2P05A

Structural insights into the evolution of a non-biological protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
KKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords a non-biological ATP binding protein 1819
publication title Structural insights into the evolution of a non-biological protein: importance of surface residues in protein fold optimization.
pubmed doi rcsb
source organism Unidentified
total genus 17
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p05A00
3LTDA 3DGMA 3DGNA 1UW1A 2P0XA 3LT8A 3LT9A 3LTAA 3LTBA 3LTCA 3DGLA 2P05A 2P09A 3DGOA
chains in the Genus database with same CATH superfamily
1B3SA 1FGRA 3G8ZA 4H61A 4WP5A 5EEOA 3VGNA 3J7Yd 2UGIA 4EYCA 4EBGA 3G6E3 2KF5A 2XEPA 1IT7A 1ZX2A 2CWTA 3EHCA 4STDA 4LSOA 1DE3A 2IUJA 2P09A 1M1K4 2YFJB 3CPOA 3STDA 5BU4A 1M9GA 1BRKA 3EX9A 3MG1A 3LTCA 1JKGA 5AIFA 2YX9A 1W6GA 4GL6A 3X42A 2WO0A 3OW22 4KVHA 5D81A 2CFWA 3WDGB 1RGHA 1B20A 1E97A 1N5PA 1RSNA 1PFPA 1V58A 1W5ZA 1YVSA 3Q2PA 3PYJA 3V99A 3CXC2 3CNXA 1GD4A 1R4YA 2D42A 1I3IA 3H51A 1IQYA 2OQEC 1RN4A 4EV2A 1Q40A 3MWZA 2C10A 1LOVA 2FXTA 1DMMA 1N5HA 3KN4A 1UGHI 3S28A 1F8NA 5IW9A 1VQO3 4CPKA 5AI1A 2Y74A 3G16A 3K63A 2KXGA 1FUSA 3UL6A 3KZTA 1VQK3 3WODG 3NM2A 1GMRA 1T5YA 1BNRA 1RDSA 3HOHA 3DGNA 1I2FA 2CFDA 2IY2A 4MEIA 3OV4A 1E3RA 2E2UA 3SOAA 1OF5A 2F5MA 3A5EA 4HOHA 4L7KA 1NB3I 3FH1A 1N9JA 3LTDA 1JBRA 1LOYA 3ECFA 1OPYA 3LMLA 4FCJA 2CFLA 1GY6A 3NXJA 1SJWA 3CC73 1JJ22 3UNLA 3B4PA 1LOWA 2MF7A 3CCL3 2K3DA 1PY3A 2CX1A 3SLUA 2HOHA 1FGMA 3IJEB 2BIRA 1QAFA 3IPTA 5JPPA 5KP1A 4R4KA 4X2OA 1TRQA 3M8CA 5IENA 1BRIA 5IEPA 1EG9B 3DY5A 1FUWA 3Q3FA 1UUVB 1ZO2A 3B4OA 3N54B 2HMJB 4WWUC 1TP6A 1LQMB 1Q7HA 4FMCA 3V92A 1VQN3 1IVWA 2ZDJA 1YIT3 5ELUA 2QA43 2V1LA 2F86B 3F8XA 1LQGC 4HM3B 5JPUA 1N8R4 1IV9A 1TRPA 1VQQA 2RNTA 2YFLB 3U97A 2B1XB 2D1WA 3EN1B 1OHPA 1RGGA 2W6JH 2CFKA 3DGYA 2O9UX 2OQEA 1WMOA 3JVCA 1A67A 3HI7A 4XDVA 2CFGA 2BO9B 1DVCA 3D79A 4XBXA 3F7SA 1JN5A 1BNSA 1UCJA 2BU4A 3F14A 3HX8A 1BNIA 5CF1A 2GSPA 1RN1A 1GOUA 3KE7A 1EA2A 1Q824 1VQM3 4HYZA 1GY5A 1GYBA 3G713 2GU3A 2SBLA 3RGAA 3MKIA 3MPHA 2AAEA 1SARA 1RRHA 2F99A 2B24B 4MMXB 3EE1A 3PXMA 5STDA 1CYVA 1JRQA 2P0XA 3H3HA 4LYLB 2W56A 4CCVA 2RGQA 1JB2A 2WGOA 5KP4A 2E2VA 5IG4A 8CHOA 4QWTA 1NU3A 3ROBA 1BRGA 4O02B 2OOVC 4H3UA 1RLSA 1ZS7A 4BTYA 4IT7A 3DGOA 3FKAA 3PZWA 2KCDA 4PEJA 1IVVA 4WFOA 1LOXA 1CEWI 2RBIA 1BSAA 3QRDA 2JQ5A 1W01A 3E99A 4J5GA 3SVAA 1IK3A 3LH4A 2CH9A 4RZMA 7GSPA 2BMRB 3FLJA 3CC43 5CK6A 1Q40B 9RNTA 3LOYA 4FMBA 3I0YA 3JUQA 1BUJA 5I97A 1EQKA 3ZFZA 2Z76A 1RGCA 1Y4KA 4RNZA 1OH0A 1ROAA 2XSOB 1UI8A 3HZPA 3MHEA 3SX1A 4EV5A 2BHMA 1BSCA 1JB5A 1OF5B 2CC3A 1US1A 1R4CA 3B8LA 1MWTA 1BAOA 5AEUB 3S5CA 1LNIA 4KFDA 4N6TA 4I4KA 1SIIA 5TGNA 4L8PA 5BXQA 3I553 3T8NA 1O7NB 3HIIA 1NNVA 2PNCA 1Q864 2KAAA 1I8VA 4LMIA 2GBWB 1I0VA 1QVG2 1RTUA 4R80A 1UUWB 1TJDA 3T0UA 1TTOA 1ISKA 3IMAB 5BIRA 2W03A 4EXRA 2CG1A 3A76A 3ZG0A 4MJDA 1S723 1L5GB 2OOVA 1EUIC 1NWWA 2BNGA 1D6ZA 3OWYA 3PGBA 3CMA3 2W2CA 4O8SA 4HZ9B 4MMYB 1GOVA 3BIRA 2Y73A 3QK9A 1YGEA 3AMOA 3EBYA 1RHLA 1W7CA 1O7HB 5G2GA 1KQS2 3S27A 1NDOB 