1M904

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1m90400
1VQL3 3CCU3 1KC84 1QVG2 1Q824 1VQM3 1W2B2 1YI23 1Q864 3CMA3 1YIT3 3CCV3 3CCL3 3CC23 1VQO3 3G4S3 3CC73 3CCJ3 1VQ53 1VQ83 3CC43 3CD63 3G713 2QEX3 1YJ93 1M1K4 3I563 3I553 3OW22 1VQK3 1QVF2 1K8A4 2OTJ3 1VQ43 1VQN3 1N8R4 1VQ73 3CCE3 3CCQ3 1YJN3 1M904 3G6E3 1K734 1VQ63 1YJW3 1S723 1JJ22 3CCM3 3CCR3 1Q7Y4 1KQS2 3CME3 3CCS3 3CXC2 1Q814 1YIJ3 2QA43 1K9M4 1VQP3 1NJI4 1KD14 3CPW2 2OTL3 1VQ93 1YHQ3
chains in the Genus database with same CATH superfamily
2QGUA 4J5KA 2F5MA 1QVG2 1RSNA 5AEUB 1VQM3 1RHLA 1IVXA 2KCDA 1O7MB 3SVAA 5IERA 1TTOA 3AMOA 1BNEA 1IV9A 1NU3A 4NPBA 2B1XB 1T3BA 3NXJA 1UI7A 3G16A 4FMCA 4N6OB 5EEOA 1OF5B 3RDEA 2CWVA 3D3LA 3NQZA 1PU4A 3G8ZA 1HYFA 2RBIA 3PCSA 4ORLA 5FW5A 1JB5A 3GAXA 4I4KA 1UCLA 1ZO2A 3X3XA 1YJW3 3EE1A 3NBRA 3GSPA 3NV0B 2GBWB 3NQYA 3QK9A 4R4KA 4RNTA 1K9M4 4QWTA 1K28A 2P0MA 2BNGA 2GSPA 3MWZA 1VQ93 1G02A 1CQSA 1MWRA 3K0ZA 2SBLA 3CCU3 4KVHA 1YNVX 1E3VA 1YVBI 1EUIC 2CFGA 2HMKB 1NB5I 3EN1B 4O2HA 4G1MB 2CC3A 2KRTA 4AKZA 3UB1A 3X3YA 1JV2B 5D83A 4K90B 5BIRA 2GXFA 1V58A 3S28A 2ML5A 2H0GA 4GB5A 3HZPA 3A5EA 2XFTA 6RNTA 5IG4A 1BAOA 1ROAA 2KF4A 1OH0A 2E2TA 1GY6A 3OWSA 1GYBA 1JZOA 3IPTA 1WMPA 1R4CA 8CHOA 3B4OA 4WFOA 1AY7A 2CFWA 4HM0B 4K1VA 9RNTA 3FF2A 1KD14 1EQKA 4DKIA 5M1AA 1NNVA 1X1XA 4HM6B 3ER7A 4ILFA 1KC84 1EG9B 5EQLA 1I8VA 3F9SA 3UJMA 4WHAA 5CXOA 2R4IA 1GMQA 4MEIA 4OK0A 1VQO3 3NM2A 5IEPA 3EBYA 1UCKA 2F56A 1Z1SA 3G713 2OOVA 2BO9B 1IT7A 1A2PA 1IQYA 1FUTA 4X2OA 1X1WA 1TU5A 1BNFA 1U8CB 3KSPA 1BSAA 3LOYA 5AIHA 3FG1A 4LYLB 4JRFA 3NBJA 2KF3A 3CCM3 5AYSC 3MYTA 4MMYB 4N6NB 3S29A 1BRHA 3A76A 1V57A 3FKAA 2IY2A 1GOVA 3KSED 3LXUX 1N9JA 4MMXB 1NB3I 3RNTA 1JKGB 1ZS7A 1RGEA 4BL3A 1W7CA 2JDIH 1NO3A 2IMJA 1AR0A 1W6CA 1L5GB 4AKYA 3AGOA 1X1UA 4LEHA 3VSYA 2GBXB 1IVWA 1LOWA 1BSBA 2IA7A 3BIRA 2OCTA 1M1K4 2GU1A 2J8XB 3KIIA 4CDLA 4GSPA 1VQN3 1DMMA 1JN5B 4K1UA 1N9EA 2F98A 1IT8A 3MKIA 2RFRA 4XDVA 4XBTA 1RJOA 1BOXA 2CG1A 4KT3B 1YJN3 1UGIA 3BU4A 2ZA4A 1IVVA 3B8LA 1JB2A 3SX1A 2LYXA 1BSEA 2W9PA 4WP5A 4L8OA 3UNLA 3SOYA 5M18A 2CFDA 2LQVA 1YIJ3 1UUGB 1FZUA 1TJDA 1GOUA 5BVBA 3RGRA 5I97A 3EBTA 3K7CA 4J9AA 1BNRA 1SQWA 2P05A 1QALA 1O7WB 3T8UA 3T8NA 3PZWA 3ZG5A 1OHPA 1HKXA 3K63A 4NHFA 2OQEC 1OHSA 4FMDA 2F99A 1B21A 3DGMA 1BRIA 1ULJB 3F8XA 1LXEA 1BVIA 4MMZB 1R4YA 2JQ5A 3AHSA 3K5TA 2CHCA 3I553 5AEWB 1U5OA 4R9LA 1E97A 1T5YA 3LT9A 3D9RA 2RNTA 2FNQA 1VQ73 3WR2A 1GY7A 1HU9A 5DREA 5KP4A 3FLJA 1UW1A 4HM5B 3ZG0A 3LT8A 3IJEB 2Z77A 1G96A 2XSHB 3L0RA 1FGOA 3HI7A 5ELUA 4HBRA 5FGOA 1N5HA 1TFOA 1I0XA 2E2VA 5IG5A 4KFEA 4BU4A 2AAEA 2XFSA 1SIHA 4XDWA 2W56A 4CCVA 2WOHA 5LC6A 3PCRA 1FYSA 1I3IA 4HOHA 2XH9A 1I2GA 1VQQA 2RSXA 3BLZA 1VQ53 1TP6A 1BGSA 3PGBA 3DMCA 3HIIA 1GOYA 4AEQA 3DGYA 3O8YA 1RRHA 1LNIA 3SEDA 3LTDA 2W04A 4FCJA 1LQMB 3G6E3 3OWYA 2C4BA 6STDA 1FW7A 1Y4KA 3OWUA 1PFPA 4K61A 1NDOB 4HKVB 2YFLB 3CPW2 2RGQA 2Z7AA 1OPYA 1VQL3 5STDA 3B7CA 3NHXA 1BU4A 1X1YA 3OV4A 1RCKA 1STDA 1YIT3 1JBTA 5JPUA 1BUJA 5G2GA 3CC73 3E99A 3JUQA 3U1WA 1DVDA 2WGOA 1ZGXA 2D42A 2F5WA 3GZBA 3OX9A 4L8PA 3UL6A 2HMMB 4FCMA 2W6JH 2CWTA 5AI1A 1RMSA 4L7KA 5CLKA 3EF8A 3F14A 3MSOA 1BNSA 3SYUA 1B3SA 1EA2A 5ELJA 2D1WA 4CJNA 1K734 1RDSA 8RNTA 2L1SA 3JUPA 3CCR3 4KZ1A 2K3DA 4LSOA 2ZL8A 1TRPA 1JB4A 1IV7A 4HM3B 4HM8B 4FR9A 1I0VA 5AIIA 5GSPA 1NJI4 3MG2A 3Q3FA 1JBRA 3KZTA 2GEXA 2XF3A 3EN8A 1LQGC 1C7HA 4R80A 2B24B 2CKFB 1S5AA 3GRDA 1KSIA 4HAAA 3WA3A 1UDII 1WMNA 3G4S3 3CCJ3 4STDA 5CF1A 3H3HA 1K41A 1RGLA 1RN4A 1WTHA 4HZBB 5TGNA 3BNCA 1M1XB 2HMOB 2OTJ3 1MWSA 1DE3A 1IDPA 1M904 3Q1CA 1J2BA 1LOVA 3CPOA 1KWIA 4OVMA 2CWUA 5D82A 3DGNA 1UUVB 1VZZA 1LNHA 1OF5A 4HVNA 4IT7A 3KCHA 4RZMA 3S5CA 1BANA 