1M904

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1m90400
1YIT3 3I553 2QA43 3CMA3 1W2B2 3CC23 1VQ73 1YJN3 1JJ22 3OW22 1YJW3 1KD14 1N8R4 3CD63 1VQN3 3G6E3 1VQP3 1KQS2 1VQ43 1VQM3 1Q814 1M1K4 1Q864 3G4S3 3G713 3CCU3 1K9M4 3CC43 1VQ83 1Q824 1K734 2OTJ3 1VQL3 1QVG2 3CCL3 1YI23 3I563 3CME3 2QEX3 1VQ63 1YIJ3 3CXC2 1YHQ3 1QVF2 1M904 1VQO3 1VQ93 3CCM3 1S723 3CCS3 3CPW2 3CCJ3 3CCV3 3CCE3 3CCR3 1VQK3 1Q7Y4 1NJI4 1KC84 3CC73 1YJ93 1K8A4 1VQ53 2OTL3 3CCQ3
chains in the Genus database with same CATH superfamily
4X2OA 2QA43 3F8XA 3CC23 1FA3A 2CFWA 4FMAA 1UUVB 3KCHA 4HVNA 3X3XA 3S5CA 2UX0A 1U5OA 5DRVA 1Q7HA 2F98A 1MGRA 3CCU3 2P05A 1LQGC 1VQ83 1RMSA 1IYYA 1YNVX 1BRGA 4FMCA 1SARA 1I2FA 1BRHA 4WWUC 4AEQA 3FLJA 3NXJA 1OH0A 5FGOA 3PZWA 2A15A 2UUGC 2AADA 5D81A 1JKGB 3NV0B 2XRXB 4K90B 1RNBA 4J9AA 4R4KA 1S723 4BL2A 3GZBA 3OXAA 1AY7A 5CF2A 1T2HA 1PFPA 4HKVB 3CC73 2PNCA 6GSPA 1JB5A 2GEXA 1CYVA 4R1KA 1W2B2 1STFI 4XDVA 1IQYA 1LNHA 3EF8A 3GZRA 3EQQB 3PCRA 1W2ZA 1R4CA 4BTWA 1DE3A 4R80A 1CYUA 1LRAA 1TP6A 1A2PA 3RGAA 3S67A 2CW9A 2BHMA 3BNDA 1RSNA 4FR9A 4EV5A 1B27A 1A90A 2HMKB 5LC7A 3VSYA 3K9MC 3SLUA 1HYFA 2XSOB 3F7SA 3KE7A 1NO3A 3AHSA 2CG1A 1E3VA 1BNEA 2LQVA 1TFOA 2Z6BA 1FUSA 2CX1A 3KSED 1YGEA 1YHQ3 1D6YA 2W9PA 2KF4A 5LC6A 2INXA 1JBRA 2OQEC 3ER7A 3ZG5A 3CCE3 1Q9EA 1HKXA 3AGOA 4AKYA 1O7NB 3URPA 4CDLA 3FG4A 2W04A 1O7MB 3SVAA 1B2UA 1BNFA 1D6ZA 2WGOA 1JBSA 1RGKA 5KP1A 2H0IA 2KXGA 1W01A 1BIRA 5JBSA 3G4S3 4N6TA 2YX9A 2P09A 1K734 3NV0A 1BSBA 1DYUA 3HIGA 4HAAA 1OF5B 1QAFA 1FUWA 3PGBA 3HI7A 3ROBA 4HM6B 2GEYA 3UL5A 4H3UA 3Q1CA 4HM8B 2O3OA 5FW5A 3N54B 3JUNA 3CCM3 3IPTA 1BGSA 3SOYA 4RNTA 1KC84 4GHOA 3I553 3GRDA 3OWSA 1I2GA 1BAOA 4KFFA 1YJN3 3GZXB 1CQSA 4KFEA 4MMXB 1DMNA 1YJW3 2OWPA 3T8UA 1GD3A 2HMNB 4J8TA 1UCKA 2Z76A 2CFDA 1MWTA 2W6JH 5ELUA 2XFSA 2RNTA 2XGNA 3B4PA 1AQZA 2CK3H 3BNCA 2WOHA 1WNHA 1QVG2 3B4OA 1RHLA 2CFGA 5AYSC 4HM3B 1IDPA 3D5IA 3UB1A 3Q3FA 4HZ9B 1I3IA 4LYLB 4GSPA 2RGQA 5BU4A 2B24B 1DETA 4HZBB 2KRTA 1AV4A 5ELJA 3PS8A 1VQO3 3D9RA 3SX1A 2QIYA 1YJ93 2F99A 2V1LA 3LMLA 3NBBA 1N8QA 2W0QA 3EX9A 3H51A 4LEHA 5AEUB 1G02A 1AVKA 3DH2A 5IG0A 4LZIA 4L8OA 1BU4A 4WYKB 1N5HA 3EN1B 1IT8A 4HM7B 1NNVA 1RN7A 4RNZA 4GB5A 1K9M4 1OF5A 1HZ1A 1OACA 1NWWA 3LOYA 4H61A 3KIIA 3SOAA 2K3DA 2CFKA 1PU4A 1B2XA 3FGYA 1SPUA 1W02A 1ISKA 5CXOA 3JUQA 1RN1A 4CJNA 1N9EA 1RGLA 4G1MB 2W56B 3U1WA 5KP3A 3CPW2 1I2EA 4KT3B 1TIJA 3BNBA 3FF0A 3I0YA 3LZAA 3NQYA 4OVMA 4R9KA 3CPOA 2CWUA 3GZYB 3SXXA 3G0KA 2ZL8A 4XDWA 1TUHA 3B7CA 1N8R4 3Q2PA 4L7KA 2J8XB 3EE1A 4O8SA 1ZS7A 1VQP3 1G96A 1GMQA 1LVNA 1BSCA 1T5YA 1V57A 2KCDA 2B1XB 1BVIA 1FZUA 3RDEA 5GSPA 3UL6A 1U8CB 4BIRA 3U97A 1B2MA 5JPPA 1EA2A 4N6UA 4XM4A 3IJEB 4HM0B 1JNQA 3CCL3 2CH9A 3X41A 1UDII 2Z77A 1JV2B 2JQ5A 2Y73A 1QVF2 1RKYA 5IG3A 1FGOA 2OOVC 1I0VA 3EBTA 3X3ZA 3F40A 1BUJA 2SARA 3LT8A 3X42A 3NM2A 2IA7A 3BU4A 4WYKA 5IEOA 1JZDA 4Q53A 1TU5A 5M1AA 1PY3A 1ULIB 3ZFZA 1OPYA 1B2SA 1MNLA 2GXFA 3HIIA 1VQ43 1ZO2A 3E99A 4STDA 3CNMA 2RFRA 5BXQA 2ML6A 2Z7AA 3G713 4MMYB 2XGLA 3K5TA 1JB2A 1RN4A 3S27A 1GOYA 4O3VA 3N9HA 2F56A 3F7XA 1RRHA 2W56A 5AYRB 1SQWA 2KF3A 2CKFB 2L1SA 1Q40A 3KKGA 3DGLA 1GY6A 1RGCA 1IQXA 3WOFB 2ZHXB 1QAKA 4HM4B 3M8CA 4HM2B 4HM5B 3B8LA 1FGMA 1O7HB 3STDA 3D79A 5RNTA 5STDA 8CHOA 1RTUA 3BLZA 1UUWB 4K1VA 1EUIC 1VQQA 1VQN3 2K0MA 4WFOA 5I97A 4QWTA 1VQM3 1FGTA 3DGOA 4XBYA 1Q42A 2WO0A 3DM8A 4J5KA 1MWUA 3S28A 1FYSA 3HK4A 1GMRA 2D42A 3AMOB 3KZTA 5AEWB 1RJOA 1JN5B 2E2VA 1JKGA 5IENA 2CX0A 2SBLA 3QK9A 1BOXA 2JDIH 3EJVA 3EBYA 1TJDA 2GBXB 3KSPA 4MEIA 5AI1A 5M18A 1ASKA 3G8ZA 3HOHA 1A67A 1UGIA 3KFQC 5BIRA 3JUMA 1RGAA 2GU1A 2LYXA 4XBXA 2OTL3 2E2UA 3CCQ3 3V99A 1DVDA 1BNRA 1IVVA 4BU4A 4LSOA 1BUQA 