2P05A

Structural insights into the evolution of a non-biological protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
KKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the evolution of a non-biological protein: importance of surface residues in protein fold optimization.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
molecule keywords a non-biological ATP binding protein 1819
total genus 17
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p05A00
3DGMA 2P0XA 3LTBA 3DGLA 3DGNA 3LTDA 3DGOA 3LTCA 1UW1A 3LT9A 2P05A 3LT8A 2P09A 3LTAA
chains in the Genus database with same CATH superfamily
1TUHA 3DGMA 1V74A 4HYZA 3LTBA 1IVVA 3D3LA 1AY7A 3MWZA 1VZZA 1JB4A 1CYVA 1X1UA 3B8LA 4N6LA 2HMKB 1W01A 6STDA 2UGIA 7STDA 1T2IA 4O2HA 2CFWA 4R9LA 2B24B 2PNCA 1LVNA 4L8PA 3JUPA 1TIJA 3PYJA 1SPUA 3OXAA 3GRDA 3MKIA 3G6E3 3N9HA 1JB5A 1G96A 4CCVA 3RGRA 3PXMA 1EUIC 3KIIA 1BRSA 1LOYA 4HM1B 1QVF2 2IYJA 1X1YA 3HZPA 3DM8A 4EXRA 2W56B 2ML5A 3FZWA 4STDA 3MG2A 3GZBA 1KD14 3B7CA 1QALA 1WMNA 5CLKA 4O3VA 2OOVA 2A15A 3PS8A 3F14A 3SOYA 5IENA 3Q1CA 4N6NB 3SEDA 1MWTA 2H0IA 1GS3A 3OW22 3PCRA 2R41A 1SQWA 4KT3B 1JV2B 3URPA 1RSNA 1Y4KA 1AQZA 5IERA 1Q7HA 1OHSA 2SBLA 1PYLA 3N8BA 2AAEA 3D9RA 1JB2A 1D6ZA 3BIRA 4CJNA 3RNTA 1YVSA 9RNTA 5RNTA 1UCLA 2GEXA 3DGNA 1T2HA 4HJLB 1W00A 2CX1A 1BOXA 2Y73A 4RNYA 5CK6A 5BXQA 1D6UA 1N9EA 1EEJA 2KRTA 3K7CA 1Q42A 1GY6A 4LEHA 2H0HA 4IPBA 1RJOA 2YFIB 1LQGC 3SOAA 5HGRA 2GBXB 4X2OA 1LNHA 1NU3A 1BRNL 3GZRA 2E2TA 5AIGA 1RN1A 2F99A 1NB3I 2KF3A 3SXXA 4BU4A 2XRXB 1KWIA 3JUNA 5D81A 5AIIA 3X42A 1VQ83 3S67A 1IQ8A 3I563 1Q824 1G0TA 2CX0A 1OGXA 2KXGA 3CU3A 3CNMA 2KCDA 1EA2A 1GD3A 2P38A 3DMCA 5JBSA 1U8CB 1YJ93 5BVBA 3ECFA 1ASKA 3CCQ3 4NPBA 3X3YA 1SJWA 3SLUA 1IT7A 1UUVB 1RGFA 2W56A 1B2XA 3UJMA 3CCE3 2CWVA 2INXA 5EQLA 1YHQ3 1RRHA 2GU3A 3STDA 2P09A 1LNIA 3CC43 1DVDA 4HVNA 5BIRA 4ORLA 5CF1A 3A5EA 3WHOA 6RNTA 3OWSA 3MG3A 1VQ63 1PU4A 1OGZA 4KVHA 1CH0A 4KFEA 4FCMA 1LRAA 4Q53A 4N6TA 2W6JH 2XFSA 4R4KA 3IJEB 4HM2B 2M7OA 3MSOA 1MNLA 3CCL3 4K90B 2XGNA 1E97A 1BSBA 1ULJB 4L7KA 2ZHXB 3DGOA 3KCHA 2F4YA 1Q7Y4 1JNQA 1B20A 1UI8A 4PEJA 1FUWA 3HOHA 3GSPA 3V92A 2MF7A 5AEWB 5CF2A 3ZFZA 2CG0A 2FGTA 1MWRA 4N6OB 1HYFA 5D82A 2PZVA 5AYRB 1RHLA 4FCJA 3M8CA 4HM6B 4MEIA 5ELJA 1N9JA 1BNRA 3O8YA 1RCKA 3PGBA 1TFKA 4K1UA 2GSPA 1TRQA 1ZO2A 2ZL8A 5IG3A 3F8XA 4KFDA 2Z76A 3A76A 3X40A 1RGLA 4KZ1A 1BANA 4J8TA 4FMCA 3F9SA 3NV0A 3IMAB 2W9PA 1US1A 4XDWA 4KFFA 3CXC2 1B2UA 1K28A 1O7WB 1YGEA 4NHFA 3N54B 4O8SA 1TTOA 3EBYA 5DRVA 3UB1A 3WOFB 3WR2A 1GOVA 2BMRB 6GSPA 4RNZA 1IK3A 1I3FA 2WO0A 3NBJA 1JN5B 1BU4A 1W2ZA 3H51A 4R9KA 1I70A 4RBNA 3WA2X 4OVMA 4MMZB 3LZAA 1TU5A 3AHSA 3FKAA 1B2MA 1A2PA 2W2CA 2CWTA 4RNTA 3B4OA 1Z1SA 1YIT3 3GAXA 3K0ZA 3OWYA 1S5AA 2BMQB 1LQMB 2XFTA 3F40A 3H3HA 1FGMA 3K63A 2XSHB 4IT7A 4WYKB 5G1KA 4AKYA 1OHOA 3EC9A 5A0OB 2OQEC 1JRQA 1JN5A 4IIAA 1BNGA 1LXEA 4JRFA 1TFOA 4K61A 2WGQA 2XF3A 3EN1B 3NBBA 1VQ93 2E2VA 5G1LA 4HM3B 4WFOA 1W2B2 4HM5B 3LMLA 4J5GA 5I97A 4RZMA 2Q07A 3CCM3 4EBGA 3EB8A 3K9MC 4XBTA 3X3ZA 1ZS7A 1BSAA 1I3IA 2CHCA 1Q864 1NB5I 2MC8A 3U1WA 4AEQA 1FGRA 3BNCA 1QMAA 2IUKA 4J5KA 1DMMA 5D83A 3BLZA 1O7HB 1NO3A 3GWRA 4WYKA 3WMDA 5KP3A 3S5CA 4BTWA 4BIRA 1C7HA 1BIRA 1RTUA 2AADA 1BNIA 1RGCA 5CXOA 1FW7A 4FMDA 2HMNB 1UCKA 4ILFA 3X3XA 4EV2A 1QJGA 1CQSA 2D42A 4JF8A 4QWTA 3WDGB 1KC84 3S27A 3KZTA 3CME3 3AMOB 2BIRA 1ROVA 2D1WA 2GEYA 2JDIH 1ZX2A 2RBIA 1RGKA 2XGLA 3K5TA 3QRDA 3HIIA 5JPPA 1CYUA 1ROAA 1YJW3 4I5QA 1OCVA 1JBSA 4BTXA 1JBTA 1BVIA 1YIJ3 1S723 3D79A 1MOLA 1GMQA 3ZG5A 2QA43 1VQ73 1QVG2 1A67A 1U5OA 4LGQA 2IMJA 4J9AA 3S29A 1PY3A 1IDPA 1ZGXA 1WNHA 3NXJA 1BSEA 1NNVA 