2KXGA 1OHOA 5RNTA 4CPKA 1O7HB 2IYJA 2I9WA 3FZWA 1QJGA 1Q9EA 3RGAA 3UL5A 2BMRB 1RKYA 1W02A 3NV0A 1CYVA 3AHWA 3LTBA 3M8CA 4EW5A 3CCL3 2M7OA 2CK3H 1LOYA 1I3FA 1VQ83 2CG0A 4EC6A 4EYCA 5IENA 2OWPA 2BU4A 2Y73A 1IYYA 2QIYA 4N6TA 3JVCA 1T2HA 1RGAA 3VGNA 1B27A 2BT3A 1BIRA 4EV5A 3GZYB 2CX0A 1GMPA 3LYGA 2BMQB 3QRDA 3FSDA 2STDA 1JJ22 1Q7Y4 1JRQA 4HM2B 3EQQB 2O9UX 3AMOB 1DMQA 4EV2A 1Q40A 3IMAB 3WA2X 3KKGA 3J7Yd 5KP1A 2XEPA 1A90A 3LMLA 1UCIA 3MPHA 3LH4A 4O02B 1N5PA 3CU3A 1I2EA 3DY5A 4RNYA 1QMAA 4HJLB 5IW9A 2HMLB 4J8TA 2GU3A 1ROVA 1LVNA 2QEX3 3CD63 1RTUA 3DGOA 2MC8A 3I563 1UUWB 4ZM8A 3SOAA 1CH0A 3D5IA 1BNJA 1D6YA 3ALAA 3WOEB 2RCDA 7RNTA 1Q42A 4FMBA 2KF6A 4BTXA 3KE7A 1HZ1A 2P09A 1VQ63 3CNMA 1S723 5IF6A 3PS8A 4RBNA 1MGRA 3GWRA 4TX4A 3B4PA 4WYKA 4GL6A 1BNGA 2BMOB 3STDA 4BTWA 1RN1A 3JUOA 1QAKA 1B2MA 4R1KA 3DM8A 3F7SA 3EX9A 3WHOA 1D6ZA 2XGNA 3D5GA 1W2B2 1YI23 3WMDA 2H0HA 3NX0A 1SIIA 2WGQA 3LTCA 3CC23 2HMNB 1IQ8A 1W5ZA 3SLUA 3AGNA 1GD4A 1JKGA 4GHOA 4O3VA 1MNLA 1TRQA 3OW22 4IPBA 3V92A 1B2SA 1BNIA 1MOLA 3OXAA 1PYLA 2F86B 2R41A 1I2FA 4HM7B 3WOFB 3MG3A 2PNCA 1AVLA 1B20A 2CFKA 3KFQC 3X3ZA 3WDGB 1YGEA 3F7XA 2INXA 4IIAA 4O8SA 2F4YA 5CF2A 5JBSA 1JN5A 1T2IA 2C10A 2P0XA 4JF8A 2L4VA 1VQP3 1WQLB 1BSDA 1IVUA 3DGLA 3FF0A 4XB5A 5G1LA 2OOVC 5G1KA 1TIJA 5EVHA 4KFFA 3VF1A 3T0UA 3CCV3 5IG0A 2IUJA 1IU7A 1ULIB 3Q2PA 2V1LA 1YJ93 3N54B 1YGWA 2H0IA 3D4AA 3PYJA 2UX0A 3WODG 1VQK3 3URPA 3DXOA 1F8NA 5BU4A 3V99A 1VQ43 1O7NB 1FUWA 1LOXA 2BHMA 2XSOB 2OQEA 1WNHA 1BRJA 1TFKA 2E2UA 1ASKA 1NWWA 1OGZA 3K9MC 4R9KA 3TDGA 1OACA 2W03A 2HOHA 1CYUA 1DYUA 4LMIA 1B2ZA 1OCVA 4H61A 4BL2A 1SPUA 3GZXB 1IK3A 1Q814 1ISKA 1W01A 3GZRA 2KF5A 1BRSA 2XGLA 3FG3A 1A2VA 1E3RA 1YHQ3 3ROBA 2Y74A 1Q7HA 1EEJA 1GMRA 1ZX2A 2BIRA 2W0QA 4HM1B 4U13A 3CMA3 2UUGC 3H51A 1RGFA 4XBXA 3V98A 6GSPA 4LZIA 3CC43 2YX9A 4XM4A 5HGRA 2K0MA 3ZFZA 1D6UA 1W2ZA 2YFIB 5CK6A 1LRAA 5JPPA 3U97A 1DVCA 1Q40B 3F40A 3N9HA 3JUNA 1N8R4 1BRNL 1BUQA 3CCQ3 4X2HA 1UCJA 3PXMA 3NUVA 1JNQA 3DUKA 4HZ9B 3JUMA 1AQZA 5KP3A 4N6MA 5IEOA 2IUKA 4PEJA 4HYZA 3EJVA 1MWTA 1UGHI 1EKMA 2OTL3 4J5GA 1FGMA 1DETA 1N8QA 3BB9A 4MJDA 4OUQA 1M9GA 3BNEA 1OGXA 4FMAA 4XBYA 4KFDA 5M19A 1RGHA 1STFI 2C11A 3CNXA 3EHCA 3Q90A 3X42A 4EBGA 4FCZA 1OUNA 5IG3A 4WYKB 1GS3A 1GSPA 1SARA 2FXTA 3FCSB 4N3VA 1FUSA 3DH2A 1MWUA 7GSPA 1IQXA 1RNBA 1BRGA 1RN7A 2SARA 1O7PB 3X41A 5A0OB 3S67A 3ECFA 5DRVA 2W56B 2XRXB 2CIUA 3CME3 1FGTA 1V74A 1CEWI 2A15A 2PZVA 2YFJB 1AV4A 1I70A 5HOHA 2MF7A 1RCLA 3MHEA 1JBSA 1PY3A 1A2KA 3NBBA 5AIFA 2ML6A 1UI8A 2CH9A 1AVKA 1C54A 3FH1A 3MG1A 3S27A 1GD3A 1FA3A 3HIGA 7STDA 3HK4A 1A67A 2FGTA 4LGQA 1YVSA 5D81A 2Z76A 2AADA 4H3UA 1FGQA 5AIGA 1QVF2 1SJWA 1US1A 5BXQA 2HMJB 3I0YA 4WWUC 1MGWA 4RNZA 3SXXA 4BIRA 4BTYA 3LTAA 1RGGA 3DZLA 1BRKA 3D79A 1TUHA 3HOHA 4N6V0 2W9QA 3LZAA 2CX1A 2Q07A 1KQS2 3CCS3 3CXC2 2QA43 1B2UA 1JZDA 2W2CA 2ZDJA 1G0TA 2WOFA 4EXRA 1RGCA 2ZHXB 1RNTA 1Q824 2GEYA 1GY5A 3F8HA 1Q864 1W6GA 5AYRB 4N6UA 2CW9A 4I5QA 3KN4A 1DMNA 1O7GB 1W4NA 4Q53A 2XR8B 2KAAA 1FGRA 3G0KA 2K54A 1K8A4 3EC9A 3EB8A 1B2XA 2UGIA 3CCE3 1BSCA 2CFLA 3HX8A 3FG4A 5LC7A 4N6LA 1RGKA 3BNDA 1WMOA 2Z6BA 2WO0A 3BNBA 2P38A 1RRLA 4HM4B 2O3OA 3N8BA 3NM7A 3X40A 4NREA 1W6YA 1RLSA 1QAFA 1W00A 3FGYA
chains in the Genus database with same CATH topology