1N9JA 1M1XB 1HU9A 1JJ22 1BNIA 1IVUA 1QJGA 1O7GB 3K63A 1RDSA 5G2GA 4HOHA 3PCSA 3UJMA 4IIAA 4EYCA 2XSHB 1V58A 2YFLB 3GWRA 1W4NA 3EC9A 2GU3A 4MJDA 4N6LA 4EC6A 3F9SA 3NM7A 2F5MA 1OHSA 2L4VA 1AR0A 4R9LA 2BMRB 3SEDA 3MWZA 2FGTA 3WHOA 4HBRA 1LQMB 3CME3 2O9UX 5CLKA 2Y74A 2QEX3 3OWUA 1RCLA 1GD4A 3QRDA 1K41A 3LTAA 3MPHA 5IERA 1M9GA 1GS3A 1RGGA 2R41A 3NUVA 1DMQA 4NHFA 2WGQA 2K54A 1T3BA 2ZDJA 3LTBA 1AVLA 3CU3A 1JZOA 2BO9B 2CG0A 3ALAA 5CK6A 5G1LA 3A76A 3WA2X 4BL3A 1VQ53 2CIUA 2R4IA 3NQZA 3CMA3 1EEJA 1NU3A 1O7WB 3DY5A 4JRFA 1E3RA 1LOVA 1UCJA 2ZA4A 1JBTA 1OCVA 3LTDA 1NB5I 1BNSA 3S29A 5G1KA 3AMOA 5M19A 2H0GA 1KD14 2F5WA 3CD63 1JN5A 4N3VA 2F86B 2BMQB 1RGFA 1I70A 1Q864 1ROAA 2XH9A 5TGNA 1Q824 3DGNA 1ULJB 3TDGA 1BRIA 4TX4A 1UW1A 1A2KA 1RCKA 2GBWB 1VQL3 1X1YA 4U13A 3V92A 1FGRA 2GSPA 2OCTA 2BT3A 3HX8A 4RZMA 1TFKA 1RGHA 3EN8A 1PYLA 5DREA 1T2IA 1B21A 5BVBA 4ZM8A 1RRLA 4HJLB 3CCV3 1TRPA 1GOUA 2XF3A 4XBTA 3MSOA 3Q90A 3AGNA 1IVXA 1YIT3 4FCZA 3FF2A 2C11A 3FG3A 3D5GA 5AIHA 3RGRA 1BRKA 4JF8A 1W6YA 2C10A 1W5ZA 3PXMA 3K7CA 1F8NA 3CC43 1B20A 4XB5A 2P0XA 1KSIA 2AAEA 3WDGB 1BRJA 2M7OA 2W2CA 1UI8A 3K0ZA 2RSXA 3OWYA 5EVHA 1CH0A 4FMDA 3BB9A 4N6MA 3X3YA 2YFIB 4MMZB 3WODG 1YIJ3 3WA3A 3FKAA 1EKMA 3BNEA 3LTCA 1WQLB 3FZWA 3WOEB 3DGYA 7RNTA 3FCSB 1STDA 3BIRA 1GSPA 5AIFA 1Z1SA 3V98A 6STDA 2PZVA 3PYJA 5D82A 2YFJB 2WOFA 1V74A 1LXEA 3IMAB 3GSPA 1A2VA 1C54A 3GAXA 1MWSA 3VF1A 3G6E3 1KQS2 3JUOA 2BIRA 4K1UA 2XEPA 1BRSA 4I5QA 2XR8B 1OHPA 1UGHI 2BNGA 7STDA 1K28A 3OX9A 1BNJA 3VGNA 3J7Yd 1W6CA 9RNTA 2KF6A 2W9QA 3EB8A 1VQ63 1IVWA 1E97A 3FG1A 4RNYA 1B3SA 1FW7A 4EXRA 3O8YA 4FMBA 2OQEA 1NJI4 3NBRA 1LOYA 1UCIA 5AIIA 4RBNA 1O7PB 1ZGXA 1BSDA 2IYJA 3NHXA 1VQ73 1J2BA 4EW5A 1RLSA 4ORLA 3OW22 1IU7A 1JB4A 2C4BA 4BTXA 1M1K4 3MG1A 1BSAA 1CEWI 3ZG0A 1BNGA 2UGIA 5IEPA 4LMIA 1IQ8A 5EEOA 3LXUX 1X1WA 2IUKA 1X1XA 3MKIA 1WMPA 3X40A 1OGZA 3D3LA 4OUQA 5JPUA 1L5GB 3I563 1SJWA 4K61A 1DVCA 1GY5A 1VZZA 1X1UA 3G16A 2RBIA 1GY7A 3NBJA 4WP5A 1OGXA 2F4YA 1D6UA 1LNIA 4N6V0 2QGUA 1B2ZA 1GOVA 2CWVA 2HOHA 2IY2A 1IT7A 4AKZA 1I8VA 1UCLA 3L0RA 4L8PA 4FCMA 1LOWA 1WTHA 3F8HA 3H3HA 1GMPA 1EG9B 4HYZA 1FUTA 5AIGA 1MWRA 2CFLA 1LOXA 1US1A 1IK3A 1Q814 4IPBA 5A0OB 2HMJB 3LH4A 1R4YA 1W7CA 2IUJA 4J5GA 2OTJ3 1G0TA 3T0UA 1I3FA 3WR2A 4KVHA 1YVBI 1Y4KA 2BMOB 3LYGA 1YI23 5IW9A 4CPKA 1W00A 1C7HA 1YGWA 1I0XA 3CXC2 3DXOA 1QALA 1S5AA 3JUPA 7GSPA 2P38A 1IV9A 2XFTA 4NREA 2Q07A 5HOHA 1VQ93 2CWTA 2RCDA 2MC8A 2FNQA 4N6NB 3CCR3 1VQK3 1YVSA 2I9WA 5CF1A 4NPBA 1SIHA 1FGQA 5HGRA 4EV2A 4ILFA 1EQKA 4DKIA 3HZPA 1JRQA 1WMOA 1NB3I 1W6GA 2KAAA 3N8BA 1IV7A 3KN4A 2E2TA 3F14A 3DMCA 4BTYA 4HM1B 8RNTA 1WMNA 3MG3A 4N6OB 2CHCA 1ROVA 3NX0A 1RGEA 3T8NA 4LGQA 5IG4A 3DZLA 2H0HA 2W03A 3AHWA 5KP4A 3FSDA 1M904 4PEJA 3MHEA 2HMOB 1K8A4 2CC3A 3D4AA 1MOLA 4I4KA 4O02B 4CCVA 3A5EA 1DMMA 1UI7A 1TRQA 2FXTA 2MF7A 2KF5A 3RNTA 2STDA 3ECFA 3JVCA 2HMLB 1N5PA 4GL6A 1BSEA 4IT7A 4KZ1A 4O2HA 5D83A 3SYUA 5IF6A 1OHOA 1QMAA 3CNXA 5EQLA 3FH1A 3WMDA 2HMMB 5IG5A 4KFDA 1TTOA 4OK0A 3MG2A 3LT9A 4EBGA 2ML5A 4X2HA 1BANA 1KWIA 6RNTA 2D1WA 1BRNL 1UUGB 1GYBA 1OUNA 2IMJA 1ZX2A 1NDOB 3MYTA 1MGWA 1RNTA 3DUKA 3DGMA 3EHCA 4WHAA 3OV4A 1SIIA 2P0MA 2BU4A 3CCS3 3CCJ3 2OOVA 3UNLA 1Q7Y4 1Q40B 4FCJA
chains in the Genus database with same CATH topology
