;  4I4K A;  2KF3 A;  4J5G A;  2HOH A;  4MJD A;  3QRD A;  2P05 A;  1STD A;  3CMA 3;  1BNJ A;  1IVX A;  1W00 A;  3ZFZ A;  1OF5 B;  1UCJ A;  1U5O A;  4BIR A;  3EX9 A;  1RGH A;  1SJW A;  1NO3 A;  3DGN A;  1SII A;  4H3U A;  4HVN A;  1B20 A;  4MMY B;  1EUI C;  3X3Y A;  1CYV A;  1IK3 A;  2CK3 H;  3H51 A;  1ISK A;  1DVD A;  1FZU A;  2SBL A;  5IEN A;  4R9K A;  1JB4 A;  3HII A;  3WOF B;  1GYB A;  3MKI A;  1HZ1 A;  1IDP A;  1VQL 3;  3KCH A;  8RNT A;  5GSP A;  1BNE A;  3RNT A;  1GMP A;  1YGE A;  1D6Z A;  2OTL 3;  1X1Y A;  3LZA A;  2O3O A;  2JQ5 A;  4N6L A;  1YNV X;  3D3L A;  1F8N A;  3SX1 A;  2GU3 A;  1UI7 A;  3WMD A;  1JJ2 2;  1JV2 B;  1Q9E A;  1BNI A;  3S28 A;  2RGQ A;  2FXT A;  3EB8 A;  1G96 A;  1NDO B;  1GY5 A;  4ORL A;  3FCS B;  3VSY A;  3WOD G;  5M18 A;  1A2P A;  1GOY A;  2XEP A;  1LNI A;  3K0Z A;  2IYJ A;  2ML6 A;  3LH4 A;  4LEH A;  4BTX A;  2LQV A;  1J2B A;  1IVV A;  4U13 A;  1WMP A;  2F99 A;  1IT8 A;  1KD1 4;  1RMS A;  2BNG A;  4J9A A;  4LYL B;  1A67 A;  2E2V A;  3EN1 B;  5CK6 A;  1W7C A;  3S27 A;  3FG3 A;  3DH2 A;  1SAR A;  2CFK A;  1IQX A;  4HBR A;  1FUS A;  4R4K A;  3A5E A;  3BIR A;  2Z77 A;  3WR2 A;  5TGN A;  3EC9 A;  2HMM B;  3K5T A;  4KFE A;  1B2U A;  2XR8 B;  5KP4 A;  1KWI A;  2P38 A;  5BVB A;  2FNQ A;  1C54 A;  1RKY A;  1RRH A;  1TRP A;  2BO9 B;  5DRV A;  3WA2 X;  4IT7 A;  1TRQ A;  3T8N A;  1I2G A;  3FZW A;  5KP1 A;  4HOH A;  3LYG A;  4K1U A;  2F98 A;  3EBY A;  1K41 A;  4H61 A;  4N6V 0;  1BSD A;  1VQ8 3;  2KF4 A;  1EKM A;  3BNB A;  5IER A;  1IT7 A;  2ZA4 A;  3RGA A;  1K9M 4;  3PS8 A;  1DET A;  1W5Z A;  4HM6 B;  1BSC A;  4KVH A;  3D4A A;  4X2O A;  1Q86 4;  1B21 A;  1JBT A;  1EG9 B;  1OUN A;  5AI1 A;  5AEU B;  4O02 B;  1LQM B;  3CCV 3;  1WTH A;  2ML5 A;  1UDI I;  3E99 A;  1IU7 A;  1CH0 A;  1OHS A;  1T3B A;  1OPY A;  2C10 A;  3IJE B;  3FGY A;  2K3D A;  4GHO A;  2JDI H;  3UNL A;  3ECF A;  4LGQ A;  1W2B 2;  1LVN A;  1B3S A;  3AGN A;  1I3F A;  3DGO A;  1LQG C;  3NM7 A;  5AII A;  2UGI A;  2WOF A;  5BXQ A;  3NUV A;  1Q40 B;  2W56 B;  3KSP A;  3NV0 B;  2STD A;  4HYZ A;  3KKG A;  1UUV B;  6GSP A;  