5GSPA 4KT3B 3VSYA 3D3LA 3WOEB 1JN5B 4BU4A 2IMJA 1CQSA 1G02A 3BU4A 1M904 6RNTA 1W02A 2JDIH 4NREA 5DREA 3N8BA 1OHSA 2H0GA 2HMNB 3K7CA 1VQ83 1A2PA 1LRAA 1RGKA 2WOFA 4O2HA 1K734 1EKMA 1ULJB 5IG0A 2CG0A 1YI23 4AKZA 1B21A 1TU5A 1I3FA 3KSED 3CCV3 1OACA 4GHOA 4EW5A 3CCS3 3BNDA 3DGMA 2W56B 3NBBA 4JF8A 4BTXA 4NPBA 1KSIA 2ZL8A 4RNTA 3WOFB 1AVKA 1O7MB 2P0MA 1MWRA 3F8HA 1BSEA 3L0RA 2R4IA 1LVNA 3BNEA 5D82A 1Q814 3EBTA 4XBTA 1BRNL 4RBNA 3BNCA 1DYUA 2OCTA 4N6MA 3DMCA 1QJGA 3Q90A 3FSDA 2OWPA 1MNLA 3FF0A 5A0OB 3CPW2 3AHSA 2XRXB 1AVLA 1G96A 5IG3A 1STDA 3WA3A 4GB5A 1BRJA 1JZOA 1BNGA 1E3VA 2W9PA 3SOYA 7STDA 3JUPA 5M18A 4HM4B 1J2BA 1B27A 1A2KA 2GXFA 1BVIA 3X3XA 5FW5A 2KF6A 1AR0A 1SIHA 5IEOA 1VQP3 3TDGA 4R9LA 1O7PB 3LT9A 1RGEA 1GOYA 3NBJA 5RNTA 1MGRA 3K9MC 1U5OA 4HM8B 5HOHA 1GMQA 2CHCA 1OGZA 1RGAA 1BNEA 1VQL3 2CX0A 3CCJ3 4KFEA 3URPA 3CC23 3DXOA 1PU4A 1MWUA 2RCDA 1ROVA 1RRLA 5EVHA 1RN7A 2OTJ3 1I70A 1RGLA 2UUGC 1DMNA 1JV2B 1WMNA 2F5WA 2XFTA 1W00A 1DMQA 4HM0B 4I5QA 1VQ73 1CYUA 3N9HA 4K1UA 4G1MB 5JBSA 1BANA 3MYTA 2P38A 1VQ53 3EN8A 1G0TA 1LXEA 3KIIA 4J8TA 5AIHA 5CF2A 3CME3 2GEXA 1QALA 1JKGB 3LTAA 1S5AA 1MWSA 2XFSA 3CCU3 1IT8A 2E2TA 2L1SA 4K90B 2O3OA 1Q9EA 3DUKA 3ER7A 1WQLB 4BIRA 2H0HA 1BNFA 4HZBB 4HM5B 2XH9A 4IPBA 2CWUA 5LC6A 1YIJ3 3D9RA 2Q07A 3D5GA 3NV0A 1FW7A 2HMMB 3NQYA 3OWSA 1FGQA 1VQ63 1PYLA 4XM4A 3G0KA 1W2B2 4HAAA 3HIGA 5CXOA 2J8XB 4HVNA 1I2GA 3KSPA 4LEHA 3V98A 5FGOA 1RJOA 1FGOA 2CW9A 1ASKA 2F98A 1W2ZA 2KF3A 1YJW3 5IF6A 2CWVA 4FCMA 2BMOB 2MC8A 3I563 1K8A4 3ZG5A 3KKGA 2F4YA 1I0XA 1T2HA 1OHOA 3GAXA 1QAKA 2IA7A 2UX0A 4HBRA 3AGNA 1B2SA 1BGSA 4MMZB 2INXA 1TFOA 2FGTA 2IYJA 3PS8A 3B7CA 2P05A 1B2ZA 4EC6A 4HM6B 3X40A 1K28A 2QGUA 4HM1B 3GWRA 4R9KA 1Z1SA 3JUMA 1SQWA 1O7GB 2KF4A 3OWUA 5M19A 1GY7A 1ZGXA 3HK4A 1RKYA 2BT3A 1T3BA 3X3YA 3UB1A 1C54A 1K9M4 3FF2A 2R41A 4BL2A 1A90A 1FZUA 3BNBA 4NHFA 3OX9A 4R1KA 2SARA 5AYSC 4XBYA 2QEX3 3DM8A 3CD63 2HMLB 1YJN3 1QMAA 4IIAA 2Z77A 3UJMA 8RNTA 1TIJA 3DGLA 1UUGB 1B2XA 1TFKA 3GZRA 3GZXB 3EF8A 3NUVA 2ZHXB 2LYXA 1Q7Y4 4WYKA 1YNVX 1STFI 1D6UA 2M7OA 1IVUA 1UDII 2ML5A 2PZVA 4N6UA 4LGQA 4X2HA 5G1LA 1W4NA 3AHWA 5IERA 1MGWA 3CCE3 1BNJA 5CLKA 3CCQ3 5DRVA 1RCLA 1B2UA 1VQ93 1AQZA 1GS3A 1RNTA 1WTHA 3CU3A 3MSOA 1IQXA 4CDLA 3EB8A 3WA2X 2FNQA 4N6OB 5AIIA 2K0MA 1RGFA 5G1KA 3EJVA 2BMQB 3O8YA 1UCLA 1V74A 2RSXA 1IV7A 3D5IA 3PCSA 1W6YA 1BUQA 1BOXA 2W0QA 4TX4A 1SPUA 3NX0A 2CKFB 3G4S3 1N9EA 1IU7A 1FGTA 2C4BA 4KZ1A 4K1VA 3EQQB 1Q42A 5KP3A 3NV0B 3T8UA 3DH2A 3FZWA 1OUNA 2WGQA 2F56A 4ILFA 4LZIA 1JNQA 1RCKA 1DVDA 1IYYA 2ML6A 3S67A 2CIUA 1OCVA 2W9QA 1YVBI 2LQVA 3F9SA 3PCRA 1FUTA 4HKVB 3GRDA 2WOHA 3BLZA 3MG2A 2XR8B 2KRTA 7RNTA 3FG3A 5AYRB 1B2MA 3AGOA 4BL3A 1RMSA 4FMAA 1M1XB 3K0ZA 4KFFA 3U1WA 1VQ43 1D6YA 1X1WA 5EQLA 1WNHA 2STDA 6STDA 4L8OA 4ZM8A 3LYGA 1AV4A 3RDEA 1JBTA 1JZDA 4HJLB 4O3VA 1TUHA 3WHOA 5LC7A 2Z7AA 3CCR3 4XB5A 2OTL3 1NJI4 5ELJA 1KC84 5AIGA 2QIYA 2XGNA 1UGIA 3NM7A 1UI7A 4J5KA 3GSPA 3F40A 1QVF2 1MOLA 2XSHB 2YFIB 2IUKA 1UW1A 1I2EA 1NB5I 4N6LA 1JBSA 4U13A 1NO3A 3FCSB 5IG5A 1YHQ3 4WHAA 1BRHA 4CJNA 3CCM3 3EC9A 3SEDA 4HM7B 4K61A 4FMDA 