2QGUA 1QVG2 5AEUB 1VQM3 2KCDA 1IVXA 3SVAA 1O7MB 5IERA 3AMOA 1IV9A 1NU3A 2B1XB 3NXJA 1UI7A 3G16A 4FMCA 4N6OB 5EEOA 1OF5B 3RDEA 2CWVA 3D3LA 3NQZA 1PU4A 3G8ZA 3PCSA 5FW5A 4ORLA 1JB5A 3GAXA 4I4KA 1ZO2A 3X3XA 1YJW3 3EE1A 3NBRA 3NV0B 4R4KA 2GBWB 3NQYA 3QK9A 1K9M4 4QWTA 1K28A 2P0MA 2BNGA 3MWZA 1VQ93 1CQSA 3K0ZA 3CCU3 2SBLA 4KVHA 1YVBI 1E3VA 2CFGA 2HMKB 1NB5I 3EN1B 4O2HA 4G1MB 2CC3A 2KRTA 4AKZA 3UB1A 3X3YA 1JV2B 5D83A 4K90B 2GXFA 3S28A 2ML5A 4GB5A 3HZPA 2XFTA 5IG4A 1ROAA 1OH0A 2E2TA 1GY6A 3OWSA 1GYBA 3IPTA 1WMPA 1R4CA 8CHOA 3B4OA 4WFOA 2CFWA 4HM0B 4K1VA 1KD14 3FF2A 1EQKA 4HM6B 3ER7A 1KC84 1EG9B 5EQLA 3F9SA 3UJMA 4WHAA 5CXOA 2R4IA 4MEIA 4OK0A 1VQO3 3NM2A 5IEPA 3EBYA 1Z1SA 3G713 2OOVA 2BO9B 1IT7A 4X2OA 1IQYA 1TU5A 1U8CB 3KSPA 3LOYA 5AIHA 3FG1A 4JRFA 3NBJA 3CCM3 5AYSC 3MYTA 4MMYB 4N6NB 3S29A 3A76A 3FKAA 3KSED 3LXUX 1N9JA 4MMXB 1NB3I 1JKGB 1W7CA 2JDIH 1NO3A 2IMJA 1AR0A 1W6CA 1L5GB 4AKYA 4LEHA 3VSYA 2GBXB 1IVWA 2IA7A 2OCTA 1M1K4 2GU1A 3KIIA 4CDLA 1VQN3 1DMMA 1JN5B 4K1UA 1N9EA 2F98A 1IT8A 3MKIA 2RFRA 4XDVA 4XBTA 1RJOA 2CG1A 1YJN3 1IVVA 3B8LA 1JB2A 3SX1A 2LYXA 2W9PA 4WP5A 4L8OA 3UNLA 3SOYA 2CFDA 2LQVA 1YIJ3 5BVBA 3RGRA 5I97A 3EBTA 3K7CA 4J9AA 1SQWA 2P05A 1QALA 1O7WB 3T8UA 3T8NA 3PZWA 1OHPA 1HKXA 3K63A 4NHFA 2OQEC 1OHSA 4FMDA 2F99A 3DGMA 1ULJB 3F8XA 1LXEA 4MMZB 2JQ5A 3K5TA 2CHCA 3I553 5AEWB 1U5OA 4R9LA 1E97A 1T5YA 3LT9A 3D9RA 2FNQA 1VQ73 1GY7A 1HU9A 5DREA 5KP4A 3FLJA 1UW1A 4HM5B 3LT8A 3IJEB 2Z77A 1G96A 2XSHB 3L0RA 1FGOA 3HI7A 5ELUA 4HBRA 5FGOA 1N5HA 1TFOA 2E2VA 5IG5A 4KFEA 2XFSA 1SIHA 4XDWA 2W56A 4CCVA 2WOHA 5LC6A 3PCRA 2XH9A 2RSXA 3BLZA 1VQ53 1TP6A 3PGBA 3DMCA 3HIIA 4AEQA 3O8YA 1RRHA 3SEDA 3LTDA 2W04A 4FCJA 3G6E3 3OWYA 6STDA 1Y4KA 3OWUA 1PFPA 4K61A 1NDOB 4HKVB 2YFLB 3CPW2 2RGQA 2Z7AA 1OPYA 1VQL3 5STDA 3B7CA 3NHXA 3OV4A 1STDA 1YIT3 5JPUA 5G2GA 3CC73 3E99A 3JUQA 3U1WA 1DVDA 2WGOA 2D42A 3GZBA 3OX9A 3UL6A 4L8PA 2HMMB 4FCMA 2W6JH 2CWTA 5AI1A 4L7KA 5CLKA 3EF8A 3F14A 3MSOA 1EA2A 5ELJA 2D1WA 1K734 3JUPA 3CCR3 4KZ1A 4LSOA 2ZL8A 1JB4A 1IV7A 4HM3B 4HM8B 4FR9A 5AIIA 1NJI4 3MG2A 3KZTA 2GEXA 2XF3A 3EN8A 1C7HA 4R80A 2B24B 2CKFB 1S5AA 3GRDA 1KSIA 3WA3A 1WMNA 3G4S3 3CCJ3 4STDA 5CF1A 3H3HA 1K41A 1WTHA 4HZBB 5TGNA 3BNCA 1M1XB 2HMOB 2OTJ3 1IDPA 1M904 3Q1CA 1J2BA 3CPOA 5D82A 1KWIA 4OVMA 2CWUA 3DGNA 1UUVB 1VZZA 1LNHA 1OF5A 4HVNA 4IT7A 4RZMA 3S5CA 2KXGA 1OHOA 1O7HB 3FZWA 2I9WA 1QJGA 3RGAA 3UL5A 2BMRB 1RKYA 1W02A 3NV0A 1CYVA 3LTBA 3M8CA 3CCL3 2M7OA 2CK3H 1VQ83 2CG0A 4EC6A 4EYCA 5IENA 2OWPA 2Y73A 2QIYA 4N6TA 3JVCA 3VGNA 2BT3A 4EV5A 3GZYB 3LYGA 2BMQB 3QRDA 3FSDA 2STDA 1JJ22 1Q7Y4 1JRQA 4HM2B 3EQQB 2O9UX 3AMOB 1DMQA 4EV2A 1Q40A 3IMAB 3WA2X 3KKGA 3J7Yd 5KP1A 2XEPA 1A90A 3LMLA 3MPHA 3LH4A 4O02B 1N5PA 3CU3A 3DY5A 4RNYA 1QMAA 4HJLB 5IW9A 2HMLB 4J8TA 2GU3A 1ROVA 1LVNA 2QEX3 3CD63 3DGOA 2MC8A 3I563 1UUWB 4ZM8A 3SOAA 1D6YA 3ALAA 3WOEB 2RCDA 1Q42A 4FMBA 4BTXA 3KE7A 2P09A 1VQ63 3CNMA 1S723 5IF6A 3PS8A 4RBNA 3GWRA 4TX4A 3B4PA 4WYKA 4GL6A 2BMOB 3STDA 4BTWA 3JUOA 1QAKA 4R1KA 3DM8A 3F7SA 3EX9A 1D6ZA 2XGNA 1W2B2 1YI23 3WMDA 3NX0A 1SIIA 2WGQA 3LTCA 3CC23 2HMNB 1IQ8A 1W5ZA 3SLUA 1GD4A 1JKGA 4O3VA 1MNLA 3OW22 4IPBA 3V92A 1MOLA 3OXAA 2F86B 4HM7B 3WOFB 3MG3A 2PNCA 1AVLA 2CFKA 3KFQC 3X3ZA 3WDGB 1YGEA 3F7XA 2INXA 4IIAA 4O8SA 5CF2A 5JBSA 1JN5A 2C10A 2P0XA 4JF8A 1VQP3 2L4VA 1WQLB 1IVUA 3DGLA 3FF0A 4XB5A 2OOVC 1TIJA 5EVHA 4KFFA 3VF1A 3T0UA 3CCV3 5IG0A 2IUJA 1IU7A 1ULIB 3Q2PA 2V1LA 1YJ93 3N54B 3PYJA 1VQK3 2UX0A 3WODG 3DXOA 1F8NA 3V99A 1VQ43 1O7NB 1FUWA 1LOXA 2XSOB 2BHMA 2OQEA 1WNHA 1TFKA 2E2UA 1ASKA 1NWWA 1OGZA 3K9MC 4R9KA 3TDGA 1OACA 2W03A 1CYUA 1DYUA 4LMIA 1OCVA 4H61A 1IK3A 1Q814 1SPUA 3GZXB 1ISKA 1W01A 3GZRA 2XGLA 3FG3A 1A2VA 1E3RA 1YHQ3 3ROBA 2Y74A 1ZX2A 2W0QA 4HM1B 4U13A 3CMA3 3H51A 3V98A 4XBXA 3CC43 4LZIA 2YX9A 4XM4A 5HGRA 2K0MA 1D6UA 1W2ZA 2YFIB 5CK6A 5JPPA 1BUQA 3U97A 1DVCA 1Q40B 3F40A 3N9HA 3JUNA 1N8R4 3CCQ3 4X2HA 3PXMA 3NUVA 1JNQA 3DUKA 4HZ9B 3JUMA 5KP3A 4N6MA 5IEOA 2IUKA 4PEJA 4HYZA 3EJVA 1EKMA 2OTL3 1FGMA 1N8QA 3BB9A 4MJDA 4OUQA 1M9GA 3BNEA 1OGXA 4FMAA 4XBYA 4KFDA 1STFI 3Q90A 2C11A 3CNXA 3EHCA 3X42A 4EBGA 