1SPU A;  3F8X A;  1I2F A;  2FGT A;  3DXO A;  4XDV A;  5IG4 A;  3CD6 3;  3BU4 A;  4L8O A;  3OW2 2;  1BUQ A;  2INX A;  4I5Q A;  4HM8 B;  1MWU A;  1RN1 A;  4ZM8 A;  1RGL A;  1RNT A;  3WDG B;  5G2G A;  3CME 3;  1BNG A;  5AIH A;  4FMB A;  3DY5 A;  3CCE 3;  3FLJ A;  2RCD A;  2RNT A;  4R9L A;  1IQ8 A;  1EA2 A;  1JKG B;  1WQL B;  1GD3 A;  2WGQ A;  3HI7 A;  1IYY A;  4CCV A;  2HML B;  1RGC A;  1FUT A;  3LML A;  1UGH I;  2CW9 A;  3AHS A;  2CG1 A;  3GZX B;  7RNT A;  2UX0 A;  1W6Y A;  1GY6 A;  1K28 A;  4LSO A;  3OWY A;  4IIA A;  4EBG A;  2P0X A;  2K0M A;  4Q53 A;  4TX4 A;  2IUJ A;  2RSX A;  1ASK A;  4AEQ A;  5DRE A;  3LT8 A;  4XBY A;  5IEO A;  3Q1C A;  1BRN L;  2OOV C;  2YFI B;  4OK0 A;  3BLZ A;  3OWS A;  1TUH A;  3KII A;  1MNL A;  4EV5 A;  5IG3 A;  1UCK A;  1E97 A;  1N8Q A;  1OGZ A;  2H0G A;  3NBR A;  3J7Y d;  2L4V A;  3NHX A;  4HM4 B;  2OQE C;  1JZO A;  3AHW A;  2F5W A;  3ALA A;  1KSI A;  2KF6 A;  3Q2P A;  3FH1 A;  3MYT A;  1YJ9 3;  3SOA A;  3ER7 A;  1T2H A;  2HMN B;  3CNX A;  3V99 A;  4HM1 B;  1GD4 A;  3FF0 A;  1YJW 3;  1RJO A;  1RLS A; 
#chains in the Genus database with same CATH homology
 3JUP A;  3LTA A;  3I55 3;  4WHA A;  3CPO A;  2CWV A;  2BMO B;  4XM4 A;  1DYU A;  1YIJ 3;  1N9J A;  2O9U X;  1AVL A;  3LTC A;  3EN8 A;  3EQQ B;  1OF5 A;  3AMO B;  3BB9 A;  3U1W A;  2GBW B;  2WGO A;  5HGR A;  2BT3 A;  4XBT A;  2HMO B;  2GU1 A;  2QEX 3;  1TFK A;  3UL6 A;  3SED A;  1QAK A;  3BNE A;  4CDL A;  4RBN A;  5IF6 A;  1FA3 A;  2XF3 A;  3CC4 3;  3FG1 A;  3NM2 A;  4EXR A;  3MPH A;  1YJN 3;  1VQ7 3;  4N6M A;  1IV9 A;  4RNZ A;  3U97 A;  1VQO 3;  2OTJ 3;  2Q07 A;  1OHO A;  2CC3 A;  2YFL B;  4HJL B;  5FW5 A;  3G16 A;  2MC8 A;  1OH0 A;  3WA3 A;  4KFF A;  1IQY A;  2A15 A;  3K9M C;  4BTY A;  2IA7 A;  1Z1S A;  3UB1 A;  2GEY A;  3JUM A;  3MSO A;  3DGM A;  4FMA A;  2OCT A;  3CPW 2;  1ROA A;  1KC8 4;  3WOE B;  1W6G A;  4EV2 A;  4WWU C;  1NWW A;  3CCL 3;  3GRD A;  3G6E 3;  1D6Y A;  1US1 A;  1K73 4;  5CXO A;  2XFT A;  4O3V A;  3ROB A;  2QA4 3;  3F8H A;  1A90 A;  1STF I;  1C7H A;  3D9R A;  3NXJ A;  3KFQ C;  1ULJ B;  1WMN A;  2QGU