1M904

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1m90400
3G713 1W2B2 1VQK3 2QEX3 3CCV3 1YJ93 1VQ43 1VQN3 1N8R4 3CPW2 1VQM3 1YIJ3 3CCU3 1YIT3 1NJI4 1YHQ3 2OTL3 3G4S3 3CCS3 3CC43 1Q7Y4 1VQ53 3CCQ3 3G6E3 1YJW3 1M1K4 1KD14 2QA43 1VQP3 1Q824 1Q864 3CCL3 3CC73 2OTJ3 1KC84 3CMA3 1Q814 3CXC2 1K734 3I553 3CCR3 3CCM3 3OW22 1QVF2 1K8A4 3CCJ3 1JJ22 1VQ93 3CME3 3I563 1S723 3CC23 1QVG2 1VQ83 3CCE3 1YJN3 1VQL3 1VQ63 3CD63 1VQ73 1M904 1K9M4 1VQO3 1KQS2 1YI23
chains in the Genus database with same CATH superfamily
1BSDA 1EA2A 3E99A 1MWUA 2P05A 1JKGA 3HIIA 3EBYA 1TRPA 1ROAA 2W03A 1B27A 5AEUB 1I2EA 5EEOA 1PU4A 2P38A 1W00A 3AHWA 4L8PA 2HMOB 3LMLA 3OV4A 4IT7A 3UB1A 1W6YA 1DMNA 1NU3A 1T3BA 1RHLA 1OUNA 3HZPA 1I2GA 1MOLA 1YGEA 4H61A 3DZLA 1IDPA 1AY7A 1FGOA 3CXC2 3CMA3 4QWTA 4KFFA 1OCVA 2Z7AA 5IG4A 1B21A 1GMRA 1Q42A 7GSPA 1RJOA 1I8VA 4FMBA 2SBLA 5AYRB 2HMKB 3LTDA 2L1SA 3M8CA 1K9M4 3FLJA 1DMQA 1FZUA 4XDWA 2A15A 2F86B 3UL6A 2QEX3 4JF8A 3WOFB 2E2TA 1JBSA 3I0YA 3HK4A 2KF4A 1T2HA 3H51A 3A76A 1IVUA 1AVKA 1BNIA 2O9UX 1CQSA 3RDEA 4ZM8A 1FGRA 2Y73A 4CJNA 1BSCA 2CFLA 2GXFA 3DMCA 4MMZB 3U97A 1DVCA 4I4KA 2C11A 1NDOB 2GSPA 4HM2B 4WFOA 2KF5A 1GMQA 3FZWA 3VF1A 2OOVA 3CME3 1FGMA 1W6GA 2F98A 2FGTA 3K9MC 3BNCA 1LOWA 1M904 1JB2A 5G2GA 3PYJA 1SPUA 1N8QA 1MNLA 3X3XA 5AEWB 2FNQA 3QK9A 2V1LA 4GL6A 3V98A 1RSNA 3HOHA 3JUQA 6STDA 3AGOA 3DGLA 3EF8A 2H0GA 3WDGB 4MMXB 2CH9A 1QAFA 1JN5A 2ZDJA 1BNFA 4LZIA 1K28A 3FF2A 3URPA 2BMRB 1RTUA 1B2MA 1YJW3 1GOYA 4KT3B 3STDA 5IW9A 4L7KA 2XF3A 1C7HA 1PFPA 3D5GA 3KKGA 3NM7A 2MF7A 4HYZA 4KFEA 3DGNA 1SARA 2XFTA 3BU4A 3KSPA 1QVF2 3EJVA 1VQ93 1V57A 1A2KA 4J5GA 3PCSA 6RNTA 2Z6BA 1BNJA 2ML5A 3T0UA 3X42A 1IV7A 2CHCA 3CD63 1STFI 1AVLA 3FCSB 1I3IA 4I5QA 2J8XB 1LXEA 2IA7A 4AKZA 3GSPA 1FYSA 3OWSA 4BL2A 2W9QA 1BGSA 5JPPA 4HZ9B 1RRLA 3MWZA 5FGOA 1RGCA 5CF1A 1NB3I 3JVCA 1GOUA 1IVWA 1IYYA 3CC43 2W2CA 1Q7Y4 2QIYA 5D82A 3BNDA 3SOYA 2B1XB 1X1YA 1BSAA 1GOVA 2XRXB 1OHSA 3EBTA 4J9AA 5IEPA 2R41A 3NV0B 1TJDA 1SQWA 4BL3A 5IF6A 3CC73 4RZMA 1TFKA 4PEJA 3CCR3 3LTCA 1YGWA 1I0XA 2Q07A 2CFWA 2JDIH 3OWUA 1UCLA 1GY5A 2CWTA 3FG4A 3CC23 1Q40B 1QALA 1JZDA 3WR2A 1CYUA 1UUWB 2D42A 1O7MB 1OHPA 2QGUA 1GD4A 2LYXA 1R4YA 3F14A 1O7GB 3FKAA 1JZOA 1UI8A 3EHCA 3DY5A 4FMAA 3LOYA 1GSPA 2WGOA 3F7SA 1N5HA 5A0OB 3NUVA 4XDVA 3RGRA 2RFRA 3KIIA 2INXA 4KZ1A 4IPBA 2BU4A 2RGQA 3WOEB 5M19A 1M1K4 3BIRA 5BIRA 1VQQA 1ASKA 3HIGA 2XFSA 1RLSA 1LOXA 2E2VA 3L0RA 3FG3A 4EW5A 3CCL3 1O7PB 2IMJA 4RNZA 1LOVA 2GBWB 5KP4A 3KSED 1TFOA 3OW22 1Y4KA 3JUMA 3LT8A 2YFIB 3Q2PA 1TIJA 2RSXA 1I70A 2L4VA 2PNCA 2BHMA 1B3SA 1EG9B 1NWWA 2CG0A 3PXMA 4HM4B 1BRIA 5IG3A 3CCE3 1JKGB 1G96A 1TP6A 1GMPA 2W6JH 1YJ93 5LC6A 2HOHA 1VQM3 1L5GB 2OOVC 4BTYA 2H0HA 4FCMA 2K54A 1UUGB 2ZA4A 1G0TA 2SARA 1UCJA 1I0VA 3UL5A 3G6E3 4FCJA 1W01A 5FW5A 3ALAA 3F9SA 2W56B 1D6UA 5RNTA 4WHAA 3D3LA 1BUQA 1TU5A 4N6OB 1Q9EA 1DVDA 1DMMA 1OH0A 2CFGA 1JJ22 1BAOA 1RCKA 2W56A 4GHOA 2MC8A 4CCVA 2CX1A 2KCDA 4WYKA 2W04A 1VQ73 2BMQB 3UNLA 1ULIB 3Q90A 5BU4A 2CFDA 4NREA 1BOXA 3KN4A 3KE7A 1JRQA 4AKYA 2PZVA 1BSEA 2F5MA 2CFKA 1W7CA 3MPHA 1YNVX 4DKIA 1MWTA 1R4CA 1O7HB 5AYSC 9RNTA 3BB9A 3NM2A 4OK0A 2OCTA 5ELJA 2Z76A 4HM5B 1A2PA 1RGFA 2K0MA 1GY6A 2BMOB 1KC84 1Q814 1K734 3OXAA 3F40A 3GZBA 4N6UA 7STDA 2BIRA 2BT3A 1RRHA 5LC7A 1ZS7A 3VGNA 3G16A 1VQ63 5TGNA 4MEIA 3X3YA 1LNHA 1HYFA 1E3VA 1RGAA 2HMNB 1AR0A 1IVVA 3DXOA 3CCV3 1BRNL 5HOHA 1IT8A 1LOYA 1RGKA 3BNBA 3NQZA 3B4PA 1JN5B 1FGTA 4RNYA 5AIHA 3SXXA 3OWYA 3WA3A 2W0QA 4BU4A 2OWPA 2XGNA 1MWSA 4HM6B 1BNSA 4EYCA 3D79A 4FMCA 1RCLA 1TTOA 3ECFA 4OVMA 1A90A 1NNVA 3KFQC 4LEHA 2C10A 4L8OA 1IVXA 5CXOA 1WMNA 2IYJA 3EN8A 2AADA 1FUTA 1M1XB 3NBBA 3S67A 3DUKA 1RGGA 1FA3A 