2INXA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 2,6-difluorophenol
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
123
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid delta-isomerase
publication title Testing geometrical discrimination within an enzyme active site: constrained hydrogen bonding in the ketosteroid isomerase oxyanion hole.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 31
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2inxA00
4IIAA 1DMMA 3LZAA 5TGNA 3EF8A 1O7MB 2XR8B 3FSDA 4N3VA 4XBYA 5JPUA 5IERA 1OF5A 2Z7AA 1O7GB 3OWSA 3UNLA 3K0ZA 1W6YA 5IENA 1JKGB 1NWWA 4OVMA 1O7NB 3B8LA 2RGQA 3SOAA 2HMKB 3T8NA 3SEDA 4XBXA 3CNMA 3G16A 4HJLB 5JPPA 3FZWA 1O7HB 1OGXA 4WYKA 5KP4A 3HX8A 4ORLA 2IMJA 2HMOB 5IEPA 1Q42A 2B1XB 1NDOB 2YFJB 3JUPA 4RZMA 2W2CA 3JUMA 3LYGA 3NUVA 5AIIA 4HM2B 4L8OA 4XDWA 2BMQB 4HM5B 1OH0A 1QMAA 4X2OA 5HGRA 5CXOA 2CKFB 1GY6A 2YFIB 3DXOA 3H3HA 2F98A 5AIGA 2BMRB 4HZBB 5BVBA 3KKGA 4R1KA 3GZXB 1IDPA 2XSHB 2R4IA 4WWUC 5DRVA 1GY5A 3GRDA 1S5AA 3G0KA 1Q40B 5KP1A 3F8HA 3B7CA 5BXQA 4HM0B 3EQQB 1OHPA 1ZX2A 5DREA 3F8XA 3F7XA 3S5CA 3H51A 3ROBA 4MJDA 1GS3A 1VZZA 4LGQA 1SJWA 5AEUB 3IPTA 3EBTA 1OUNA 5AI1A 3Q90A 4XBTA 1BUQA 3OX9A 1ISKA 3EX9A 3NXJA 5CF2A 3ECFA 3OWUA 5IF6A 3F14A 3F40A 4HM8B 4XB5A 7STDA 4K1UA 3K7CA 3FLJA 2HMNB 4CDLA 2Z76A 2RFRA 5KP3A 1GY7A 3OV4A 4J8TA 2STDA 1O7WB 3E99A 4R9LA 2B24B 4FCJA 3FF0A 5G2GA 6STDA 2A15A 1OF5B 2HMMB 3BB9A 3EC9A 3SOYA 5IG3A 3F7SA 3MG1A 2XSOB 3FKAA 2F86B 1K41A 1ULJB 1TP6A 1ASKA 1JB2A 4WYKB 3GZRA 3GZYB 1JN5A 3CNXA 1TUHA 4HM6B 1CQSA 1NU3A 2HMJB 3KE7A 3KSPA 2GBXB 3GWRA 4U13A 2GEXA 3RGRA 3KZTA 1Z1SA 3FF2A 1C7HA 1E3VA 4XM4A 4HM1B 1JN5B 4L8PA 2BNGA 3BLZA 5AEWB 1OGZA 5STDA 3T8UA 3EN8A 3RGAA 2GBWB 5D83A 1U5OA 1A2KA 8CHOA 4OUQA 5FW5A 4HM4B 3CU3A 3GZBA 5D82A 1OHOA 4HM3B 4LMIA 1UUWB 3NV0A 4H3UA 1W02A 3G8ZA 2YFLB 2I9WA 3MG2A 1OHSA 1W00A 1E97A 1ULIB 3MYTA 3DMCA 2RCDA 3MKIA 4X2HA 5AIFA 3M8CA 3ER7A 5IG0A 2GXFA 2JQ5A 3B4OA 1AR0A 4J9AA 3DM8A 2BMOB 3EBYA 4L7KA 4I4KA 1JB4A 3JUOA 5CK6A 4GB5A 2Z77A 2GEYA 3MG3A 4PEJA 2INXA 2OWPA 3F9SA 4HM7B 2QIYA 3VSYA 1HKXA 3B4PA 4XDVA 3JUNA 1JB5A 1E3RA 3HK4A 3MHEA 5CLKA 1DMNA 1EG9B 4KVHA 3NBRA 3STDA 4LEHA 3MSOA 2PZVA 5CF1A 3NHXA 4HZ9B 3WMDA 5IEOA 1Q40A 1W01A 4WP5A 3A76A 3EJVA 5IG5A 2HMLB 3VGNA 3FH1A 3NM2A 1ZO2A 4Q53A 3EHCA 3UJMA 2CHCA 3D9RA 1QJGA 5IG4A 1GYBA 3OXAA 3I0YA 4K1VA 1OCVA 2UX0A 2F99A 4R9KA 3JUQA 1O7PB 3FGYA 4STDA 1STDA 2K54A 3HZPA 1EA2A 1DMQA 4HKVB 3OWYA 4HVNA 3EN1B 1JKGA 5AIHA 1UUVB 4FCMA 1WQLB 3DUKA 1OPYA 2XRXB 5EVHA 3NV0B 3CPOA 5D81A 3DZLA 2QGUA
chains in the Genus database with same CATH superfamily
2IA7A 4IIAA 1Q824 1DMMA 1FGOA 1VQQA 1BNRA 2P0XA 3LZAA 5TGNA 3EF8A 1O7MB 1CH0A 1CEWI 2XR8B 2CWUA 3FSDA 4N6OB 3UL6A 3RNTA 4BTYA 1YGEA 2R41A 4N3VA 4XBYA 2V1LA 5JPUA 5IERA 4HAAA 1VQM3 1W6GA 1OF5A 2Z7AA 1O7GB 3OWSA 1RHLA 4FMCA 5JBSA 1JJ22 3X3XA 3S67A 3UNLA 3K0ZA 1W6YA 5IENA 1JKGB 1NWWA 4H61A 4OVMA 1O7NB 3B8LA 2RGQA 3LXUX 3SOAA 1RGKA 2GSPA 2HMKB 3D5IA 3T8NA 4O2HA 1Q7Y4 3SEDA 1BRJA 1RN1A 1PU4A 2IUKA 1V74A 4XBXA 9RNTA 1VQK3 1JBSA 3CNMA 2IYJA 3QRDA 3G16A 2F4YA 3CME3 4HJLB 5JPPA 1B2SA 3TDGA 4KFDA 4MMXB 1B3SA 3FZWA 1O7HB 1OGXA 4ZM8A 4WYKA 3SXXA 1FUTA 4BIRA 5KP4A 3PCRA 1A90A 3HX8A 2Q07A 4ORLA 2IMJA 1IV9A 3S28A 1VQL3 2HMOB 5IEPA 1M1K4 3DGLA 1DYUA 1N9EA 1Q42A 1I0XA 2FNQA 1EEJA 3AMOA 1B20A 3V92A 3BU4A 2B1XB 3HOHA 2QEX3 2XFTA 3BNBA 1BRKA 4BTXA 1GOUA 1LOWA 3JVCA 3CPW2 4CCVA 1NDOB 2YFJB 3JUPA 4WHAA 4RZMA 3HIGA 4N6V0 2W2CA 4BU4A 3JUMA 2W04A 1GSPA 3LYGA 3NUVA 2CX1A 4ILFA 3FCSB 5AIIA 3MWZA 1RLSA 4HM2B 4IT7A 1N5PA 3SLUA 1RGHA 4L8OA 4XDWA 2BMQB 1QAFA 1OH0A 4HM5B 1BSEA 2CFGA 4GHOA 3CCE3 1QMAA 1B27A 4X2OA 5HGRA 4BL3A 1RSNA 4JRFA 1B2MA 2H0HA 4EYCA 1BAOA 5CXOA 2CKFB 1JBRA 1GY6A 3WODG 2CIUA 2YFIB 2JDIH 1IVVA 3DXOA 1AQZA 2YX9A 3H3HA 2F98A 4KT3B 1NJI4 1SPUA 5AIGA 2BMRB 1YJW3 2CG0A 1IT8A 4HZBB 5BVBA 8RNTA 3KKGA 4R1KA 4FMAA 3GZXB 1EQKA 1IVWA 1VQ73 1NB5I 1IDPA 4AKYA 2XSHB 1PYLA 2R4IA 2D42A 4WWUC 1W7CA 5DRVA 1GY5A 1T2HA 3GRDA 1VQ43 2ZHXB 1BSCA 1S5AA 1UCJA 1BRIA 2XF3A 1UGIA 5G1KA 3G0KA 1Q40B 2O9UX 1ZGXA 1WMPA 5KP1A 2AAEA 3F8HA 3OW22 1QVG2 1KD14 1CYUA 1RRHA 2P09A 1DE3A 3G6E3 3B7CA 3T0UA 1US1A 1FUSA 3U1WA 5BXQA 4HM0B 4FMBA 4N6NB 2ML6A 5ELUA 3EQQB 