4FCZA 1OUNA 5IG3A 4WYKB 1GS3A 2FXTA 3FCSB 4N3VA 1IQXA 1RN7A 5A0OB 1O7PB 3X41A 3S67A 3ECFA 5DRVA 2W56B 2XRXB 2CIUA 3CME3 1FGTA 1V74A 1CEWI 2A15A 2PZVA 2YFJB 1AV4A 2MF7A 3MHEA 1A2KA 3NBBA 5AIFA 2ML6A 1UI8A 2CH9A 1AVKA 3FH1A 3MG1A 3S27A 1GD3A 1FA3A 3HIGA 7STDA 3HK4A 1A67A 2FGTA 4LGQA 5D81A 2Z76A 4H3UA 1FGQA 5AIGA 1QVF2 1SJWA 1US1A 5BXQA 2HMJB 3I0YA 4WWUC 4RNZA 4BTYA 3SXXA 3LTAA 3DZLA 4N6V0 1TUHA 2W9QA 3LZAA 2Q07A 1KQS2 3CCS3 3CXC2 2QA43 2W2CA 2ZDJA 2WOFA 4EXRA 1Q824 2GEYA 1GY5A 3F8HA 1Q864 1W6GA 5AYRB 4N6UA 2CW9A 3KN4A 1DMNA 1O7GB 1W4NA 4Q53A 2XR8B 1FGRA 3G0KA 2K54A 1K8A4 3EC9A 3EB8A 3CCE3 2CFLA 3HX8A 3FG4A 5LC7A 4N6LA 3BNDA 1WMOA 2Z6BA 2WO0A 3BNBA 2P38A 1RRLA 4HM4B 2O3OA 3N8BA 3NM7A 3X40A 4NREA 1W6YA 1QAFA 1W00A 3FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL 3;  3CCU 3;  1KC8 4;  1QVG 2;  1Q82 4;  1VQM 3;  1W2B 2;  1YI2 3;  1Q86 4;  3CMA 3;  1YIT 3;  3CCV 3;  3CCL 3;  3CC2 3;  1VQO 3;  3G4S 3;  3CC7 3;  3CCJ 3;  1VQ5 3;  1VQ8 3;  3CC4 3;  3CD6 3;  3G71 3;  2QEX 3;  1YJ9 3;  1M1K 4;  3I56 3;  3I55 3;  3OW2 2;  1VQK 3;  1QVF 2;  1K8A 4;  2OTJ 3;  1VQ4 3;  1VQN 3;  1N8R 4;  1VQ7 3;  3CCE 3;  3CCQ 3;  1YJN 3;  1M90 4;  3G6E 3;  1K73 4;  1VQ6 3;  1YJW 3;  1S72 3;  1JJ2 2;  3CCM 3;  3CCR 3;  1Q7Y 4;  1KQS 2;  3CME 3;  3CCS 3;  3CXC 2;  1Q81 4;  1YIJ 3;  2QA4 3;  1K9M 4;  1VQP 3;  1NJI 4;  1KD1 4;  3CPW 2;  2OTL 3;  1VQ9 3;  1YHQ 3; 
#chains in the Genus database with same CATH topology
 2QGU A;  4J5K A;  2F5M A;  1QVG 2;  1RSN A;  5AEU B;  1VQM 3;  1RHL A;  1IVX A;  2KCD A;  1O7M B;  3SVA A;  5IER A;  1TTO A;  3AMO A;  1BNE A;  1IV9 A;  1NU3 A;  4NPB A;  2B1X B;  1T3B A;  3NXJ A;  1UI7 A;  3G16 A;  4FMC A;  4N6O B;  5EEO A;  1OF5 B;  3RDE A;  2CWV A;  3D3L A;  3NQZ A;  1PU4 A;  3G8Z A;  1HYF A;  2RBI A;  3PCS A;  4ORL A;  5FW5 A;  1JB5 A;  3GAX A;  4I4K A;  1UCL A;  1ZO2 A;  3X3X A;  1YJW 3;  3EE1 A;  3NBR A;  3GSP A;  3NV0 B;  2GBW B;  3NQY A;  3QK9 A;  4R4K A;  4RNT A;  1K9M 4;  4QWT A;  1K28 A;  2P0M A;  2BNG A;  2GSP A;  3MWZ A;  1VQ9 3;  1G02 A;  1CQS A;  1MWR A;  3K0Z A;  2SBL A;  3CCU 3;  4KVH A;  1YNV X;  1E3V A;  1YVB I;  1EUI C;  2CFG A;  2HMK B;  1NB5 I;  3EN1 B;  4O2H A;  4G1M B;  2CC3 A;  2KRT A;  4AKZ A;  3UB1 A;  3X3Y A;  1JV2 B;  5D83 A;  4K90 B;  5BIR A;  2GXF A;  1V58 A;  3S28 A;  2ML5 A;  2H0G A;  4GB5 A;  3HZP A;  3A5E A;  2XFT A;  6RNT A;  5IG4 A;  1BAO A;  1ROA A;  2KF4 A;  1OH0 A;  2E2T A;  1GY6 A;  3OWS A;  1GYB A;  1JZO A;  3IPT A;  1WMP A;  1R4C A;  8CHO A;  3B4O A;  4WFO A;  1AY7 A;  2CFW A;  4HM0 B;  4K1V A;  9RNT A;  3FF2 A;  1KD1 4;  1EQK A;  4DKI A;  5M1A A;  1NNV A;  1X1X A;  4HM6 B;  3ER7 A;  4ILF A;  1KC8 4;  1EG9 B;  5EQL A;  1I8V A;  3F9S A;  3UJM A;  4WHA A;  5CXO A;  2R4I A;  1GMQ A;  4MEI A;  4OK0 A;  1VQO 3;  3NM2 A;  5IEP A;  3EBY A;  1UCK A;  2F56 A;  1Z1S A;  3G71 3;  2OOV A;  2BO9 B;  1IT7 A;  1A2P A;  1IQY A;  1FUT A;  4X2O A;  1X1W A;  1TU5 A;  1BNF A;  1U8C B;  3KSP A;  1BSA A;  3LOY A;  5AIH A;  3FG1 A;  4LYL B;  4JRF A;  3NBJ A;  2KF3 A;  3CCM 3;  5AYS C;  3MYT A;  4MMY B;  4N6N B;  3S29 A;  1BRH A;  3A76 A;  1V57 A;  3FKA A;  2IY2 A;  1GOV A;  3KSE D;  3LXU X;  1N9J A;  4MMX B;  1NB3 I;  3RNT A;  1JKG B;  1ZS7 A;  1RGE A;  4BL3 A;  1W7C A;  2JDI H;  1NO3 A;  2IMJ A;  1AR0 A;  1W6C A;  1L5G B;  4AKY A;  3AGO A;  1X1U A;  4LEH A;  3VSY A;  2GBX B;  1IVW A;  1LOW A;  1BSB A;  2IA7 A;  3BIR A;  2OCT A;  1M1K 4;  2GU1 A;  2J8X B;  3KII A;  4CDL A;  4GSP A;  1VQN 3;  1DMM A;  1JN5 B;  4K1U A;  1N9E A;  2F98 A;  1IT8 A;  3MKI A;  2RFR A;  4XDV A;  4XBT A;  1RJO A;  1BOX A;  2CG1 A;  4KT3 B;  1YJN 3;  1UGI A;  