3CCJ3 2CX0A 3UJMA 3AGNA 1BNEA 1TUHA 2OQEA 1QVG2 3RGAA 2H0IA 2ZHXB 3ZFZA 2RCDA 4CDLA 2YFJB 1X1XA 3WODG 4R9LA 3FGYA 3WMDA 1VQK3 5CF2A 2CIUA 3DM8A 1N8R4 1YIJ3 3HX8A 1RDSA 1T5YA 3QRDA 4N6MA 7RNTA 3LXUX 5EQLA 1ZO2A 3G4S3 3KZTA 3F8XA 4BIRA 3CNXA 1QAKA 4HJLB 4XBYA 1IK3A 2ML6A 4R9KA 3DGOA 4N3VA 2CC3A 1OF5A 1Q824 3MG2A 3MKIA 3AMOA 1X1WA 3CCM3 2FXTA 4H3UA 3N9HA 4FMDA 3F8HA 1IU7A 3K7CA 2CWUA 4N6LA 3V99A 1S723 1D6YA 3GZXB 5DRVA 1OGXA 3GZRA 1YJN3 1RN7A 3B4OA 1YI23 3WA2X 1SIHA 4K61A 4WP5A 1W2B2 4EBGA 1YVBI 1GD3A 1IQYA 2KAAA 1RNBA 3NX0A 1FUWA 3LYGA 3EN1B 1CH0A 1NB5I 3DGMA 4N6V0 2BNGA 4NHFA 1E97A 3MG1A 1OHOA 5GSPA 3IPTA 3LTBA 1D6ZA 4EV2A 2HMJB 1X1UA 1ZGXA 3B7CA 1UGIA 4Q53A 5AI1A 3ZG5A 5BXQA 5IENA 1KSIA 5M1AA 3MHEA 1UCKA 3LZAA 1I2FA 1W6CA 5D83A 4G1MB 4GB5A 3SYUA 4KFDA 3A5EA 1LQMB 1AQZA 2B24B 3NBJA 3GWRA 1BRGA 3NXJA 1VQL3 5AIGA 1B2SA 3CNMA 3MSOA 1B2ZA 1VQO3 1HZ1A 3DGYA 1IT7A 2UGIA 8RNTA 5IEOA 3S27A 3G8ZA 4STDA 3SX1A 4MJDA 1Z1SA 2Y74A 3MG3A 1GS3A 1OPYA 2M7OA 1M9GA 3VSYA 4HVNA 3ZG0A 4XM4A 2GEXA 4ORLA 3RNTA 2P0MA 2KRTA 2RBIA 4LSOA 5KP1A 4BTXA 3KCHA 1KQS2 1LQGC 1PYLA 2YX9A 4O8SA 2XGLA 4HAAA 1EKMA 4JRFA 5IG5A 3LT9A 1EQKA 1RMSA 1BNRA 4HM8B 3SVAA 1UCIA 3Q3FA 3D4AA 4XBTA 1ISKA 4WYKB 4HM7B 2RNTA 3PGBA 2XH9A 3HI7A 1N9EA 2CWVA 1VQ83 1U5OA 3GZYB 3JUNA 3LTAA 2C4BA 1YVSA 1EUIC 3V92A 3X41A 1FGQA 1LVNA 1UDII 2WGQA 1U8CB 4HM3B 1MGRA 1WMOA 5D81A 1FUSA 1WQLB 3SOAA 1UUVB 1UW1A 2D1WA 2OQEC 2YFLB 3GAXA 2STDA 4LMIA 3T8UA 1YHQ3 1W5ZA 3NBRA 1B20A 2XEPA 3D9RA 3FF0A 2W9PA 4N6TA 2IUJA 2GU1A 2CW9A 1DETA 1QJGA 4X2OA 5BVBA 5IERA 4EXRA 1BRSA 2WOFA 1K41A 3SEDA 4AEQA 1US1A 1V74A 5DREA 2CG1A 4FR9A 1ROVA 3ER7A 3ROBA 4X2HA 2K3DA 1N9JA 1FW7A 3JUOA 1UGHI 1HKXA 1RGHA 4O2HA 3S5CA 1BSBA 2ZL8A 1EEJA 5CLKA 5G1KA 3CCU3 3J7Yd 3K0ZA 2Z77A 2P0XA 1AV4A 3EC9A 1PY3A 1BANA 4HZBB 2BO9B 4N6NB 2LQVA 2UX0A 3B8LA 4GSPA 4HM1B 2F4YA 1IQ8A 4HBRA 2XR8B 3PS8A 2QA43 1QMAA 1Q864 1BRJA 1DYUA 1OGZA 2KF6A 3LH4A 4TX4A 1A67A 1SIIA 4IIAA 2GEYA 4K1VA 6GSPA 4K90B 1K8A4 4BTWA 2R4IA 1STDA 2AAEA 3K5TA 5AIIA 1JBTA 1RNTA 1BRHA 4RNTA 4LYLB 4U13A 3MYTA 5EVHA 4XBXA 3K63A 5JPUA 4HKVB 3SLUA 1BU4A 2F56A 3CPW2 1WNHA 3EE1A 3TDGA 1NJI4 1MGWA 5STDA 5HGRA 1BNGA 4R1KA 1VZZA 4CPKA 1GYBA 4J5KA 5IG0A 1OF5B 2GBXB 3FG1A 3H3HA 1BVIA 2F99A 1CYVA 1G02A 3AMOB 3IJEB 3BNEA 3X3ZA 1RGLA 2CKFB 1BRKA 4MMYB 3NQYA 5G1LA 3FH1A 2P09A 2HMLB 4O02B 3FSDA 1WTHA 3D5IA 3GRDA 8CHOA 3EB8A 1IV9A 3NHXA 3G713 1A2VA 1JV2B 5AIFA 3OX9A 1TRQA 5ELUA 2XSHB 1VQN3 1YIT3 3N54B 1OACA 5I97A 5M18A 4HOHA 2OTL3 2CK3H 3CCS3 1O7NB 4FCZA 1RKYA 1B2XA 1J2BA 2JQ5A 1VQ53 4KVHA 1HU9A 3EX9A 1KD14 1JNQA 1UI7A 1WMPA 1Q7HA 3PCRA 1JBRA 4EV5A 3CU3A 1BUJA 1BIRA 2I9WA 2O3OA 3U1WA 3NV0A 4J8TA 1I3FA 3AHSA 4O3VA 3X40A 1W2ZA 3Q1CA 4WWUC 3T8NA 2IUKA 1B2UA 1W02A 3JUPA 3BLZA 4EC6A 5KP3A 3EQQB 4NPBA 1IQXA 3O8YA 4K1UA 1Q40A 1E3RA 4RBNA 1F8NA 1VQ43 2UUGC 3S28A 2WO0A 3G0KA 3N8BA 1C54A 2KXGA 1T2IA 3PZWA 2WOHA 3CPOA 2KF3A 4XB5A 4R4KA 1S5AA 3F7XA 1KWIA 1CEWI 4HM0B 3CCQ3 2HMMB 1SJWA 1V58A 3IMAB 4ILFA 1JB5A 2E2UA 5JBSA 1VQP3 1RGEA 4LGQA 2OTJ3 1GY7A 5CK6A 1LNIA 3I553 1O7WB 1NO3A 1JB4A 2XSOB 3WHOA 4OUQA 1DE3A 1MWRA 3I563 1RN4A 2F5WA 1W4NA 2IY2A 1ULJB 3DH2A 1ZX2A 1RN1A 3S29A 2GU3A 1LRAA 1N5PA 4R80A
chains in the Genus database with same CATH topology