1C7HA 2K54A 1IQ8A 5M1AA 2C11A 2GU1A 3AMOB 3X41A 1KWIA 1KD14 2AADA 1T2IA 2CK3H 3ALAA 1X1YA 1JB4A 2ZA4A 3Q1CA 3NBRA 3UL5A 4GSPA 1FYSA 2H0IA 1YGWA 3NHXA 1EEJA 2I9WA 4N3VA 3VF1A 3WR2A 4XDWA 3KFQC 2HMOB 3SYUA 1BSDA 1BU4A 2XF3A 4N6V0 4WYKB 1GD3A 2GEYA 2HMKB 2L4VA 4J9AA 1HU9A 4FCZA 1GSPA 3WMDA 5HGRA 4Q53A 4RNYA 3RNTA 4OK0A 4JRFA 2RFRA 3FG1A 1RNBA 6GSPA 2A15A 1AY7A 4FR9A 3K5TA 3NQZA 1X1UA 3CNMA 1DETA 3LXUX 1FA3A 1O7WB 3KCHA 4HM2B 4OVMA 2W04A 3RGRA 3MG3A 1A2VA 1V57A 1GMPA 3LT8A 4AEQA 2XGLA 1U8CB 3BB9A 1HYFA 3GZYB 1N8QA 1BRSA 3FGYA 1W6CA 2GBXB 3OXAA 3LTBA 1IVXA 1VZZA 4N6NB 3JUOA 3FG4A 5BVBA 3S29A 1LNHA 5AEWB 1HKXA 1UCKA 3F7XA 3JUNA 5D83A 3GZBA 3X3ZA 1YJ93 1K41A 1OGXA 1UCIA 1X1XA 3SXXA 4BTWA 4DKIA 1ULIB 1BIRA 1HZ1A 1WMPA 2Z6BA 4ORLA 1IDPA 3DZLA 4OUQA 1CH0A 4AKYA 3D4AA 1BSBA 3LZAA
chains in the Genus database with same CATH topology
1FGRA 4H61A 3G8ZA 4WP5A 5EEOA 3J7Yd 3VGNA 4EYCA 4EBGA 3G6E3 3EHCA 2XEPA 1IT7A 1ZX2A 2CWTA 4STDA 4LSOA 2IUJA 2P09A 1M1K4 2YFJB 3CPOA 3STDA 1M9GA 3EX9A 3MG1A 3LTCA 1JKGA 5AIFA 2YX9A 1W6GA 4GL6A 3X42A 2WO0A 3OW22 4KVHA 5D81A 2CFWA 3WDGB 1E97A 1N5PA 1PFPA 1W5ZA 3Q2PA 3PYJA 3V99A 3CXC2 3CNXA 1GD4A 2D42A 3H51A 1IQYA 2OQEC 4EV2A 1Q40A 3MWZA 2C10A 2FXTA 1DMMA 1N5HA 3KN4A 3S28A 5IW9A 1F8NA 1VQO3 5AI1A 2Y74A 3G16A 3K63A 2KXGA 3UL6A 1VQK3 3KZTA 3WODG 3NM2A 1T5YA 3DGNA 2CFDA 4MEIA 3OV4A 1E3RA 2E2UA 3SOAA 1OF5A 4L7KA 1NB3I 3FH1A 1N9JA 3LTDA 3ECFA 1OPYA 3LMLA 4FCJA 2CFLA 1GY6A 3NXJA 1SJWA 3CC73 1JJ22 3UNLA 3B4PA 2MF7A 3CCL3 3SLUA 3IPTA 1FGMA 3IJEB 1QAFA 5JPPA 5KP1A 4R4KA 4X2OA 3M8CA 5IENA 5IEPA 1FUWA 1EG9B 3DY5A 1UUVB 1ZO2A 3B4OA 3N54B 2HMJB 4WWUC 1TP6A 4FMCA 3V92A 1VQN3 1IVWA 2ZDJA 1YIT3 5ELUA 2QA43 2V1LA 2F86B 3F8XA 4HM3B 5JPUA 1N8R4 1IV9A 2YFLB 3U97A 2B1XB 2D1WA 3EN1B 1OHPA 2W6JH 2CFKA 2OQEA 2O9UX 1A67A 1WMOA 3JVCA 3HI7A 4XDVA 2CFGA 2BO9B 1DVCA 4XBXA 3F7SA 1JN5A 3F14A 3HX8A 5CF1A 3KE7A 1EA2A 1Q824 1VQM3 4HYZA 1GY5A 1GYBA 3G713 2GU3A 2SBLA 3RGAA 3MKIA 3MPHA 1RRHA 2F99A 2B24B 4MMXB 3EE1A 3PXMA 5STDA 1CYVA 1JRQA 2P0XA 3H3HA 2W56A 4CCVA 2RGQA 1JB2A 2WGOA 5KP4A 2E2VA 5IG4A 8CHOA 4QWTA 1NU3A 3ROBA 4O02B 2OOVC 4H3UA 4BTYA 4IT7A 3DGOA 3FKAA 3PZWA 2KCDA 4PEJA 1IVVA 4WFOA 1LOXA 1CEWI 3QRDA 2JQ5A 1W01A 3E99A 3SVAA 1IK3A 3LH4A 2CH9A 4RZMA 2BMRB 3FLJA 3CC43 5CK6A 1Q40B 3LOYA 4FMBA 3I0YA 3JUQA 5I97A 1EQKA 2Z76A 1Y4KA 4RNZA 1OH0A 1ROAA 2XSOB 1UI8A 3HZPA 3MHEA 3SX1A 4EV5A 2BHMA 1JB5A 1OF5B 2CC3A 1US1A 1R4CA 3B8LA 5AEUB 3S5CA 4KFDA 4N6TA 4I4KA 1SIIA 5TGNA 4L8PA 5BXQA 3I553 3T8NA 1O7NB 3HIIA 2PNCA 1Q864 4LMIA 2GBWB 1QVG2 4R80A 1UUWB 3T0UA 1ISKA 3IMAB 2W03A 4EXRA 2CG1A 3A76A 4MJDA 1S723 1L5GB 2OOVA 1NWWA 2BNGA 1D6ZA 3OWYA 3PGBA 3CMA3 2W2CA 4O8SA 4HZ9B 4MMYB 2Y73A 3QK9A 1YGEA 3AMOA 3EBYA 1W7CA 1O7HB 5G2GA 1KQS2 3S27A 1NDOB 3VSYA 3D3LA 3WOEB 1JN5B 2IMJA 1CQSA 1M904 1W02A 2JDIH 4NREA 5DREA 3N8BA 1OHSA 2HMNB 3K7CA 1VQ83 2WOFA 4O2HA 1K734 1EKMA 1ULJB 5IG0A 2CG0A 1YI23 4AKZA 1TU5A 3KSED 3CCV3 1OACA 3CCS3 3BNDA 3DGMA 2W56B 3NBBA 4JF8A 4BTXA 1KSIA 2ZL8A 3WOFB 1AVKA 1O7MB 2P0MA 3F8HA 3L0RA 2R4IA 1LVNA 3BNEA 5D82A 1Q814 3EBTA 4XBTA 4RBNA 