3BU4 A;  2ZA4 A;  1IVV A;  3B8L A;  1JB2 A;  3SX1 A;  2LYX A;  1BSE A;  2W9P A;  4WP5 A;  4L8O A;  3UNL A;  3SOY A;  5M18 A;  2CFD A;  2LQV A;  1YIJ 3;  1UUG B;  1FZU A;  1TJD A;  1GOU A;  5BVB A;  3RGR A;  5I97 A;  3EBT A;  3K7C A;  4J9A A;  1BNR A;  1SQW A;  2P05 A;  1QAL A;  1O7W B;  3T8U A;  3T8N A;  3PZW A;  3ZG5 A;  1OHP A;  1HKX A;  3K63 A;  4NHF A;  2OQE C;  1OHS A;  4FMD A;  2F99 A;  1B21 A;  3DGM A;  1BRI A;  1ULJ B;  3F8X A;  1LXE A;  1BVI A;  4MMZ B;  1R4Y A;  2JQ5 A;  3AHS A;  3K5T A;  2CHC A;  3I55 3;  5AEW B;  1U5O A;  4R9L A;  1E97 A;  1T5Y A;  3LT9 A;  3D9R A;  2RNT A;  2FNQ A;  1VQ7 3;  3WR2 A;  1GY7 A;  1HU9 A;  5DRE A;  5KP4 A;  3FLJ A;  1UW1 A;  4HM5 B;  3ZG0 A;  3LT8 A;  3IJE B;  2Z77 A;  1G96 A;  2XSH B;  3L0R A;  1FGO A;  3HI7 A;  5ELU A;  4HBR A;  5FGO A;  1N5H A;  1TFO A;  1I0X A;  2E2V A;  5IG5 A;  4KFE A;  4BU4 A;  2AAE A;  2XFS A;  1SIH A;  4XDW A;  2W56 A;  4CCV A;  2WOH A;  5LC6 A;  3PCR A;  1FYS A;  1I3I A;  4HOH A;  2XH9 A;  1I2G A;  1VQQ A;  2RSX A;  3BLZ A;  1VQ5 3;  1TP6 A;  1BGS A;  3PGB A;  3DMC A;  3HII A;  1GOY A;  4AEQ A;  3DGY A;  3O8Y A;  1RRH A;  1LNI A;  3SED A;  3LTD A;  2W04 A;  4FCJ A;  1LQM B;  3G6E 3;  3OWY A;  2C4B A;  6STD A;  1FW7 A;  1Y4K A;  3OWU A;  1PFP A;  4K61 A;  1NDO B;  4HKV B;  2YFL B;  3CPW 2;  2RGQ A;  2Z7A A;  1OPY A;  1VQL 3;  5STD A;  3B7C A;  3NHX A;  1BU4 A;  1X1Y A;  3OV4 A;  1RCK A;  1STD A;  1YIT 3;  1JBT A;  5JPU A;  1BUJ A;  5G2G A;  3CC7 3;  3E99 A;  3JUQ A;  3U1W A;  1DVD A;  2WGO A;  1ZGX A;  2D42 A;  2F5W A;  3GZB A;  3OX9 A;  4L8P A;  3UL6 A;  2HMM B;  4FCM A;  2W6J H;  2CWT A;  5AI1 A;  1RMS A;  4L7K A;  5CLK A;  3EF8 A;  3F14 A;  3MSO A;  1BNS A;  3SYU A;  1B3S A;  1EA2 A;  5ELJ A;  2D1W A;  4CJN A;  1K73 4;  1RDS A;  8RNT A;  2L1S A;  3JUP A;  3CCR 3;  4KZ1 A;  2K3D A;  4LSO A;  2ZL8 A;  1TRP A;  1JB4 A;  1IV7 A;  4HM3 B;  4HM8 B;  4FR9 A;  1I0V A;  5AII A;  5GSP A;  1NJI 4;  3MG2 A;  3Q3F A;  1JBR A;  3KZT A;  2GEX A;  2XF3 A;  3EN8 A;  1LQG C;  1C7H A;  4R80 A;  2B24 B;  2CKF B;  1S5A A;  3GRD A;  1KSI A;  4HAA A;  3WA3 A;  1UDI I;  1WMN A;  3G4S 3;  3CCJ 3;  4STD A;  5CF1 A;  3H3H A;  1K41 A;  1RGL A;  1RN4 A;  1WTH A;  4HZB B;  5TGN A;  3BNC A;  1M1X B;  2HMO B;  2OTJ 3;  1MWS A;  1DE3 A;  1IDP A;  1M90 4;  3Q1C A;  1J2B A;  1LOV A;  3CPO A;  1KWI A;  4OVM A;  2CWU A;  5D82 A;  3DGN A;  1UUV B;  1VZZ A;  1LNH A;  1OF5 A;  4HVN A;  4IT7 A;  3KCH A;  4RZM A;  3S5C A;  1BAN A;  2KXG A;  1OHO A;  5RNT A;  4CPK A;  1O7H B;  2IYJ A;  2I9W A;  3FZW A;  1QJG A;  1Q9E A;  3RGA A;  3UL5 A;  2BMR B;  1RKY A;  1W02 A;  3NV0 A;  1CYV A;  3AHW A;  3LTB A;  3M8C A;  4EW5 A;  3CCL 3;  2M7O A;  2CK3 H;  1LOY A;  1I3F A;  1VQ8 3;  2CG0 A;  4EC6 A;  4EYC A;  5IEN A;  2OWP A;  2BU4 A;  2Y73 A;  1IYY A;  2QIY A;  4N6T A;  3JVC A;  1T2H A;  1RGA A;  3VGN A;  1B27 A;  2BT3 A;  1BIR A;  4EV5 A;  3GZY B;  2CX0 A;  1GMP A;  3LYG A;  2BMQ B;  3QRD A;  3FSD A;  2STD A;  1JJ2 2;  1Q7Y 4;  1JRQ A;  4HM2 B;  3EQQ B;  2O9U X;  3AMO B;  1DMQ A;  4EV2 A;  1Q40 A;  3IMA B;  3WA2 X;  3KKG A;  3J7Y d;  5KP1 A;  2XEP A;  1A90 A;  3LML A;  1UCI A;  3MPH A;  3LH4 A;  4O02 B;  1N5P A;  3CU3 A;  1I2E A;  3DY5 A;  4RNY A;  1QMA A;  4HJL B;  5IW9 A;  2HML B;  4J8T A;  2GU3 A;  1ROV A;  1LVN A;  2QEX 3;  3CD6 3;  1RTU A;  3DGO A;  2MC8 A;  3I56 3;  1UUW B;  4ZM8 A;  3SOA A;  1CH0 A;  3D5I A;  1BNJ A;  1D6Y A;  3ALA A;  3WOE B;  2RCD A;  7RNT A;  1Q42 A;  4FMB A;  2KF6 A;  4BTX A;  3KE7 A;  1HZ1 A;  2P09 A;  1VQ6 3;  3CNM A;  1S72 3;  5IF6 A;  3PS8 A;  4RBN A;  1MGR A;  3GWR A;  4TX4 A;  3B4P A;  4WYK A;  4GL6 A;  1BNG