1EA2A 3E99A 2P05A 1JKGA 3HIIA 3EBYA 1ROAA 2W03A 5AEUB 5EEOA 1PU4A 2P38A 1W00A 4L8PA 2HMOB 3LMLA 3OV4A 4IT7A 3UB1A 1W6YA 1DMNA 1NU3A 3HZPA 1OUNA 1MOLA 1YGEA 4H61A 3DZLA 1IDPA 1FGOA 3CXC2 3CMA3 4QWTA 4KFFA 1OCVA 2Z7AA 5IG4A 1Q42A 1RJOA 4FMBA 2SBLA 5AYRB 2HMKB 3LTDA 3M8CA 1K9M4 3FLJA 1DMQA 4XDWA 2A15A 2F86B 3UL6A 2QEX3 4JF8A 3WOFB 2E2TA 3I0YA 3HK4A 3H51A 3A76A 1IVUA 1AVKA 2O9UX 1CQSA 3RDEA 4ZM8A 1FGRA 2Y73A 2CFLA 2GXFA 3DMCA 4MMZB 3U97A 1DVCA 4I4KA 2C11A 1NDOB 4HM2B 4WFOA 3FZWA 3VF1A 2OOVA 3CME3 1FGMA 1W6GA 2F98A 2FGTA 3K9MC 3BNCA 1M904 1JB2A 5G2GA 3PYJA 1SPUA 1N8QA 1MNLA 3X3XA 5AEWB 2FNQA 3QK9A 2V1LA 4GL6A 3V98A 3JUQA 6STDA 3DGLA 3EF8A 3WDGB 4MMXB 2CH9A 1QAFA 1JN5A 2ZDJA 4LZIA 1K28A 3FF2A 2BMRB 1YJW3 3STDA 5IW9A 4L7KA 2XF3A 1C7HA 1PFPA 3KKGA 3NM7A 2MF7A 4HYZA 4KFEA 3DGNA 2XFTA 3KSPA 1QVF2 3EJVA 1VQ93 1A2KA 3PCSA 2Z6BA 3T0UA 2ML5A 3X42A 3CD63 1IV7A 2CHCA 1STFI 1AVLA 3FCSB 1LXEA 2IA7A 4AKZA 3OWSA 2W9QA 5JPPA 4HZ9B 1RRLA 3MWZA 5FGOA 5CF1A 1NB3I 3JVCA 1IVWA 3CC43 1Q7Y4 2QIYA 5D82A 3BNDA 3SOYA 2B1XB 5IEPA 3EBTA 2XRXB 1OHSA 4J9AA 3NV0B 1SQWA 5IF6A 3CC73 4RZMA 1TFKA 4PEJA 3CCR3 3LTCA 2Q07A 2CFWA 2JDIH 3OWUA 3CC23 1GY5A 2CWTA 3FG4A 1Q40B 1QALA 1CYUA 1UUWB 2D42A 1O7MB 1OHPA 2QGUA 1GD4A 2LYXA 3F14A 1O7GB 3FKAA 1UI8A 3EHCA 3DY5A 4FMAA 3LOYA 2WGOA 3F7SA 1N5HA 5A0OB 3NUVA 4XDVA 3RGRA 2RFRA 3KIIA 2INXA 4KZ1A 4IPBA 2RGQA 3WOEB 1M1K4 1ASKA 3HIGA 2XFSA 1LOXA 2E2VA 3L0RA 3FG3A 3CCL3 1O7PB 2IMJA 4RNZA 2GBWB 5KP4A 3KSED 1TFOA 3OW22 1Y4KA 3JUMA 3LT8A 2YFIB 3Q2PA 1TIJA 2RSXA 2L4VA 2PNCA 2BHMA 1NWWA 1EG9B 3PXMA 2CG0A 5IG3A 4HM4B 3CCE3 1JKGB 1G96A 1TP6A 2W6JH 1YJ93 5LC6A 1VQM3 1L5GB 2OOVC 4BTYA 4FCMA 2K54A 3UL5A 3G6E3 4FCJA 1W01A 5FW5A 3ALAA 3F9SA 2W56B 1D6UA 1BUQA 4WHAA 3D3LA 1TU5A 4N6OB 1DVDA 1DMMA 1OH0A 2CFGA 1JJ22 2W56A 2MC8A 2GU3A 4CCVA 2KCDA 4WYKA 2W04A 1VQ73 2BMQB 3UNLA 1ULIB 3Q90A 2CFDA 4NREA 3KN4A 3KE7A 1JRQA 4AKYA 2PZVA 2CFKA 1W7CA 3MPHA 1R4CA 1O7HB 5AYSC 3BB9A 3NM2A 4OK0A 2OCTA 5ELJA 2Z76A 4HM5B 2K0MA 1GY6A 2BMOB 1KC84 1Q814 1K734 3OXAA 3F40A 3GZBA 4N6UA 7STDA 2BT3A 1RRHA 5LC7A 3VGNA 3G16A 1VQ63 5TGNA 4MEIA 3X3YA 1LNHA 1E3VA 2HMNB 1AR0A 1IVVA 3DXOA 3CCV3 1IT8A 3BNBA 3NQZA 3B4PA 1JN5B 1FGTA 4RNYA 5AIHA 3SXXA 3OWYA 3WA3A 2W0QA 2OWPA 2XGNA 4HM6B 4EYCA 4FMCA 4OVMA 3ECFA 1A90A 3KFQC 4LEHA 2C10A 4L8OA 1IVXA 5CXOA 1WMNA 3EN8A 1M1XB 3S67A 3NBBA 3DUKA 1FA3A 3CCJ3 3UJMA 1TUHA 2OQEA 1QVG2 3RGAA 2RCDA 4CDLA 2YFJB 3WODG 4R9LA 3FGYA 3WMDA 1VQK3 5CF2A 2CIUA 3DM8A 1N8R4 1YIJ3 3HX8A 1T5YA 3QRDA 4N6MA 3LXUX 5EQLA 1ZO2A 3G4S3 3KZTA 3F8XA 3CNXA 1QAKA 4HJLB 4XBYA 1IK3A 2ML6A 4R9KA 3DGOA 4N3VA 2CC3A 1OF5A 1Q824 3MG2A 3MKIA 3AMOA 3CCM3 2FXTA 4H3UA 3N9HA 4FMDA 3F8HA 1IU7A 3K7CA 2CWUA 4N6LA 3V99A 1S723 1D6YA 3GZXB 5DRVA 1OGXA 3GZRA 1YJN3 1RN7A 3B4OA 1YI23 3WA2X 1SIHA 4K61A 4WP5A 1W2B2 4EBGA 1YVBI 1GD3A 1IQYA 3NX0A 1FUWA 3LYGA 3EN1B 1NB5I 3DGMA 4N6V0 2BNGA 4NHFA 1E97A 3MG1A 1OHOA 3IPTA 3LTBA 1D6ZA 4EV2A 2HMJB 3B7CA 5BXQA 4Q53A 5AI1A 5IENA 1KSIA 3MHEA 3LZAA 1W6CA 5D83A 4G1MB 4GB5A 4KFDA 2B24B 3NBJA 3GWRA 3NXJA 1VQL3 5AIGA 3CNMA 3MSOA 1VQO3 1IT7A 5IEOA 3S27A 3G8ZA 4STDA 3SX1A 4MJDA 1Z1SA 2Y74A 3MG3A 1GS3A 1OPYA 2M7OA 1M9GA 3VSYA 4HVNA 4XM4A 2GEXA 4ORLA 2P0MA 2KRTA 4LSOA 5KP1A 4BTXA 2YX9A 4O8SA 2XGLA 1EKMA 4JRFA 5IG5A 3LT9A 1EQKA 4HM8B 3SVAA 4XBTA 1ISKA 4WYKB 4HM7B 3PGBA 2XH9A 3HI7A 1N9EA 2CWVA 1VQ83 1U5OA 3GZYB 3JUNA 3LTAA 3V92A 3X41A 1FGQA 1LVNA 2WGQA 1U8CB 4HM3B 1WMOA 5D81A 3SOAA 1WQLB 1UUVB 1UW1A 2D1WA 2YFLB 2OQEC 3GAXA 2STDA 4LMIA 3T8UA 1YHQ3 1W5ZA 3NBRA 2XEPA 3D9RA 3FF0A 2W9PA 4N6TA 2IUJA 2GU1A 2CW9A 1QJGA 4X2OA 5BVBA 5IERA 4EXRA 2WOFA 1K41A 3SEDA 4AEQA 1US1A 1V74A 5DREA 2CG1A 4FR9A 1ROVA 3ER7A 3ROBA 4X2HA 1N9JA 3JUOA 1HKXA 4O2HA 3S5CA 2ZL8A 5CLKA 3CCU3 3J7Yd 3K0ZA 2Z77A 2P0XA 1AV4A 3EC9A 4HZBB 2BO9B 4N6NB 2LQVA 2UX0A 3B8LA 4HM1B 1IQ8A 4HBRA 2XR8B 3PS8A 2QA43 1QMAA 1Q864 1DYUA 1OGZA 4TX4A 3LH4A 1A67A 1SIIA 4IIAA 2GEYA 4K1VA 1K8A4 4K90B 4BTWA 2R4IA 1STDA 3K5TA 5AIIA 4U13A 3MYTA 5EVHA 4XBXA 3K63A 5JPUA 4HKVB 3SLUA 3CPW2 1WNHA 3EE1A 3TDGA 1NJI4 5STDA 5HGRA 4R1KA 1VZZA 1GYBA 5IG0A 1OF5B 2GBXB 