1OHPA 1ZX2A 5DREA 1DVCA 3F8XA 3DGMA 4R80A 4AKZA 3F7XA 1UCIA 1K9M4 1RGLA 3H51A 2F5WA 4O02B 3S5CA 3SX1A 2XFSA 5D81A 3ROBA 4MJDA 1BU4A 2QA43 2FXTA 1GS3A 1MNLA 4MMYB 4J5GA 1GMRA 1VZZA 3I553 2CFLA 4LGQA 1SJWA 5AEUB 3IPTA 3EBTA 4KFFA 1OUNA 3KIIA 3DGNA 3PXMA 1RGGA 1QVF2 1JZOA 2KAAA 1AVKA 5AI1A 4BTWA 1Q7HA 3CXC2 1DVDA 3BNDA 1PY3A 4KFEA 2K0MA 2WGOA 3Q90A 4XBTA 1BUQA 4BL2A 4FMDA 2OTJ3 3OX9A 2W9PA 1ISKA 1LRAA 3EX9A 3NXJA 3PS8A 2IUJA 2C11A 4EXRA 2ML5A 3LMLA 5CF2A 1M904 3ECFA 2WOHA 3OWUA 2CWVA 5IF6A 1TRQA 1MOLA 3D4AA 3F14A 1B2ZA 4FCZA 5M19A 3F40A 1VQ83 5AYRB 4HM8B 3CCL3 1VQP3 3DY5A 1WMNA 3HIIA 1NO3A 2KRTA 3Q2PA 4XB5A 6RNTA 4K1UA 3K7CA 3PYJA 7STDA 1A67A 3FLJA 4LYLB 1BRNL 2HMNB 1FGQA 3SVAA 1RRLA 2OTL3 4CDLA 1I70A 1VQ63 2P38A 3DH2A 3LT9A 1L5GB 5EEOA 1W4NA 2CX0A 2Z76A 1X1YA 5LC7A 2RFRA 1GY7A 3OV4A 5KP3A 1KSIA 4J8TA 1RGAA 2STDA 1O7WB 3EE1A 3WHOA 1A2PA 3E99A 4KZ1A 4R9LA 1SQWA 1SARA 7GSPA 2B24B 2SARA 2J8XB 1TFKA 1LQGC 4FCJA 3FF0A 1AY7A 1WNHA 3X40A 1BRGA 3ALAA 5G2GA 6STDA 2A15A 3NQYA 3CC43 1OACA 1IU7A 1OF5B 1N9JA 3N8BA 4IPBA 5G1LA 1STFI 3I563 1Q9EA 1AVLA 2HMMB 3BB9A 3EC9A 2SBLA 3SOYA 1LVNA 1D6UA 1SIHA 5IG3A 3F7SA 3LTAA 2Z6BA 3MG1A 1GMQA 1BNFA 2XSOB 1PFPA 2Y74A 3D3LA 3FKAA 1LXEA 3D5GA 2H0IA 1C54A 4N6LA 2F86B 3CCS3 2GU1A 1IV7A 1RTUA 3URPA 3DGYA 1ULJB 5RNTA 4NHFA 4WFOA 1IQ8A 1TP6A 1ASKA 1JB2A 4WYKB 5M1AA 2CH9A 1RCKA 1UUGB 2RSXA 1JN5A 3GZRA 3GZYB 1M1XB 1T3BA 1IK3A 3CNXA 1VQO3 2M7OA 3LTDA 1TUHA 4HM6B 1R4YA 1X1WA 1HZ1A 1CQSA 1M9GA 1NU3A 1QAKA 4J5KA 2HMJB 3AMOB 1I2EA 1MGWA 3WA2X 3J7Yd 3AGNA 3KE7A 3KSPA 3NX0A 1YI23 2GBXB 3GWRA 2CG1A 4LSOA 3CCJ3 3AGOA 4EW5A 2P0MA 1LQMB 3KCHA 4U13A 2GEXA 5IW9A 3RGRA 2CFKA 3KZTA 2E2VA 5BIRA 1S723 1U8CB 5LC6A 2XH9A 1BNSA 2OOVC 3CCQ3 1Z1SA 3FF2A 1C7HA 1A2VA 3O8YA 4O3VA 3ZG0A 3UL5A 6GSPA 4N6MA 1RN4A 3CMA3 1E3VA 3D79A 3PZWA 4HM1B 4XM4A 1JN5B 4L8PA 2BNGA 3N54B 1YJN3 4HOHA 3BLZA 1N8QA 5AEWB 3RDEA 1JNQA 1OGZA 3BNCA 2UUGC 5STDA 1BSBA 4RNYA 3T8UA 3EN8A 1EKMA 1B21A 1BSDA 3LOYA 1MWTA 3K9MC 3RGAA 3VF1A 3V98A 2CW9A 2GBWB 3L0RA 2ZA4A 4RNZA 5D83A 3WOFB 1U5OA 3ZFZA 1A2KA 8CHOA 1D6ZA 4HYZA 5M18A 1NNVA 4OUQA 1BRHA 5FW5A 3G4S3 4N6UA 4HM4B 3LTCA 1I0VA 5ELJA 1MWRA 2CC3A 3CU3A 3EB8A 3UB1A 3K5TA 3CCM3 3AHWA 1YVSA 3GZBA 4FR9A 2RNTA 4RNTA 5D82A 1Y4KA 5EQLA 3WA3A 2ZL8A 1OHOA 4HM3B 4LMIA 1UUWB 2CWTA 3NV0A 1TRPA 4H3UA 1W02A 1FGMA 1IVXA 2YFLB 2F5MA 1I2GA 2IY2A 3G8ZA 1VQ53 4R4KA 2I9WA 1VQ93 2WOFA 3MG2A 1NB3I 3PGBA 1OHSA 1W6CA 2PNCA 1W00A 1LOYA 2OQEC 3Q1CA 1BNJA 1E97A 5BU4A 2W0QA 1GD4A 3LT8A 4LZIA 1ULIB 2KF6A 3MYTA 7RNTA 4GL6A 1RN7A 3DMCA 1YJ93 1BANA 1K734 2RCDA 3MKIA 1B2XA 2HOHA 5GSPA 1RJOA 4X2HA 1R4CA 1GD3A 2KF4A 2OCTA 2Y73A 5AIFA 3S29A 3M8CA 3ER7A 1VQN3 5A0OB 1RDSA 1BNGA 5IG0A 1JRQA 3CC23 1G0TA 1UCKA 1WMOA 2GXFA 1BNIA 4NREA 2L4VA 1X1XA 2JQ5A 3A5EA 3B4OA 1AR0A 1RGEA 2E2TA 3N9HA 4J9AA 2O3OA 2LYXA 2D1WA 1K8A4 3DM8A 2C4BA 1F8NA 2BMOB 3NBJA 1JBTA 2F56A 1B2UA 3EBYA 3X3YA 1RCLA 2FGTA 4L7KA 4EBGA 1RKYA 3IJEB 4I4KA 1JB4A 3JUOA 5CK6A 1MWUA 4GB5A 2XGLA 1ROVA 3AHSA 1BOXA 1IYYA 2Z77A 1G02A 2KCDA 2BT3A 3K63A 1TIJA 3KN4A 2OQEA 2GEYA 3WOEB 1TU5A 3MG3A 1IQYA 1MWSA 3MPHA 3GAXA 1KQS2 4PEJA 2INXA 2W56A 5I97A 2OWPA 1GMPA 1I3IA 1BRSA 3F9SA 2BIRA 1G96A 1HU9A 2L1SA 4HM7B 3ZG5A 1LNHA 3KFQC 1RGFA 3KSED 2QIYA 3VSYA 2W6JH 1FUWA 3X41A 2W03A 1HKXA 5AYSC 3B4PA 3DGOA 1UDII 1YHQ3 1KWIA 4XDVA 1IT7A 1CYVA 3JUNA 1JB5A 1UCLA 4EC6A 4NPBA 1E3RA 3HK4A 1UI7A 2UGIA 3MHEA 5CLKA 1DMNA 1I3FA 3U97A 1TTOA 3Q3FA 1EG9B 4KVHA 3SYUA 3NBRA 3CC73 3STDA 1BUJA 2CFDA 1LOVA 1W2B2 1JV2B 1LNIA 4LEHA 1N5HA 4CPKA 1N8R4 3MSOA 1YIT3 1FYSA 2PZVA 1BVIA 5CF1A 2ZDJA 1T2IA 2W56B 3NHXA 2BU4A 1UW1A 3FG3A 1RMSA 4HZ9B 1V57A 1BSAA 1UGHI 2P05A 1J2BA 1Q864 4HBRA 1BGSA 2RBIA 4N6TA 1AV4A 1RGCA 3WMDA 1IQXA 1MGRA 1EUIC 5IEOA 2K3DA 4I5QA 1Q40A 1W01A 4WP5A 3WDGB 2BO9B 1ZS7A 3A76A 3NM7A 1QALA 3EJVA 1FW7A 1SIIA 4DKIA 5IG5A 4JF8A 2HMLB 1GOYA 3VGNA 2WGQA 3FH1A 3NM2A 1TFOA 3LTBA 3NQZA 1KC84 3NBBA 3S27A 1ZO2A 1LOXA 3CCV3 1HYFA 1YNVX 4EV5A 4AEQA 4EV2A 1RNTA 4Q53A 3EHCA 3LH4A 3PCSA 3UJMA 2KF5A 1V58A 2CHCA 4OK0A 2MC8A 2H0GA 1FGRA 3D9RA 1QJGA 4MMZB 3V99A 5IG4A 1Q814 1GOVA 1GYBA 1FA3A 3OXAA 1IVUA 3I0YA 4K61A 4K1VA 1OCVA 2UX0A 1I8VA 2F99A 2XEPA 2KXGA 1ROAA 3QK9A 4GSPA 3FG1A 3G713 3CCU3 4R9KA 1TJDA 2OOVA 1WTHA 5HOHA 3JUQA 3CCR3 1O7PB 1YIJ3 3CD63 1JZDA 3FGYA 4STDA 1STDA 3BIRA 4QWTA 1K28A 1W2ZA 1T5YA 3WR2A 2W9QA 2K54A 1UI8A 2LQVA 1FZUA 3FG4A 3HI7A 3HZPA 3IMAB 2CK3H 3BNEA 3GSPA 1EA2A 1DMQA 1D6YA 1FGTA 4HKVB 2XGNA 2CFWA 1DETA 3X3ZA 2BHMA 3OWYA 1YGWA 2WO0A 4HVNA 1RNBA 3X42A 5FGOA 1I2FA 3EN1B 1JKGA 5AIHA 2GU3A 4CJNA 1UUVB 4FCMA 1BNEA 1WQLB 2C10A 3DUKA 1YVBI 4G1MB 4RBNA 2AADA 1BIRA 1OPYA 2E2UA 4O8SA 1X1UA 2XRXB 5EVHA 2MF7A 4TX4A 4MEIA 4K90B 2KF3A 3NV0B 1W5ZA 3CPOA 1K41A 3DZLA 2QGUA