4X2OA 2QA43 3F8XA 3CC23 1FA3A 2CFWA 4FMAA 1UUVB 4HVNA 3X3XA 3S5CA 2UX0A 1U5OA 5DRVA 2F98A 3CCU3 2P05A 1VQ83 4FMCA 4WWUC 4AEQA 3FLJA 3NXJA 1OH0A 5FGOA 3PZWA 2A15A 5D81A 1JKGB 3NV0B 2XRXB 4K90B 4J9AA 4R4KA 1S723 3GZBA 3OXAA 5CF2A 4HKVB 1PFPA 3CC73 2PNCA 1JB5A 2GEXA 1CYVA 4R1KA 1W2B2 1STFI 4XDVA 1IQYA 1LNHA 3EF8A 3GZRA 3EQQB 3PCRA 1W2ZA 1R4CA 4BTWA 4R80A 1CYUA 1TP6A 3S67A 3RGAA 2CW9A 2BHMA 3BNDA 4FR9A 4EV5A 1A90A 2HMKB 5LC7A 3VSYA 3K9MC 3SLUA 2XSOB 3KE7A 3F7SA 1NO3A 2CG1A 1E3VA 2LQVA 1TFOA 2Z6BA 3KSED 1YGEA 1YHQ3 1D6YA 2W9PA 5LC6A 2INXA 2OQEC 3ER7A 3CCE3 1HKXA 4AKYA 1O7NB 4CDLA 3FG4A 2W04A 1O7MB 3SVAA 1D6ZA 2WGOA 5KP1A 2KXGA 1W01A 3G4S3 5JBSA 4N6TA 2YX9A 2P09A 1K734 3NV0A 1DYUA 3HIGA 1OF5B 1QAFA 1FUWA 3PGBA 3HI7A 3ROBA 4HM6B 2GEYA 3UL5A 4H3UA 3Q1CA 4HM8B 2O3OA 5FW5A 3N54B 3JUNA 3CCM3 3IPTA 3SOYA 1KC84 3I553 3GRDA 3OWSA 1YJN3 4KFFA 3GZXB 1CQSA 4KFEA 4MMXB 1DMNA 1YJW3 2OWPA 3T8UA 1GD3A 2HMNB 4J8TA 2Z76A 2CFDA 2W6JH 5ELUA 3B4PA 2XGNA 2XFSA 2CK3H 3BNCA 2WOHA 1WNHA 1QVG2 3B4OA 2CFGA 5AYSC 4HM3B 1IDPA 3UB1A 4HZ9B 2RGQA 2B24B 4HZBB 5ELJA 2KRTA 1AV4A 3PS8A 1VQO3 3D9RA 3SX1A 2QIYA 1YJ93 2F99A 2V1LA 3LMLA 3NBBA 1N8QA 2W0QA 3EX9A 3H51A 4LEHA 5AEUB 1AVKA 5IG0A 4LZIA 4L8OA 4WYKB 1N5HA 3EN1B 1IT8A 4HM7B 1RN7A 4RNZA 1K9M4 4GB5A 1OF5A 1OACA 3LOYA 1NWWA 4H61A 3KIIA 3SOAA 2CFKA 1PU4A 3FGYA 1SPUA 1W02A 1ISKA 5CXOA 3JUQA 1N9EA 4G1MB 2W56B 3U1WA 5KP3A 3CPW2 1TIJA 3BNBA 3FF0A 3I0YA 3LZAA 3NQYA 4OVMA 4R9KA 3CPOA 2CWUA 3GZYB 3SXXA 3G0KA 2ZL8A 4XDWA 1TUHA 3B7CA 1N8R4 3Q2PA 4L7KA 3EE1A 4O8SA 1VQP3 1G96A 1LVNA 1T5YA 2KCDA 2B1XB 3RDEA 3UL6A 1U8CB 3U97A 5JPPA 1EA2A 4N6UA 4XM4A 3IJEB 4HM0B 1JNQA 3CCL3 2CH9A 3X41A 2Z77A 1JV2B 2JQ5A 2Y73A 1QVF2 1RKYA 5IG3A 1FGOA 2OOVC 3EBTA 3X3ZA 3F40A 3LT8A 3X42A 3NM2A 2IA7A 4WYKA 5IEOA 4Q53A 1TU5A 1ULIB 1OPYA 1MNLA 2GXFA 3HIIA 1VQ43 1ZO2A 3E99A 4STDA 3CNMA 2RFRA 5BXQA 2ML6A 2Z7AA 3G713 4MMYB 2XGLA 3K5TA 1JB2A 3S27A 4O3VA 3N9HA 3F7XA 1RRHA 2W56A 5AYRB 1SQWA 2CKFB 1Q40A 3KKGA 3DGLA 1GY6A 1IQXA 3WOFB 1QAKA 4HM4B 3M8CA 4HM2B 4HM5B 3B8LA 1FGMA 1O7HB 3STDA 5STDA 8CHOA 3BLZA 1UUWB 4K1VA 1VQN3 2K0MA 4WFOA 5I97A 4QWTA 1VQM3 1FGTA 3DGOA 4XBYA 1Q42A 2WO0A 3DM8A 3S28A 3HK4A 2D42A 3AMOB 3KZTA 5AEWB 1RJOA 1JN5B 2E2VA 1JKGA 5IENA 2SBLA 3QK9A 2JDIH 3EJVA 3EBYA 2GBXB 3KSPA 4MEIA 5AI1A 1ASKA 3G8ZA 1A67A 3KFQC 3JUMA 2GU1A 2LYXA 4XBXA 2OTL3 2E2UA 3CCQ3 3V99A 1DVDA 1IVVA 4LSOA 1BUQA 1N9JA 1M1XB 1HU9A 1JJ22 1IVUA 1QJGA 1O7GB 3K63A 5G2GA 3PCSA 3UJMA 4IIAA 4EYCA 2XSHB 2YFLB 3GWRA 1W4NA 3EC9A 2GU3A 4MJDA 4N6LA 4EC6A 3F9SA 3NM7A 1OHSA 2L4VA 1AR0A 4R9LA 2BMRB 3SEDA 3MWZA 2FGTA 4HBRA 3CME3 2O9UX 5CLKA 2Y74A 2QEX3 3OWUA 1GD4A 3QRDA 1K41A 3LTAA 3MPHA 5IERA 1M9GA 1GS3A 4NHFA 3NUVA 1DMQA 2WGQA 2K54A 2ZDJA 3LTBA 1AVLA 3CU3A 2BO9B 3ALAA 2CG0A 5CK6A 3WA2X 1VQ53 3A76A 2CIUA 2R4IA 3NQZA 3CMA3 1NU3A 4JRFA 1O7WB 3DY5A 1E3RA 1NB5I 1OCVA 3LTDA 3S29A 1KD14 3AMOA 3CD63 1JN5A 4N3VA 2F86B 2BMQB 1Q864 1ROAA 2XH9A 5TGNA 1Q824 3DGNA 1ULJB 3TDGA 4TX4A 1UW1A 1A2KA 2GBWB 1VQL3 4U13A 3V92A 1FGRA 2OCTA 2BT3A 3HX8A 4RZMA 1TFKA 3EN8A 5DREA 5BVBA 4ZM8A 1RRLA 4HJLB 3CCV3 2XF3A 4XBTA 3MSOA 3Q90A 1IVXA 1YIT3 4FCZA 3FF2A 2C11A 3FG3A 5AIHA 3RGRA 4JF8A 1W6YA 2C10A 1W5ZA 3PXMA 3K7CA 1F8NA 3CC43 4XB5A 2P0XA 1KSIA 3WDGB 2M7OA 2W2CA 1UI8A 3K0ZA 2RSXA 3OWYA 5EVHA 4FMDA 3BB9A 4N6MA 3X3YA 2YFIB 4MMZB 3WODG 1YIJ3 3WA3A 3FKAA 1EKMA 3BNEA 3LTCA 1WQLB 3FZWA 3WOEB 3FCSB 1STDA 5AIFA 1Z1SA 3V98A 6STDA 2PZVA 3PYJA 5D82A 2YFJB 2WOFA 1V74A 1LXEA 3IMAB 1A2VA 3GAXA 3VF1A 3G6E3 1KQS2 3JUOA 4K1UA 2XEPA 2XR8B 1OHPA 2BNGA 7STDA 1K28A 3OX9A 3VGNA 3J7Yd 1W6CA 2W9QA 3EB8A 1VQ63 1IVWA 1E97A 3FG1A 4RNYA 4EXRA 3O8YA 4FMBA 2OQEA 1NJI4 3NBRA 5AIIA 4RBNA 1O7PB 3NHXA 1VQ73 1J2BA 4ORLA 3OW22 1IU7A 1JB4A 4BTXA 1M1K4 3MG1A 1CEWI 5IEPA 4LMIA 1IQ8A 5EEOA 3LXUX 2IUKA 3MKIA 1WMPA 3X40A 1OGZA 3D3LA 4OUQA 5JPUA 1L5GB 3I563 1SJWA 4K61A 1DVCA 1GY5A 1VZZA 3G16A 1GY7A 3NBJA 4WP5A 1OGXA 1D6UA 4N6V0 2QGUA 2CWVA 1IT7A 4AKZA 3L0RA 4L8PA 4FCMA 1WTHA 3F8HA 3H3HA 1EG9B 4HYZA 5AIGA 2CFLA 1LOXA 1US1A 1IK3A 1Q814 4IPBA 5A0OB 2HMJB 3LH4A 1W7CA 2IUJA 2OTJ3 3T0UA 4KVHA 