A;  2BMO B;  3STD A;  4BTW A;  1RN1 A;  3JUO A;  1QAK A;  1B2M A;  4R1K A;  3DM8 A;  3F7S A;  3EX9 A;  3WHO A;  1D6Z A;  2XGN A;  3D5G A;  1W2B 2;  1YI2 3;  3WMD A;  2H0H A;  3NX0 A;  1SII A;  2WGQ A;  3LTC A;  3CC2 3;  2HMN B;  1IQ8 A;  1W5Z A;  3SLU A;  3AGN A;  1GD4 A;  1JKG A;  4GHO A;  4O3V A;  1MNL A;  1TRQ A;  3OW2 2;  4IPB A;  3V92 A;  1B2S A;  1BNI A;  1MOL A;  3OXA A;  1PYL A;  2F86 B;  2R41 A;  1I2F A;  4HM7 B;  3WOF B;  3MG3 A;  2PNC A;  1AVL A;  1B20 A;  2CFK A;  3KFQ C;  3X3Z A;  3WDG B;  1YGE A;  3F7X A;  2INX A;  4IIA A;  4O8S A;  2F4Y A;  5CF2 A;  5JBS A;  1JN5 A;  1T2I A;  2C10 A;  2P0X A;  4JF8 A;  2L4V A;  1VQP 3;  1WQL B;  1BSD A;  1IVU A;  3DGL A;  3FF0 A;  4XB5 A;  5G1L A;  2OOV C;  5G1K A;  1TIJ A;  5EVH A;  4KFF A;  3VF1 A;  3T0U A;  3CCV 3;  5IG0 A;  2IUJ A;  1IU7 A;  1ULI B;  3Q2P A;  2V1L A;  1YJ9 3;  3N54 B;  1YGW A;  2H0I A;  3D4A A;  3PYJ A;  2UX0 A;  3WOD G;  1VQK 3;  3URP A;  3DXO A;  1F8N A;  5BU4 A;  3V99 A;  1VQ4 3;  1O7N B;  1FUW A;  1LOX A;  2BHM A;  2XSO B;  2OQE A;  1WNH A;  1BRJ A;  1TFK A;  2E2U A;  1ASK A;  1NWW A;  1OGZ A;  3K9M C;  4R9K A;  3TDG A;  1OAC A;  2W03 A;  2HOH A;  1CYU A;  1DYU A;  4LMI A;  1B2Z A;  1OCV A;  4H61 A;  4BL2 A;  1SPU A;  3GZX B;  1IK3 A;  1Q81 4;  1ISK A;  1W01 A;  3GZR A;  2KF5 A;  1BRS A;  2XGL A;  3FG3 A;  1A2V A;  1E3R A;  1YHQ 3;  3ROB A;  2Y74 A;  1Q7H A;  1EEJ A;  1GMR A;  1ZX2 A;  2BIR A;  2W0Q A;  4HM1 B;  4U13 A;  3CMA 3;  2UUG C;  3H51 A;  1RGF A;  4XBX A;  3V98 A;  6GSP A;  4LZI A;  3CC4 3;  2YX9 A;  4XM4 A;  5HGR A;  2K0M A;  3ZFZ A;  1D6U A;  1W2Z A;  2YFI B;  5CK6 A;  1LRA A;  5JPP A;  3U97 A;  1DVC A;  1Q40 B;  3F40 A;  3N9H A;  3JUN A;  1N8R 4;  1BRN L;  1BUQ A;  3CCQ 3;  4X2H A;  1UCJ A;  3PXM A;  3NUV A;  1JNQ A;  3DUK A;  4HZ9 B;  3JUM A;  1AQZ A;  5KP3 A;  4N6M A;  5IEO A;  2IUK A;  4PEJ A;  4HYZ A;  3EJV A;  1MWT A;  1UGH I;  1EKM A;  2OTL 3;  4J5G A;  1FGM A;  1DET A;  1N8Q A;  3BB9 A;  4MJD A;  4OUQ A;  1M9G A;  3BNE A;  1OGX A;  4FMA A;  4XBY A;  4KFD A;  5M19 A;  1RGH A;  1STF I;  2C11 A;  3CNX A;  3EHC A;  3Q90 A;  3X42 A;  4EBG A;  4FCZ A;  1OUN A;  5IG3 A;  4WYK B;  1GS3 A;  1GSP A;  1SAR A;  2FXT A;  3FCS B;  4N3V A;  1FUS A;  3DH2 A;  1MWU A;  7GSP A;  1IQX A;  1RNB A;  1BRG A;  1RN7 A;  2SAR A;  1O7P B;  3X41 A;  5A0O B;  3S67 A;  3ECF A;  5DRV A;  2W56 B;  2XRX B;  2CIU A;  3CME 3;  1FGT A;  1V74 A;  1CEW I;  2A15 A;  2PZV A;  2YFJ B;  1AV4 A;  1I70 A;  5HOH A;  2MF7 A;  1RCL A;  3MHE A;  1JBS A;  1PY3 A;  1A2K A;  3NBB A;  5AIF A;  2ML6 A;  1UI8 A;  2CH9 A;  1AVK A;  1C54 A;  3FH1 A;  3MG1 A;  3S27 A;  1GD3 A;  1FA3 A;  3HIG A;  7STD A;  3HK4 A;  1A67 A;  2FGT A;  4LGQ A;  1YVS A;  5D81 A;  2Z76 A;  2AAD A;  4H3U A;  1FGQ A;  5AIG A;  1QVF 2;  1SJW A;  1US1 A;  5BXQ A;  2HMJ B;  3I0Y A;  4WWU C;  1MGW A;  4RNZ A;  3SXX A;  4BIR A;  4BTY A;  3LTA A;  1RGG A;  3DZL A;  1BRK A;  3D79 A;  1TUH A;  3HOH A;  4N6V 0;  2W9Q A;  3LZA A;  2CX1 A;  2Q07 A;  1KQS 2;  3CCS 3;  3CXC 2;  2QA4 3;  1B2U A;  1JZD A;  2W2C A;  2ZDJ A;  1G0T A;  2WOF A;  4EXR A;  1RGC A;  2ZHX B;  1RNT A;  1Q82 4;  2GEY A;  1GY5 A;  3F8H A;  1Q86 4;  1W6G A;  5AYR B;  4N6U A;  2CW9 A;  4I5Q A;  3KN4 A;  1DMN A;  1O7G B;  1W4N A;  4Q53 A;  2XR8 B;  2KAA A;  1FGR A;  3G0K A;  2K54 A;  1K8A 4;  3EC9 A;  3EB8 A;  1B2X A;  2UGI A;  3CCE 3;  1BSC A;  2CFL A;  3HX8 A;  3FG4 A;  5LC7 A;  4N6L A;  1RGK A;  3BND A;  1WMO A;  2Z6B A;  2WO0 A;  3BNB A;  2P38 A;  1RRL A;  4HM4 B;  2O3O A;  3N8B A;  3NM7 A;  3X40 A;  4NRE A;  1W6Y A;  1RLS A;  1QAF A;  1W00 A;  3FGY A; 
#chains in the Genus database with same CATH homology