2E2UA 5LC7A 1IQYA 4HM4B 3DGYA 1MGRA 3VGNA 3GZXB 1IT8A 1BNEA 3QK9A 3CCJ3 5AIHA 2O3OA 1OACA 3EQQB 1OHPA 3VF1A 3IPTA 2RCDA 1BRIA 1T3BA 3FF0A 4FMBA 3CD63 1RNBA 1FGQA 5ELUA 1YJN3 5EVHA 5IF6A 1MWUA 3KN4A 3LTCA 2OOVC 4CDLA 1BUJA 5IEPA 1GYBA 1RN7A 1VQL3 4HM7B 1RGHA 1W5ZA 2XR8B 1NDOB 5BU4A 4HAAA 3NQZA 2FNQA 2O9UX 2BNGA 1AVLA 1TJDA 2OCTA 2YFLB 3NBRA 1ULIB 1RRLA 3RDEA 4HOHA 2BO9B 3OWUA 1GMPA 1EKMA 1GOUA 1NWWA 2KF5A 2HMMB 4FR9A 4XBXA 4BTYA 2RNTA 1A2KA 1B2SA 1RCLA 1QAFA 1M1K4 3Q2PA 1DE3A 3EHCA 2K54A 4AKZA 4LMIA 1X1XA 1C54A 1VQK3 1LOXA 2BMOB 1JZDA 3FG1A 4LSOA 1Q9EA 4EV5A 1RDSA 3KFQC 5KP1A 3D4AA 1AVKA 1OH0A 4WHAA 5G2GA 1DMNA 2CG1A 2Z77A 1FGTA 2L1SA 5IEOA 2K0MA 3GZYB 1V58A 3LH4A 1M1XB 3LTDA 1JJ22 1WMPA 1AR0A 3DY5A 5LC6A 1IYYA 3D5GA 2LYXA 3T8UA 5KP4A 3F7SA 1W02A 5GSPA 5STDA 5HOHA 3Q90A 2YFJB 4GB5A 3FG3A 2Y74A 4MMYB 2OQEA 1YNVX 5DREA 4O02B 4OUQA 1N8R4 4N3VA 3DGLA 2RSXA 3NV0B 1BRGA 2IUJA 3DXOA 1TP6A 2GXFA 2J8XB 1RKYA 1BRJA 1M9GA 2WOHA 1ISKA 1N8QA 2CW9A 1R4YA 4H3UA 3ZG0A 1EQKA 1GY5A 1UI7A 2BU4A 4BL2A 1I2FA 3MG1A 1I0XA 1IVUA 2CKFB 5JPUA 2K3DA 3FH1A 2XSOB 3FCSB 5AI1A 1BSCA 3V98A 4R80A 2C10A 1KQS2 1K734 1O7NB 1PFPA 1FUSA 1GOYA 2C4BA 1VQM3 3LT8A 1BRHA 1G02A 1UCJA 5M18A 3AGNA 1DVCA 3HK4A 2H0GA 3LOYA 1O7PB 2JQ5A 4HBRA 2WGOA 3G8ZA 1GY7A 1UGHI 4XDVA 2F5WA 1HKXA 5FGOA 3NM7A 3RGAA 1OPYA 1RLSA 1A2VA 2KAAA 3BNDA 2RFRA 1N5PA 1YGWA 2W9QA 3HI7A 1X1WA 5EEOA 4N6MA 1IU7A 3ER7A 3AGOA 4GHOA 4DKIA 8CHOA 2I9WA 3ALAA 2B1XB 2UX0A 3WOEB 4XB5A 2CC3A 1NJI4 1IVXA 1JKGB 5IG5A 1BRKA 2ZDJA 2IA7A 1SIHA 3NUVA 2ZA4A 3NM2A 5FW5A 1WMOA 2OTL3 2QGUA 2CFKA 2KF4A 1DYUA 1RGEA 1T5YA 2HMJB 1B21A 1GSPA 2OTJ3 2QIYA 1BSDA 4ZM8A 1JKGA 1FUTA 1W6CA 3OV4A 4N6V0 3BNBA 4R1KA 2L4VA 1M904 2CH9A 1UW1A 3L0RA 4EC6A 1BAOA 1HZ1A 1DMQA 3SVAA 1K41A 1OF5B 3SX1A 3G713 1B3SA 1VQQA 3FSDA 1WTHA 5AYSC 1O7GB 3NQYA 1W6GA 1W6YA 3MHEA 4MMXB 3CPW2 3JVCA 3CCU3 2QEX3 1IQXA 3G0KA 1L5GB 4G1MB 3DH2A 4WWUC 3JUMA 1UGIA 2F86B 3PZWA 4U13A 3JUOA 3MYTA 4N6UA 3AMOA 4HZ9B 3CC23 1Q814 3S28A 3EE1A 4FCZA 3F8HA 1STDA 2YX9A 1I0VA 1RN4A 1GD4A 3T0UA 3UL5A 2WOFA 4TX4A 2GU1A 2BT3A 3U97A 3V99A 1QAKA 3NHXA 3DUKA 3D5IA 1V57A 3EBTA 3LTAA 3TDGA 1MWSA 1Q40A 2XH9A 1E3VA 1UCIA 3UL6A 4K1VA 4XBYA 1HU9A 2Z7AA 3CCS3 1W4NA 4H61A 2P0XA 1SIIA 1IV9A 1W7CA 3EX9A 3J7Yd 1SARA 1F8NA 2FXTA 4L8OA 1YVBI 1AV4A 2IY2A 2V1LA 3T8NA 1D6YA 1IVWA 1K8A4 2RGQA 3FLJA 1RNTA 1I2EA 4HM0B 3CC73 3CCV3 3F7XA 1BNJA 1VQ43 1MGWA 2W04A 3KKGA 8RNTA 4EYCA 1Q40B 2LQVA 3BU4A 1VQN3 3FGYA 1BUQA 3SYUA 1JBRA 5IW9A 3FG4A 2HMLB 2P0MA 2XEPA 4NREA 1VQ53 3BNEA 3OX9A 3HIGA 3ROBA 3Q3FA 4HZBB 1R4CA 1UDII 2HMOB 2KF6A 5AIFA 2CWUA 3PCSA 1A90A 2W03A 4BL3A 3G4S3 3NX0A 3LYGA 1EG9B 1N5HA 1B2ZA 3KE7A 1K9M4 3AHWA 1LOWA 2P05A 1LOVA 2BHMA 1DETA 2CIUA 3CNXA 3CPOA 1KSIA 2CFLA 2SARA 4HKVB 3HX8A 2HOHA 1RMSA 3CCR3 5IG0A 2F56A 1IV7A 3KSED 3I553 1I2GA 2F5MA 3X41A 1YI23 3WA3A 4EW5A 1FYSA 7GSPA 3EJVA 2ML6A 1STFI 2UUGC 1OF5A 4LYLB 1TRPA 1BGSA 1UUWB 2STDA 4WP5A 1O7MB 1CEWI 2CFGA 3LXUX 3FF2A 1FA3A 1JZOA 1I8VA 3WODG 3CMA3 2GBWB 2Z6BA 4I4KA 4HM8B 2CFDA 2CK3H 3I0YA 1UUGB 4OK0A 1E3RA 3B4PA 1WQLB 1VQO3 1J2BA 1VQP3 1RGAA 4X2HA 5TGNA 2OWPA 7RNTA 4GSPA 4LZIA 5AEUB 1FZUA 2R4IA 5M1AA 4FMAA 1BNFA 1FGOA 3E99A 3JUQA 3LT9A 4MJDA 5M19A 4GL6A 3UNLA 1B27A 3KSPA 3DZLA 2W0QA 5IG4A 3BB9A 1BNSA 2F98A 2C11A 3MPHA 3EN8A 3VSYA 4CPKA 3EF8A 1OUNA 4XM4A 3G16A 1GMRA 1RGGA
chains in the Genus database with same CATH topology