chains in the Genus database with same CATH topology
2IA7A 4IIAA 1Q824 1DMMA 1FGOA 2P0XA 3LZAA 5TGNA 3EF8A 1O7MB 2XR8B 1CEWI 4N6OB 3UL6A 3FSDA 4BTYA 1YGEA 4N3VA 4XBYA 2V1LA 5JPUA 5IERA 1VQM3 1W6GA 1OF5A 2Z7AA 1O7GB 3OWSA 4FMCA 5JBSA 1JJ22 3X3XA 3S67A 3UNLA 3K0ZA 1W6YA 5IENA 1JKGB 1NWWA 4H61A 4OVMA 1O7NB 3B8LA 2RGQA 3LXUX 3SOAA 2HMKB 3T8NA 4O2HA 1Q7Y4 3SEDA 1PU4A 2IUKA 1V74A 4XBXA 1VQK3 3CNMA 3QRDA 3G16A 3CME3 4HJLB 5JPPA 3TDGA 4KFDA 4MMXB 3FZWA 1O7HB 1OGXA 4ZM8A 4WYKA 3SXXA 5KP4A 3PCRA 1A90A 3HX8A 2Q07A 4ORLA 2IMJA 1IV9A 3S28A 1VQL3 2HMOB 5IEPA 1M1K4 3DGLA 1DYUA 1N9EA 1Q42A 2FNQA 3AMOA 3V92A 2QEX3 2B1XB 2XFTA 3BNBA 4BTXA 3JVCA 3CPW2 4CCVA 1NDOB 2YFJB 3JUPA 4WHAA 4RZMA 3HIGA 4N6V0 2W2CA 3JUMA 2W04A 3LYGA 3NUVA 3FCSB 5AIIA 3MWZA 4HM2B 4IT7A 3SLUA 1N5PA 4L8OA 4XDWA 2BMQB 1QAFA 1OH0A 4HM5B 2CFGA 3CCE3 1QMAA 4X2OA 5HGRA 4JRFA 4EYCA 5CXOA 2CKFB 1GY6A 3WODG 2CIUA 2YFIB 2JDIH 1IVVA 3DXOA 2YX9A 3H3HA 2F98A 1NJI4 1SPUA 5AIGA 2BMRB 1YJW3 2CG0A 1IT8A 4HZBB 5BVBA 3KKGA 4R1KA 4FMAA 3GZXB 1EQKA 1IVWA 1VQ73 1NB5I 1IDPA 4AKYA 2XSHB 2R4IA 2D42A 4WWUC 1W7CA 5DRVA 1GY5A 3GRDA 1VQ43 1S5AA 2XF3A 3G0KA 1Q40B 2O9UX 1WMPA 5KP1A 3F8HA 3OW22 1QVG2 1CYUA 1KD14 1RRHA 2P09A 3G6E3 3B7CA 3T0UA 1US1A 3U1WA 5BXQA 4HM0B 4FMBA 4N6NB 2ML6A 5ELUA 3EQQB 1OHPA 1ZX2A 5DREA 1DVCA 3F8XA 3DGMA 4R80A 4AKZA 3F7XA 4O02B 3H51A 3S5CA 3SX1A 2XFSA 5D81A 3ROBA 4MJDA 2QA43 2FXTA 1GS3A 1MNLA 4MMYB 1VZZA 3I553 2CFLA 4LGQA 1SJWA 5AEUB 3IPTA 3EBTA 4KFFA 1OUNA 3KIIA 3DGNA 3PXMA 1QVF2 1AVKA 5AI1A 4BTWA 3CXC2 1DVDA 3BNDA 4KFEA 2K0MA 2WGOA 3Q90A 4XBTA 1BUQA 4FMDA 2OTJ3 3OX9A 2W9PA 1ISKA 3EX9A 3NXJA 3PS8A 2IUJA 2C11A 4EXRA 2ML5A 3LMLA 5CF2A 1M904 3ECFA 2WOHA 3OWUA 2CWVA 5IF6A 1MOLA 3F14A 4FCZA 3F40A 1VQ83 5AYRB 4HM8B 3CCL3 1VQP3 3DY5A 1WMNA 3HIIA 1NO3A 2KRTA 3Q2PA 4XB5A 7STDA 4K1UA 3K7CA 3PYJA 1A67A 3FLJA 2HMNB 1FGQA 3SVAA 1RRLA 2OTL3 4CDLA 1VQ63 2P38A 3LT9A 1L5GB 5EEOA 1W4NA 2Z76A 5LC7A 2RFRA 1GY7A 3OV4A 5KP3A 1KSIA 4J8TA 2STDA 1O7WB 3EE1A 3E99A 4KZ1A 4R9LA 1SQWA 2B24B 1TFKA 4FCJA 3FF0A 1WNHA 3X40A 1S723 3ALAA 3CC43 5G2GA 6STDA 2A15A 3NQYA 1OACA 1IU7A 1OF5B 1N9JA 3N8BA 4IPBA 1STFI 3I563 1AVLA 2HMMB 3BB9A 3EC9A 2SBLA 3SOYA 1LVNA 1D6UA 1SIHA 5IG3A 3F7SA 3LTAA 2Z6BA 3MG1A 2XSOB 2Y74A 1PFPA 3D3LA 3FKAA 1LXEA 4N6LA 2F86B 3CCS3 2GU1A 1IV7A 1K41A 1ULJB 4NHFA 4WFOA 1IQ8A 1TP6A 1ASKA 1JB2A 4WYKB 2CH9A 3GZRA 2RSXA 3GZYB 1JN5A 1IK3A 1M1XB 3CNXA 1VQO3 2M7OA 3LTDA 1TUHA 4HM6B 1CQSA 1M9GA 1NU3A 1QAKA 2HMJB 3AMOB 3WA2X 3J7Yd 3KE7A 3KSPA 3NX0A 1YI23 2GBXB 3GWRA 2CG1A 4LSOA 3CCJ3 2P0MA 4U13A 2GEXA 5IW9A 3RGRA 2CFKA 3KZTA 2E2VA 1U8CB 5LC6A 2XH9A 2OOVC 3CCQ3 1Z1SA 3FF2A 1C7HA 1A2VA 3O8YA 4O3VA 3UL5A 4N6MA 3CMA3 1E3VA 4XM4A 3PZWA 4HM1B 1JN5B 4L8PA 2BNGA 3N54B 1YJN3 3BLZA 1N8QA 5AEWB 3RDEA 1JNQA 1OGZA 3BNCA 5STDA 4RNYA 3T8UA 3EN8A 1EKMA 3LOYA 3K9MC 3RGAA 3VF1A 3V98A 2CW9A 2GBWB 3L0RA 4RNZA 3WOFB 5D83A 1U5OA 1A2KA 8CHOA 1D6ZA 4HYZA 4OUQA 5FW5A 3G4S3 4N6UA 4HM4B 3LTCA 5ELJA 3UB1A 2CC3A 3EB8A 3CU3A 3CCM3 3K5TA 3GZBA 4FR9A 5D82A 1Y4KA 5EQLA 3WA3A 2ZL8A 1OHOA 4HM3B 4LMIA 1UUWB 2CWTA 3NV0A 4H3UA 1W02A 1FGMA 1IVXA 2YFLB 3G8ZA 1VQ53 1VQ93 1VQN3 4R4KA 2I9WA 2WOFA 3MG2A 1NB3I 3PGBA 1OHSA 1W6CA 2PNCA 1W00A 2OQEC 3Q1CA 1E97A 2W0QA 1GD4A 3LT8A 4LZIA 1ULIB 3MYTA 4GL6A 1RN7A 3DMCA 1YJ93 1K734 2RCDA 3MKIA 1RJOA 4X2HA 1R4CA 1GD3A 2OCTA 2Y73A 5AIFA 3S29A 3M8CA 3ER7A 5A0OB 5IG0A 1JRQA 3CC23 1WMOA 2GXFA 4NREA 2L4VA 2JQ5A 3B4OA 1AR0A 2E2TA 3N9HA 4J9AA 2O3OA 2LYXA 2D1WA 1K8A4 3DM8A 1F8NA 2BMOB 3NBJA 3EBYA 3X3YA 2FGTA 4L7KA 4EBGA 1RKYA 3IJEB 4I4KA 1JB4A 3JUOA 5CK6A 4GB5A 2XGLA 1ROVA 2Z77A 3K63A 2KCDA 2BT3A 3KN4A 1TIJA 2OQEA 3WOEB 2GEYA 1TU5A 3MG3A 1IQYA 3MPHA 3GAXA 1KQS2 4PEJA 2INXA 2W56A 5I97A 2OWPA 1K9M4 3F9SA 1G96A 4HM7B 1HU9A 1LNHA 3KFQC 3KSED 2QIYA 