3BNCA 1DYUA 2OCTA 4N6MA 3DMCA 1QJGA 3Q90A 3FSDA 2OWPA 1MNLA 3FF0A 5A0OB 3CPW2 2XRXB 1AVLA 1G96A 5IG3A 1STDA 3WA3A 4GB5A 1E3VA 2W9PA 3SOYA 7STDA 3JUPA 1J2BA 4HM4B 1A2KA 2GXFA 3X3XA 5FW5A 1AR0A 1SIHA 5IEOA 1VQP3 3TDGA 4R9LA 1O7PB 3LT9A 3NBJA 3K9MC 1U5OA 4HM8B 2CHCA 1OGZA 1VQL3 3CCJ3 4KFEA 3CC23 3DXOA 1PU4A 2RCDA 1ROVA 1RRLA 5EVHA 1RN7A 2OTJ3 2XFTA 1DMNA 1JV2B 1WMNA 1W00A 1DMQA 4HM0B 1CYUA 1VQ73 3N9HA 4K1UA 4G1MB 5JBSA 3MYTA 1VQ53 2P38A 3EN8A 1LXEA 4J8TA 3KIIA 5AIHA 5CF2A 3CME3 2GEXA 1QALA 1JKGB 3LTAA 1S5AA 2XFSA 3CCU3 1IT8A 2E2TA 4K90B 2O3OA 3DUKA 3ER7A 1WQLB 4IPBA 4HZBB 4HM5B 2XH9A 2CWUA 5LC6A 1YIJ3 3D9RA 2Q07A 3NV0A 2HMMB 3NQYA 3OWSA 1FGQA 1VQ63 4XM4A 3G0KA 1W2B2 3HIGA 5CXOA 4HVNA 3KSPA 4LEHA 3V98A 5FGOA 1RJOA 1FGOA 2CW9A 1ASKA 2F98A 1W2ZA 1YJW3 5IF6A 2CWVA 4FCMA 2BMOB 2MC8A 3I563 1K8A4 3KKGA 1OHOA 3GAXA 1QAKA 2IA7A 2UX0A 4HBRA 4MMZB 2INXA 1TFOA 2FGTA 3PS8A 3B7CA 2P05A 4EC6A 4HM6B 3X40A 1K28A 2QGUA 4HM1B 3GWRA 4R9KA 1Z1SA 3JUMA 1SQWA 1O7GB 3OWUA 1GY7A 3HK4A 1RKYA 2BT3A 3X3YA 3UB1A 1K9M4 3FF2A 1A90A 3BNBA 4NHFA 3OX9A 4R1KA 5AYSC 4XBYA 2QEX3 3DM8A 3CD63 2HMLB 1YJN3 1QMAA 4IIAA 2Z77A 3UJMA 1TIJA 3DGLA 1TFKA 3GZRA 3GZXB 3EF8A 3NUVA 2LYXA 1Q7Y4 4WYKA 2M7OA 1STFI 1D6UA 2ML5A 1IVUA 2PZVA 4N6UA 4X2HA 5IERA 4LGQA 3CCE3 1W4NA 5CLKA 3CCQ3 5DRVA 1VQ93 1GS3A 1WTHA 3CU3A 3MSOA 1IQXA 4CDLA 3EB8A 3WA2X 2FNQA 4N6OB 5AIIA 2K0MA 3EJVA 2BMQB 3O8YA 2RSXA 1V74A 1IV7A 3PCSA 1W6YA 1BUQA 2W0QA 4TX4A 1SPUA 3NX0A 2CKFB 3G4S3 1N9EA 1IU7A 1FGTA 4KZ1A 4K1VA 3EQQB 1Q42A 5KP3A 3NV0B 3T8UA 3FZWA 1OUNA 2WGQA 1DVDA 4LZIA 1JNQA 2ML6A 3S67A 2CIUA 1OCVA 2W9QA 1YVBI 2LQVA 3F9SA 3PCRA 4HKVB 3GRDA 2WOHA 3BLZA 3MG2A 2XR8B 2KRTA 3FG3A 5AYRB 4FMAA 1M1XB 3K0ZA 4KFFA 3U1WA 1VQ43 1D6YA 5EQLA 1WNHA 2STDA 6STDA 4L8OA 4ZM8A 3LYGA 1AV4A 3RDEA 4HJLB 4O3VA 1TUHA 5LC7A 2Z7AA 3CCR3 4XB5A 2OTL3 1NJI4 5ELJA 1KC84 5AIGA 2QIYA 2XGNA 3NM7A 1UI7A 3F40A 1QVF2 1MOLA 2XSHB 2YFIB 2IUKA 1UW1A 1NB5I 4N6LA 4U13A 1NO3A 5IG5A 1YHQ3 4WHAA 3CCM3 3EC9A 3SEDA 4HM7B 4K61A 4FMDA 1C7HA 2K54A 1IQ8A 2C11A 2GU1A 3AMOB 3X41A 1KWIA 1KD14 3ALAA 2CK3H 1JB4A 3Q1CA 3NBRA 3UL5A 3NHXA 4N3VA 3VF1A 2I9WA 4XDWA 3KFQC 2HMOB 2XF3A 4N6V0 4WYKB 1GD3A 2GEYA 2HMKB 2L4VA 4J9AA 1HU9A 4FCZA 3WMDA 5HGRA 4Q53A 4RNYA 4OK0A 4JRFA 2RFRA 3FG1A 2A15A 4FR9A 3K5TA 3NQZA 3CNMA 3LXUX 1FA3A 1O7WB 4HM2B 4OVMA 2W04A 3RGRA 3MG3A 1A2VA 3LT8A 4AEQA 2XGLA 1U8CB 3BB9A 3GZYB 1N8QA 3FGYA 1W6CA 2GBXB 3OXAA 3LTBA 1IVXA 1VZZA 4N6NB 3JUOA 3FG4A 5BVBA 3S29A 1LNHA 5AEWB 1HKXA 3F7XA 3JUNA 5D83A 3GZBA 3X3ZA 1YJ93 1K41A 1OGXA 3SXXA 4BTWA 1ULIB 1WMPA 2Z6BA 4ORLA 1IDPA 3DZLA 4OUQA 4AKYA 3FCSB 3LZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTD A;  3DGM A;  3DGN A;  1UW1 A;  2P0X A;  3LT8 A;  3LT9 A;  3LTA A;  3LTB A;  3LTC A;  3DGL A;  2P05 A;  2P09 A;  3DGO A; 
#chains in the Genus database with same CATH topology