A;  3NX0 A;  3SLU A;  4WYK B;  2IUK A;  3L0R A;  1M90 4;  2D42 A;  1RRL A;  2CWT A;  4HM7 B;  4OVM A;  1QAF A;  1TFO A;  3HIG A;  1U8C B;  1OHP A;  1JN5 B;  3B4P A;  3CCS 3;  3OV4 A;  2E2T A;  3FG4 A;  3G0K A;  1V74 A;  3M8C A;  4KFD A;  4HKV B;  1A2V A;  3KSE D;  3X40 A;  3CC7 3;  4K1V A;  3V98 A;  5EVH A;  2KRT A;  3BNC A;  4L8P A;  3GZR A;  4L7K A;  2M7O A;  4FCJ A;  2XGL A;  3A76 A;  1ZX2 A;  5JPU A;  3LTD A;  1N8R 4;  1CQS A;  1HU9 A;  2V1L A;  4FCZ A;  3FSD A;  1UI8 A;  3SXX A;  5EEO A;  3S5C A;  1PU4 A;  2ZL8 A;  2GEX A;  2P09 A;  3SVA A;  3MG3 A;  3T8U A;  2W6J H;  4XBX A;  1GS3 A;  2ZDJ A;  4MMX B;  2HMJ B;  1Q40 A;  2W56 A;  3NV0 A;  2CFW A;  2CFG A;  3TDG A;  1CEW I;  1N5P A;  2RFR A;  5D82 A;  3OX9 A;  3B4O A;  5D81 A;  1IVU A;  5ELJ A;  2OOV A;  1JKG A;  2HMK B;  1MOL A;  1NB3 I;  4J8T A;  3O8Y A;  6STD A;  4HM3 B;  3F7X A;  3EJV A;  4N6U A;  3B7C A;  2GXF A;  3H3H A;  4RZM A;  1CYU A;  4AKZ A;  4MMZ B;  2OQE A;  5CLK A;  3IPT A;  4FMD A;  4NHF A;  4RNY A;  4GL6 A;  2WO0 A;  1QMA A;  5STD A;  3PXM A;  3S29 A;  1VZZ A;  3EF8 A;  1W4N A;  3V92 A;  3OWU A;  3CCM 3;  4XDW A;  1VQ4 3;  2CHC A;  3DZL A;  1E3R A;  4NRE A;  1E3V A;  5ELU A;  3UL5 A;  1T5Y A;  3OXA A;  2CFL A;  1A2K A;  3PCR A;  3LTB A;  2IMJ A;  3SOY A;  1L5G B;  3STD A;  2BHM A;  1S5A A;  1TP6 A;  3KN4 A;  3F9S A;  1JB2 A;  2LYX A;  1DMN A;  2CFD A;  5LC6 A;  1VQ5 3;  1SQW A;  1OGX A;  3DMC A;  5AEW B;  1NU3 A;  1JB5 A;  2KCD A;  1PFP A;  1O7G B;  1NJI 4;  3FF2 A;  3CU3 A;  3JUQ A;  3JUO A;  3MG2 A;  4FCM A;  5AYS C;  3DGL A;  2XSO B;  3X41 A;  4JF8 A;  1O7M B;  3GZB A;  1O7P B;  1OAC A;  2CH9 A;  3CCJ 3;  1R4C A;  3CCQ 3;  3VGN A;  4EC6 A;  3AMO A;  3LXU X;  2BMR B;  1DMM A;  1QVF 2;  1WNH A;  4QWT A;  1FUW A;  3B8L A;  1AV4 A;  2K54 A;  1LXE A;  2OWP A;  1IVW A;  1YHQ 3;  1Q81 4;  4X2H A;  4STD A;  3F7S A;  1FGO A;  3G71 3;  3GWR A;  2CG0 A;  2W04 A;  5CF2 A;  2Z7A A;  5A0O B;  4MEI A;  4GB5 A;  4LMI A;  1W2Z A;  3PZW A;  5AIG A;  2Y74 A;  4EYC A;  1NB5 I;  2YFJ B;  3HX8 A;  3LT9 A;  4JRF A;  2XGN A;  3PCS A;  5JBS A;  5D83 