3VSYA 2W6JH 1FUWA 3X41A 2W03A 1HKXA 5AYSC 3B4PA 3DGOA 1YHQ3 1KWIA 4XDVA 1IT7A 1CYVA 3JUNA 1JB5A 4EC6A 1E3RA 3HK4A 1UI7A 3MHEA 5CLKA 1DMNA 3U97A 1EG9B 4KVHA 3CC73 3NBRA 3STDA 2CFDA 1W2B2 1JV2B 4LEHA 1N5HA 1N8R4 3MSOA 1YIT3 2PZVA 5CF1A 2ZDJA 2W56B 3NHXA 1UW1A 3FG3A 4HZ9B 2P05A 1J2BA 1Q864 4HBRA 4N6TA 1AV4A 3WMDA 1IQXA 5IEOA 1Q40A 1W01A 4WP5A 3WDGB 2BO9B 3A76A 3NM7A 1QALA 3EJVA 1SIIA 5IG5A 4JF8A 2HMLB 3VGNA 2WGQA 3FH1A 3NM2A 1TFOA 3LTBA 3NQZA 1KC84 3NBBA 3S27A 1ZO2A 1LOXA 3CCV3 4EV5A 4AEQA 4EV2A 4Q53A 3EHCA 3LH4A 3PCSA 3UJMA 2MC8A 4OK0A 2CHCA 1FGRA 3D9RA 1QJGA 4MMZB 3V99A 5IG4A 1Q814 1GYBA 1FA3A 3OXAA 1IVUA 3I0YA 4K61A 4K1VA 1OCVA 2UX0A 2F99A 2XEPA 2KXGA 1ROAA 3QK9A 3CCU3 3FG1A 3G713 4R9KA 2OOVA 1WTHA 3JUQA 3CCR3 1O7PB 1YIJ3 3CD63 3FGYA 4STDA 1STDA 4QWTA 1K28A 1W2ZA 1T5YA 2W9QA 2K54A 1UI8A 2LQVA 3HI7A 3FG4A 3HZPA 3IMAB 2CK3H 3BNEA 1EA2A 1DMQA 1D6YA 1FGTA 4HKVB 2XGNA 2CFWA 3X3ZA 2BHMA 3OWYA 2WO0A 4HVNA 3X42A 5FGOA 3EN1B 1JKGA 5AIHA 2GU3A 1UUVB 4FCMA 1WQLB 2C10A 3DUKA 1YVBI 4G1MB 4RBNA 1OPYA 2E2UA 4O8SA 2XRXB 5EVHA 2MF7A 4TX4A 4MEIA 4K90B 3NV0B 1W5ZA 3CPOA 2CWUA 3DZLA 2QGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIA A;  1DMM A;  3LZA A;  5TGN A;  3EF8 A;  1O7M B;  2XR8 B;  3FSD A;  4N3V A;  4XBY A;  5JPU A;  5IER A;  1OF5 A;  2Z7A A;  1O7G B;  3OWS A;  3UNL A;  3K0Z A;  1W6Y A;  5IEN A;  1JKG B;  1NWW A;  4OVM A;  1O7N B;  3B8L A;  2RGQ A;  3SOA A;  2HMK B;  3T8N A;  3SED A;  4XBX A;  3CNM A;  3G16 A;  4HJL B;  5JPP A;  3FZW A;  1O7H B;  1OGX A;  4WYK A;  5KP4 A;  3HX8 A;  4ORL A;  2IMJ A;  2HMO B;  5IEP A;  1Q42 A;  2B1X B;  1NDO B;  2YFJ B;  3JUP A;  4RZM A;  2W2C A;  3JUM A;  3LYG A;  3NUV A;  5AII A;  4HM2 B;  4L8O A;  4XDW A;  2BMQ B;  4HM5 B;  1OH0 A;  1QMA A;  4X2O A;  5HGR A;  5CXO A;  2CKF B;  1GY6 A;  2YFI B;  3DXO A;  3H3H A;  2F98 A;  5AIG A;  2BMR B;  4HZB B;  5BVB A;  3KKG A;  4R1K A;  3GZX B;  1IDP A;  2XSH B;  2R4I A;  4WWU C;  5DRV A;  1GY5 A;  3GRD A;  1S5A A;  3G0K A;  1Q40 B;  5KP1 A;  3F8H A;  3B7C A;  5BXQ A;  4HM0 B;  3EQQ B;  1OHP A;  1ZX2 A;  5DRE A;  3F8X A;  3F7X A;  3S5C A;  3H51 A;  3ROB A;  4MJD A;  1GS3 A;  1VZZ A;  4LGQ A;  1SJW A;  5AEU B;  3IPT A;  3EBT A;  1OUN A;  5AI1 A;  3Q90 A;  4XBT A;  1BUQ A;  3OX9 A;  1ISK A;  3EX9 A;  3NXJ A;  5CF2 A;  3ECF A;  3OWU A;  5IF6 A;  3F14 A;  3F40 A;  4HM8 B;  4XB5 A;  7STD A;  4K1U A;  3K7C A;  3FLJ A;  2HMN B;  4CDL A;  2Z76 A;  2RFR A;  5KP3 A;  1GY7 A;  3OV4 A;  4J8T A;  2STD A;  1O7W B;  3E99 A;  4R9L A;  2B24 B;  4FCJ A;  3FF0 A;  5G2G A;  6STD A;  2A15 A;  1OF5 B;  2HMM B;  3BB9 A;  3EC9 A;  3SOY A;  5IG3 A;  3F7S A;  3MG1 A;  2XSO B;  3FKA A;  2F86 B;  1K41 A;  1ULJ B;  1TP6 A;  1ASK A;  1JB2 A;  4WYK B;  3GZR A;  3GZY B;  1JN5 A;  3CNX A;  1TUH A;  4HM6 B;  1CQS A;  1NU3 A;  2HMJ B;  3KE7 A;  3KSP A;  2GBX B;  3GWR A;  4U13 A;  2GEX A;  3RGR A;  3KZT A;  1Z1S A;  3FF2 A;  1C7H A;  1E3V A;  4XM4 A;  4HM1 B;  1JN5 B;  4L8P A;  2BNG A;  3BLZ A;  5AEW B;  1OGZ A;  5STD A;  3T8U A;  3EN8 A;  3RGA A;  2GBW B;  5D83 A;  1U5O A;  1A2K A;  8CHO A;  4OUQ A;  5FW5 A;  4HM4 B;  3CU3 A;  3GZB A;  5D82 A;  1OHO A;  4HM3 B;  4LMI A;  1UUW B;  3NV0 A;  4H3U A;  1W02 A;  3G8Z A;  2YFL B;  2I9W A;  3MG2 A;  1OHS A;  1W00 A;  1E97 A;  1ULI B;  3MYT A;  3DMC A;  2RCD A;  3MKI A;  4X2H A;  5AIF A;  3M8C A;  3ER7 A;  5IG0 A;  2GXF A;  2JQ5 A;  3B4O A;  1AR0 A;  4J9A A;  3DM8 A;  2BMO B;  3EBY A;  4L7K A;  4I4K A;  1JB4 A;  3JUO A;  5CK6 A;  4GB5 A;  2Z77 A;  2GEY A;  3MG3 A;  4PEJ A;  2INX A;  2OWP A;  3F9S A;  4HM7 B;  2QIY A;  3VSY A;  1HKX A;  3B4P A;  4XDV A;  3JUN A;  1JB5 A;  1E3R A;  3HK4 A;  3MHE A;  5CLK A;  1DMN A;  1EG9 B;  4KVH A;  3NBR A;  3STD A;  4LEH A;  3MSO A;  2PZV A;  5CF1 A;  3NHX A;  4HZ9 B;  3WMD A;  5IEO A;  1Q40 A;  1W01 A;  4WP5 A;  3A76 A;  3EJV A;  5IG5 A;  2HML B;  3VGN A;  3FH1 A;  3NM2 A;  1ZO2 A;  4Q53 A;  3EHC A;  3UJM A;  2CHC A;  3D9R A;  1QJG A;  5IG4 A;  1GYB A;  3OXA A;  3I0Y A;  4K1V A;  1OCV A;  2UX0 A;  2F99 A;  4R9K A;  3JUQ A;  1O7P B;  3FGY A;  4STD A;  1STD A;  2K54 A;  3HZP A;  1EA2 A;  1DMQ A;  4HKV B;  3OWY A;  4HVN A;  3EN1 B;  1JKG A;  5AIH A;  1UUV B;  4FCM A;  1WQL B;  3DUK A;  1OPY A;  2XRX B;  5EVH A;  3NV0 B;  3CPO A;  5D81 A;  3DZL A;  2QGU A; 