 1B3S A;  1FGR A;  3G8Z A;  4H61 A;  4WP5 A;  5EEO A;  3VGN A;  3J7Y d;  2UGI A;  4EYC A;  4EBG A;  3G6E 3;  2KF5 A;  2XEP A;  1IT7 A;  1ZX2 A;  2CWT A;  3EHC A;  4STD A;  4LSO A;  1DE3 A;  2IUJ A;  2P09 A;  1M1K 4;  2YFJ B;  3CPO A;  3STD A;  5BU4 A;  1M9G A;  1BRK A;  3EX9 A;  3MG1 A;  3LTC A;  1JKG A;  5AIF A;  2YX9 A;  1W6G A;  4GL6 A;  3X42 A;  2WO0 A;  3OW2 2;  4KVH A;  5D81 A;  2CFW A;  3WDG B;  1RGH A;  1B20 A;  1E97 A;  1N5P A;  1RSN A;  1PFP A;  1V58 A;  1W5Z A;  1YVS A;  3Q2P A;  3PYJ A;  3V99 A;  3CXC 2;  3CNX A;  1GD4 A;  1R4Y A;  2D42 A;  1I3I A;  3H51 A;  1IQY A;  2OQE C;  1RN4 A;  4EV2 A;  1Q40 A;  3MWZ A;  2C10 A;  1LOV A;  2FXT A;  1DMM A;  1N5H A;  3KN4 A;  1UGH I;  3S28 A;  1F8N A;  5IW9 A;  1VQO 3;  4CPK A;  5AI1 A;  2Y74 A;  3G16 A;  3K63 A;  2KXG A;  1FUS A;  3UL6 A;  3KZT A;  1VQK 3;  3WOD G;  3NM2 A;  1GMR A;  1T5Y A;  1BNR A;  1RDS A;  3HOH A;  3DGN A;  1I2F A;  2CFD A;  2IY2 A;  4MEI A;  3OV4 A;  1E3R A;  2E2U A;  3SOA A;  1OF5 A;  2F5M A;  3A5E A;  4HOH A;  4L7K A;  1NB3 I;  3FH1 A;  1N9J A;  3LTD A;  1JBR A;  1LOY A;  3ECF A;  1OPY A;  3LML A;  4FCJ A;  2CFL A;  1GY6 A;  3NXJ A;  1SJW A;  3CC7 3;  1JJ2 2;  3UNL A;  3B4P A;  1LOW A;  2MF7 A;  3CCL 3;  2K3D A;  1PY3 A;  2CX1 A;  3SLU A;  2HOH A;  1FGM A;  3IJE B;  2BIR A;  1QAF A;  3IPT A;  5JPP A;  5KP1 A;  4R4K A;  4X2O A;  1TRQ A;  3M8C A;  5IEN A;  1BRI A;  5IEP A;  1EG9 B;  3DY5 A;  1FUW A;  3Q3F A;  1UUV B;  1ZO2 A;  3B4O A;  3N54 B;  2HMJ B;  4WWU C;  1TP6 A;  1LQM B;  1Q7H A;  4FMC A;  3V92 A;  1VQN 3;  1IVW A;  2ZDJ A;  1YIT 3;  5ELU A;  2QA4 3;  2V1L A;  2F86 B;  3F8X A;  1LQG C;  4HM3 B;  5JPU A;  1N8R 4;  1IV9 A;  1TRP A;  1VQQ A;  2RNT A;  2YFL B;  3U97 A;  2B1X B;  2D1W A;  3EN1 B;  1OHP A;  1RGG A;  2W6J H;  2CFK A;  3DGY A;  2O9U X;  2OQE A;  1WMO A;  3JVC A;  1A67 A;  3HI7 A;  4XDV A;  2CFG A;  2BO9 B;  1DVC A;  3D79 A;  4XBX A;  3F7S A;  1JN5 A;  1BNS A;  1UCJ A;  2BU4 A;  3F14 A;  3HX8 A;  1BNI A;  5CF1 A;  2GSP A;  1RN1 A;  1GOU A;  3KE7 A;  1EA2 A;  1Q82 4;  1VQM 3;  4HYZ A;  1GY5 A;  1GYB A;  3G71 3;  2GU3 A;  2SBL A;  3RGA A;  3MKI A;  3MPH A;  2AAE A;  1SAR A;  1RRH A;  2F99 A;  2B24 B;  4MMX B;  3EE1 A;  3PXM A;  5STD A;  1CYV A;  1JRQ A;  2P0X A;  3H3H A;  4LYL B;  2W56 A;  4CCV A;  2RGQ A;  1JB2 A;  2WGO A;  5KP4 A;  2E2V A;  5IG4 A;  8CHO A;  4QWT A;  1NU3 A;  3ROB A;  1BRG A;  4O02 B;  2OOV C;  4H3U A;  1RLS A;  1ZS7 A;  4BTY A;  4IT7 A;  3DGO A;  3FKA A;  3PZW A;  2KCD A;  4PEJ A;  1IVV A;  4WFO A;  1LOX A;  1CEW I;  2RBI A;  1BSA A;  3QRD A;  2JQ5 A;  1W01 A;  3E99 A;  4J5G A;  3SVA A;  1IK3 A;  3LH4 A;  2CH9 A;  4RZM A;  7GSP A;  2BMR B;  3FLJ A;  3CC4 3;  5CK6 A;  1Q40 B;  9RNT A;  3LOY A;  4FMB A;  3I0Y A;  3JUQ A;  1BUJ A;  5I97 A;  1EQK A;  3ZFZ A;  2Z76 A;  1RGC A;  1Y4K A;  4RNZ A;  1OH0 A;  1ROA A;  2XSO B;  1UI8 A;  3HZP A;  3MHE A;  3SX1 A;  4EV5 A;  2BHM A;  1BSC A;  1JB5 A;  1OF5 B;  2CC3 A;  1US1 A;  1R4C A;  3B8L A;  1MWT A;  1BAO A;  5AEU B;  3S5C A;  1LNI A;  4KFD A;  4N6T A;  4I4K A;  1SII A;  5TGN A;  4L8P A;  5BXQ A;  3I55 3;  3T8N A;  1O7N B;  3HII A;  1NNV A;  2PNC A;  1Q86 4;  2KAA A;  1I8V A;  4LMI A;  2GBW B;  1I0V A;  1QVG 2;  1RTU A;  4R80 A;  1UUW B;  1TJD A;  3T0U A;  1TTO A;  1ISK A;  3IMA B;  5BIR