1TUHA 3DGMA 1V74A 4HYZA 3LTBA 1IVVA 3D3LA 3MWZA 1VZZA 1JB4A 1CYVA 3B8LA 4N6LA 2HMKB 1W01A 6STDA 7STDA 4O2HA 2CFWA 4R9LA 2B24B 2PNCA 1LVNA 4L8PA 3JUPA 1TIJA 3PYJA 1SPUA 3OXAA 3GRDA 3MKIA 3G6E3 3N9HA 1JB5A 1G96A 4CCVA 3RGRA 3PXMA 3KIIA 4HM1B 1QVF2 3HZPA 3DM8A 4EXRA 2W56B 2ML5A 3FZWA 4STDA 3MG2A 3GZBA 1KD14 3B7CA 1QALA 1WMNA 5CLKA 4O3VA 2OOVA 2A15A 3PS8A 3F14A 3SOYA 5IENA 3Q1CA 4N6NB 3SEDA 1GS3A 3OW22 3PCRA 1SQWA 1JV2B 1Y4KA 5IERA 2SBLA 1OHSA 3N8BA 3D9RA 1JB2A 1D6ZA 2GEXA 3DGNA 4HJLB 1W00A 4RNYA 2Y73A 5CK6A 5BXQA 1D6UA 1N9EA 2KRTA 3K7CA 1Q42A 1GY6A 4LEHA 4IPBA 1RJOA 2YFIB 3SOAA 5HGRA 2GBXB 4X2OA 1LNHA 1NU3A 3GZRA 2E2TA 5AIGA 2F99A 1NB3I 3SXXA 2XRXB 1KWIA 3JUNA 5D81A 5AIIA 3X42A 1VQ83 3S67A 1IQ8A 3I563 1Q824 1OGXA 2KXGA 3CU3A 3CNMA 2KCDA 1EA2A 1GD3A 2P38A 3DMCA 5JBSA 1U8CB 1YJ93 5BVBA 3ECFA 1ASKA 3CCQ3 3X3YA 1SJWA 3SLUA 1IT7A 1UUVB 2W56A 3UJMA 3CCE3 2CWVA 2INXA 5EQLA 1YHQ3 1RRHA 2GU3A 3STDA 2P09A 3CC43 1DVDA 4HVNA 4ORLA 5CF1A 3OWSA 3MG3A 1VQ63 1PU4A 1OGZA 4KVHA 4KFEA 4FCMA 4Q53A 4N6TA 2W6JH 2XFSA 4R4KA 3IJEB 4HM2B 2M7OA 3MSOA 1MNLA 3CCL3 4K90B 2XGNA 1E97A 1ULJB 4L7KA 3DGOA 1Q7Y4 1JNQA 1UI8A 4PEJA 1FUWA 3V92A 2MF7A 5AEWB 5CF2A 2CG0A 2FGTA 4N6OB 5D82A 2PZVA 5AYRB 4FCJA 3M8CA 4HM6B 4MEIA 5ELJA 1N9JA 3O8YA 3PGBA 1TFKA 4K1UA 1ZO2A 2ZL8A 5IG3A 3F8XA 4KFDA 2Z76A 3A76A 3X40A 4KZ1A 4J8TA 4FMCA 3F9SA 3NV0A 3IMAB 2W9PA 1US1A 4XDWA 4KFFA 3CXC2 1K28A 1O7WB 1YGEA 4NHFA 3N54B 4O8SA 3EBYA 5DRVA 3UB1A 3WOFB 2BMRB 4RNZA 1IK3A 3NBJA 2WO0A 1JN5B 1W2ZA 3H51A 4R9KA 4RBNA 3WA2X 4OVMA 4MMZB 3LZAA 1TU5A 3FKAA 2W2CA 2CWTA 3B4OA 1Z1SA 1YIT3 3GAXA 3K0ZA 3OWYA 1S5AA 2BMQB 2XFTA 3F40A 3H3HA 3K63A 1FGMA 4IT7A 2XSHB 4WYKB 4AKYA 1OHOA 3EC9A 5A0OB 2OQEC 1JRQA 1JN5A 4IIAA 1LXEA 4JRFA 1TFOA 4K61A 2WGQA 2XF3A 3EN1B 3NBBA 1VQ93 2E2VA 4HM3B 4WFOA 1W2B2 4HM5B 3LMLA 5I97A 4RZMA 2Q07A 3CCM3 4EBGA 3EB8A 3K9MC 4XBTA 3X3ZA 2CHCA 1Q864 1NB5I 2MC8A 3U1WA 4AEQA 1FGRA 3BNCA 1QMAA 2IUKA 1DMMA 5D83A 3BLZA 1O7HB 1NO3A 3GWRA 4WYKA 3WMDA 5KP3A 3S5CA 4BTWA 1C7HA 5CXOA 4FMDA 2HMNB 3X3XA 4EV2A 1QJGA 1CQSA 2D42A 4JF8A 4QWTA 3WDGB 1KC84 3S27A 3KZTA 3CME3 3AMOB 1ROVA 2D1WA 2GEYA 2JDIH 1ZX2A 2XGLA 3K5TA 3QRDA 5JPPA 3HIIA 1CYUA 1ROAA 1YJW3 1OCVA 4BTXA 1YIJ3 1S723 1MOLA 2QA43 1VQ73 1QVG2 1A67A 1U5OA 4LGQA 2IMJA 4J9AA 3S29A 1IDPA 1WNHA 3NXJA 2E2UA 5LC7A 1IQYA 4HM4B 3VGNA 3GZXB 1IT8A 3QK9A 3CCJ3 5AIHA 2O3OA 1OACA 3EQQB 1OHPA 3VF1A 3IPTA 2RCDA 3FF0A 4FMBA 3CD63 1FGQA 5ELUA 1YJN3 5EVHA 5IF6A 3KN4A 3LTCA 2OOVC 4CDLA 5IEPA 1GYBA 1RN7A 1VQL3 4HM7B 1W5ZA 2XR8B 1NDOB 3NQZA 2FNQA 2O9UX 2BNGA 1AVLA 2OCTA 2YFLB 3NBRA 1ULIB 1RRLA 3RDEA 2BO9B 3OWUA 1NWWA 1EKMA 4BTYA 4XBXA 2HMMB 4FR9A 1A2KA 1QAFA 1M1K4 3Q2PA 3EHCA 2K54A 4AKZA 4LMIA 1VQK3 1LOXA 2BMOB 3FG1A 4LSOA 4EV5A 3KFQC 5KP1A 1AVKA 1OH0A 4WHAA 5G2GA 1DMNA 2CG1A 2Z77A 1FGTA 5IEOA 2K0MA 3GZYB 3LH4A 1M1XB 3LTDA 1JJ22 1WMPA 1AR0A 3DY5A 5LC6A 2LYXA 3T8UA 5KP4A 3F7SA 1W02A 5STDA 3Q90A 2YFJB 4GB5A 3FG3A 2Y74A 4MMYB 2OQEA 5DREA 4O02B 4OUQA 1N8R4 4N3VA 3DGLA 2RSXA 3NV0B 2IUJA 3DXOA 1TP6A 2GXFA 1RKYA 1M9GA 2WOHA 1ISKA 1N8QA 2CW9A 4H3UA 1EQKA 1GY5A 1UI7A 3MG1A 1IVUA 2CKFB 5JPUA 3FH1A 2XSOB 3FCSB 5AI1A 3V98A 4R80A 2C10A 1KQS2 1K734 1O7NB 1PFPA 1VQM3 3LT8A 1DVCA 3HK4A 3LOYA 1O7PB 2JQ5A 4HBRA 2WGOA 3G8ZA 1GY7A 4XDVA 1HKXA 5FGOA 3NM7A 3RGAA 1OPYA 1A2VA 3BNDA 2RFRA 1N5PA 2W9QA 3HI7A 5EEOA 4N6MA 1IU7A 3ER7A 8CHOA 2I9WA 3ALAA 2B1XB 2UX0A 3WOEB 4XB5A 2CC3A 1NJI4 1IVXA 1JKGB 5IG5A 2ZDJA 2IA7A 1SIHA 3NUVA 3NM2A 5FW5A 1WMOA 2OTL3 2QGUA 2CFKA 1DYUA 1T5YA 2HMJB 2OTJ3 2QIYA 4ZM8A 1JKGA 1W6CA 3OV4A 4N6V0 3BNBA 4R1KA 2L4VA 1M904 2CH9A 1UW1A 3L0RA 4EC6A 1DMQA 3SVAA 1K41A 1OF5B 3SX1A 3G713 3FSDA 1WTHA 5AYSC 1O7GB 3NQYA 1W6GA 1W6YA 3MHEA 4MMXB 3CPW2 3JVCA 3CCU3 2QEX3 1IQXA 1L5GB 4G1MB 4WWUC 3JUMA 2F86B 3PZWA 4U13A 3JUOA 3MYTA 4N6UA 3AMOA 4HZ9B 3CC23 1Q814 3S28A 3EE1A 4FCZA 3F8HA 