A;  1JNQ A;  2GBX B;  1Q42 A;  1D6U A;  2B24 B;  1QVG 2;  3MHE A;  2XH9 A;  1O7H B;  4WFO A;  3KE7 A;  1YVB I;  5IG5 A;  1VQN 3;  1M9G A;  3IMA B;  3KZT A;  1W01 A;  4FMC A;  4N6T A;  2R4I A;  2I9W A;  4R1K A;  3G8Z A;  2B1X B;  2CWU A;  2W9P A;  1JRQ A;  3X42 A;  2E2U A;  1EQK A;  2P0M A;  3NBB A;  3I0Y A;  3I56 3;  2XSH B;  2Z76 A;  3CCU 3;  4WYK A;  1VQK 3;  1W6C A;  1O7W B;  4R80 A;  2KXG A;  4HM2 B;  2QIY A;  3G4S 3;  4HZB B;  3X3Z A;  3F40 A;  1VQ9 3;  4N6N B;  1JN5 A;  3CC2 3;  1K8A 4;  4FR9 A;  1AR0 A;  2D1W A;  2YX9 A;  3NQZ A;  4O2H A;  3UJM A;  3J7Y d;  3S67 A;  2WOH A;  3NBJ A;  3DUK A;  1UUW B;  1N5H A;  1YI2 3;  3JVC A;  2XRX B;  5JPP A;  1Q82 4;  2F86 B;  5KP3 A;  3Q90 A;  1KQS 2;  3HK4 A;  3VF1 A;  1TIJ A;  1DVC A;  1ROV A;  1O7N B;  2W9Q A;  4BTW A;  3LOY A;  2Y73 A;  1ZO2 A;  2PNC A;  1HKX A;  1QJG A;  4HM5 B;  3X3X A;  3CCR 3;  1FGT A;  1VQM 3;  1Y4K A;  4G1M B;  1RN7 A;  3K63 A;  3EBT A;  2C11 A;  4PEJ A;  3GZY B;  3JUN A;  3HZP A;  3PYJ A;  3RDE A;  3EHC A;  4HZ9 B;  2PZV A;  3FKA A;  1ULI B;  1YIT 3;  2W2C A;  1Q7Y 4;  8CHO A;  2XFS A;  3N54 B;  3PGB A;  1VQP 3;  1SIH A;  2CKF B;  5FGO A;  1FGQ A;  3NQY A;  4N3V A;  3DM8 A;  3N9H A;  3EE1 A;  4K90 B;  3BND A;  2BMQ B;  2Z6B A;  5IEP A;  1QAL A;  4HM0 B;  4IPB A;  1S72 3;  5CF1 A;  3T0U A;  3GAX A;  5IW9 A;  4XB5 A;  1OCV A;  1W02 A;  3CNM A;  3QK9 A;  5EQL A;  1N9E A;  1AVK A;  3MWZ A;  2CIU A;  3F14 A;  1M1K 4;  1M1X B;  1FGR A;  5LC7 A;  7STD A;  1FGM A;  1IV7 A;  4WP5 A;  1LOX A;  1VQ6 3;  3N8B A;  5AIF A;  4N6O B;  3MG1 A;  1GY7 A;  4OUQ A;  1DMQ A;  4LZI A;  2MF7 A;  4K61 A;  3RGR A;  4O8S A;  1TU5 A;  2W03 A;  5IG0 A;  5AYR B;  1WMO A;  3CXC 2;  3K7C A;  5I97 A;  1LNH A;  2W0Q A;  1UW1 A;  4KZ1 A;  4I4K A;  4MJD A;  3QRD A;  2P05 A;  1STD A;  3CMA 3;  1IVX A;  1W00 A;  1OF5 B;  1U5O A;  3EX9 A;  1SJW A;  1NO3 A;  3DGN A;  1SII A;  4H3U A;  4HVN A;  4MMY B;  3X3Y A;  1CYV A;  1IK3 A;  2CK3 H;  3H51 A;  1ISK A;  1DVD A;  2SBL A;  5IEN A;  4R9K A;  1JB4 A;  3HII A;  3WOF B;  1GYB A;  3MKI A;  1VQL 3;  1IDP A;  1YGE A;  