A;  2W03 A;  4EXR A;  2CG1 A;  3A76 A;  3ZG0 A;  4MJD A;  1S72 3;  1L5G B;  2OOV A;  1EUI C;  1NWW A;  2BNG A;  1D6Z A;  3OWY A;  3PGB A;  3CMA 3;  2W2C A;  4O8S A;  4HZ9 B;  4MMY B;  1GOV A;  3BIR A;  2Y73 A;  3QK9 A;  1YGE A;  3AMO A;  3EBY A;  1RHL A;  1W7C A;  1O7H B;  5G2G A;  1KQS 2;  3S27 A;  1NDO B;  5GSP A;  4KT3 B;  3VSY A;  3D3L A;  3WOE B;  1JN5 B;  4BU4 A;  2IMJ A;  1CQS A;  1G02 A;  3BU4 A;  1M90 4;  6RNT A;  1W02 A;  2JDI H;  4NRE A;  5DRE A;  3N8B A;  1OHS A;  2H0G A;  2HMN B;  3K7C A;  1VQ8 3;  1A2P A;  1LRA A;  1RGK A;  2WOF A;  4O2H A;  1K73 4;  1EKM A;  1ULJ B;  5IG0 A;  2CG0 A;  1YI2 3;  4AKZ A;  1B21 A;  1TU5 A;  1I3F A;  3KSE D;  3CCV 3;  1OAC A;  4GHO A;  4EW5 A;  3CCS 3;  3BND A;  3DGM A;  2W56 B;  3NBB A;  4JF8 A;  4BTX A;  4NPB A;  1KSI A;  2ZL8 A;  4RNT A;  3WOF B;  1AVK A;  1O7M B;  2P0M A;  1MWR A;  3F8H A;  1BSE A;  3L0R A;  2R4I A;  1LVN A;  3BNE A;  5D82 A;  1Q81 4;  3EBT A;  4XBT A;  1BRN L;  4RBN A;  3BNC A;  1DYU A;  2OCT A;  4N6M A;  3DMC A;  1QJG A;  3Q90 A;  3FSD A;  2OWP A;  1MNL A;  3FF0 A;  5A0O B;  3CPW 2;  3AHS A;  2XRX B;  1AVL A;  1G96 A;  5IG3 A;  1STD A;  3WA3 A;  4GB5 A;  1BRJ A;  1JZO A;  1BNG A;  1E3V A;  2W9P A;  3SOY A;  7STD A;  3JUP A;  5M18 A;  4HM4 B;  1J2B A;  1B27 A;  1A2K A;  2GXF A;  1BVI A;  3X3X A;  5FW5 A;  2KF6 A;  1AR0 A;  1SIH A;  5IEO A;  1VQP 3;  3TDG A;  4R9L A;  1O7P B;  3LT9 A;  1RGE A;  1GOY A;  3NBJ A;  5RNT A;  1MGR A;  3K9M C;  1U5O A;  4HM8 B;  5HOH A;  1GMQ A;  2CHC A;  1OGZ A;  1RGA A;  1BNE A;  1VQL 3;  2CX0 A;  3CCJ 3;  4KFE A;  3URP A;  3CC2 3;  3DXO A;  1PU4 A;  1MWU A;  2RCD A;  1ROV A;  1RRL A;  5EVH A;  1RN7 A;  2OTJ 3;  1I70 A;  1RGL A;  2UUG C;  1DMN A;  1JV2 B;  1WMN A;  2F5W A;  2XFT A;  1W00 A;  1DMQ A;  4HM0 B;  4I5Q A;  1VQ7 3;  1CYU A;  3N9H A;  4K1U A;  4G1M B;  5JBS A;  1BAN A;  3MYT A;  2P38 A;  1VQ5 3;  3EN8 A;  1G0T A;  1LXE A;  3KII A;  4J8T A;  5AIH A;  5CF2 A;  3CME 3;  2GEX A;  1QAL A;  1JKG B;  3LTA A;  1S5A A;  1MWS A;  2XFS A;  3CCU 3;  1IT8 A;  2E2T A;  2L1S A;  4K90 B;  2O3O A;  1Q9E A;  3DUK A;  3ER7 A;  1WQL B;  4BIR A;  2H0H A;  1BNF A;  4HZB B;  4HM5 B;  2XH9 A;  4IPB A;  2CWU A;  5LC6 A;  1YIJ 3;  3D9R A;  2Q07 A;  3D5G A;  3NV0 A;  1FW7 A;  2HMM B;  3NQY A;  3OWS A;  1FGQ A;  1VQ6 3;  1PYL A;  4XM4 A;  3G0K A;  1W2B 2;  4HAA A;  3HIG A;  5CXO A;  2J8X B;  4HVN A;  1I2G A;  3KSP A;  4LEH A;  3V98 A;  5FGO A;  1RJO A;  1FGO A;  2CW9 A;  1ASK A;  2F98 A;  1W2Z A;  2KF3 A;  1YJW 3;  5IF6 A;  2CWV A;  4FCM A;  2BMO B;  2MC8 A;  3I56 3;  1K8A 4;  3ZG5 A;  3KKG A;  2F4Y A;  1I0X A;  1T2H A;  1OHO A;  3GAX A;  1QAK A;  2IA7 A;  2UX0 A;  4HBR A;  3AGN A;  1B2S A;  1BGS A;  4MMZ B;  2INX A;  1TFO A;  2FGT A;  2IYJ A;  3PS8 A;  3B7C A;  2P05 A;  1B2Z A;  4EC6 A;  4HM6 B;  3X40 A;  1K28 A;  2QGU A;  4HM1 B;  3GWR A;  4R9K A;  1Z1S A;  3JUM A;  1SQW A;  1O7G B;  2KF4 A;  3OWU A;  5M19 A;  1GY7 A;  1ZGX A;  3HK4 A;  1RKY A;  2BT3 A;  1T3B A;  3X3Y A;  3UB1 A;  1C54 A;  1K9M 4;  3FF2 A;  2R41 A;  4BL2 A;  1A90 A;  