1STDA 2YX9A 3UL5A 3T0UA 1GD4A 2WOFA 4TX4A 2GU1A 2BT3A 3U97A 3V99A 1QAKA 3NHXA 3DUKA 3EBTA 3LTAA 3TDGA 1Q40A 2XH9A 1E3VA 3UL6A 4K1VA 4XBYA 1HU9A 2Z7AA 3CCS3 1W4NA 4H61A 2P0XA 1SIIA 1IV9A 1W7CA 3EX9A 3J7Yd 1F8NA 2FXTA 4L8OA 1YVBI 1AV4A 2V1LA 3T8NA 1D6YA 1IVWA 1K8A4 2RGQA 3FLJA 3CC73 3CCV3 4HM0B 1VQ43 3F7XA 2W04A 3KKGA 4EYCA 1Q40B 2LQVA 1VQN3 3FGYA 1BUQA 5IW9A 3FG4A 2HMLB 2P0MA 2XEPA 4NREA 1VQ53 3BNEA 3OX9A 3HIGA 3ROBA 4HZBB 1R4CA 2HMOB 5AIFA 2CWUA 3PCSA 1A90A 2W03A 3G4S3 3NX0A 3LYGA 1EG9B 1N5HA 3KE7A 1K9M4 2P05A 2BHMA 2CIUA 3CNXA 3CPOA 1KSIA 2CFLA 4HKVB 3HX8A 3CCR3 5IG0A 1IV7A 3KSED 3I553 3X41A 1YI23 3WA3A 3EJVA 2ML6A 1STFI 1OF5A 2STDA 1UUWB 4WP5A 1O7MB 1CEWI 2CFGA 3LXUX 3FF2A 1FA3A 3CMA3 3WODG 2GBWB 2Z6BA 4I4KA 4HM8B 2CFDA 2CK3H 3I0YA 4OK0A 1E3RA 3B4PA 1WQLB 1VQO3 1J2BA 1VQP3 4X2HA 5TGNA 2OWPA 4LZIA 5AEUB 2R4IA 4FMAA 1FGOA 3E99A 3JUQA 3LT9A 4MJDA 4GL6A 3UNLA 3KSPA 3DZLA 2W0QA 5IG4A 3BB9A 2F98A 2C11A 3MPHA 3EN8A 3VSYA 3EF8A 1OUNA 4XM4A 3G16A 3G0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGM A;  2P0X A;  3LTB A;  3DGL A;  3DGN A;  3LTD A;  3DGO A;  3LTC A;  1UW1 A;  3LT9 A;  2P05 A;  3LT8 A;  2P09 A;  3LTA A; 
#chains in the Genus database with same CATH topology
 1TUH A;  3DGM A;  1V74 A;  4HYZ A;  3LTB A;  1IVV A;  3D3L A;  1AY7 A;  3MWZ A;  1VZZ A;  1JB4 A;  1CYV A;  1X1U A;  3B8L A;  4N6L A;  2HMK B;  1W01 A;  6STD A;  2UGI A;  7STD A;  1T2I A;  4O2H A;  2CFW A;  4R9L A;  2B24 B;  2PNC A;  1LVN A;  4L8P A;  3JUP A;  1TIJ A;  3PYJ A;  1SPU A;  3OXA A;  3GRD A;  3MKI A;  3G6E 3;  3N9H A;  1JB5 A;  1G96 A;  4CCV A;  3RGR A;  3PXM A;  1EUI C;  3KII A;  1BRS A;  1LOY A;  4HM1 B;  1QVF 2;  2IYJ A;  1X1Y A;  3HZP A;  3DM8 A;  4EXR A;  2W56 B;  2ML5 A;  3FZW A;  4STD A;  3MG2 A;  3GZB A;  1KD1 4;  3B7C A;  1QAL A;  1WMN A;  5CLK A;  4O3V A;  2OOV A;  2A15 A;  3PS8 A;  3F14 A;  3SOY A;  5IEN A;  3Q1C A;  4N6N B;  3SED A;  1MWT A;  2H0I A;  1GS3 A;  3OW2 2;  3PCR A;  2R41 A;  1SQW A;  4KT3 B;  1JV2 B;  3URP A;  1RSN A;  1Y4K A;  1AQZ A;  5IER A;  1Q7H A;  1OHS A;  2SBL A;  1PYL A;  3N8B A;  2AAE A;  3D9R A;  1JB2 A;  1D6Z A;  3BIR A;  4CJN A;  3RNT A;  1YVS A;  9RNT A;  5RNT A;  1UCL A;  2GEX A;  3DGN A;  1T2H A;  4HJL B;  1W00 A;  2CX1 A;  1BOX A;  2Y73 A;  4RNY A;  5CK6 A;  5BXQ A;  1D6U A;  1N9E A;  1EEJ A;  2KRT A;  3K7C A;  1Q42 A;  1GY6 A;  4LEH A;  2H0H A;  4IPB A;  1RJO A;  2YFI B;  1LQG C;  3SOA A;  5HGR A;  2GBX B;  4X2O A;  1LNH A;  1NU3 A;  1BRN L;  3GZR A;  2E2T A;  5AIG A;  1RN1 A;  2F99 A;  1NB3 I;  2KF3 A;  3SXX A;  4BU4 A;  2XRX B;  1KWI A;  3JUN A;  5D81 A;  5AII A;  3X42 A;  1VQ8 3;  3S67 A;  1IQ8 A;  3I56 3;  1Q82 4;  1G0T A;  2CX0 A;  1OGX A;  2KXG A;  3CU3 A;  3CNM A;  2KCD A;  1EA2 A;  1GD3 A;  2P38 A;  3DMC A;  5JBS A;  1U8C B;  1YJ9 3;  5BVB A;  3ECF A;  1ASK A;  3CCQ 3;  4NPB A;  3X3Y A;  1SJW A;  3SLU A;  1IT7 A;  1UUV B;  1RGF A;  2W56 A;  1B2X A;  3UJM A;  3CCE 3;  2CWV A;  2INX A;  5EQL A;  1YHQ 3;  1RRH A;  2GU3 A;  3STD A;  2P09 A;  1LNI A;  3CC4 3;  1DVD A;  4HVN A;  5BIR A;  4ORL A;  5CF1 A;  3A5E A;  3WHO A;  6RNT A;  3OWS A;  3MG3 A;  1VQ6 3;  1PU4 A;  1OGZ A;  4KVH A;  1CH0 A;  4KFE A;  4FCM A;  1LRA A;  4Q53 A;  4N6T A;  2W6J H;  2XFS A;  4R4K A;  3IJE B;  4HM2 B;  2M7O A;  3MSO A;  1MNL A;  3CCL 3;  4K90 B;  2XGN A;  1E97 A;  1BSB A;  1ULJ B;  4L7K A;  2ZHX B;  3DGO A;  3KCH A;  2F4Y A;  1Q7Y 4;  1JNQ A;  1B20 A;  1UI8 A;  4PEJ A;  1FUW A;  3HOH A;  3GSP A;  3V92 A;  2MF7 A;  5AEW B;  5CF2 A;  3ZFZ A;  2CG0 A;  2FGT A;  1MWR A;  4N6O B;  1HYF A;  5D82 A;  2PZV A;  5AYR B;  