#chains in the Genus database with same CATH topology
 2IA7 A;  4IIA A;  1Q82 4;  1DMM A;  1FGO A;  1VQQ A;  1BNR A;  2P0X A;  3LZA A;  5TGN A;  3EF8 A;  1O7M B;  1CH0 A;  1CEW I;  2XR8 B;  2CWU A;  3FSD A;  4N6O B;  3UL6 A;  3RNT A;  4BTY A;  1YGE A;  2R41 A;  4N3V A;  4XBY A;  2V1L A;  5JPU A;  5IER A;  4HAA A;  1VQM 3;  1W6G A;  1OF5 A;  2Z7A A;  1O7G B;  3OWS A;  1RHL A;  4FMC A;  5JBS A;  1JJ2 2;  3X3X A;  3S67 A;  3UNL A;  3K0Z A;  1W6Y A;  5IEN A;  1JKG B;  1NWW A;  4H61 A;  4OVM A;  1O7N B;  3B8L A;  2RGQ A;  3LXU X;  3SOA A;  1RGK A;  2GSP A;  2HMK B;  3D5I A;  3T8N A;  4O2H A;  1Q7Y 4;  3SED A;  1BRJ A;  1RN1 A;  1PU4 A;  2IUK A;  1V74 A;  4XBX A;  9RNT A;  1VQK 3;  1JBS A;  3CNM A;  2IYJ A;  3QRD A;  3G16 A;  2F4Y A;  3CME 3;  4HJL B;  5JPP A;  1B2S A;  3TDG A;  4KFD A;  4MMX B;  1B3S A;  3FZW A;  1O7H B;  1OGX A;  4ZM8 A;  4WYK A;  3SXX A;  1FUT A;  4BIR A;  5KP4 A;  3PCR A;  1A90 A;  3HX8 A;  2Q07 A;  4ORL A;  2IMJ A;  1IV9 A;  3S28 A;  1VQL 3;  2HMO B;  5IEP A;  1M1K 4;  3DGL A;  1DYU A;  1N9E A;  1Q42 A;  1I0X A;  2FNQ A;  1EEJ A;  3AMO A;  1B20 A;  3V92 A;  3BU4 A;  2B1X B;  3HOH A;  2QEX 3;  2XFT A;  3BNB A;  1BRK A;  4BTX A;  1GOU A;  1LOW A;  3JVC A;  3CPW 2;  4CCV A;  1NDO B;  2YFJ B;  3JUP A;  4WHA A;  4RZM A;  3HIG A;  4N6V 0;  2W2C A;  4BU4 A;  3JUM A;  2W04 A;  1GSP A;  3LYG A;  3NUV A;  2CX1 A;  4ILF A;  3FCS B;  5AII A;  3MWZ A;  1RLS A;  4HM2 B;  4IT7 A;  1N5P A;  3SLU A;  1RGH A;  4L8O A;  4XDW A;  2BMQ B;  1QAF A;  1OH0 A;  4HM5 B;  1BSE A;  2CFG A;  4GHO A;  3CCE 3;  1QMA A;  1B27 A;  4X2O A;  5HGR A;  4BL3 A;  1RSN A;  4JRF A;  1B2M A;  2H0H A;  4EYC A;  1BAO A;  5CXO A;  2CKF B;  1JBR A;  1GY6 A;  3WOD G;  2CIU A;  2YFI B;  2JDI H;  1IVV A;  3DXO A;  1AQZ A;  2YX9 A;  3H3H A;  2F98 A;  4KT3 B;  1NJI 4;  1SPU A;  5AIG A;  2BMR B;  1YJW 3;  2CG0 A;  1IT8 A;  4HZB B;  5BVB A;  8RNT A;  3KKG A;  4R1K A;  4FMA A;  3GZX B;  1EQK A;  1IVW A;  1VQ7 3;  1NB5 I;  1IDP A;  4AKY A;  2XSH B;  1PYL A;  2R4I A;  2D42 A;  4WWU C;  1W7C A;  5DRV A;  1GY5 A;  1T2H A;  3GRD A;  1VQ4 3;  2ZHX B;  1BSC A;  1S5A A;  1UCJ A;  1BRI A;  2XF3 A;  1UGI A;  5G1K A;  3G0K A;  1Q40 B;  2O9U X;  1ZGX A;  1WMP A;  5KP1 A;  2AAE A;  3F8H A;  3OW2 2;  1QVG 2;  1KD1 4;  1CYU A;  1RRH A;  2P09 A;  1DE3 A;  3G6E 3;  3B7C A;  3T0U A;  1US1 A;  1FUS A;  3U1W A;  5BXQ A;  4HM0 B;  4FMB A;  4N6N B;  2ML6 A;  5ELU A;  3EQQ B;  1OHP A;  1ZX2 A;  5DRE A;  1DVC A;  3F8X A;  3DGM A;  4R80 A;  4AKZ A;  3F7X A;  1UCI A;  1K9M 4;  1RGL A;  3H51 A;  2F5W A;  4O02 B;  3S5C A;  3SX1 A;  2XFS A;  5D81 A;  3ROB A;  4MJD A;  1BU4 A;  2QA4 3;  2FXT A;  1GS3 A;  1MNL A;  4MMY B;  4J5G A;  1GMR A;  1VZZ A;  3I55 3;  2CFL A;  4LGQ A;  1SJW A;  5AEU B;  3IPT A;  3EBT A;  4KFF A;  1OUN A;  3KII A;  3DGN A;  3PXM A;  1RGG A;  1QVF 2;  1JZO A;  2KAA A;  1AVK A;  5AI1 A;  4BTW A;  1Q7H A;  3CXC 2;  1DVD A;  3BND A;  1PY3 A;  4KFE A;  2K0M A;  2WGO A;  3Q90 A;  4XBT A;  1BUQ A;  4BL2 A;  4FMD A;  2OTJ 3;  3OX9 A;  2W9P A;  1ISK A;  1LRA A;  3EX9 A;  3NXJ A;  3PS8 A;  2IUJ A;  2C11 A;  4EXR A;  2ML5 A;  3LML A;  5CF2 A;  1M90 4;  3ECF A;  2WOH A;  3OWU A;  2CWV A;  5IF6 A;  1TRQ A;  1MOL A;  3D4A A;  3F14 A;  1B2Z A;  4FCZ A;  5M19 A;  3F40 A;  1VQ8 3;  5AYR B;  4HM8 B;  3CCL 3;  1VQP 3;  3DY5 A;  1WMN A;  3HII A;  1NO3 A;  2KRT A;  3Q2P A;  4XB5 A;  6RNT A;  4K1U A;  3K7C A;  3PYJ A;  7STD A;  1A67 A;  3FLJ A;  4LYL B;  1BRN L;  2HMN B;  1FGQ A;  3SVA A;  1RRL A;  2OTL 3;  4CDL A;  1I70 A;  1VQ6 3;  2P38 A;  3DH2 A;  3LT9 A;  1L5G B;  5EEO A;  1W4N A;  2CX0 A;  2Z76 A;  1X1Y A;  5LC7 A;  2RFR A;  1GY7 A;  3OV4 A;  5KP3 A;  1KSI A;  4J8T A;  1RGA A;  2STD A;  1O7W B;  3EE1 A;  3WHO A;  1A2P A;  3E99 A;  4KZ1 A;  4R9L A;  1SQW A;  1SAR A;  7GSP A;  2B24 B;  2SAR A;  2J8X B;  1TFK A;  1LQG C;  4FCJ A;  3FF0 A;  1AY7 A;  1WNH A;  3X40 A;  1BRG A;  3ALA A;  5G2G A;  6STD A;  2A15 A;  3NQY A;  3CC4 3;  1OAC A;  1IU7 A;  1OF5 B;  1N9J A;  3N8B A;  4IPB A;  5G1L A;  1STF I;  3I56 3;  1Q9E A;  1AVL A;  2HMM B;  3BB9 A;  3EC9 A;  2SBL A;  3SOY A;  1LVN A;  1D6U A;  1SIH A;  5IG3 A;  