 2QGU A;  1QVG 2;  5AEU B;  1VQM 3;  2KCD A;  1IVX A;  3SVA A;  1O7M B;  5IER A;  3AMO A;  1IV9 A;  1NU3 A;  2B1X B;  3NXJ A;  1UI7 A;  3G16 A;  4FMC A;  4N6O B;  5EEO A;  1OF5 B;  3RDE A;  2CWV A;  3D3L A;  3NQZ A;  1PU4 A;  3G8Z A;  3PCS A;  5FW5 A;  4ORL A;  1JB5 A;  3GAX A;  4I4K A;  1ZO2 A;  3X3X A;  1YJW 3;  3EE1 A;  3NBR A;  3NV0 B;  4R4K A;  2GBW B;  3NQY A;  3QK9 A;  1K9M 4;  4QWT A;  1K28 A;  2P0M A;  2BNG A;  3MWZ A;  1VQ9 3;  1CQS A;  3K0Z A;  3CCU 3;  2SBL A;  4KVH A;  1YVB I;  1E3V A;  2CFG A;  2HMK B;  1NB5 I;  3EN1 B;  4O2H A;  4G1M B;  2CC3 A;  2KRT A;  4AKZ A;  3UB1 A;  3X3Y A;  1JV2 B;  5D83 A;  4K90 B;  2GXF A;  3S28 A;  2ML5 A;  4GB5 A;  3HZP A;  2XFT A;  5IG4 A;  1ROA A;  1OH0 A;  2E2T A;  1GY6 A;  3OWS A;  1GYB A;  3IPT A;  1WMP A;  1R4C A;  8CHO A;  3B4O A;  4WFO A;  2CFW A;  4HM0 B;  4K1V A;  1KD1 4;  3FF2 A;  1EQK A;  4HM6 B;  3ER7 A;  1KC8 4;  1EG9 B;  5EQL A;  3F9S A;  3UJM A;  4WHA A;  5CXO A;  2R4I A;  4MEI A;  4OK0 A;  1VQO 3;  3NM2 A;  5IEP A;  3EBY A;  1Z1S A;  3G71 3;  2OOV A;  2BO9 B;  1IT7 A;  4X2O A;  1IQY A;  1TU5 A;  1U8C B;  3KSP A;  3LOY A;  5AIH A;  3FG1 A;  4JRF A;  3NBJ A;  3CCM 3;  5AYS C;  3MYT A;  4MMY B;  4N6N B;  3S29 A;  3A76 A;  3FKA A;  3KSE D;  3LXU X;  1N9J A;  4MMX B;  1NB3 I;  1JKG B;  1W7C A;  2JDI H;  1NO3 A;  2IMJ A;  1AR0 A;  1W6C A;  1L5G B;  4AKY A;  4LEH A;  3VSY A;  2GBX B;  1IVW A;  2IA7 A;  2OCT A;  1M1K 4;  2GU1 A;  3KII A;  4CDL A;  1VQN 3;  1DMM A;  1JN5 B;  4K1U A;  1N9E A;  2F98 A;  1IT8 A;  3MKI A;  2RFR A;  4XDV A;  4XBT A;  1RJO A;  2CG1 A;  1YJN 3;  1IVV A;  3B8L A;  1JB2 A;  3SX1 A;  2LYX A;  2W9P A;  4WP5 A;  4L8O A;  3UNL A;  3SOY A;  2CFD A;  2LQV A;  1YIJ 3;  5BVB A;  3RGR A;  5I97 A;  3EBT A;  3K7C A;  4J9A A;  1SQW A;  2P05 A;  1QAL A;  1O7W B;  3T8U A;  3T8N A;  3PZW A;  1OHP A;  1HKX A;  3K63 A;  4NHF A;  2OQE C;  1OHS A;  4FMD A;  2F99 A;  3DGM A;  1ULJ B;  3F8X A;  1LXE A;  4MMZ B;  2JQ5 A;  3K5T A;  2CHC A;  3I55 3;  5AEW B;  1U5O A;  4R9L A;  1E97 A;  1T5Y A;  3LT9 A;  3D9R A;  2FNQ A;  1VQ7 3;  1GY7 A;  1HU9 A;  5DRE A;  5KP4 A;  3FLJ A;  1UW1 A;  4HM5 B;  3LT8 A;  3IJE B;  2Z77 A;  1G96 A;  2XSH B;  3L0R A;  1FGO A;  3HI7 A;  5ELU A;  4HBR A;  5FGO A;  1N5H A;  1TFO A;  2E2V A;  5IG5 A;  4KFE A;  2XFS A;  1SIH A;  4XDW A;  2W56 A;  4CCV A;  2WOH A;  5LC6 A;  3PCR A;  2XH9 A;  2RSX A;  3BLZ A;  1VQ5 3;  1TP6 A;  3PGB A;  3DMC A;  3HII A;  4AEQ A;  3O8Y A;  1RRH A;  3SED A;  3LTD A;  2W04 A;  4FCJ A;  3G6E 3;  3OWY A;  6STD A;  1Y4K A;  3OWU A;  1PFP A;  4K61 A;  1NDO B;  4HKV B;  2YFL B;  3CPW 2;  2RGQ A;  2Z7A A;  1OPY A;  1VQL 3;  5STD A;  3B7C A;  3NHX A;  3OV4 A;  1STD A;  1YIT 3;  5JPU A;  5G2G A;  3CC7 3;  3E99 A;  3JUQ A;  3U1W A;  1DVD A;  2WGO A;  2D42 A;  3GZB A;  3OX9 A;  3UL6 A;  4L8P A;  2HMM B;  4FCM A;  2W6J H;  2CWT A;  5AI1 A;  4L7K A;  5CLK A;  3EF8 A;  3F14 A;  3MSO A;  1EA2 A;  5ELJ A;  2D1W A;  1K73 4;  3JUP A;  3CCR 3;  4KZ1 A;  4LSO A;  2ZL8 A;  1JB4 A;  1IV7 A;  4HM3 B;  4HM8 B;  4FR9 A;  5AII A;  1NJI 4;  3MG2 A;  3KZT A;  2GEX A;  2XF3 A;  3EN8 A;  1C7H A;  4R80 A;  2B24 B;  2CKF B;  1S5A A;  3GRD A;  1KSI A;  3WA3 A;  1WMN A;  3G4S 3;  3CCJ 3;  4STD A;  5CF1 A;  3H3H A;  1K41 A;  1WTH A;  4HZB B;  5TGN A;  3BNC A;  1M1X B;  2HMO B;  2OTJ 3;  1IDP A;  1M90 4;  3Q1C A;  1J2B A;  3CPO A;  5D82 A;  1KWI A;  4OVM A;  2CWU A;  3DGN A;  1UUV B;  1VZZ A;  1LNH A;  1OF5 A;  4HVN A;  4IT7 A;  4RZM A;  3S5C A;  2KXG A;  1OHO A;  1O7H B;  3FZW A;  2I9W A;  1QJG A;  3RGA A;  3UL5 A;  2BMR B;  1RKY A;  1W02 A;  3NV0 A;  1CYV A;  3LTB A;  