1RHL A;  4FCJ A;  3M8C A;  4HM6 B;  4MEI A;  5ELJ A;  1N9J A;  1BNR A;  3O8Y A;  1RCK A;  3PGB A;  1TFK A;  4K1U A;  2GSP A;  1TRQ A;  1ZO2 A;  2ZL8 A;  5IG3 A;  3F8X A;  4KFD A;  2Z76 A;  3A76 A;  3X40 A;  1RGL A;  4KZ1 A;  1BAN A;  4J8T A;  4FMC A;  3F9S A;  3NV0 A;  3IMA B;  2W9P A;  1US1 A;  4XDW A;  4KFF A;  3CXC 2;  1B2U A;  1K28 A;  1O7W B;  1YGE A;  4NHF A;  3N54 B;  4O8S A;  1TTO A;  3EBY A;  5DRV A;  3UB1 A;  3WOF B;  3WR2 A;  1GOV A;  2BMR B;  6GSP A;  4RNZ A;  1IK3 A;  1I3F A;  2WO0 A;  3NBJ A;  1JN5 B;  1BU4 A;  1W2Z A;  3H51 A;  4R9K A;  1I70 A;  4RBN A;  3WA2 X;  4OVM A;  4MMZ B;  3LZA A;  1TU5 A;  3AHS A;  3FKA A;  1B2M A;  1A2P A;  2W2C A;  2CWT A;  4RNT A;  3B4O A;  1Z1S A;  1YIT 3;  3GAX A;  3K0Z A;  3OWY A;  1S5A A;  2BMQ B;  1LQM B;  2XFT A;  3F40 A;  3H3H A;  1FGM A;  3K63 A;  2XSH B;  4IT7 A;  4WYK B;  5G1K A;  4AKY A;  1OHO A;  3EC9 A;  5A0O B;  2OQE C;  1JRQ A;  1JN5 A;  4IIA A;  1BNG A;  1LXE A;  4JRF A;  1TFO A;  4K61 A;  2WGQ A;  2XF3 A;  3EN1 B;  3NBB A;  1VQ9 3;  2E2V A;  5G1L A;  4HM3 B;  4WFO A;  1W2B 2;  4HM5 B;  3LML A;  4J5G A;  5I97 A;  4RZM A;  2Q07 A;  3CCM 3;  4EBG A;  3EB8 A;  3K9M C;  4XBT A;  3X3Z A;  1ZS7 A;  1BSA A;  1I3I A;  2CHC A;  1Q86 4;  1NB5 I;  2MC8 A;  3U1W A;  4AEQ A;  1FGR A;  3BNC A;  1QMA A;  2IUK A;  4J5K A;  1DMM A;  5D83 A;  3BLZ A;  1O7H B;  1NO3 A;  3GWR A;  4WYK A;  3WMD A;  5KP3 A;  3S5C A;  4BTW A;  4BIR A;  1C7H A;  1BIR A;  1RTU A;  2AAD A;  1BNI A;  1RGC A;  5CXO A;  1FW7 A;  4FMD A;  2HMN B;  1UCK A;  4ILF A;  3X3X A;  4EV2 A;  1QJG A;  1CQS A;  2D42 A;  4JF8 A;  4QWT A;  3WDG B;  1KC8 4;  3S27 A;  3KZT A;  3CME 3;  3AMO B;  2BIR A;  1ROV A;  2D1W A;  2GEY A;  2JDI H;  1ZX2 A;  2RBI A;  1RGK A;  2XGL A;  3K5T A;  3QRD A;  3HII A;  5JPP A;  1CYU A;  1ROA A;  1YJW 3;  4I5Q A;  1OCV A;  1JBS A;  4BTX A;  1JBT A;  1BVI A;  1YIJ 3;  1S72 3;  3D79 A;  1MOL A;  1GMQ A;  3ZG5 A;  2QA4 3;  1VQ7 3;  1QVG 2;  1A67 A;  1U5O A;  4LGQ A;  2IMJ A;  4J9A A;  3S29 A;  1PY3 A;  1IDP A;  1ZGX A;  1WNH A;  3NXJ A;  1BSE A;  1NNV A;  2E2U A;  5LC7 A;  1IQY A;  4HM4 B;  3DGY A;  1MGR A;  3VGN A;  3GZX B;  1IT8 A;  1BNE A;  3QK9 A;  3CCJ 3;  5AIH A;  2O3O A;  1OAC A;  3EQQ B;  1OHP A;  3VF1 A;  3IPT A;  2RCD A;  1BRI A;  1T3B A;  3FF0 A;  4FMB A;  3CD6 3;  1RNB A;  1FGQ A;  5ELU A;  1YJN 3;  5EVH A;  5IF6 A;  1MWU A;  3KN4 A;  3LTC A;  2OOV C;  4CDL A;  1BUJ A;  5IEP A;  1GYB A;  1RN7 A;  1VQL 3;  4HM7 B;  1RGH A;  1W5Z A;  2XR8 B;  1NDO B;  5BU4 A;  4HAA A;  3NQZ A;  2FNQ A;  2O9U X;  2BNG A;  1AVL A;  1TJD A;  2OCT A;  2YFL B;  3NBR A;  1ULI B;  1RRL A;  3RDE A;  4HOH A;  2BO9 B;  3OWU A;  1GMP A;  1EKM A;  1GOU A;  1NWW A;  2KF5 A;  2HMM B;  4FR9 A;  4XBX A;  4BTY A;  2RNT A;  1A2K A;  1B2S A;  1RCL A;  1QAF A;  1M1K 4;  3Q2P A;  1DE3 A;  3EHC A;  2K54 A;  4AKZ A;  4LMI A;  1X1X A;  1C54 A;  1VQK 3;  1LOX A;  2BMO B;  1JZD A;  3FG1 A;  4LSO A;  1Q9E A;  4EV5 A;  1RDS A;  3KFQ C;  5KP1 A;  3D4A A;  1AVK A;  1OH0 A;  4WHA A;  5G2G A;  1DMN A;  2CG1 A;  2Z77 A;  1FGT A;  2L1S A;  5IEO A;  2K0M A;  3GZY B;  1V58 A;  3LH4 A;  1M1X B;  3LTD A;  1JJ2 2;  1WMP A;  1AR0 A;  3DY5 A;  5LC6 A;  1IYY A;  3D5G A;  2LYX A;  3T8U A;  5KP4 A;  3F7S A;  1W02 A;  5GSP A;  5STD A;  5HOH A;  3Q90 A;  2YFJ B;  4GB5 A;  3FG3 A;  2Y74 A;  4MMY B;  2OQE A;  1YNV X;  5DRE A;  4O02 B;  4OUQ A;  1N8R 4;  4N3V A;  3DGL A;  2RSX A;  3NV0 B;  1BRG A;  2IUJ A;  3DXO A;  1TP6 A;  2GXF A;  2J8X B;  1RKY A;  1BRJ A;  1M9G A;  2WOH A;  1ISK A;  1N8Q A;  2CW9 A;  1R4Y A;  4H3U A;  3ZG0 A;  1EQK A;  1GY5 