3F7S A;  3LTA A;  2Z6B A;  3MG1 A;  1GMQ A;  1BNF A;  2XSO B;  1PFP A;  2Y74 A;  3D3L A;  3FKA A;  1LXE A;  3D5G A;  2H0I A;  1C54 A;  4N6L A;  2F86 B;  3CCS 3;  2GU1 A;  1IV7 A;  1RTU A;  3URP A;  3DGY A;  1ULJ B;  5RNT A;  4NHF A;  4WFO A;  1IQ8 A;  1TP6 A;  1ASK A;  1JB2 A;  4WYK B;  5M1A A;  2CH9 A;  1RCK A;  1UUG B;  2RSX A;  1JN5 A;  3GZR A;  3GZY B;  1M1X B;  1T3B A;  1IK3 A;  3CNX A;  1VQO 3;  2M7O A;  3LTD A;  1TUH A;  4HM6 B;  1R4Y A;  1X1W A;  1HZ1 A;  1CQS A;  1M9G A;  1NU3 A;  1QAK A;  4J5K A;  2HMJ B;  3AMO B;  1I2E A;  1MGW A;  3WA2 X;  3J7Y d;  3AGN A;  3KE7 A;  3KSP A;  3NX0 A;  1YI2 3;  2GBX B;  3GWR A;  2CG1 A;  4LSO A;  3CCJ 3;  3AGO A;  4EW5 A;  2P0M A;  1LQM B;  3KCH A;  4U13 A;  2GEX A;  5IW9 A;  3RGR A;  2CFK A;  3KZT A;  2E2V A;  5BIR A;  1S72 3;  1U8C B;  5LC6 A;  2XH9 A;  1BNS A;  2OOV C;  3CCQ 3;  1Z1S A;  3FF2 A;  1C7H A;  1A2V A;  3O8Y A;  4O3V A;  3ZG0 A;  3UL5 A;  6GSP A;  4N6M A;  1RN4 A;  3CMA 3;  1E3V A;  3D79 A;  3PZW A;  4HM1 B;  4XM4 A;  1JN5 B;  4L8P A;  2BNG A;  3N54 B;  1YJN 3;  4HOH A;  3BLZ A;  1N8Q A;  5AEW B;  3RDE A;  1JNQ A;  1OGZ A;  3BNC A;  2UUG C;  5STD A;  1BSB A;  4RNY A;  3T8U A;  3EN8 A;  1EKM A;  1B21 A;  1BSD A;  3LOY A;  1MWT A;  3K9M C;  3RGA A;  3VF1 A;  3V98 A;  2CW9 A;  2GBW B;  3L0R A;  2ZA4 A;  4RNZ A;  5D83 A;  3WOF B;  1U5O A;  3ZFZ A;  1A2K A;  8CHO A;  1D6Z A;  4HYZ A;  5M18 A;  1NNV A;  4OUQ A;  1BRH A;  5FW5 A;  3G4S 3;  4N6U A;  4HM4 B;  3LTC A;  1I0V A;  5ELJ A;  1MWR A;  2CC3 A;  3CU3 A;  3EB8 A;  3UB1 A;  3K5T A;  3CCM 3;  3AHW A;  1YVS A;  3GZB A;  4FR9 A;  2RNT A;  4RNT A;  5D82 A;  1Y4K A;  5EQL A;  3WA3 A;  2ZL8 A;  1OHO A;  4HM3 B;  4LMI A;  1UUW B;  2CWT A;  3NV0 A;  1TRP A;  4H3U A;  1W02 A;  1FGM A;  1IVX A;  2YFL B;  2F5M A;  1I2G A;  2IY2 A;  3G8Z A;  1VQ5 3;  4R4K A;  2I9W A;  1VQ9 3;  2WOF A;  3MG2 A;  1NB3 I;  3PGB A;  1OHS A;  1W6C A;  2PNC A;  1W00 A;  1LOY A;  2OQE C;  3Q1C A;  1BNJ A;  1E97 A;  5BU4 A;  2W0Q A;  1GD4 A;  3LT8 A;  4LZI A;  1ULI B;  2KF6 A;  3MYT A;  7RNT A;  4GL6 A;  1RN7 A;  3DMC A;  1YJ9 3;  1BAN A;  1K73 4;  2RCD A;  3MKI A;  1B2X A;  2HOH A;  5GSP A;  1RJO A;  4X2H A;  1R4C A;  1GD3 A;  2KF4 A;  2OCT A;  2Y73 A;  5AIF A;  3S29 A;  3M8C A;  3ER7 A;  1VQN 3;  5A0O B;  1RDS A;  1BNG A;  5IG0 A;  1JRQ A;  3CC2 3;  1G0T A;  1UCK A;  1WMO A;  2GXF A;  1BNI A;  4NRE A;  2L4V A;  1X1X A;  2JQ5 A;  3A5E A;  3B4O A;  1AR0 A;  1RGE A;  2E2T A;  3N9H A;  4J9A A;  2O3O A;  2LYX A;  2D1W A;  1K8A 4;  3DM8 A;  2C4B A;  1F8N A;  2BMO B;  3NBJ A;  1JBT A;  2F56 A;  1B2U A;  3EBY A;  3X3Y A;  1RCL A;  2FGT A;  4L7K A;  4EBG A;  1RKY A;  3IJE B;  4I4K A;  1JB4 A;  3JUO A;  5CK6 A;  1MWU A;  4GB5 A;  2XGL A;  1ROV A;  3AHS A;  1BOX A;  1IYY A;  2Z77 A;  1G02 A;  2KCD A;  2BT3 A;  3K63 A;  1TIJ A;  3KN4 A;  2OQE A;  2GEY A;  3WOE B;  1TU5 A;  3MG3 A;  1IQY A;  1MWS A;  3MPH A;  3GAX A;  1KQS 2;  4PEJ A;  2INX A;  2W56 A;  5I97 A;  2OWP A;  1GMP A;  1I3I A;  1BRS A;  3F9S A;  2BIR A;  1G96 A;  1HU9 A;  2L1S A;  4HM7 B;  3ZG5 A;  1LNH A;  3KFQ C;  1RGF A;  3KSE D;  2QIY A;  3VSY A;  2W6J H;  1FUW A;  3X41 A;  2W03 A;  1HKX A;  5AYS C;  3B4P A;  3DGO A;  1UDI I;  1YHQ 3;  1KWI A;  4XDV A;  1IT7 A;  1CYV A;  3JUN A;  1JB5 A;  1UCL A;  4EC6 A;  4NPB A;  1E3R A;  3HK4 A;  1UI7 A;  2UGI A;  3MHE A;  5CLK A;  1DMN A;  1I3F A;  3U97 A;  1TTO A;  3Q3F A;  1EG9 B;  4KVH A;  3SYU A;  3NBR A;  3CC7 3;  3STD A;  1BUJ A;  2CFD A;  1LOV A;  1W2B 2;  1JV2 B;  1LNI A;  4LEH A;  1N5H A;  4CPK A;  1N8R 4;  3MSO A;  1YIT 3;  1FYS A;  2PZV A;  1BVI A;  5CF1 A;  2ZDJ A;  1T2I A;  2W56 B;  3NHX A;  2BU4 A;  1UW1 A;  3FG3 A;  1RMS A;  4HZ9 B;  1V57 A;  1BSA A;  1UGH I;  2P05 A;  1J2B A;  1Q86 4;  4HBR A;  1BGS A;  2RBI A;  4N6T A;  1AV4 A;  1RGC A;  3WMD A;  1IQX A;  1MGR A;  1EUI C;  5IEO A;  2K3D A;  4I5Q A;  1Q40 A;  1W01 A;  4WP5 A;  3WDG B;  2BO9 B;  1ZS7 A;  3A76 A;  3NM7 A;  1QAL A;  3EJV A;  1FW7 A;  1SII A;  4DKI A;  5IG5 A;  4JF8 A;  2HML B;  1GOY A;  3VGN A;  2WGQ A;  3FH1 A;  3NM2 A;  1TFO A;  3LTB A;  3NQZ A;  1KC8 4;  3NBB A;  3S27 A;  1ZO2 A;  1LOX A;  3CCV 3;  1HYF A;  1YNV X;  4EV5 A;  4AEQ A;  4EV2 A;  1RNT A;  4Q53 A;  3EHC