3FG1A 3H3HA 2F99A 1CYVA 3AMOB 3IJEB 3BNEA 3X3ZA 2CKFB 4MMYB 3NQYA 3FH1A 2P09A 2HMLB 4O02B 3FSDA 1WTHA 3GRDA 8CHOA 3EB8A 1IV9A 3NHXA 3G713 1A2VA 1JV2B 5AIFA 3OX9A 5ELUA 2XSHB 1VQN3 1YIT3 3N54B 1OACA 5I97A 2OTL3 2CK3H 3CCS3 1O7NB 4FCZA 1RKYA 1J2BA 2JQ5A 1VQ53 4KVHA 1HU9A 3EX9A 1KD14 1JNQA 1UI7A 1WMPA 3PCRA 4EV5A 3CU3A 2I9WA 2O3OA 3U1WA 3NV0A 4J8TA 4O3VA 3X40A 1W2ZA 3Q1CA 4WWUC 3T8NA 2IUKA 1W02A 3JUPA 3BLZA 4EC6A 5KP3A 3EQQB 1IQXA 3O8YA 4K1UA 1Q40A 1E3RA 4RBNA 1F8NA 1VQ43 3S28A 2WO0A 3G0KA 3N8BA 2KXGA 3PZWA 2WOHA 3CPOA 4XB5A 4R4KA 1S5AA 3F7XA 1KWIA 1CEWI 4HM0B 3CCQ3 2HMMB 1SJWA 3IMAB 1JB5A 2E2UA 5JBSA 1VQP3 4LGQA 2OTJ3 1GY7A 5CK6A 3I553 1O7WB 1NO3A 1JB4A 2XSOB 4OUQA 3I563 1W4NA 1ULJB 1ZX2A 3S29A 2W2CA 1KQS2 1N5PA 4R80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 3;  1W2B 2;  1VQK 3;  2QEX 3;  3CCV 3;  1YJ9 3;  1VQ4 3;  1VQN 3;  1N8R 4;  3CPW 2;  1VQM 3;  1YIJ 3;  3CCU 3;  1YIT 3;  1NJI 4;  1YHQ 3;  2OTL 3;  3G4S 3;  3CCS 3;  3CC4 3;  1Q7Y 4;  1VQ5 3;  3CCQ 3;  3G6E 3;  1YJW 3;  1M1K 4;  1KD1 4;  2QA4 3;  1VQP 3;  1Q82 4;  1Q86 4;  3CCL 3;  3CC7 3;  2OTJ 3;  1KC8 4;  3CMA 3;  1Q81 4;  3CXC 2;  1K73 4;  3I55 3;  3CCR 3;  3CCM 3;  3OW2 2;  1QVF 2;  1K8A 4;  3CCJ 3;  1JJ2 2;  1VQ9 3;  3CME 3;  3I56 3;  1S72 3;  3CC2 3;  1QVG 2;  1VQ8 3;  3CCE 3;  1YJN 3;  1VQL 3;  1VQ6 3;  3CD6 3;  1VQ7 3;  1M90 4;  1K9M 4;  1VQO 3;  1KQS 2;  1YI2 3; 
#chains in the Genus database with same CATH topology
 1BSD A;  1EA2 A;  3E99 A;  1MWU A;  2P05 A;  1JKG A;  3HII A;  3EBY A;  1TRP A;  1ROA A;  2W03 A;  1B27 A;  5AEU B;  1I2E A;  5EEO A;  1PU4 A;  2P38 A;  1W00 A;  3AHW A;  4L8P A;  2HMO B;  3LML A;  3OV4 A;  4IT7 A;  3UB1 A;  1W6Y A;  1DMN A;  1NU3 A;  1T3B A;  1RHL A;  1OUN A;  3HZP A;  1I2G A;  1MOL A;  1YGE A;  4H61 A;  3DZL A;  1IDP A;  1AY7 A;  1FGO A;  3CXC 2;  3CMA 3;  4QWT A;  4KFF A;  1OCV A;  2Z7A A;  5IG4 A;  1B21 A;  1GMR A;  1Q42 A;  7GSP A;  1RJO A;  1I8V A;  4FMB A;  2SBL A;  5AYR B;  2HMK B;  3LTD A;  2L1S A;  3M8C A;  1K9M 4;  3FLJ A;  1DMQ A;  1FZU A;  4XDW A;  2A15 A;  2F86 B;  3UL6 A;  2QEX 3;  4JF8 A;  3WOF B;  2E2T A;  1JBS A;  3I0Y A;  3HK4 A;  2KF4 A;  1T2H A;  3H51 A;  3A76 A;  1IVU A;  1AVK A;  1BNI A;  2O9U X;  1CQS A;  3RDE A;  4ZM8 A;  1FGR A;  2Y73 A;  4CJN A;  1BSC A;  2CFL A;  2GXF A;  3DMC A;  4MMZ B;  3U97 A;  1DVC A;  4I4K A;  2C11 A;  1NDO B;  2GSP A;  4HM2 B;  4WFO A;  2KF5 A;  1GMQ A;  3FZW A;  3VF1 A;  2OOV A;  3CME 3;  1FGM A;  1W6G A;  2F98 A;  2FGT A;  3K9M C;  3BNC A;  1LOW A;  1M90 4;  1JB2 A;  5G2G A;  3PYJ A;  1SPU A;  1N8Q A;  1MNL A;  3X3X A;  5AEW B;  2FNQ A;  3QK9 A;  2V1L A;  4GL6 A;  3V98 A;  1RSN A;  3HOH A;  3JUQ A;  6STD A;  3AGO A;  3DGL A;  3EF8 A;  2H0G A;  3WDG B;  4MMX B;  2CH9 A;  1QAF A;  1JN5 A;  2ZDJ A;  1BNF A;  4LZI A;  1K28 A;  3FF2 A;  3URP A;  2BMR B;  1RTU A;  1B2M A;  1YJW 3;  1GOY A;  4KT3 B;  3STD A;  5IW9 A;  4L7K A;  2XF3 A;  1C7H A;  1PFP A;  3D5G A;  3KKG A;  3NM7 A;  2MF7 A;  4HYZ A;  4KFE A;  3DGN A;  1SAR A;  2XFT A;  3BU4 A;  3KSP A;  1QVF 2;  3EJV A;  1VQ9 3;  1V57 A;  1A2K A;  4J5G A;  3PCS A;  6RNT A;  2Z6B A;  1BNJ A;  2ML5 A;  3T0U A;  3X42 A;  1IV7 A;  2CHC A;  3CD6 3;  1STF I;  1AVL A;  3FCS B;  1I3I A;  4I5Q A;  2J8X B;  1LXE A;  2IA7 A;  4AKZ A;  3GSP A;  1FYS A;  3OWS A;  4BL2 A;  2W9Q A;  1BGS A;  5JPP A;  4HZ9 B;  1RRL A;  3MWZ A;  5FGO A;  1RGC A;  5CF1 A;  1NB3 I;  3JVC A;  1GOU A;  1IVW A;  1IYY A;  3CC4 3;  2W2C A;  1Q7Y 4;  2QIY A;  5D82 A;  3BND A;  3SOY A;  2B1X B;  1X1Y A;  1BSA A;  1GOV A;  2XRX B;  1OHS A;  3EBT A;  4J9A A;  5IEP A;  2R41 A;  3NV0 B;  1TJD A;  1SQW A;  