A;  1UI7 A;  2BU4 A;  4BL2 A;  1I2F A;  3MG1 A;  1I0X A;  1IVU A;  2CKF B;  5JPU A;  2K3D A;  3FH1 A;  2XSO B;  3FCS B;  5AI1 A;  1BSC A;  3V98 A;  4R80 A;  2C10 A;  1KQS 2;  1K73 4;  1O7N B;  1PFP A;  1FUS A;  1GOY A;  2C4B A;  1VQM 3;  3LT8 A;  1BRH A;  1G02 A;  1UCJ A;  5M18 A;  3AGN A;  1DVC A;  3HK4 A;  2H0G A;  3LOY A;  1O7P B;  2JQ5 A;  4HBR A;  2WGO A;  3G8Z A;  1GY7 A;  1UGH I;  4XDV A;  2F5W A;  1HKX A;  5FGO A;  3NM7 A;  3RGA A;  1OPY A;  1RLS A;  1A2V A;  2KAA A;  3BND A;  2RFR A;  1N5P A;  1YGW A;  2W9Q A;  3HI7 A;  1X1W A;  5EEO A;  4N6M A;  1IU7 A;  3ER7 A;  3AGO A;  4GHO A;  4DKI A;  8CHO A;  2I9W A;  3ALA A;  2B1X B;  2UX0 A;  3WOE B;  4XB5 A;  2CC3 A;  1NJI 4;  1IVX A;  1JKG B;  5IG5 A;  1BRK A;  2ZDJ A;  2IA7 A;  1SIH A;  3NUV A;  2ZA4 A;  3NM2 A;  5FW5 A;  1WMO A;  2OTL 3;  2QGU A;  2CFK A;  2KF4 A;  1DYU A;  1RGE A;  1T5Y A;  2HMJ B;  1B21 A;  1GSP A;  2OTJ 3;  2QIY A;  1BSD A;  4ZM8 A;  1JKG A;  1FUT A;  1W6C A;  3OV4 A;  4N6V 0;  3BNB A;  4R1K A;  2L4V A;  1M90 4;  2CH9 A;  1UW1 A;  3L0R A;  4EC6 A;  1BAO A;  1HZ1 A;  1DMQ A;  3SVA A;  1K41 A;  1OF5 B;  3SX1 A;  3G71 3;  1B3S A;  1VQQ A;  3FSD A;  1WTH A;  5AYS C;  1O7G B;  3NQY A;  1W6G A;  1W6Y A;  3MHE A;  4MMX B;  3CPW 2;  3JVC A;  3CCU 3;  2QEX 3;  1IQX A;  3G0K A;  1L5G B;  4G1M B;  3DH2 A;  4WWU C;  3JUM A;  1UGI A;  2F86 B;  3PZW A;  4U13 A;  3JUO A;  3MYT A;  4N6U A;  3AMO A;  4HZ9 B;  3CC2 3;  1Q81 4;  3S28 A;  3EE1 A;  4FCZ A;  3F8H A;  1STD A;  2YX9 A;  1I0V A;  1RN4 A;  1GD4 A;  3T0U A;  3UL5 A;  2WOF A;  4TX4 A;  2GU1 A;  2BT3 A;  3U97 A;  3V99 A;  1QAK A;  3NHX A;  3DUK A;  3D5I A;  1V57 A;  3EBT A;  3LTA A;  3TDG A;  1MWS A;  1Q40 A;  2XH9 A;  1E3V A;  1UCI A;  3UL6 A;  4K1V A;  4XBY A;  1HU9 A;  2Z7A A;  3CCS 3;  1W4N A;  4H61 A;  2P0X A;  1SII A;  1IV9 A;  1W7C A;  3EX9 A;  3J7Y d;  1SAR A;  1F8N A;  2FXT A;  4L8O A;  1YVB I;  1AV4 A;  2IY2 A;  2V1L A;  3T8N A;  1D6Y A;  1IVW A;  1K8A 4;  2RGQ A;  3FLJ A;  1RNT A;  1I2E A;  4HM0 B;  3CC7 3;  3CCV 3;  3F7X A;  1BNJ A;  1VQ4 3;  1MGW A;  2W04 A;  3KKG A;  8RNT A;  4EYC A;  1Q40 B;  2LQV A;  3BU4 A;  1VQN 3;  3FGY A;  1BUQ A;  3SYU A;  1JBR A;  5IW9 A;  3FG4 A;  2HML B;  2P0M A;  2XEP A;  4NRE A;  1VQ5 3;  3BNE A;  3OX9 A;  3HIG A;  3ROB A;  3Q3F A;  4HZB B;  1R4C A;  1UDI I;  2HMO B;  2KF6 A;  5AIF A;  2CWU A;  3PCS A;  1A90 A;  2W03 A;  4BL3 A;  3G4S 3;  3NX0 A;  3LYG A;  1EG9 B;  1N5H A;  1B2Z A;  3KE7 A;  1K9M 4;  3AHW A;  1LOW A;  2P05 A;  1LOV A;  2BHM A;  1DET A;  2CIU A;  3CNX A;  3CPO A;  1KSI A;  2CFL A;  2SAR A;  4HKV B;  3HX8 A;  2HOH A;  1RMS A;  3CCR 3;  5IG0 A;  2F56 A;  1IV7 A;  3KSE D;  3I55 3;  1I2G A;  2F5M A;  3X41 A;  1YI2 3;  3WA3 A;  4EW5 A;  1FYS A;  7GSP A;  3EJV A;  2ML6 A;  1STF I;  2UUG C;  1OF5 A;  4LYL B;  1TRP A;  1BGS A;  1UUW B;  2STD A;  4WP5 A;  1O7M B;  1CEW I;  2CFG A;  3LXU X;  3FF2 A;  1FA3 A;  1JZO A;  1I8V A;  3WOD G;  3CMA 3;  2GBW B;  2Z6B A;  4I4K A;  4HM8 B;  2CFD A;  2CK3 H;  3I0Y A;  1UUG B;  4OK0 A;  1E3R A;  3B4P A;  1WQL B;  1VQO 3;  1J2B A;  1VQP 3;  1RGA A;  4X2H A;  5TGN A;  2OWP A;  7RNT A;  4GSP A;  4LZI A;  5AEU B;  1FZU A;  2R4I A;  5M1A A;  4FMA A;  1BNF A;  1FGO A;  3E99 A;  3JUQ A;  3LT9 A;  4MJD A;  5M19 A;  4GL6 A;  3UNL A;  1B27 A;  3KSP A;  3DZL A;  2W0Q A;  5IG4 A;  3BB9 A;  1BNS A;  2F98 A;  2C11 A;  3MPH A;  3EN8 A;  3VSY A;  4CPK A;  3EF8 A;  1OUN A;  4XM4 A;  3G16 A;  1GMR A;  1RGG A; 
#chains in the Genus database with same CATH homology