A;  3LH4 A;  3PCS A;  3UJM A;  2KF5 A;  1V58 A;  2CHC A;  4OK0 A;  2MC8 A;  2H0G A;  1FGR A;  3D9R A;  1QJG A;  4MMZ B;  3V99 A;  5IG4 A;  1Q81 4;  1GOV A;  1GYB A;  1FA3 A;  3OXA A;  1IVU A;  3I0Y A;  4K61 A;  4K1V A;  1OCV A;  2UX0 A;  1I8V A;  2F99 A;  2XEP A;  2KXG A;  1ROA A;  3QK9 A;  4GSP A;  3FG1 A;  3G71 3;  3CCU 3;  4R9K A;  1TJD A;  2OOV A;  1WTH A;  5HOH A;  3JUQ A;  3CCR 3;  1O7P B;  1YIJ 3;  3CD6 3;  1JZD A;  3FGY A;  4STD A;  1STD A;  3BIR A;  4QWT A;  1K28 A;  1W2Z A;  1T5Y A;  3WR2 A;  2W9Q A;  2K54 A;  1UI8 A;  2LQV A;  1FZU A;  3FG4 A;  3HI7 A;  3HZP A;  3IMA B;  2CK3 H;  3BNE A;  3GSP A;  1EA2 A;  1DMQ A;  1D6Y A;  1FGT A;  4HKV B;  2XGN A;  2CFW A;  1DET A;  3X3Z A;  2BHM A;  3OWY A;  1YGW A;  2WO0 A;  4HVN A;  1RNB A;  3X42 A;  5FGO A;  1I2F A;  3EN1 B;  1JKG A;  5AIH A;  2GU3 A;  4CJN A;  1UUV B;  4FCM A;  1BNE A;  1WQL B;  2C10 A;  3DUK A;  1YVB I;  4G1M B;  4RBN A;  2AAD A;  1BIR A;  1OPY A;  2E2U A;  4O8S A;  1X1U A;  2XRX B;  5EVH A;  2MF7 A;  4TX4 A;  4MEI A;  4K90 B;  2KF3 A;  3NV0 B;  1W5Z A;  3CPO A;  1K41 A;  3DZL A;  2QGU A; 
#chains in the Genus database with same CATH homology
 2IA7 A;  4IIA A;  1Q82 4;  1DMM A;  1FGO A;  2P0X A;  3LZA A;  5TGN A;  3EF8 A;  1O7M B;  2XR8 B;  1CEW I;  4N6O B;  3UL6 A;  3FSD A;  4BTY A;  1YGE A;  4N3V A;  4XBY A;  2V1L A;  5JPU A;  5IER A;  1VQM 3;  1W6G A;  1OF5 A;  2Z7A A;  1O7G B;  3OWS A;  4FMC A;  5JBS A;  1JJ2 2;  3X3X A;  3S67 A;  3UNL A;  3K0Z A;  1W6Y A;  5IEN A;  1JKG B;  1NWW A;  4H61 A;  4OVM A;  1O7N B;  3B8L A;  2RGQ A;  3LXU X;  3SOA A;  2HMK B;  3T8N A;  4O2H A;  1Q7Y 4;  3SED A;  1PU4 A;  2IUK A;  1V74 A;  4XBX A;  1VQK 3;  3CNM A;  3QRD A;  3G16 A;  3CME 3;  4HJL B;  5JPP A;  3TDG A;  4KFD A;  4MMX B;  3FZW A;  1O7H B;  1OGX A;  4ZM8 A;  4WYK A;  3SXX A;  5KP4 A;  3PCR A;  1A90 A;  3HX8 A;  2Q07 A;  4ORL A;  2IMJ A;  1IV9 A;  3S28 A;  1VQL 3;  2HMO B;  5IEP A;  1M1K 4;  3DGL A;  1DYU A;  1N9E A;  1Q42 A;  2FNQ A;  3AMO A;  3V92 A;  2QEX 3;  2B1X B;  2XFT A;  3BNB A;  4BTX A;  3JVC A;  3CPW 2;  4CCV A;  1NDO B;  2YFJ B;  3JUP A;  4WHA A;  4RZM A;  3HIG A;  4N6V 0;  2W2C A;  3JUM A;  2W04 A;  3LYG A;  3NUV A;  3FCS B;  5AII A;  3MWZ A;  4HM2 B;  4IT7 A;  3SLU A;  1N5P A;  4L8O A;  4XDW A;  2BMQ B;  1QAF A;  1OH0 A;  4HM5 B;  2CFG A;  3CCE 3;  1QMA A;  4X2O A;  5HGR A;  4JRF A;  4EYC A;  5CXO A;  2CKF B;  1GY6 A;  3WOD G;  2CIU A;  2YFI B;  2JDI H;  1IVV A;  3DXO A;  2YX9 A;  3H3H A;  2F98 A;  1NJI 4;  1SPU A;  5AIG A;  2BMR B;  1YJW 3;  2CG0 A;  1IT8 A;  4HZB B;  5BVB A;  3KKG A;  4R1K A;  4FMA A;  3GZX B;  1EQK A;  1IVW A;  1VQ7 3;  1NB5 I;  1IDP A;  4AKY A;  2XSH B;  2R4I A;  2D42 A;  4WWU C;  1W7C A;  5DRV A;  1GY5 A;  3GRD A;  1VQ4 3;  1S5A A;  2XF3 A;  3G0K A;  1Q40 B;  2O9U X;  1WMP A;  5KP1 A;  3F8H A;  3OW2 2;  1QVG 2;  1CYU A;  1KD1 4;  1RRH A;  2P09 A;  3G6E 3;  3B7C A;  3T0U A;  1US1 A;  3U1W A;  5BXQ A;  4HM0 B;  4FMB A;  4N6N B;  2ML6 A;  5ELU A;  3EQQ B;  1OHP A;  1ZX2 A;  5DRE A;  1DVC A;  3F8X A;  3DGM A;  4R80 A;  4AKZ A;  3F7X A;  4O02 B;  3H51 A;  3S5C A;  3SX1 A;  2XFS A;  5D81 A;  3ROB A;  4MJD A;  2QA4 3;  2FXT A;  1GS3 A;  1MNL A;  4MMY B;  1VZZ A;  3I55 3;  2CFL A;  4LGQ A;  1SJW A;  5AEU B;  3IPT A;  3EBT A;  4KFF A;  1OUN A;  3KII A;  3DGN A;  3PXM A;  1QVF 2;  1AVK A;  5AI1 A;  4BTW A;  3CXC 2;  1DVD A;  3BND A;  4KFE A;  2K0M A;  2WGO A;  3Q90 A;  4XBT A;  1BUQ A;  4FMD A;  2OTJ 3;  3OX9 A;  2W9P A;  1ISK A;  3EX9 A;  3NXJ A;  3PS8 A;  2IUJ A;  2C11 A;  4EXR A;  2ML5 A;  3LML A;  5CF2 A;  1M90 4;  3ECF A;  2WOH A;  3OWU A;  2CWV A;  5IF6 A;  1MOL A;  3F14 A;  4FCZ A;  3F40 A;  1VQ8 3;  5AYR B;  4HM8 B;  3CCL 3;  1VQP 3;  3DY5 A;  1WMN A;  3HII A;  1NO3 A;  2KRT A;  3Q2P A;  4XB5 A;  7STD A;  4K1U A;  3K7C A;  3PYJ A;  1A67 A;  3FLJ A;  2HMN B;  1FGQ A;  3SVA A;  1RRL A;  2OTL 3;  4CDL A;  1VQ6 3;  2P38 A;  3LT9 A;  1L5G B;  5EEO A;  1W4N A;  2Z76 A;  5LC7 A;  2RFR A;  1GY7 A;  3OV4 A;  5KP3 A;  1KSI A;  4J8T A;  2STD A;  1O7W B;  3EE1 A;  3E99 A;  4KZ1 A;  4R9L A;  1SQW A;  2B24 B;  1TFK A;  4FCJ A;  3FF0 A;  1WNH A;  3X40 A;  1S72 3;  3ALA A;  3CC4 3;  5G2G A;  6STD A;  2A15 A;  3NQY A;  1OAC