1YVBI 1Y4KA 2BMOB 3LYGA 1YI23 5IW9A 1W00A 1C7HA 3CXC2 3DXOA 1QALA 1S5AA 3JUPA 2P38A 1IV9A 2XFTA 4NREA 2Q07A 1VQ93 2CWTA 2RCDA 2MC8A 2FNQA 4N6NB 3CCR3 1VQK3 2I9WA 5CF1A 1SIHA 1FGQA 5HGRA 4EV2A 1EQKA 3HZPA 1JRQA 1WMOA 1NB3I 1W6GA 3N8BA 1IV7A 3KN4A 2E2TA 3F14A 3DMCA 4BTYA 4HM1B 1WMNA 3MG3A 4N6OB 2CHCA 1ROVA 3NX0A 3T8NA 4LGQA 5IG4A 3DZLA 2W03A 5KP4A 3FSDA 1M904 4PEJA 3MHEA 2HMOB 1K8A4 2CC3A 1MOLA 4I4KA 4O02B 4CCVA 1DMMA 1UI7A 2MF7A 2FXTA 2STDA 3ECFA 3JVCA 2HMLB 1N5PA 4GL6A 4IT7A 4KZ1A 5IF6A 4O2HA 5D83A 1OHOA 1QMAA 3CNXA 5EQLA 3FH1A 3WMDA 2HMMB 5IG5A 4KFDA 4OK0A 3MG2A 3LT9A 4EBGA 2ML5A 4X2HA 1KWIA 2D1WA 1GYBA 1OUNA 2IMJA 1ZX2A 1NDOB 3MYTA 3DUKA 3DGMA 3EHCA 4WHAA 3OV4A 1SIIA 2P0MA 3CCS3 3CCJ3 2OOVA 3UNLA 1Q7Y4 1Q40B 4FCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT 3;  3I55 3;  2QA4 3;  3CMA 3;  1W2B 2;  3CC2 3;  1VQ7 3;  1YJN 3;  1JJ2 2;  3OW2 2;  1YJW 3;  1KD1 4;  1N8R 4;  3CD6 3;  1VQN 3;  3G6E 3;  1VQP 3;  1KQS 2;  1VQ4 3;  1VQM 3;  1Q81 4;  1M1K 4;  1Q86 4;  3G4S 3;  3G71 3;  3CCU 3;  1K9M 4;  3CC4 3;  1VQ8 3;  1Q82 4;  1K73 4;  2OTJ 3;  1VQL 3;  1QVG 2;  3CCL 3;  1YI2 3;  3I56 3;  3CME 3;  2QEX 3;  1VQ6 3;  1YIJ 3;  3CXC 2;  1YHQ 3;  1QVF 2;  1M90 4;  1VQO 3;  1VQ9 3;  3CCM 3;  1S72 3;  3CCS 3;  3CPW 2;  3CCJ 3;  3CCV 3;  3CCE 3;  3CCR 3;  1VQK 3;  1Q7Y 4;  1NJI 4;  1KC8 4;  3CC7 3;  1YJ9 3;  1K8A 4;  1VQ5 3;  2OTL 3;  3CCQ 3; 
#chains in the Genus database with same CATH topology
 4X2O A;  2QA4 3;  3F8X A;  3CC2 3;  1FA3 A;  2CFW A;  4FMA A;  1UUV B;  3KCH A;  4HVN A;  3X3X A;  3S5C A;  2UX0 A;  1U5O A;  5DRV A;  1Q7H A;  2F98 A;  1MGR A;  3CCU 3;  2P05 A;  1LQG C;  1VQ8 3;  1RMS A;  1IYY A;  1YNV X;  1BRG A;  4FMC A;  1SAR A;  1I2F A;  1BRH A;  4WWU C;  4AEQ A;  3FLJ A;  3NXJ A;  1OH0 A;  5FGO A;  3PZW A;  2A15 A;  2UUG C;  2AAD A;  5D81 A;  1JKG B;  3NV0 B;  2XRX B;  4K90 B;  1RNB A;  4J9A A;  4R4K A;  1S72 3;  4BL2 A;  3GZB A;  3OXA A;  1AY7 A;  5CF2 A;  1T2H A;  1PFP A;  4HKV B;  3CC7 3;  2PNC A;  6GSP A;  1JB5 A;  2GEX A;  1CYV A;  4R1K A;  1W2B 2;  1STF I;  4XDV A;  1IQY A;  1LNH A;  3EF8 A;  3GZR A;  3EQQ B;  3PCR A;  1W2Z A;  1R4C A;  4BTW A;  1DE3 A;  4R80 A;  1CYU A;  1LRA A;  1TP6 A;  1A2P A;  3RGA A;  3S67 A;  2CW9 A;  2BHM A;  3BND A;  1RSN A;  4FR9 A;  4EV5 A;  1B27 A;  1A90 A;  2HMK B;  5LC7 A;  3VSY A;  3K9M C;  3SLU A;  1HYF A;  2XSO B;  3F7S A;  3KE7 A;  1NO3 A;  3AHS A;  2CG1 A;  1E3V A;  1BNE A;  2LQV A;  1TFO A;  2Z6B A;  1FUS A;  2CX1 A;  3KSE D;  1YGE A;  1YHQ 3;  1D6Y A;  2W9P A;  2KF4 A;  5LC6 A;  2INX A;  1JBR A;  2OQE C;  3ER7 A;  3ZG5 A;  3CCE 3;  1Q9E A;  1HKX A;  3AGO A;  4AKY A;  1O7N B;  3URP A;  4CDL A;  3FG4 A;  2W04 A;  1O7M B;  3SVA A;  1B2U A;  1BNF A;  1D6Z A;  2WGO A;  1JBS A;  1RGK A;  5KP1 A;  2H0I A;  2KXG A;  1W01 A;  1BIR A;  5JBS A;  3G4S 3;  4N6T A;  2YX9 A;  2P09 A;  1K73 4;  3NV0 A;  1BSB A;  1DYU A;  3HIG A;  4HAA A;  1OF5 B;  1QAF A;  1FUW A;  3PGB A;  3HI7 A;  3ROB A;  4HM6 B;  2GEY A;  3UL5 A;  4H3U A;  3Q1C A;  4HM8 B;  2O3O A;  5FW5 A;  3N54 B;  3JUN A;  3CCM 3;  3IPT A;  1BGS A;  3SOY A;  4RNT A;  1KC8 4;  4GHO A;  3I55 3;  3GRD A;  3OWS A;  1I2G A;  1BAO A;  4KFF A;  1YJN 3;  3GZX B;  1CQS A;  4KFE A;  4MMX B;  1DMN A;  1YJW 3;  2OWP A;  3T8U A;  1GD3 A;  2HMN B;  4J8T A;  1UCK A;  2Z76 A;  2CFD A;  1MWT A;  2W6J H;  5ELU A;  2XFS A;  2RNT A;  2XGN A;  3B4P A;  1AQZ A;  2CK3 H;  3BNC A;  2WOH A;  1WNH A;  1QVG 2;  3B4O A;  1RHL A;  2CFG A;  5AYS C;  4HM3 B;  1IDP A;  3D5I A;  3UB1 A;  3Q3F A;  4HZ9 B;  1I3I A;  4LYL B;  4GSP A;  2RGQ A;  5BU4 A;  2B24 B;  1DET A;  4HZB B;  2KRT A;  1AV4 A;  