 1TUH A;  3DGM A;  1V74 A;  4HYZ A;  3LTB A;  1IVV A;  3D3L A;  3MWZ A;  1VZZ A;  1JB4 A;  1CYV A;  3B8L A;  4N6L A;  2HMK B;  1W01 A;  6STD A;  7STD A;  4O2H A;  2CFW A;  4R9L A;  2B24 B;  2PNC A;  1LVN A;  4L8P A;  3JUP A;  1TIJ A;  3PYJ A;  1SPU A;  3OXA A;  3GRD A;  3MKI A;  3G6E 3;  3N9H A;  1JB5 A;  1G96 A;  4CCV A;  3RGR A;  3PXM A;  3KII A;  4HM1 B;  1QVF 2;  3HZP A;  3DM8 A;  4EXR A;  2W56 B;  2ML5 A;  3FZW A;  4STD A;  3MG2 A;  3GZB A;  1KD1 4;  3B7C A;  1QAL A;  1WMN A;  5CLK A;  4O3V A;  2OOV A;  2A15 A;  3PS8 A;  3F14 A;  3SOY A;  5IEN A;  3Q1C A;  4N6N B;  3SED A;  1GS3 A;  3OW2 2;  3PCR A;  1SQW A;  1JV2 B;  1Y4K A;  5IER A;  2SBL A;  1OHS A;  3N8B A;  3D9R A;  1JB2 A;  1D6Z A;  2GEX A;  3DGN A;  4HJL B;  1W00 A;  4RNY A;  2Y73 A;  5CK6 A;  5BXQ A;  1D6U A;  1N9E A;  2KRT A;  3K7C A;  1Q42 A;  1GY6 A;  4LEH A;  4IPB A;  1RJO A;  2YFI B;  3SOA A;  5HGR A;  2GBX B;  4X2O A;  1LNH A;  1NU3 A;  3GZR A;  2E2T A;  5AIG A;  2F99 A;  1NB3 I;  3SXX A;  2XRX B;  1KWI A;  3JUN A;  5D81 A;  5AII A;  3X42 A;  1VQ8 3;  3S67 A;  1IQ8 A;  3I56 3;  1Q82 4;  1OGX A;  2KXG A;  3CU3 A;  3CNM A;  2KCD A;  1EA2 A;  1GD3 A;  2P38 A;  3DMC A;  5JBS A;  1U8C B;  1YJ9 3;  5BVB A;  3ECF A;  1ASK A;  3CCQ 3;  3X3Y A;  1SJW A;  3SLU A;  1IT7 A;  1UUV B;  2W56 A;  3UJM A;  3CCE 3;  2CWV A;  2INX A;  5EQL A;  1YHQ 3;  1RRH A;  2GU3 A;  3STD A;  2P09 A;  3CC4 3;  1DVD A;  4HVN A;  4ORL A;  5CF1 A;  3OWS A;  3MG3 A;  1VQ6 3;  1PU4 A;  1OGZ A;  4KVH A;  4KFE A;  4FCM A;  4Q53 A;  4N6T A;  2W6J H;  2XFS A;  4R4K A;  3IJE B;  4HM2 B;  2M7O A;  3MSO A;  1MNL A;  3CCL 3;  4K90 B;  2XGN A;  1E97 A;  1ULJ B;  4L7K A;  3DGO A;  1Q7Y 4;  1JNQ A;  1UI8 A;  4PEJ A;  1FUW A;  3V92 A;  2MF7 A;  5AEW B;  5CF2 A;  2CG0 A;  2FGT A;  4N6O B;  5D82 A;  2PZV A;  5AYR B;  4FCJ A;  3M8C A;  4HM6 B;  4MEI A;  5ELJ A;  1N9J A;  3O8Y A;  3PGB A;  1TFK A;  4K1U A;  1ZO2 A;  2ZL8 A;  5IG3 A;  3F8X A;  4KFD A;  2Z76 A;  3A76 A;  3X40 A;  4KZ1 A;  4J8T A;  4FMC A;  3F9S A;  3NV0 A;  3IMA B;  2W9P A;  1US1 A;  4XDW A;  4KFF A;  3CXC 2;  1K28 A;  1O7W B;  1YGE A;  4NHF A;  3N54 B;  4O8S A;  3EBY A;  5DRV A;  3UB1 A;  3WOF B;  2BMR B;  4RNZ A;  1IK3 A;  3NBJ A;  2WO0 A;  1JN5 B;  1W2Z A;  3H51 A;  4R9K A;  4RBN A;  3WA2 X;  4OVM A;  4MMZ B;  3LZA A;  1TU5 A;  3FKA A;  2W2C A;  2CWT A;  3B4O A;  1Z1S A;  1YIT 3;  3GAX A;  3K0Z A;  3OWY A;  1S5A A;  2BMQ B;  2XFT A;  3F40 A;  3H3H A;  3K63 A;  1FGM A;  4IT7 A;  2XSH B;  4WYK B;  4AKY A;  1OHO A;  3EC9 A;  5A0O B;  2OQE C;  1JRQ A;  1JN5 A;  4IIA A;  1LXE A;  4JRF A;  1TFO A;  4K61 A;  2WGQ A;  2XF3 A;  3EN1 B;  3NBB A;  1VQ9 3;  2E2V A;  4HM3 B;  4WFO A;  1W2B 2;  4HM5 B;  3LML A;  5I97 A;  4RZM A;  2Q07 A;  3CCM 3;  4EBG A;  3EB8 A;  3K9M C;  4XBT A;  3X3Z A;  2CHC A;  1Q86 4;  1NB5 I;  2MC8 A;  3U1W A;  4AEQ A;  1FGR A;  3BNC A;  1QMA A;  2IUK A;  1DMM A;  5D83 A;  3BLZ A;  1O7H B;  1NO3 A;  3GWR A;  4WYK A;  3WMD A;  5KP3 A;  3S5C A;  4BTW A;  1C7H A;  5CXO A;  4FMD A;  2HMN B;  3X3X A;  4EV2 A;  1QJG A;  1CQS A;  2D42 A;  4JF8 A;  4QWT A;  3WDG B;  1KC8 4;  3S27 A;  3KZT A;  3CME 3;  3AMO B;  1ROV A;  2D1W A;  2GEY A;  2JDI H;  1ZX2 A;  2XGL A;  3K5T A;  3QRD A;  5JPP A;  3HII A;  1CYU A;  1ROA A;  1YJW 3;  1OCV A;  4BTX A;  1YIJ 3;  1S72 3;  1MOL A;  2QA4 3;  1VQ7 3;  1QVG 2;  1A67 A;  1U5O A;  4LGQ A;  2IMJ A;  4J9A A;  3S29 A;  1IDP A;  1WNH A;  3NXJ A;  2E2U A;  5LC7 A;  1IQY A;  4HM4 B;  3VGN A;  3GZX B;  1IT8 A;  3QK9 A;  3CCJ 3;  5AIH A;  2O3O A;  1OAC A;  3EQQ B;  1OHP A;  3VF1 A;  3IPT A;  2RCD A;  3FF0 A;  4FMB A;  3CD6 3;  1FGQ A;  5ELU A;  1YJN 3;  5EVH A;  5IF6 A;  