4BL3 A;  5IF6 A;  3CC7 3;  4RZM A;  1TFK A;  4PEJ A;  3CCR 3;  3LTC A;  1YGW A;  1I0X A;  2Q07 A;  2CFW A;  2JDI H;  3OWU A;  1UCL A;  1GY5 A;  2CWT A;  3FG4 A;  3CC2 3;  1Q40 B;  1QAL A;  1JZD A;  3WR2 A;  1CYU A;  1UUW B;  2D42 A;  1O7M B;  1OHP A;  2QGU A;  1GD4 A;  2LYX A;  1R4Y A;  3F14 A;  1O7G B;  3FKA A;  1JZO A;  1UI8 A;  3EHC A;  3DY5 A;  4FMA A;  3LOY A;  1GSP A;  2WGO A;  3F7S A;  1N5H A;  5A0O B;  3NUV A;  4XDV A;  3RGR A;  2RFR A;  3KII A;  2INX A;  4KZ1 A;  4IPB A;  2BU4 A;  2RGQ A;  3WOE B;  5M19 A;  1M1K 4;  3BIR A;  5BIR A;  1VQQ A;  1ASK A;  3HIG A;  2XFS A;  1RLS A;  1LOX A;  2E2V A;  3L0R A;  3FG3 A;  4EW5 A;  3CCL 3;  1O7P B;  2IMJ A;  4RNZ A;  1LOV A;  2GBW B;  5KP4 A;  3KSE D;  1TFO A;  3OW2 2;  1Y4K A;  3JUM A;  3LT8 A;  2YFI B;  3Q2P A;  1TIJ A;  2RSX A;  1I70 A;  2L4V A;  2PNC A;  2BHM A;  1B3S A;  1EG9 B;  1NWW A;  2CG0 A;  3PXM A;  4HM4 B;  1BRI A;  5IG3 A;  3CCE 3;  1JKG B;  1G96 A;  1TP6 A;  1GMP A;  2W6J H;  1YJ9 3;  5LC6 A;  2HOH A;  1VQM 3;  1L5G B;  2OOV C;  4BTY A;  2H0H A;  4FCM A;  2K54 A;  1UUG B;  2ZA4 A;  1G0T A;  2SAR A;  1UCJ A;  1I0V A;  3UL5 A;  3G6E 3;  4FCJ A;  1W01 A;  5FW5 A;  3ALA A;  3F9S A;  2W56 B;  1D6U A;  5RNT A;  4WHA A;  3D3L A;  1BUQ A;  1TU5 A;  4N6O B;  1Q9E A;  1DVD A;  1DMM A;  1OH0 A;  2CFG A;  1JJ2 2;  1BAO A;  1RCK A;  2W56 A;  4GHO A;  2MC8 A;  4CCV A;  2CX1 A;  2KCD A;  4WYK A;  2W04 A;  1VQ7 3;  2BMQ B;  3UNL A;  1ULI B;  3Q90 A;  5BU4 A;  2CFD A;  4NRE A;  1BOX A;  3KN4 A;  3KE7 A;  1JRQ A;  4AKY A;  2PZV A;  1BSE A;  2F5M A;  2CFK A;  1W7C A;  3MPH A;  1YNV X;  4DKI A;  1MWT A;  1R4C A;  1O7H B;  5AYS C;  9RNT A;  3BB9 A;  3NM2 A;  4OK0 A;  2OCT A;  5ELJ A;  2Z76 A;  4HM5 B;  1A2P A;  1RGF A;  2K0M A;  1GY6 A;  2BMO B;  1KC8 4;  1Q81 4;  1K73 4;  3OXA A;  3F40 A;  3GZB A;  4N6U A;  7STD A;  2BIR A;  2BT3 A;  1RRH A;  5LC7 A;  1ZS7 A;  3VGN A;  3G16 A;  1VQ6 3;  5TGN A;  4MEI A;  3X3Y A;  1LNH A;  1HYF A;  1E3V A;  1RGA A;  2HMN B;  1AR0 A;  1IVV A;  3DXO A;  3CCV 3;  1BRN L;  5HOH A;  1IT8 A;  1LOY A;  1RGK A;  3BNB A;  3NQZ A;  3B4P A;  1JN5 B;  1FGT A;  4RNY A;  5AIH A;  3SXX A;  3OWY A;  3WA3 A;  2W0Q A;  4BU4 A;  2OWP A;  2XGN A;  1MWS A;  4HM6 B;  1BNS A;  4EYC A;  3D79 A;  4FMC A;  1RCL A;  1TTO A;  3ECF A;  4OVM A;  1A90 A;  1NNV A;  3KFQ C;  4LEH A;  2C10 A;  4L8O A;  1IVX A;  5CXO A;  1WMN A;  2IYJ A;  3EN8 A;  2AAD A;  1FUT A;  1M1X B;  3NBB A;  3S67 A;  3DUK A;  1RGG A;  1FA3 A;  3CCJ 3;  2CX0 A;  3UJM A;  3AGN A;  1BNE A;  1TUH A;  2OQE A;  1QVG 2;  3RGA A;  2H0I A;  2ZHX B;  3ZFZ A;  2RCD A;  4CDL A;  2YFJ B;  1X1X A;  3WOD G;  4R9L A;  3FGY A;  3WMD A;  1VQK 3;  5CF2 A;  2CIU A;  3DM8 A;  1N8R 4;  1YIJ 3;  3HX8 A;  1RDS A;  1T5Y A;  3QRD A;  4N6M A;  7RNT A;  3LXU X;  5EQL A;  1ZO2 A;  3G4S 3;  3KZT A;  3F8X A;  4BIR A;  3CNX A;  1QAK A;  4HJL B;  4XBY A;  1IK3 A;  2ML6 A;  4R9K A;  3DGO A;  4N3V A;  2CC3 A;  1OF5 A;  1Q82 4;  3MG2 A;  3MKI A;  3AMO A;  1X1W A;  3CCM 3;  2FXT A;  4H3U A;  3N9H A;  4FMD A;  3F8H A;  1IU7 A;  3K7C A;  2CWU A;  4N6L A;  3V99 A;  1S72 3;  1D6Y A;  3GZX B;  5DRV A;  1OGX A;  3GZR A;  1YJN 3;  1RN7 A;  3B4O A;  1YI2 3;  3WA2 X;  1SIH A;  4K61 A;  4WP5 A;  1W2B 2;  4EBG A;  1YVB I;  1GD3 A;  1IQY A;  2KAA A;  1RNB A;  3NX0 A;  1FUW A;  3LYG A;  3EN1 B;  1CH0 A;  1NB5 I;  3DGM A;  4N6V 0;  2BNG A;  4NHF A;  1E97 A;  3MG1 A;  1OHO A;  5GSP A;  3IPT A;  3LTB A;  1D6Z A;  4EV2 A;  2HMJ B;  1X1U A;  1ZGX A;  3B7C A;  1UGI A;  4Q53 A;  5AI1 A;  3ZG5 A;  5BXQ A;  5IEN A;  1KSI A;  5M1A A;  3MHE A;  1UCK A;  3LZA A;  1I2F A;  1W6C A;  5D83 A;  4G1M B;  4GB5 