1D6Z A;  2OTL 3;  3LZA A;  2O3O A;  2JQ5 A;  4N6L A;  3D3L A;  1F8N A;  3SX1 A;  2GU3 A;  1UI7 A;  3WMD A;  1JJ2 2;  1JV2 B;  3S28 A;  2RGQ A;  2FXT A;  3EB8 A;  1G96 A;  1NDO B;  1GY5 A;  4ORL A;  3FCS B;  3VSY A;  3WOD G;  2XEP A;  3K0Z A;  2ML6 A;  3LH4 A;  4LEH A;  4BTX A;  2LQV A;  1J2B A;  1IVV A;  4U13 A;  1WMP A;  2F99 A;  1IT8 A;  1KD1 4;  2BNG A;  4J9A A;  1A67 A;  2E2V A;  3EN1 B;  5CK6 A;  1W7C A;  3S27 A;  3FG3 A;  2CFK A;  1IQX A;  4HBR A;  4R4K A;  2Z77 A;  5TGN A;  3EC9 A;  2HMM B;  3K5T A;  4KFE A;  2XR8 B;  5KP4 A;  1KWI A;  2P38 A;  5BVB A;  2FNQ A;  1RKY A;  1RRH A;  2BO9 B;  5DRV A;  3WA2 X;  4IT7 A;  3T8N A;  3FZW A;  5KP1 A;  3LYG A;  4K1U A;  2F98 A;  3EBY A;  1K41 A;  4H61 A;  4N6V 0;  1VQ8 3;  1EKM A;  3BNB A;  5IER A;  1IT7 A;  3RGA A;  1K9M 4;  3PS8 A;  1W5Z A;  4HM6 B;  4KVH A;  4X2O A;  1Q86 4;  1EG9 B;  1OUN A;  5AI1 A;  5AEU B;  4O02 B;  3CCV 3;  1WTH A;  2ML5 A;  3E99 A;  1IU7 A;  1OHS A;  3IJE B;  3UNL A;  1OPY A;  2C10 A;  4AKY A;  3FGY A;  2JDI H;  1W2B 2;  3ECF A;  4LGQ A;  1LVN A;  3DGO A;  5AII A;  3NM7 A;  2WOF A;  5BXQ A;  3NUV A;  2W56 B;  1Q40 B;  3KSP A;  3NV0 B;  2STD A;  4HYZ A;  3KKG A;  1UUV B;  5IG4 A;  1SPU A;  3F8X A;  2FGT A;  3DXO A;  4XDV A;  3CD6 3;  4L8O A;  3OW2 2;  1BUQ A;  2INX A;  4HM8 B;  4ZM8 A;  3WDG B;  5G2G A;  3CME 3;  5AIH A;  4FMB A;  3DY5 A;  3CCE 3;  3FLJ A;  2RCD A;  4R9L A;  1IQ8 A;  1EA2 A;  1JKG B;  1WQL B;  1GD3 A;  2WGQ A;  3HI7 A;  4CCV A;  2HML B;  3LML A;  2CW9 A;  2CG1 A;  3GZX B;  2UX0 A;  1W6Y A;  1GY6 A;  1K28 A;  4LSO A;  3OWY A;  4IIA A;  4EBG A;  2P0X A;  2K0M A;  4Q53 A;  4TX4 A;  2IUJ A;  2RSX A;  1ASK A;  4AEQ A;  5DRE A;  3LT8 A;  4XBY A;  5IEO A;  3Q1C A;  2OOV C;  2YFI B;  4OK0 A;  3BLZ A;  3OWS A;  1TUH A;  3KII A;  1MNL A;  4EV5 A;  5IG3 A;  1E97 A;  1N8Q A;  1OGZ A;  3NBR A;  2L4V A;  3NHX A;  4HM4 B;  2OQE C;  3ALA A;  1KSI A;  3Q2P A;  3FH1 A;  3MYT A;  1YJ9 3;  3SOA A;  3ER7 A;  2HMN B;  3CNX A;  3V99 A;  4HM1 B;  1GD4 A;  3FF0 A;  1YJW 3;  1RJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...