3KN4 A;  3LTC A;  2OOV C;  4CDL A;  5IEP A;  1GYB A;  1RN7 A;  1VQL 3;  4HM7 B;  1W5Z A;  2XR8 B;  1NDO B;  3NQZ A;  2FNQ A;  2O9U X;  2BNG A;  1AVL A;  2OCT A;  2YFL B;  3NBR A;  1ULI B;  1RRL A;  3RDE A;  2BO9 B;  3OWU A;  1NWW A;  1EKM A;  4BTY A;  4XBX A;  2HMM B;  4FR9 A;  1A2K A;  1QAF A;  1M1K 4;  3Q2P A;  3EHC A;  2K54 A;  4AKZ A;  4LMI A;  1VQK 3;  1LOX A;  2BMO B;  3FG1 A;  4LSO A;  4EV5 A;  3KFQ C;  5KP1 A;  1AVK A;  1OH0 A;  4WHA A;  5G2G A;  1DMN A;  2CG1 A;  2Z77 A;  1FGT A;  5IEO A;  2K0M A;  3GZY B;  3LH4 A;  1M1X B;  3LTD A;  1JJ2 2;  1WMP A;  1AR0 A;  3DY5 A;  5LC6 A;  2LYX A;  3T8U A;  5KP4 A;  3F7S A;  1W02 A;  5STD A;  3Q90 A;  2YFJ B;  4GB5 A;  3FG3 A;  2Y74 A;  4MMY B;  2OQE A;  5DRE A;  4O02 B;  4OUQ A;  1N8R 4;  4N3V A;  3DGL A;  2RSX A;  3NV0 B;  2IUJ A;  3DXO A;  1TP6 A;  2GXF A;  1RKY A;  1M9G A;  2WOH A;  1ISK A;  1N8Q A;  2CW9 A;  4H3U A;  1EQK A;  1GY5 A;  1UI7 A;  3MG1 A;  1IVU A;  2CKF B;  5JPU A;  3FH1 A;  2XSO B;  3FCS B;  5AI1 A;  3V98 A;  4R80 A;  2C10 A;  1KQS 2;  1K73 4;  1O7N B;  1PFP A;  1VQM 3;  3LT8 A;  1DVC A;  3HK4 A;  3LOY A;  1O7P B;  2JQ5 A;  4HBR A;  2WGO A;  3G8Z A;  1GY7 A;  4XDV A;  1HKX A;  5FGO A;  3NM7 A;  3RGA A;  1OPY A;  1A2V A;  3BND A;  2RFR A;  1N5P A;  2W9Q A;  3HI7 A;  5EEO A;  4N6M A;  1IU7 A;  3ER7 A;  8CHO A;  2I9W A;  3ALA A;  2B1X B;  2UX0 A;  3WOE B;  4XB5 A;  2CC3 A;  1NJI 4;  1IVX A;  1JKG B;  5IG5 A;  2ZDJ A;  2IA7 A;  1SIH A;  3NUV A;  3NM2 A;  5FW5 A;  1WMO A;  2OTL 3;  2QGU A;  2CFK A;  1DYU A;  1T5Y A;  2HMJ B;  2OTJ 3;  2QIY A;  4ZM8 A;  1JKG A;  1W6C A;  3OV4 A;  4N6V 0;  3BNB A;  4R1K A;  2L4V A;  1M90 4;  2CH9 A;  1UW1 A;  3L0R A;  4EC6 A;  1DMQ A;  3SVA A;  1K41 A;  1OF5 B;  3SX1 A;  3G71 3;  3FSD A;  1WTH A;  5AYS C;  1O7G B;  3NQY A;  1W6G A;  1W6Y A;  3MHE A;  4MMX B;  3CPW 2;  3JVC A;  3CCU 3;  2QEX 3;  1IQX A;  1L5G B;  4G1M B;  4WWU C;  3JUM A;  2F86 B;  3PZW A;  4U13 A;  3JUO A;  3MYT A;  4N6U A;  3AMO A;  4HZ9 B;  3CC2 3;  1Q81 4;  3S28 A;  3EE1 A;  4FCZ A;  3F8H A;  1STD A;  2YX9 A;  3UL5 A;  3T0U A;  1GD4 A;  2WOF A;  4TX4 A;  2GU1 A;  2BT3 A;  3U97 A;  3V99 A;  1QAK A;  3NHX A;  3DUK A;  3EBT A;  3LTA A;  3TDG A;  1Q40 A;  2XH9 A;  1E3V A;  3UL6 A;  4K1V A;  4XBY A;  1HU9 A;  2Z7A A;  3CCS 3;  1W4N A;  4H61 A;  2P0X A;  1SII A;  1IV9 A;  1W7C A;  3EX9 A;  3J7Y d;  1F8N A;  2FXT A;  4L8O A;  1YVB I;  1AV4 A;  2V1L A;  3T8N A;  1D6Y A;  1IVW A;  1K8A 4;  2RGQ A;  3FLJ A;  3CC7 3;  3CCV 3;  4HM0 B;  1VQ4 3;  3F7X A;  2W04 A;  3KKG A;  4EYC A;  1Q40 B;  2LQV A;  1VQN 3;  3FGY A;  1BUQ A;  5IW9 A;  3FG4 A;  2HML B;  2P0M A;  2XEP A;  4NRE A;  1VQ5 3;  3BNE A;  3OX9 A;  3HIG A;  3ROB A;  4HZB B;  1R4C A;  2HMO B;  5AIF A;  2CWU A;  3PCS A;  1A90 A;  2W03 A;  3G4S 3;  3NX0 A;  3LYG A;  1EG9 B;  1N5H A;  3KE7 A;  1K9M 4;  2P05 A;  2BHM A;  2CIU A;  3CNX A;  3CPO A;  1KSI A;  2CFL A;  4HKV B;  3HX8 A;  3CCR 3;  5IG0 A;  1IV7 A;  3KSE D;  3I55 3;  3X41 A;  1YI2 3;  3WA3 A;  3EJV A;  2ML6 A;  1STF I;  1OF5 A;  2STD A;  1UUW B;  4WP5 A;  1O7M B;  1CEW I;  2CFG A;  3LXU X;  3FF2 A;  1FA3 A;  3CMA 3;  3WOD G;  2GBW B;  2Z6B A;  4I4K A;  4HM8 B;  2CFD A;  2CK3 H;  3I0Y A;  4OK0 A;  1E3R A;  3B4P A;  1WQL B;  1VQO 3;  1J2B A;  1VQP 3;  4X2H A;  5TGN A;  2OWP A;  4LZI A;  5AEU B;  2R4I A;  4FMA A;  1FGO A;  3E99 A;  3JUQ A;  3LT9 A;  4MJD A;  4GL6 A;  3UNL A;  3KSP A;  3DZL A;  2W0Q A;  5IG4 A;  3BB9 A;  2F98 A;  2C11 A;  3MPH A;  3EN8 A;  3VSY A;  3EF8 A;  1OUN A;  4XM4 A;  3G16 A;  3G0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...