5ELJ A;  3PS8 A;  1VQO 3;  3D9R A;  3SX1 A;  2QIY A;  1YJ9 3;  2F99 A;  2V1L A;  3LML A;  3NBB A;  1N8Q A;  2W0Q A;  3EX9 A;  3H51 A;  4LEH A;  5AEU B;  1G02 A;  1AVK A;  3DH2 A;  5IG0 A;  4LZI A;  4L8O A;  1BU4 A;  4WYK B;  1N5H A;  3EN1 B;  1IT8 A;  4HM7 B;  1NNV A;  1RN7 A;  4RNZ A;  4GB5 A;  1K9M 4;  1OF5 A;  1HZ1 A;  1OAC A;  1NWW A;  3LOY A;  4H61 A;  3KII A;  3SOA A;  2K3D A;  2CFK A;  1PU4 A;  1B2X A;  3FGY A;  1SPU A;  1W02 A;  1ISK A;  5CXO A;  3JUQ A;  1RN1 A;  4CJN A;  1N9E A;  1RGL A;  4G1M B;  2W56 B;  3U1W A;  5KP3 A;  3CPW 2;  1I2E A;  4KT3 B;  1TIJ A;  3BNB A;  3FF0 A;  3I0Y A;  3LZA A;  3NQY A;  4OVM A;  4R9K A;  3CPO A;  2CWU A;  3GZY B;  3SXX A;  3G0K A;  2ZL8 A;  4XDW A;  1TUH A;  3B7C A;  1N8R 4;  3Q2P A;  4L7K A;  2J8X B;  3EE1 A;  4O8S A;  1ZS7 A;  1VQP 3;  1G96 A;  1GMQ A;  1LVN A;  1BSC A;  1T5Y A;  1V57 A;  2KCD A;  2B1X B;  1BVI A;  1FZU A;  3RDE A;  5GSP A;  3UL6 A;  1U8C B;  4BIR A;  3U97 A;  1B2M A;  5JPP A;  1EA2 A;  4N6U A;  4XM4 A;  3IJE B;  4HM0 B;  1JNQ A;  3CCL 3;  2CH9 A;  3X41 A;  1UDI I;  2Z77 A;  1JV2 B;  2JQ5 A;  2Y73 A;  1QVF 2;  1RKY A;  5IG3 A;  1FGO A;  2OOV C;  1I0V A;  3EBT A;  3X3Z A;  3F40 A;  1BUJ A;  2SAR A;  3LT8 A;  3X42 A;  3NM2 A;  2IA7 A;  3BU4 A;  4WYK A;  5IEO A;  1JZD A;  4Q53 A;  1TU5 A;  5M1A A;  1PY3 A;  1ULI B;  3ZFZ A;  1OPY A;  1B2S A;  1MNL A;  2GXF A;  3HII A;  1VQ4 3;  1ZO2 A;  3E99 A;  4STD A;  3CNM A;  2RFR A;  5BXQ A;  2ML6 A;  2Z7A A;  3G71 3;  4MMY B;  2XGL A;  3K5T A;  1JB2 A;  1RN4 A;  3S27 A;  1GOY A;  4O3V A;  3N9H A;  2F56 A;  3F7X A;  1RRH A;  2W56 A;  5AYR B;  1SQW A;  2KF3 A;  2CKF B;  2L1S A;  1Q40 A;  3KKG A;  3DGL A;  1GY6 A;  1RGC A;  1IQX A;  3WOF B;  2ZHX B;  1QAK A;  4HM4 B;  3M8C A;  4HM2 B;  4HM5 B;  3B8L A;  1FGM A;  1O7H B;  3STD A;  3D79 A;  5RNT A;  5STD A;  8CHO A;  1RTU A;  3BLZ A;  1UUW B;  4K1V A;  1EUI C;  1VQQ A;  1VQN 3;  2K0M A;  4WFO A;  5I97 A;  4QWT A;  1VQM 3;  1FGT A;  3DGO A;  4XBY A;  1Q42 A;  2WO0 A;  3DM8 A;  4J5K A;  1MWU A;  3S28 A;  1FYS A;  3HK4 A;  1GMR A;  2D42 A;  3AMO B;  3KZT A;  5AEW B;  1RJO A;  1JN5 B;  2E2V A;  1JKG A;  5IEN A;  2CX0 A;  2SBL A;  3QK9 A;  1BOX A;  2JDI H;  3EJV A;  3EBY A;  1TJD A;  2GBX B;  3KSP A;  4MEI A;  5AI1 A;  5M18 A;  1ASK A;  3G8Z A;  3HOH A;  1A67 A;  1UGI A;  3KFQ C;  5BIR A;  3JUM A;  1RGA A;  2GU1 A;  2LYX A;  4XBX A;  2OTL 3;  2E2U A;  3CCQ 3;  3V99 A;  1DVD A;  1BNR A;  1IVV A;  4BU4 A;  4LSO A;  1BUQ A;  1N9J A;  1M1X B;  1HU9 A;  1JJ2 2;  1BNI A;  1IVU A;  1QJG A;  1O7G B;  3K63 A;  1RDS A;  5G2G A;  4HOH A;  3PCS A;  3UJM A;  4IIA A;  4EYC A;  2XSH B;  1V58 A;  2YFL B;  3GWR A;  1W4N A;  3EC9 A;  2GU3 A;  4MJD A;  4N6L A;  4EC6 A;  3F9S A;  3NM7 A;  2F5M A;  1OHS A;  2L4V A;  1AR0 A;  4R9L A;  2BMR B;  3SED A;  3MWZ A;  2FGT A;  3WHO A;  4HBR A;  1LQM B;  3CME 3;  2O9U X;  5CLK A;  2Y74 A;  2QEX 3;  3OWU A;  1RCL A;  1GD4 A;  3QRD A;  1K41 A;  3LTA A;  3MPH A;  5IER A;  1M9G A;  1GS3 A;  1RGG A;  2R41 A;  3NUV A;  1DMQ A;  4NHF A;  2WGQ A;  2K54 A;  1T3B A;  2ZDJ A;  3LTB A;  1AVL A;  3CU3 A;  1JZO A;  2BO9 B;  2CG0 A;  3ALA A;  5CK6 A;  5G1L A;  3A76 A;  3WA2 X;  4BL3 A;  1VQ5 3;  2CIU A;  2R4I A;  3NQZ A;  3CMA 3;  1EEJ A;  1NU3 A;  1O7W B;  3DY5 A;  4JRF A;  1E3R A;  1LOV A;  1UCJ A;  2ZA4 A;  1JBT A;  1OCV A;  3LTD A;  1NB5 I;  1BNS A;  3S29 A;  5G1K A;  3AMO A;  5M19 A;  2H0G A;  1KD1 4;  2F5W A;  3CD6 3;  1JN5 A;  4N3V A;  2F86 B;  2BMQ B;  1RGF A;  1I70 A;  1Q86 4;  1ROA A;  2XH9 A;  5TGN A;  1Q82 4;  3DGN A;  1ULJ B;  3TDG A;  1BRI A;  4TX4 A;  1UW1 A;  1A2K A;  1RCK A;  2GBW B;  1VQL 3;  1X1Y