3M8C A;  3CCL 3;  2M7O A;  2CK3 H;  1VQ8 3;  2CG0 A;  4EC6 A;  4EYC A;  5IEN A;  2OWP A;  2Y73 A;  2QIY A;  4N6T A;  3JVC A;  3VGN A;  2BT3 A;  4EV5 A;  3GZY B;  3LYG A;  2BMQ B;  3QRD A;  3FSD A;  2STD A;  1JJ2 2;  1Q7Y 4;  1JRQ A;  4HM2 B;  3EQQ B;  2O9U X;  3AMO B;  1DMQ A;  4EV2 A;  1Q40 A;  3IMA B;  3WA2 X;  3KKG A;  3J7Y d;  5KP1 A;  2XEP A;  1A90 A;  3LML A;  3MPH A;  3LH4 A;  4O02 B;  1N5P A;  3CU3 A;  3DY5 A;  4RNY A;  1QMA A;  4HJL B;  5IW9 A;  2HML B;  4J8T A;  2GU3 A;  1ROV A;  1LVN A;  2QEX 3;  3CD6 3;  3DGO A;  2MC8 A;  3I56 3;  1UUW B;  4ZM8 A;  3SOA A;  1D6Y A;  3ALA A;  3WOE B;  2RCD A;  1Q42 A;  4FMB A;  4BTX A;  3KE7 A;  2P09 A;  1VQ6 3;  3CNM A;  1S72 3;  5IF6 A;  3PS8 A;  4RBN A;  3GWR A;  4TX4 A;  3B4P A;  4WYK A;  4GL6 A;  2BMO B;  3STD A;  4BTW A;  3JUO A;  1QAK A;  4R1K A;  3DM8 A;  3F7S A;  3EX9 A;  1D6Z A;  2XGN A;  1W2B 2;  1YI2 3;  3WMD A;  3NX0 A;  1SII A;  2WGQ A;  3LTC A;  3CC2 3;  2HMN B;  1IQ8 A;  1W5Z A;  3SLU A;  1GD4 A;  1JKG A;  4O3V A;  1MNL A;  3OW2 2;  4IPB A;  3V92 A;  1MOL A;  3OXA A;  2F86 B;  4HM7 B;  3WOF B;  3MG3 A;  2PNC A;  1AVL A;  2CFK A;  3KFQ C;  3X3Z A;  3WDG B;  1YGE A;  3F7X A;  2INX A;  4IIA A;  4O8S A;  5CF2 A;  5JBS A;  1JN5 A;  2C10 A;  2P0X A;  4JF8 A;  1VQP 3;  2L4V A;  1WQL B;  1IVU A;  3DGL A;  3FF0 A;  4XB5 A;  2OOV C;  1TIJ A;  5EVH A;  4KFF A;  3VF1 A;  3T0U A;  3CCV 3;  5IG0 A;  2IUJ A;  1IU7 A;  1ULI B;  3Q2P A;  2V1L A;  1YJ9 3;  3N54 B;  3PYJ A;  1VQK 3;  2UX0 A;  3WOD G;  3DXO A;  1F8N A;  3V99 A;  1VQ4 3;  1O7N B;  1FUW A;  1LOX A;  2XSO B;  2BHM A;  2OQE A;  1WNH A;  1TFK A;  2E2U A;  1ASK A;  1NWW A;  1OGZ A;  3K9M C;  4R9K A;  3TDG A;  1OAC A;  2W03 A;  1CYU A;  1DYU A;  4LMI A;  1OCV A;  4H61 A;  1IK3 A;  1Q81 4;  1SPU A;  3GZX B;  1ISK A;  1W01 A;  3GZR A;  2XGL A;  3FG3 A;  1A2V A;  1E3R A;  1YHQ 3;  3ROB A;  2Y74 A;  1ZX2 A;  2W0Q A;  4HM1 B;  4U13 A;  3CMA 3;  3H51 A;  3V98 A;  4XBX A;  3CC4 3;  4LZI A;  2YX9 A;  4XM4 A;  5HGR A;  2K0M A;  1D6U A;  1W2Z A;  2YFI B;  5CK6 A;  5JPP A;  1BUQ A;  3U97 A;  1DVC A;  1Q40 B;  3F40 A;  3N9H A;  3JUN A;  1N8R 4;  3CCQ 3;  4X2H A;  3PXM A;  3NUV A;  1JNQ A;  3DUK A;  4HZ9 B;  3JUM A;  5KP3 A;  4N6M A;  5IEO A;  2IUK A;  4PEJ A;  4HYZ A;  3EJV A;  1EKM A;  2OTL 3;  1FGM A;  1N8Q A;  3BB9 A;  4MJD A;  4OUQ A;  1M9G A;  3BNE A;  1OGX A;  4FMA A;  4XBY A;  4KFD A;  1STF I;  3Q90 A;  2C11 A;  3CNX A;  3EHC A;  3X42 A;  4EBG A;  4FCZ A;  1OUN A;  5IG3 A;  4WYK B;  1GS3 A;  2FXT A;  3FCS B;  4N3V A;  1IQX A;  1RN7 A;  5A0O B;  1O7P B;  3X41 A;  3S67 A;  3ECF A;  5DRV A;  2W56 B;  2XRX B;  2CIU A;  3CME 3;  1FGT A;  1V74 A;  1CEW I;  2A15 A;  2PZV A;  2YFJ B;  1AV4 A;  2MF7 A;  3MHE A;  1A2K A;  3NBB A;  5AIF A;  2ML6 A;  1UI8 A;  2CH9 A;  1AVK A;  3FH1 A;  3MG1 A;  3S27 A;  1GD3 A;  1FA3 A;  3HIG A;  7STD A;  3HK4 A;  1A67 A;  2FGT A;  4LGQ A;  5D81 A;  2Z76 A;  4H3U A;  1FGQ A;  5AIG A;  1QVF 2;  1SJW A;  1US1 A;  5BXQ A;  2HMJ B;  3I0Y A;  4WWU C;  4RNZ A;  4BTY A;  3SXX A;  3LTA A;  3DZL A;  4N6V 0;  1TUH A;  2W9Q A;  3LZA A;  2Q07 A;  1KQS 2;  3CCS 3;  3CXC 2;  2QA4 3;  2W2C A;  2ZDJ A;  2WOF A;  4EXR A;  1Q82 4;  2GEY A;  1GY5 A;  3F8H A;  1Q86 4;  1W6G A;  5AYR B;  4N6U A;  2CW9 A;  3KN4 A;  1DMN A;  1O7G B;  1W4N A;  4Q53 A;  2XR8 B;  1FGR A;  3G0K A;  2K54 A;  1K8A 4;  3EC9 A;  3EB8 A;  3CCE 3;  2CFL A;  3HX8 A;  3FG4 A;  5LC7 A;  4N6L A;  3BND A;  1WMO A;  2Z6B A;  2WO0 A;  3BNB A;  2P38 A;  1RRL A;  4HM4 B;  2O3O A;  3N8B A;  3NM7 A;  3X40 A;  4NRE A;  1W6Y A;  1QAF A;  1W00 A;  3FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...