A;  3SYU A;  4KFD A;  3A5E A;  1LQM B;  1AQZ A;  2B24 B;  3NBJ A;  3GWR A;  1BRG A;  3NXJ A;  1VQL 3;  5AIG A;  1B2S A;  3CNM A;  3MSO A;  1B2Z A;  1VQO 3;  1HZ1 A;  3DGY A;  1IT7 A;  2UGI A;  8RNT A;  5IEO A;  3S27 A;  3G8Z A;  4STD A;  3SX1 A;  4MJD A;  1Z1S A;  2Y74 A;  3MG3 A;  1GS3 A;  1OPY A;  2M7O A;  1M9G A;  3VSY A;  4HVN A;  3ZG0 A;  4XM4 A;  2GEX A;  4ORL A;  3RNT A;  2P0M A;  2KRT A;  2RBI A;  4LSO A;  5KP1 A;  4BTX A;  3KCH A;  1KQS 2;  1LQG C;  1PYL A;  2YX9 A;  4O8S A;  2XGL A;  4HAA A;  1EKM A;  4JRF A;  5IG5 A;  3LT9 A;  1EQK A;  1RMS A;  1BNR A;  4HM8 B;  3SVA A;  1UCI A;  3Q3F A;  3D4A A;  4XBT A;  1ISK A;  4WYK B;  4HM7 B;  2RNT A;  3PGB A;  2XH9 A;  3HI7 A;  1N9E A;  2CWV A;  1VQ8 3;  1U5O A;  3GZY B;  3JUN A;  3LTA A;  2C4B A;  1YVS A;  1EUI C;  3V92 A;  3X41 A;  1FGQ A;  1LVN A;  1UDI I;  2WGQ A;  1U8C B;  4HM3 B;  1MGR A;  1WMO A;  5D81 A;  1FUS A;  1WQL B;  3SOA A;  1UUV B;  1UW1 A;  2D1W A;  2OQE C;  2YFL B;  3GAX A;  2STD A;  4LMI A;  3T8U A;  1YHQ 3;  1W5Z A;  3NBR A;  1B20 A;  2XEP A;  3D9R A;  3FF0 A;  2W9P A;  4N6T A;  2IUJ A;  2GU1 A;  2CW9 A;  1DET A;  1QJG A;  4X2O A;  5BVB A;  5IER A;  4EXR A;  1BRS A;  2WOF A;  1K41 A;  3SED A;  4AEQ A;  1US1 A;  1V74 A;  5DRE A;  2CG1 A;  4FR9 A;  1ROV A;  3ER7 A;  3ROB A;  4X2H A;  2K3D A;  1N9J A;  1FW7 A;  3JUO A;  1UGH I;  1HKX A;  1RGH A;  4O2H A;  3S5C A;  1BSB A;  2ZL8 A;  1EEJ A;  5CLK A;  5G1K A;  3CCU 3;  3J7Y d;  3K0Z A;  2Z77 A;  2P0X A;  1AV4 A;  3EC9 A;  1PY3 A;  1BAN A;  4HZB B;  2BO9 B;  4N6N B;  2LQV A;  2UX0 A;  3B8L A;  4GSP A;  4HM1 B;  2F4Y A;  1IQ8 A;  4HBR A;  2XR8 B;  3PS8 A;  2QA4 3;  1QMA A;  1Q86 4;  1BRJ A;  1DYU A;  1OGZ A;  2KF6 A;  3LH4 A;  4TX4 A;  1A67 A;  1SII A;  4IIA A;  2GEY A;  4K1V A;  6GSP A;  4K90 B;  1K8A 4;  4BTW A;  2R4I A;  1STD A;  2AAE A;  3K5T A;  5AII A;  1JBT A;  1RNT A;  1BRH A;  4RNT A;  4LYL B;  4U13 A;  3MYT A;  5EVH A;  4XBX A;  3K63 A;  5JPU A;  4HKV B;  3SLU A;  1BU4 A;  2F56 A;  3CPW 2;  1WNH A;  3EE1 A;  3TDG A;  1NJI 4;  1MGW A;  5STD A;  5HGR A;  1BNG A;  4R1K A;  1VZZ A;  4CPK A;  1GYB A;  4J5K A;  5IG0 A;  1OF5 B;  2GBX B;  3FG1 A;  3H3H A;  1BVI A;  2F99 A;  1CYV A;  1G02 A;  3AMO B;  3IJE B;  3BNE A;  3X3Z A;  1RGL A;  2CKF B;  1BRK A;  4MMY B;  3NQY A;  5G1L A;  3FH1 A;  2P09 A;  2HML B;  4O02 B;  3FSD A;  1WTH A;  3D5I A;  3GRD A;  8CHO A;  3EB8 A;  1IV9 A;  3NHX A;  3G71 3;  1A2V A;  1JV2 B;  5AIF A;  3OX9 A;  1TRQ A;  5ELU A;  2XSH B;  1VQN 3;  1YIT 3;  3N54 B;  1OAC A;  5I97 A;  5M18 A;  4HOH A;  2OTL 3;  2CK3 H;  3CCS 3;  1O7N B;  4FCZ A;  1RKY A;  1B2X A;  1J2B A;  2JQ5 A;  1VQ5 3;  4KVH A;  1HU9 A;  3EX9 A;  1KD1 4;  1JNQ A;  1UI7 A;  1WMP A;  1Q7H A;  3PCR A;  1JBR A;  4EV5 A;  3CU3 A;  1BUJ A;  1BIR A;  2I9W A;  2O3O A;  3U1W A;  3NV0 A;  4J8T A;  1I3F A;  3AHS A;  4O3V A;  3X40 A;  1W2Z A;  3Q1C A;  4WWU C;  3T8N A;  2IUK A;  1B2U A;  1W02 A;  3JUP A;  3BLZ A;  4EC6 A;  5KP3 A;  3EQQ B;  4NPB A;  1IQX A;  3O8Y A;  4K1U A;  1Q40 A;  1E3R A;  4RBN A;  1F8N A;  1VQ4 3;  2UUG C;  3S28 A;  2WO0 A;  3G0K A;  3N8B A;  1C54 A;  2KXG A;  1T2I A;  3PZW A;  2WOH A;  3CPO A;  2KF3 A;  4XB5 A;  4R4K A;  1S5A A;  3F7X A;  1KWI A;  1CEW I;  4HM0 B;  3CCQ 3;  2HMM B;  1SJW A;  1V58 A;  3IMA B;  4ILF A;  1JB5 A;  2E2U A;  5JBS A;  1VQP 3;  1RGE A;  4LGQ A;  2OTJ 3;  1GY7 A;  5CK6 A;  1LNI A;  3I55 3;  1O7W B;  1NO3 A;  1JB4 A;  2XSO B;  3WHO A;  4OUQ A;  1DE3 A;  1MWR A;  3I56 3;  1RN4 A;  2F5W A;  1W4N A;  2IY2 A;  1ULJ B;  3DH2 A;  1ZX2 A;  1RN1 A;  3S29 A;  2GU3 A;  1LRA A;  1N5P A;  4R80 A; 
#chains in the Genus database with same CATH homology