1FZU A;  3BNB A;  4NHF A;  3OX9 A;  4R1K A;  2SAR A;  5AYS C;  4XBY A;  2QEX 3;  3DM8 A;  3CD6 3;  2HML B;  1YJN 3;  1QMA A;  4IIA A;  2Z77 A;  3UJM A;  8RNT A;  1TIJ A;  3DGL A;  1UUG B;  1B2X A;  1TFK A;  3GZR A;  3GZX B;  3EF8 A;  3NUV A;  2ZHX B;  2LYX A;  1Q7Y 4;  4WYK A;  1YNV X;  1STF I;  1D6U A;  2M7O A;  1IVU A;  1UDI I;  2ML5 A;  2PZV A;  4N6U A;  4LGQ A;  4X2H A;  5G1L A;  1W4N A;  3AHW A;  5IER A;  1MGW A;  3CCE 3;  1BNJ A;  5CLK A;  3CCQ 3;  5DRV A;  1RCL A;  1B2U A;  1VQ9 3;  1AQZ A;  1GS3 A;  1RNT A;  1WTH A;  3CU3 A;  3MSO A;  1IQX A;  4CDL A;  3EB8 A;  3WA2 X;  2FNQ A;  4N6O B;  5AII A;  2K0M A;  1RGF A;  5G1K A;  3EJV A;  2BMQ B;  3O8Y A;  1UCL A;  1V74 A;  2RSX A;  1IV7 A;  3D5I A;  3PCS A;  1W6Y A;  1BUQ A;  1BOX A;  2W0Q A;  4TX4 A;  1SPU A;  3NX0 A;  2CKF B;  3G4S 3;  1N9E A;  1IU7 A;  1FGT A;  2C4B A;  4KZ1 A;  4K1V A;  3EQQ B;  1Q42 A;  5KP3 A;  3NV0 B;  3T8U A;  3DH2 A;  3FZW A;  1OUN A;  2WGQ A;  2F56 A;  4ILF A;  4LZI A;  1JNQ A;  1RCK A;  1DVD A;  1IYY A;  2ML6 A;  3S67 A;  2CIU A;  1OCV A;  2W9Q A;  1YVB I;  2LQV A;  3F9S A;  3PCR A;  1FUT A;  4HKV B;  3GRD A;  2WOH A;  3BLZ A;  3MG2 A;  2XR8 B;  2KRT A;  7RNT A;  3FG3 A;  5AYR B;  1B2M A;  3AGO A;  4BL3 A;  1RMS A;  4FMA A;  1M1X B;  3K0Z A;  4KFF A;  3U1W A;  1VQ4 3;  1D6Y A;  1X1W A;  5EQL A;  1WNH A;  2STD A;  6STD A;  4L8O A;  4ZM8 A;  3LYG A;  1AV4 A;  3RDE A;  1JBT A;  1JZD A;  4HJL B;  4O3V A;  1TUH A;  3WHO A;  5LC7 A;  2Z7A A;  3CCR 3;  4XB5 A;  2OTL 3;  1NJI 4;  5ELJ A;  1KC8 4;  5AIG A;  2QIY A;  2XGN A;  1UGI A;  3NM7 A;  1UI7 A;  4J5K A;  3GSP A;  3F40 A;  1QVF 2;  1MOL A;  2XSH B;  2YFI B;  2IUK A;  1UW1 A;  1I2E A;  1NB5 I;  4N6L A;  1JBS A;  4U13 A;  1NO3 A;  3FCS B;  5IG5 A;  1YHQ 3;  4WHA A;  1BRH A;  4CJN A;  3CCM 3;  3EC9 A;  3SED A;  4HM7 B;  4K61 A;  4FMD A;  1C7H A;  2K54 A;  1IQ8 A;  5M1A A;  2C11 A;  2GU1 A;  3AMO B;  3X41 A;  1KWI A;  1KD1 4;  2AAD A;  1T2I A;  2CK3 H;  3ALA A;  1X1Y A;  1JB4 A;  2ZA4 A;  3Q1C A;  3NBR A;  3UL5 A;  4GSP A;  1FYS A;  2H0I A;  1YGW A;  3NHX A;  1EEJ A;  2I9W A;  4N3V A;  3VF1 A;  3WR2 A;  4XDW A;  3KFQ C;  2HMO B;  3SYU A;  1BSD A;  1BU4 A;  2XF3 A;  4N6V 0;  4WYK B;  1GD3 A;  2GEY A;  2HMK B;  2L4V A;  4J9A A;  1HU9 A;  4FCZ A;  1GSP A;  3WMD A;  5HGR A;  4Q53 A;  4RNY A;  3RNT A;  4OK0 A;  4JRF A;  2RFR A;  3FG1 A;  1RNB A;  6GSP A;  2A15 A;  1AY7 A;  4FR9 A;  3K5T A;  3NQZ A;  1X1U A;  3CNM A;  1DET A;  3LXU X;  1FA3 A;  1O7W B;  3KCH A;  4HM2 B;  4OVM A;  2W04 A;  3RGR A;  3MG3 A;  1A2V A;  1V57 A;  1GMP A;  3LT8 A;  4AEQ A;  2XGL A;  1U8C B;  3BB9 A;  1HYF A;  3GZY B;  1N8Q A;  1BRS A;  3FGY A;  1W6C A;  2GBX B;  3OXA A;  3LTB A;  1IVX A;  1VZZ A;  4N6N B;  3JUO A;  3FG4 A;  5BVB A;  3S29 A;  1LNH A;  5AEW B;  1HKX A;  1UCK A;  3F7X A;  3JUN A;  5D83 A;  3GZB A;  3X3Z A;  1YJ9 3;  1K41 A;  1OGX A;  1UCI A;  1X1X A;  3SXX A;  4BTW A;  4DKI A;  1ULI B;  1BIR A;  1HZ1 A;  1WMP A;  2Z6B A;  4ORL A;  1IDP A;  3DZL A;  4OUQ A;  1CH0 A;  4AKY A;  3D4A A;  1BSB A;  3LZA A; 