A;  4U13 A;  3V92 A;  1FGR A;  2GSP A;  2OCT A;  2BT3 A;  3HX8 A;  4RZM A;  1TFK A;  1RGH A;  3EN8 A;  1PYL A;  5DRE A;  1T2I A;  1B21 A;  5BVB A;  4ZM8 A;  1RRL A;  4HJL B;  3CCV 3;  1TRP A;  1GOU A;  2XF3 A;  4XBT A;  3MSO A;  3Q90 A;  3AGN A;  1IVX A;  1YIT 3;  4FCZ A;  3FF2 A;  2C11 A;  3FG3 A;  3D5G A;  5AIH A;  3RGR A;  1BRK A;  4JF8 A;  1W6Y A;  2C10 A;  1W5Z A;  3PXM A;  3K7C A;  1F8N A;  3CC4 3;  1B20 A;  4XB5 A;  2P0X A;  1KSI A;  2AAE A;  3WDG B;  1BRJ A;  2M7O A;  2W2C A;  1UI8 A;  3K0Z A;  2RSX A;  3OWY A;  5EVH A;  1CH0 A;  4FMD A;  3BB9 A;  4N6M A;  3X3Y A;  2YFI B;  4MMZ B;  3WOD G;  1YIJ 3;  3WA3 A;  3FKA A;  1EKM A;  3BNE A;  3LTC A;  1WQL B;  3FZW A;  3WOE B;  3DGY A;  7RNT A;  3FCS B;  1STD A;  3BIR A;  1GSP A;  5AIF A;  1Z1S A;  3V98 A;  6STD A;  2PZV A;  3PYJ A;  5D82 A;  2YFJ B;  2WOF A;  1V74 A;  1LXE A;  3IMA B;  3GSP A;  1A2V A;  1C54 A;  3GAX A;  1MWS A;  3VF1 A;  3G6E 3;  1KQS 2;  3JUO A;  2BIR A;  4K1U A;  2XEP A;  1BRS A;  4I5Q A;  2XR8 B;  1OHP A;  1UGH I;  2BNG A;  7STD A;  1K28 A;  3OX9 A;  1BNJ A;  3VGN A;  3J7Y d;  1W6C A;  9RNT A;  2KF6 A;  2W9Q A;  3EB8 A;  1VQ6 3;  1IVW A;  1E97 A;  3FG1 A;  4RNY A;  1B3S A;  1FW7 A;  4EXR A;  3O8Y A;  4FMB A;  2OQE A;  1NJI 4;  3NBR A;  1LOY A;  1UCI A;  5AII A;  4RBN A;  1O7P B;  1ZGX A;  1BSD A;  2IYJ A;  3NHX A;  1VQ7 3;  1J2B A;  4EW5 A;  1RLS A;  4ORL A;  3OW2 2;  1IU7 A;  1JB4 A;  2C4B A;  4BTX A;  1M1K 4;  3MG1 A;  1BSA A;  1CEW I;  3ZG0 A;  1BNG A;  2UGI A;  5IEP A;  4LMI A;  1IQ8 A;  5EEO A;  3LXU X;  1X1W A;  2IUK A;  1X1X A;  3MKI A;  1WMP A;  3X40 A;  1OGZ A;  3D3L A;  4OUQ A;  5JPU A;  1L5G B;  3I56 3;  1SJW A;  4K61 A;  1DVC A;  1GY5 A;  1VZZ A;  1X1U A;  3G16 A;  2RBI A;  1GY7 A;  3NBJ A;  4WP5 A;  1OGX A;  2F4Y A;  1D6U A;  1LNI A;  4N6V 0;  2QGU A;  1B2Z A;  1GOV A;  2CWV A;  2HOH A;  2IY2 A;  1IT7 A;  4AKZ A;  1I8V A;  1UCL A;  3L0R A;  4L8P A;  4FCM A;  1LOW A;  1WTH A;  3F8H A;  3H3H A;  1GMP A;  1EG9 B;  4HYZ A;  1FUT A;  5AIG A;  1MWR A;  2CFL A;  1LOX A;  1US1 A;  1IK3 A;  1Q81 4;  4IPB A;  5A0O B;  2HMJ B;  3LH4 A;  1R4Y A;  1W7C A;  2IUJ A;  4J5G A;  2OTJ 3;  1G0T A;  3T0U A;  1I3F A;  3WR2 A;  4KVH A;  1YVB I;  1Y4K A;  2BMO B;  3LYG A;  1YI2 3;  5IW9 A;  4CPK A;  1W00 A;  1C7H A;  1YGW A;  1I0X A;  3CXC 2;  3DXO A;  1QAL A;  1S5A A;  3JUP A;  7GSP A;  2P38 A;  1IV9 A;  2XFT A;  4NRE A;  2Q07 A;  5HOH A;  1VQ9 3;  2CWT A;  2RCD A;  2MC8 A;  2FNQ A;  4N6N B;  3CCR 3;  1VQK 3;  1YVS A;  2I9W A;  5CF1 A;  4NPB A;  1SIH A;  1FGQ A;  5HGR A;  4EV2 A;  4ILF A;  1EQK A;  4DKI A;  3HZP A;  1JRQ A;  1WMO A;  1NB3 I;  1W6G A;  2KAA A;  3N8B A;  1IV7 A;  3KN4 A;  2E2T A;  3F14 A;  3DMC A;  4BTY A;  4HM1 B;  8RNT A;  1WMN A;  3MG3 A;  4N6O B;  2CHC A;  1ROV A;  3NX0 A;  1RGE A;  3T8N A;  4LGQ A;  5IG4 A;  3DZL A;  2H0H A;  2W03 A;  3AHW A;  5KP4 A;  3FSD A;  1M90 4;  4PEJ A;  3MHE A;  2HMO B;  1K8A 4;  2CC3 A;  3D4A A;  1MOL A;  4I4K A;  4O02 B;  4CCV A;  3A5E A;  1DMM A;  1UI7 A;  1TRQ A;  2FXT A;  2MF7 A;  2KF5 A;  3RNT A;  2STD A;  3ECF A;  3JVC A;  2HML B;  1N5P A;  4GL6 A;  1BSE A;  4IT7 A;  4KZ1 A;  4O2H A;  5D83 A;  3SYU A;  5IF6 A;  1OHO A;  1QMA A;  3CNX A;  5EQL A;  3FH1 A;  3WMD A;  2HMM B;  5IG5 A;  4KFD A;  1TTO A;  4OK0 A;  3MG2 A;  3LT9 A;  4EBG A;  2ML5 A;  4X2H A;  1BAN A;  1KWI A;  6RNT A;  2D1W A;  1BRN L;  1UUG B;  1GYB A;  1OUN A;  2IMJ A;  1ZX2 A;  1NDO B;  3MYT A;  1MGW A;  1RNT A;  3DUK A;  3DGM A;  3EHC A;  4WHA A;  3OV4 A;  1SII A;  2P0M A;  2BU4 A;  3CCS 3;  3CCJ 3;  2OOV A;  3UNL A;  1Q7Y 4;  1Q40 B;  4FCJ A; 
#chains in the Genus database with same CATH homology