 1EA2 A;  3E99 A;  2P05 A;  1JKG A;  3HII A;  3EBY A;  1ROA A;  2W03 A;  5AEU B;  5EEO A;  1PU4 A;  2P38 A;  1W00 A;  4L8P A;  2HMO B;  3LML A;  3OV4 A;  4IT7 A;  3UB1 A;  1W6Y A;  1DMN A;  1NU3 A;  3HZP A;  1OUN A;  1MOL A;  1YGE A;  4H61 A;  3DZL A;  1IDP A;  1FGO A;  3CXC 2;  3CMA 3;  4QWT A;  4KFF A;  1OCV A;  2Z7A A;  5IG4 A;  1Q42 A;  1RJO A;  4FMB A;  2SBL A;  5AYR B;  2HMK B;  3LTD A;  3M8C A;  1K9M 4;  3FLJ A;  1DMQ A;  4XDW A;  2A15 A;  2F86 B;  3UL6 A;  2QEX 3;  4JF8 A;  3WOF B;  2E2T A;  3I0Y A;  3HK4 A;  3H51 A;  3A76 A;  1IVU A;  1AVK A;  2O9U X;  1CQS A;  3RDE A;  4ZM8 A;  1FGR A;  2Y73 A;  2CFL A;  2GXF A;  3DMC A;  4MMZ B;  3U97 A;  1DVC A;  4I4K A;  2C11 A;  1NDO B;  4HM2 B;  4WFO A;  3FZW A;  3VF1 A;  2OOV A;  3CME 3;  1FGM A;  1W6G A;  2F98 A;  2FGT A;  3K9M C;  3BNC A;  1M90 4;  1JB2 A;  5G2G A;  3PYJ A;  1SPU A;  1N8Q A;  1MNL A;  3X3X A;  5AEW B;  2FNQ A;  3QK9 A;  2V1L A;  4GL6 A;  3V98 A;  3JUQ A;  6STD A;  3DGL A;  3EF8 A;  3WDG B;  4MMX B;  2CH9 A;  1QAF A;  1JN5 A;  2ZDJ A;  4LZI A;  1K28 A;  3FF2 A;  2BMR B;  1YJW 3;  3STD A;  5IW9 A;  4L7K A;  2XF3 A;  1C7H A;  1PFP A;  3KKG A;  3NM7 A;  2MF7 A;  4HYZ A;  4KFE A;  3DGN A;  2XFT A;  3KSP A;  1QVF 2;  3EJV A;  1VQ9 3;  1A2K A;  3PCS A;  2Z6B A;  3T0U A;  2ML5 A;  3X42 A;  3CD6 3;  1IV7 A;  2CHC A;  1STF I;  1AVL A;  3FCS B;  1LXE A;  2IA7 A;  4AKZ A;  3OWS A;  2W9Q A;  5JPP A;  4HZ9 B;  1RRL A;  3MWZ A;  5FGO A;  5CF1 A;  1NB3 I;  3JVC A;  1IVW A;  3CC4 3;  1Q7Y 4;  2QIY A;  5D82 A;  3BND A;  3SOY A;  2B1X B;  5IEP A;  3EBT A;  2XRX B;  1OHS A;  4J9A A;  3NV0 B;  1SQW A;  5IF6 A;  3CC7 3;  4RZM A;  1TFK A;  4PEJ A;  3CCR 3;  3LTC A;  2Q07 A;  2CFW A;  2JDI H;  3OWU A;  3CC2 3;  1GY5 A;  2CWT A;  3FG4 A;  1Q40 B;  1QAL A;  1CYU A;  1UUW B;  2D42 A;  1O7M B;  1OHP A;  2QGU A;  1GD4 A;  2LYX A;  3F14 A;  1O7G B;  3FKA A;  1UI8 A;  3EHC A;  3DY5 A;  4FMA A;  3LOY A;  2WGO A;  3F7S A;  1N5H A;  5A0O B;  3NUV A;  4XDV A;  3RGR A;  2RFR A;  3KII A;  2INX A;  4KZ1 A;  4IPB A;  2RGQ A;  3WOE B;  1M1K 4;  1ASK A;  3HIG A;  2XFS A;  1LOX A;  2E2V A;  3L0R A;  3FG3 A;  3CCL 3;  1O7P B;  2IMJ A;  4RNZ A;  2GBW B;  5KP4 A;  3KSE D;  1TFO A;  3OW2 2;  1Y4K A;  3JUM A;  3LT8 A;  2YFI B;  3Q2P A;  1TIJ A;  2RSX A;  2L4V A;  2PNC A;  2BHM A;  1NWW A;  1EG9 B;  3PXM A;  2CG0 A;  5IG3 A;  4HM4 B;  3CCE 3;  1JKG B;  1G96 A;  1TP6 A;  2W6J H;  1YJ9 3;  5LC6 A;  1VQM 3;  1L5G B;  2OOV C;  4BTY A;  4FCM A;  2K54 A;  3UL5 A;  3G6E 3;  4FCJ A;  1W01 A;  5FW5 A;  3ALA A;  3F9S A;  2W56 B;  1D6U A;  1BUQ A;  4WHA A;  3D3L A;  1TU5 A;  4N6O B;  1DVD A;  1DMM A;  1OH0 A;  2CFG A;  1JJ2 2;  2W56 A;  2MC8 A;  2GU3 A;  4CCV A;  2KCD A;  4WYK A;  2W04 A;  1VQ7 3;  2BMQ B;  3UNL A;  1ULI B;  3Q90 A;  2CFD A;  4NRE A;  3KN4 A;  3KE7 A;  1JRQ A;  4AKY A;  2PZV A;  2CFK A;  1W7C A;  3MPH A;  1R4C A;  1O7H B;  5AYS C;  3BB9 A;  3NM2 A;  4OK0 A;  2OCT A;  5ELJ A;  2Z76 A;  4HM5 B;  2K0M A;  1GY6 A;  2BMO B;  1KC8 4;  1Q81 4;  1K73 4;  3OXA A;  3F40 A;  3GZB A;  4N6U A;  7STD A;  2BT3 A;  1RRH A;  5LC7 A;  3VGN A;  3G16 A;  1VQ6 3;  5TGN A;  4MEI A;  3X3Y A;  1LNH A;  1E3V A;  2HMN B;  1AR0 A;  1IVV A;  3DXO A;  3CCV 3;  1IT8 A;  3BNB A;  3NQZ A;  3B4P A;  1JN5 B;  1FGT A;  4RNY A;  5AIH A;  3SXX A;  3OWY A;  3WA3 A;  2W0Q A;  2OWP A;  2XGN A;  4HM6 B;  4EYC A;  4FMC A;  4OVM A;  3ECF A;  1A90 A;  3KFQ C;  4LEH A;  2C10 A;  4L8O A;  1IVX A;  5CXO A;  1WMN A;  3EN8 A;  1M1X B;  3S67 A;  3NBB A;  3DUK A;  1FA3 A;  3CCJ 3;  3UJM A;  1TUH A;  2OQE A;  1QVG 2;  3RGA A;  2RCD A;  4CDL A;  2YFJ B;  3WOD G;  