A;  1IU7 A;  1OF5 B;  1N9J A;  3N8B A;  4IPB A;  1STF I;  3I56 3;  1AVL A;  2HMM B;  3BB9 A;  3EC9 A;  2SBL A;  3SOY A;  1LVN A;  1D6U A;  1SIH A;  5IG3 A;  3F7S A;  3LTA A;  2Z6B A;  3MG1 A;  2XSO B;  2Y74 A;  1PFP A;  3D3L A;  3FKA A;  1LXE A;  4N6L A;  2F86 B;  3CCS 3;  2GU1 A;  1IV7 A;  1K41 A;  1ULJ B;  4NHF A;  4WFO A;  1IQ8 A;  1TP6 A;  1ASK A;  1JB2 A;  4WYK B;  2CH9 A;  3GZR A;  2RSX A;  3GZY B;  1JN5 A;  1IK3 A;  1M1X B;  3CNX A;  1VQO 3;  2M7O A;  3LTD A;  1TUH A;  4HM6 B;  1CQS A;  1M9G A;  1NU3 A;  1QAK A;  2HMJ B;  3AMO B;  3WA2 X;  3J7Y d;  3KE7 A;  3KSP A;  3NX0 A;  1YI2 3;  2GBX B;  3GWR A;  2CG1 A;  4LSO A;  3CCJ 3;  2P0M A;  4U13 A;  2GEX A;  5IW9 A;  3RGR A;  2CFK A;  3KZT A;  2E2V A;  1U8C B;  5LC6 A;  2XH9 A;  2OOV C;  3CCQ 3;  1Z1S A;  3FF2 A;  1C7H A;  1A2V A;  3O8Y A;  4O3V A;  3UL5 A;  4N6M A;  3CMA 3;  1E3V A;  4XM4 A;  3PZW A;  4HM1 B;  1JN5 B;  4L8P A;  2BNG A;  3N54 B;  1YJN 3;  3BLZ A;  1N8Q A;  5AEW B;  3RDE A;  1JNQ A;  1OGZ A;  3BNC A;  5STD A;  4RNY A;  3T8U A;  3EN8 A;  1EKM A;  3LOY A;  3K9M C;  3RGA A;  3VF1 A;  3V98 A;  2CW9 A;  2GBW B;  3L0R A;  4RNZ A;  3WOF B;  5D83 A;  1U5O A;  1A2K A;  8CHO A;  1D6Z A;  4HYZ A;  4OUQ A;  5FW5 A;  3G4S 3;  4N6U A;  4HM4 B;  3LTC A;  5ELJ A;  3UB1 A;  2CC3 A;  3EB8 A;  3CU3 A;  3CCM 3;  3K5T A;  3GZB A;  4FR9 A;  5D82 A;  1Y4K A;  5EQL A;  3WA3 A;  2ZL8 A;  1OHO A;  4HM3 B;  4LMI A;  1UUW B;  2CWT A;  3NV0 A;  4H3U A;  1W02 A;  1FGM A;  1IVX A;  2YFL B;  3G8Z A;  1VQ5 3;  1VQ9 3;  1VQN 3;  4R4K A;  2I9W A;  2WOF A;  3MG2 A;  1NB3 I;  3PGB A;  1OHS A;  1W6C A;  2PNC A;  1W00 A;  2OQE C;  3Q1C A;  1E97 A;  2W0Q A;  1GD4 A;  3LT8 A;  4LZI A;  1ULI B;  3MYT A;  4GL6 A;  1RN7 A;  3DMC A;  1YJ9 3;  1K73 4;  2RCD A;  3MKI A;  1RJO A;  4X2H A;  1R4C A;  1GD3 A;  2OCT A;  2Y73 A;  5AIF A;  3S29 A;  3M8C A;  3ER7 A;  5A0O B;  5IG0 A;  1JRQ A;  3CC2 3;  1WMO A;  2GXF A;  4NRE A;  2L4V A;  2JQ5 A;  3B4O A;  1AR0 A;  2E2T A;  3N9H A;  4J9A A;  2O3O A;  2LYX A;  2D1W A;  1K8A 4;  3DM8 A;  1F8N A;  2BMO B;  3NBJ A;  3EBY A;  3X3Y A;  2FGT A;  4L7K A;  4EBG A;  1RKY A;  3IJE B;  4I4K A;  1JB4 A;  3JUO A;  5CK6 A;  4GB5 A;  2XGL A;  1ROV A;  2Z77 A;  3K63 A;  2KCD A;  2BT3 A;  3KN4 A;  1TIJ A;  2OQE A;  3WOE B;  2GEY A;  1TU5 A;  3MG3 A;  1IQY A;  3MPH A;  3GAX A;  1KQS 2;  4PEJ A;  2INX A;  2W56 A;  5I97 A;  2OWP A;  1K9M 4;  3F9S A;  1G96 A;  4HM7 B;  1HU9 A;  1LNH A;  3KFQ C;  3KSE D;  2QIY A;  3VSY A;  2W6J H;  1FUW A;  3X41 A;  2W03 A;  1HKX A;  5AYS C;  3B4P A;  3DGO A;  1YHQ 3;  1KWI A;  4XDV A;  1IT7 A;  1CYV A;  3JUN A;  1JB5 A;  4EC6 A;  1E3R A;  3HK4 A;  1UI7 A;  3MHE A;  5CLK A;  1DMN A;  3U97 A;  1EG9 B;  4KVH A;  3CC7 3;  3NBR A;  3STD A;  2CFD A;  1W2B 2;  1JV2 B;  4LEH A;  1N5H A;  1N8R 4;  3MSO A;  1YIT 3;  2PZV A;  5CF1 A;  2ZDJ A;  2W56 B;  3NHX A;  1UW1 A;  3FG3 A;  4HZ9 B;  2P05 A;  1J2B A;  1Q86 4;  4HBR A;  4N6T A;  1AV4 A;  3WMD A;  1IQX A;  5IEO A;  1Q40 A;  1W01 A;  4WP5 A;  3WDG B;  2BO9 B;  3A76 A;  3NM7 A;  1QAL A;  3EJV A;  1SII A;  5IG5 A;  4JF8 A;  2HML B;  3VGN A;  2WGQ A;  3FH1 A;  3NM2 A;  1TFO A;  3LTB A;  3NQZ A;  1KC8 4;  3NBB A;  3S27 A;  1ZO2 A;  1LOX A;  3CCV 3;  4EV5 A;  4AEQ A;  4EV2 A;  4Q53 A;  3EHC A;  3LH4 A;  3PCS A;  3UJM A;  2MC8 A;  4OK0 A;  2CHC A;  1FGR A;  3D9R A;  1QJG A;  4MMZ B;  3V99 A;  5IG4 A;  1Q81 4;  1GYB A;  1FA3 A;  3OXA A;  1IVU A;  3I0Y A;  4K61 A;  4K1V A;  1OCV A;  2UX0 A;  2F99 A;  2XEP A;  2KXG A;  1ROA A;  3QK9 A;  3CCU 3;  3FG1 A;  3G71 3;  4R9K A;  2OOV A;  1WTH A;  3JUQ A;  3CCR 3;  1O7P B;  1YIJ 3;  3CD6 3;  3FGY A;  4STD A;  1STD A;  4QWT A;  1K28 A;  1W2Z A;  1T5Y A;  2W9Q A;  2K54 A;  1UI8 A;  2LQV A;  3HI7 A;  3FG4 A;  3HZP A;  3IMA B;  2CK3 H;  3BNE A;  1EA2 A;  1DMQ A;  1D6Y A;  1FGT A;  4HKV B;  2XGN A;  2CFW A;  3X3Z A;  2BHM A;  3OWY A;  2WO0 A;  4HVN A;  3X42 A;  5FGO A;  3EN1 B;  1JKG A;  5AIH A;  2GU3 A;  1UUV B;  4FCM A;  1WQL B;  2C10 A;  3DUK A;  1YVB I;  4G1M B;  4RBN A;  1OPY A;  2E2U A;  4O8S A;  2XRX B;  5EVH A;  2MF7 A;  4TX4 A;  4MEI A;  4K90 B;  3NV0 B;  1W5Z A;  3CPO A;  2CWU A;  3DZL A;  2QGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...