 4X2O A;  2QA4 3;  3F8X A;  3CC2 3;  1FA3 A;  2CFW A;  4FMA A;  1UUV B;  4HVN A;  3X3X A;  3S5C A;  2UX0 A;  1U5O A;  5DRV A;  2F98 A;  3CCU 3;  2P05 A;  1VQ8 3;  4FMC A;  4WWU C;  4AEQ A;  3FLJ A;  3NXJ A;  1OH0 A;  5FGO A;  3PZW A;  2A15 A;  5D81 A;  1JKG B;  3NV0 B;  2XRX B;  4K90 B;  4J9A A;  4R4K A;  1S72 3;  3GZB A;  3OXA A;  5CF2 A;  4HKV B;  1PFP A;  3CC7 3;  2PNC A;  1JB5 A;  2GEX A;  1CYV A;  4R1K A;  1W2B 2;  1STF I;  4XDV A;  1IQY A;  1LNH A;  3EF8 A;  3GZR A;  3EQQ B;  3PCR A;  1W2Z A;  1R4C A;  4BTW A;  4R80 A;  1CYU A;  1TP6 A;  3S67 A;  3RGA A;  2CW9 A;  2BHM A;  3BND A;  4FR9 A;  4EV5 A;  1A90 A;  2HMK B;  5LC7 A;  3VSY A;  3K9M C;  3SLU A;  2XSO B;  3KE7 A;  3F7S A;  1NO3 A;  2CG1 A;  1E3V A;  2LQV A;  1TFO A;  2Z6B A;  3KSE D;  1YGE A;  1YHQ 3;  1D6Y A;  2W9P A;  5LC6 A;  2INX A;  2OQE C;  3ER7 A;  3CCE 3;  1HKX A;  4AKY A;  1O7N B;  4CDL A;  3FG4 A;  2W04 A;  1O7M B;  3SVA A;  1D6Z A;  2WGO A;  5KP1 A;  2KXG A;  1W01 A;  3G4S 3;  5JBS A;  4N6T A;  2YX9 A;  2P09 A;  1K73 4;  3NV0 A;  1DYU A;  3HIG A;  1OF5 B;  1QAF A;  1FUW A;  3PGB A;  3HI7 A;  3ROB A;  4HM6 B;  2GEY A;  3UL5 A;  4H3U A;  3Q1C A;  4HM8 B;  2O3O A;  5FW5 A;  3N54 B;  3JUN A;  3CCM 3;  3IPT A;  3SOY A;  1KC8 4;  3I55 3;  3GRD A;  3OWS A;  1YJN 3;  4KFF A;  3GZX B;  1CQS A;  4KFE A;  4MMX B;  1DMN A;  1YJW 3;  2OWP A;  3T8U A;  1GD3 A;  2HMN B;  4J8T A;  2Z76 A;  2CFD A;  2W6J H;  5ELU A;  3B4P A;  2XGN A;  2XFS A;  2CK3 H;  3BNC A;  2WOH A;  1WNH A;  1QVG 2;  3B4O A;  2CFG A;  5AYS C;  4HM3 B;  1IDP A;  3UB1 A;  4HZ9 B;  2RGQ A;  2B24 B;  4HZB B;  5ELJ A;  2KRT A;  1AV4 A;  3PS8 A;  1VQO 3;  3D9R A;  3SX1 A;  2QIY A;  1YJ9 3;  2F99 A;  2V1L A;  3LML A;  3NBB A;  1N8Q A;  2W0Q A;  3EX9 A;  3H51 A;  4LEH A;  5AEU B;  1AVK A;  5IG0 A;  4LZI A;  4L8O A;  4WYK B;  1N5H A;  3EN1 B;  1IT8 A;  4HM7 B;  1RN7 A;  4RNZ A;  1K9M 4;  4GB5 A;  1OF5 A;  1OAC A;  3LOY A;  1NWW A;  4H61 A;  3KII A;  3SOA A;  2CFK A;  1PU4 A;  3FGY A;  1SPU A;  1W02 A;  1ISK A;  5CXO A;  3JUQ A;  1N9E A;  4G1M B;  2W56 B;  3U1W A;  5KP3 A;  3CPW 2;  1TIJ A;  3BNB A;  3FF0 A;  3I0Y A;  3LZA A;  3NQY A;  4OVM A;  4R9K A;  3CPO A;  2CWU A;  3GZY B;  3SXX A;  3G0K A;  2ZL8 A;  4XDW A;  1TUH A;  3B7C A;  1N8R 4;  3Q2P A;  4L7K A;  3EE1 A;  4O8S A;  1VQP 3;  1G96 A;  1LVN A;  1T5Y A;  2KCD A;  2B1X B;  3RDE A;  3UL6 A;  1U8C B;  3U97 A;  5JPP A;  1EA2 A;  4N6U A;  4XM4 A;  3IJE B;  4HM0 B;  1JNQ A;  3CCL 3;  2CH9 A;  3X41 A;  2Z77 A;  1JV2 B;  2JQ5 A;  2Y73 A;  1QVF 2;  1RKY A;  5IG3 A;  1FGO A;  2OOV C;  3EBT A;  3X3Z A;  3F40 A;  3LT8 A;  3X42 A;  3NM2 A;  2IA7 A;  4WYK A;  5IEO A;  4Q53 A;  1TU5 A;  1ULI B;  1OPY A;  1MNL A;  2GXF A;  3HII A;  1VQ4 3;  1ZO2 A;  3E99 A;  4STD A;  3CNM A;  2RFR A;  5BXQ A;  2ML6 A;  2Z7A A;  3G71 3;  4MMY B;  2XGL A;  3K5T A;  1JB2 A;  3S27 A;  4O3V A;  3N9H A;  3F7X A;  1RRH A;  2W56 A;  5AYR B;  1SQW A;  2CKF B;  1Q40 A;  3KKG A;  3DGL A;  1GY6 A;  1IQX A;  3WOF B;  1QAK A;  4HM4 B;  3M8C A;  4HM2 B;  4HM5 B;  3B8L A;  1FGM A;  1O7H B;  3STD A;  5STD A;  8CHO A;  3BLZ A;  1UUW B;  4K1V A;  1VQN 3;  2K0M A;  4WFO A;  5I97 A;  4QWT A;  1VQM 3;  1FGT A;  3DGO A;  4XBY A;  1Q42 A;  2WO0 A;  3DM8 A;  3S28 A;  3HK4 A;  2D42 A;  3AMO B;  3KZT A;  5AEW B;  1RJO A;  1JN5 B;  2E2V A;  1JKG A;  5IEN A;  2SBL A;  3QK9 A;  2JDI H;  3EJV A;  3EBY A;  2GBX B;  3KSP A;  4MEI A;  5AI1 A;  1ASK A;  3G8Z A;  1A67 A;  3KFQ C;  3JUM A;  2GU1 A;  2LYX A;  4XBX A;  2OTL 3;  2E2U A;  3CCQ 3;  3V99 A;  1DVD A;  1IVV A;  4LSO A;  1BUQ A;  1N9J A;  1M1X B;  1HU9 A;  1JJ2 2;  1IVU A;  