4R9L A;  3FGY A;  3WMD A;  1VQK 3;  5CF2 A;  2CIU A;  3DM8 A;  1N8R 4;  1YIJ 3;  3HX8 A;  1T5Y A;  3QRD A;  4N6M A;  3LXU X;  5EQL A;  1ZO2 A;  3G4S 3;  3KZT A;  3F8X A;  3CNX A;  1QAK A;  4HJL B;  4XBY A;  1IK3 A;  2ML6 A;  4R9K A;  3DGO A;  4N3V A;  2CC3 A;  1OF5 A;  1Q82 4;  3MG2 A;  3MKI A;  3AMO A;  3CCM 3;  2FXT A;  4H3U A;  3N9H A;  4FMD A;  3F8H A;  1IU7 A;  3K7C A;  2CWU A;  4N6L A;  3V99 A;  1S72 3;  1D6Y A;  3GZX B;  5DRV A;  1OGX A;  3GZR A;  1YJN 3;  1RN7 A;  3B4O A;  1YI2 3;  3WA2 X;  1SIH A;  4K61 A;  4WP5 A;  1W2B 2;  4EBG A;  1YVB I;  1GD3 A;  1IQY A;  3NX0 A;  1FUW A;  3LYG A;  3EN1 B;  1NB5 I;  3DGM A;  4N6V 0;  2BNG A;  4NHF A;  1E97 A;  3MG1 A;  1OHO A;  3IPT A;  3LTB A;  1D6Z A;  4EV2 A;  2HMJ B;  3B7C A;  5BXQ A;  4Q53 A;  5AI1 A;  5IEN A;  1KSI A;  3MHE A;  3LZA A;  1W6C A;  5D83 A;  4G1M B;  4GB5 A;  4KFD A;  2B24 B;  3NBJ A;  3GWR A;  3NXJ A;  1VQL 3;  5AIG A;  3CNM A;  3MSO A;  1VQO 3;  1IT7 A;  5IEO A;  3S27 A;  3G8Z A;  4STD A;  3SX1 A;  4MJD A;  1Z1S A;  2Y74 A;  3MG3 A;  1GS3 A;  1OPY A;  2M7O A;  1M9G A;  3VSY A;  4HVN A;  4XM4 A;  2GEX A;  4ORL A;  2P0M A;  2KRT A;  4LSO A;  5KP1 A;  4BTX A;  2YX9 A;  4O8S A;  2XGL A;  1EKM A;  4JRF A;  5IG5 A;  3LT9 A;  1EQK A;  4HM8 B;  3SVA A;  4XBT A;  1ISK A;  4WYK B;  4HM7 B;  3PGB A;  2XH9 A;  3HI7 A;  1N9E A;  2CWV A;  1VQ8 3;  1U5O A;  3GZY B;  3JUN A;  3LTA A;  3V92 A;  3X41 A;  1FGQ A;  1LVN A;  2WGQ A;  1U8C B;  4HM3 B;  1WMO A;  5D81 A;  3SOA A;  1WQL B;  1UUV B;  1UW1 A;  2D1W A;  2YFL B;  2OQE C;  3GAX A;  2STD A;  4LMI A;  3T8U A;  1YHQ 3;  1W5Z A;  3NBR A;  2XEP A;  3D9R A;  3FF0 A;  2W9P A;  4N6T A;  2IUJ A;  2GU1 A;  2CW9 A;  1QJG A;  4X2O A;  5BVB A;  5IER A;  4EXR A;  2WOF A;  1K41 A;  3SED A;  4AEQ A;  1US1 A;  1V74 A;  5DRE A;  2CG1 A;  4FR9 A;  1ROV A;  3ER7 A;  3ROB A;  4X2H A;  1N9J A;  3JUO A;  1HKX A;  4O2H A;  3S5C A;  2ZL8 A;  5CLK A;  3CCU 3;  3J7Y d;  3K0Z A;  2Z77 A;  2P0X A;  1AV4 A;  3EC9 A;  4HZB B;  2BO9 B;  4N6N B;  2LQV A;  2UX0 A;  3B8L A;  4HM1 B;  1IQ8 A;  4HBR A;  2XR8 B;  3PS8 A;  2QA4 3;  1QMA A;  1Q86 4;  1DYU A;  1OGZ A;  4TX4 A;  3LH4 A;  1A67 A;  1SII A;  4IIA A;  2GEY A;  4K1V A;  1K8A 4;  4K90 B;  4BTW A;  2R4I A;  1STD A;  3K5T A;  5AII A;  4U13 A;  3MYT A;  5EVH A;  4XBX A;  3K63 A;  5JPU A;  4HKV B;  3SLU A;  3CPW 2;  1WNH A;  3EE1 A;  3TDG A;  1NJI 4;  5STD A;  5HGR A;  4R1K A;  1VZZ A;  1GYB A;  5IG0 A;  1OF5 B;  2GBX B;  3FG1 A;  3H3H A;  2F99 A;  1CYV A;  3AMO B;  3IJE B;  3BNE A;  3X3Z A;  2CKF B;  4MMY B;  3NQY A;  3FH1 A;  2P09 A;  2HML B;  4O02 B;  3FSD A;  1WTH A;  3GRD A;  8CHO A;  3EB8 A;  1IV9 A;  3NHX A;  3G71 3;  1A2V A;  1JV2 B;  5AIF A;  3OX9 A;  5ELU A;  2XSH B;  1VQN 3;  1YIT 3;  3N54 B;  1OAC A;  5I97 A;  2OTL 3;  2CK3 H;  3CCS 3;  1O7N B;  4FCZ A;  1RKY A;  1J2B A;  2JQ5 A;  1VQ5 3;  4KVH A;  1HU9 A;  3EX9 A;  1KD1 4;  1JNQ A;  1UI7 A;  1WMP A;  3PCR A;  4EV5 A;  3CU3 A;  2I9W A;  2O3O A;  3U1W A;  3NV0 A;  4J8T A;  4O3V A;  3X40 A;  1W2Z A;  3Q1C A;  4WWU C;  3T8N A;  2IUK A;  1W02 A;  3JUP A;  3BLZ A;  4EC6 A;  5KP3 A;  3EQQ B;  1IQX A;  3O8Y A;  4K1U A;  1Q40 A;  1E3R A;  4RBN A;  1F8N A;  1VQ4 3;  3S28 A;  2WO0 A;  3G0K A;  3N8B A;  2KXG A;  3PZW A;  2WOH A;  3CPO A;  4XB5 A;  4R4K A;  1S5A A;  3F7X A;  1KWI A;  1CEW I;  4HM0 B;  3CCQ 3;  2HMM B;  1SJW A;  3IMA B;  1JB5 A;  2E2U A;  5JBS A;  1VQP 3;  4LGQ A;  2OTJ 3;  1GY7 A;  5CK6 A;  3I55 3;  1O7W B;  1NO3 A;  1JB4 A;  2XSO B;  4OUQ A;  3I56 3;  1W4N A;  1ULJ B;  1ZX2 A;  3S29 A;  2W2C A;  1KQS 2;  1N5P A;  4R80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...