1QJG A;  1O7G B;  3K63 A;  5G2G A;  3PCS A;  3UJM A;  4IIA A;  4EYC A;  2XSH B;  2YFL B;  3GWR A;  1W4N A;  3EC9 A;  2GU3 A;  4MJD A;  4N6L A;  4EC6 A;  3F9S A;  3NM7 A;  1OHS A;  2L4V A;  1AR0 A;  4R9L A;  2BMR B;  3SED A;  3MWZ A;  2FGT A;  4HBR A;  3CME 3;  2O9U X;  5CLK A;  2Y74 A;  2QEX 3;  3OWU A;  1GD4 A;  3QRD A;  1K41 A;  3LTA A;  3MPH A;  5IER A;  1M9G A;  1GS3 A;  4NHF A;  3NUV A;  1DMQ A;  2WGQ A;  2K54 A;  2ZDJ A;  3LTB A;  1AVL A;  3CU3 A;  2BO9 B;  3ALA A;  2CG0 A;  5CK6 A;  3WA2 X;  1VQ5 3;  3A76 A;  2CIU A;  2R4I A;  3NQZ A;  3CMA 3;  1NU3 A;  4JRF A;  1O7W B;  3DY5 A;  1E3R A;  1NB5 I;  1OCV A;  3LTD A;  3S29 A;  1KD1 4;  3AMO A;  3CD6 3;  1JN5 A;  4N3V A;  2F86 B;  2BMQ B;  1Q86 4;  1ROA A;  2XH9 A;  5TGN A;  1Q82 4;  3DGN A;  1ULJ B;  3TDG A;  4TX4 A;  1UW1 A;  1A2K A;  2GBW B;  1VQL 3;  4U13 A;  3V92 A;  1FGR A;  2OCT A;  2BT3 A;  3HX8 A;  4RZM A;  1TFK A;  3EN8 A;  5DRE A;  5BVB A;  4ZM8 A;  1RRL A;  4HJL B;  3CCV 3;  2XF3 A;  4XBT A;  3MSO A;  3Q90 A;  1IVX A;  1YIT 3;  4FCZ A;  3FF2 A;  2C11 A;  3FG3 A;  5AIH A;  3RGR A;  4JF8 A;  1W6Y A;  2C10 A;  1W5Z A;  3PXM A;  3K7C A;  1F8N A;  3CC4 3;  4XB5 A;  2P0X A;  1KSI A;  3WDG B;  2M7O A;  2W2C A;  1UI8 A;  3K0Z A;  2RSX A;  3OWY A;  5EVH A;  4FMD A;  3BB9 A;  4N6M A;  3X3Y A;  2YFI B;  4MMZ B;  3WOD G;  1YIJ 3;  3WA3 A;  3FKA A;  1EKM A;  3BNE A;  3LTC A;  1WQL B;  3FZW A;  3WOE B;  3FCS B;  1STD A;  5AIF A;  1Z1S A;  3V98 A;  6STD A;  2PZV A;  3PYJ A;  5D82 A;  2YFJ B;  2WOF A;  1V74 A;  1LXE A;  3IMA B;  1A2V A;  3GAX A;  3VF1 A;  3G6E 3;  1KQS 2;  3JUO A;  4K1U A;  2XEP A;  2XR8 B;  1OHP A;  2BNG A;  7STD A;  1K28 A;  3OX9 A;  3VGN A;  3J7Y d;  1W6C A;  2W9Q A;  3EB8 A;  1VQ6 3;  1IVW A;  1E97 A;  3FG1 A;  4RNY A;  4EXR A;  3O8Y A;  4FMB A;  2OQE A;  1NJI 4;  3NBR A;  5AII A;  4RBN A;  1O7P B;  3NHX A;  1VQ7 3;  1J2B A;  4ORL A;  3OW2 2;  1IU7 A;  1JB4 A;  4BTX A;  1M1K 4;  3MG1 A;  1CEW I;  5IEP A;  4LMI A;  1IQ8 A;  5EEO A;  3LXU X;  2IUK A;  3MKI A;  1WMP A;  3X40 A;  1OGZ A;  3D3L A;  4OUQ A;  5JPU A;  1L5G B;  3I56 3;  1SJW A;  4K61 A;  1DVC A;  1GY5 A;  1VZZ A;  3G16 A;  1GY7 A;  3NBJ A;  4WP5 A;  1OGX A;  1D6U A;  4N6V 0;  2QGU A;  2CWV A;  1IT7 A;  4AKZ A;  3L0R A;  4L8P A;  4FCM A;  1WTH A;  3F8H A;  3H3H A;  1EG9 B;  4HYZ A;  5AIG A;  2CFL A;  1LOX A;  1US1 A;  1IK3 A;  1Q81 4;  4IPB A;  5A0O B;  2HMJ B;  3LH4 A;  1W7C A;  2IUJ A;  2OTJ 3;  3T0U A;  4KVH A;  1YVB I;  1Y4K A;  2BMO B;  3LYG A;  1YI2 3;  5IW9 A;  1W00 A;  1C7H A;  3CXC 2;  3DXO A;  1QAL A;  1S5A A;  3JUP A;  2P38 A;  1IV9 A;  2XFT A;  4NRE A;  2Q07 A;  1VQ9 3;  2CWT A;  2RCD A;  2MC8 A;  2FNQ A;  4N6N B;  3CCR 3;  1VQK 3;  2I9W A;  5CF1 A;  1SIH A;  1FGQ A;  5HGR A;  4EV2 A;  1EQK A;  3HZP A;  1JRQ A;  1WMO A;  1NB3 I;  1W6G A;  3N8B A;  1IV7 A;  3KN4 A;  2E2T A;  3F14 A;  3DMC A;  4BTY A;  4HM1 B;  1WMN A;  3MG3 A;  4N6O B;  2CHC A;  1ROV A;  3NX0 A;  3T8N A;  4LGQ A;  5IG4 A;  3DZL A;  2W03 A;  5KP4 A;  3FSD A;  1M90 4;  4PEJ A;  3MHE A;  2HMO B;  1K8A 4;  2CC3 A;  1MOL A;  4I4K A;  4O02 B;  4CCV A;  1DMM A;  1UI7 A;  2MF7 A;  2FXT A;  2STD A;  3ECF A;  3JVC A;  2HML B;  1N5P A;  4GL6 A;  4IT7 A;  4KZ1 A;  5IF6 A;  4O2H A;  5D83 A;  1OHO A;  1QMA A;  3CNX A;  5EQL A;  3FH1 A;  3WMD A;  2HMM B;  5IG5 A;  4KFD A;  4OK0 A;  3MG2 A;  3LT9 A;  4EBG A;  2ML5 A;  4X2H A;  1KWI A;  2D1W A;  1GYB A;  1OUN A;  2IMJ A;  1ZX2 A;  1NDO B;  3MYT A;  3DUK A;  3DGM A;  3EHC A;  4WHA A;  3OV4 A;  1SII A;  2P0M A;  3CCS 3;  3CCJ 3;  2OOV A;  3UNL A;  1Q7Y 4;  1Q40 B;  4FCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...