#chains in the Genus database with same CATH homology
 1FGR A;  4H61 A;  3G8Z A;  4WP5 A;  5EEO A;  3J7Y d;  3VGN A;  4EYC A;  4EBG A;  3G6E 3;  3EHC A;  2XEP A;  1IT7 A;  1ZX2 A;  2CWT A;  4STD A;  4LSO A;  2IUJ A;  2P09 A;  1M1K 4;  2YFJ B;  3CPO A;  3STD A;  1M9G A;  3EX9 A;  3MG1 A;  3LTC A;  1JKG A;  5AIF A;  2YX9 A;  1W6G A;  4GL6 A;  3X42 A;  2WO0 A;  3OW2 2;  4KVH A;  5D81 A;  2CFW A;  3WDG B;  1E97 A;  1N5P A;  1PFP A;  1W5Z A;  3Q2P A;  3PYJ A;  3V99 A;  3CXC 2;  3CNX A;  1GD4 A;  2D42 A;  3H51 A;  1IQY A;  2OQE C;  4EV2 A;  1Q40 A;  3MWZ A;  2C10 A;  2FXT A;  1DMM A;  1N5H A;  3KN4 A;  3S28 A;  5IW9 A;  1F8N A;  1VQO 3;  5AI1 A;  2Y74 A;  3G16 A;  3K63 A;  2KXG A;  3UL6 A;  1VQK 3;  3KZT A;  3WOD G;  3NM2 A;  1T5Y A;  3DGN A;  2CFD A;  4MEI A;  3OV4 A;  1E3R A;  2E2U A;  3SOA A;  1OF5 A;  4L7K A;  1NB3 I;  3FH1 A;  1N9J A;  3LTD A;  3ECF A;  1OPY A;  3LML A;  4FCJ A;  2CFL A;  1GY6 A;  3NXJ A;  1SJW A;  3CC7 3;  1JJ2 2;  3UNL A;  3B4P A;  2MF7 A;  3CCL 3;  3SLU A;  3IPT A;  1FGM A;  3IJE B;  1QAF A;  5JPP A;  5KP1 A;  4R4K A;  4X2O A;  3M8C A;  5IEN A;  5IEP A;  1FUW A;  1EG9 B;  3DY5 A;  1UUV B;  1ZO2 A;  3B4O A;  3N54 B;  2HMJ B;  4WWU C;  1TP6 A;  4FMC A;  3V92 A;  1VQN 3;  1IVW A;  2ZDJ A;  1YIT 3;  5ELU A;  2QA4 3;  2V1L A;  2F86 B;  3F8X A;  4HM3 B;  5JPU A;  1N8R 4;  1IV9 A;  2YFL B;  3U97 A;  2B1X B;  2D1W A;  3EN1 B;  1OHP A;  2W6J H;  2CFK A;  2OQE A;  2O9U X;  1A67 A;  1WMO A;  3JVC A;  3HI7 A;  4XDV A;  2CFG A;  2BO9 B;  1DVC A;  4XBX A;  3F7S A;  1JN5 A;  3F14 A;  3HX8 A;  5CF1 A;  3KE7 A;  1EA2 A;  1Q82 4;  1VQM 3;  4HYZ A;  1GY5 A;  1GYB A;  3G71 3;  2GU3 A;  2SBL A;  3RGA A;  3MKI A;  3MPH A;  1RRH A;  2F99 A;  2B24 B;  4MMX B;  3EE1 A;  3PXM A;  5STD A;  1CYV A;  1JRQ A;  2P0X A;  3H3H A;  2W56 A;  4CCV A;  2RGQ A;  1JB2 A;  2WGO A;  5KP4 A;  2E2V A;  5IG4 A;  8CHO A;  4QWT A;  1NU3 A;  3ROB A;  4O02 B;  2OOV C;  4H3U A;  4BTY A;  4IT7 A;  3DGO A;  3FKA A;  3PZW A;  2KCD A;  4PEJ A;  1IVV A;  4WFO A;  1LOX A;  1CEW I;  3QRD A;  2JQ5 A;  1W01 A;  3E99 A;  3SVA A;  1IK3 A;  3LH4 A;  2CH9 A;  4RZM A;  2BMR B;  3FLJ A;  3CC4 3;  5CK6 A;  1Q40 B;  3LOY A;  4FMB A;  3I0Y A;  3JUQ A;  5I97 A;  1EQK A;  2Z76 A;  1Y4K A;  4RNZ A;  1OH0 A;  1ROA A;  2XSO B;  1UI8 A;  3HZP A;  3MHE A;  3SX1 A;  4EV5 A;  2BHM A;  1JB5 A;  1OF5 B;  2CC3 A;  1US1 A;  1R4C A;  3B8L A;  5AEU B;  3S5C A;  4KFD A;  4N6T A;  4I4K A;  1SII A;  5TGN A;  4L8P A;  5BXQ A;  3I55 3;  3T8N A;  1O7N B;  3HII A;  2PNC A;  1Q86 4;  4LMI A;  2GBW B;  1QVG 2;  4R80 A;  1UUW B;  3T0U A;  1ISK A;  3IMA B;  2W03 A;  4EXR A;  2CG1 A;  3A76 A;  4MJD A;  1S72 3;  1L5G B;  2OOV A;  1NWW A;  2BNG A;  1D6Z A;  3OWY A;  3PGB A;  3CMA 3;  2W2C A;  4O8S A;  4HZ9 B;  4MMY B;  2Y73 A;  3QK9 A;  1YGE A;  3AMO A;  3EBY A;  1W7C A;  1O7H B;  5G2G A;  1KQS 2;  3S27 A;  1NDO B;  3VSY A;  3D3L A;  3WOE B;  1JN5 B;  2IMJ A;  1CQS A;  1M90 4;  1W02 A;  2JDI H;  4NRE A;  5DRE A;  3N8B A;  1OHS A;  2HMN B;  3K7C A;  1VQ8 3;  2WOF A;  4O2H A;  1K73 4;  1EKM A;  1ULJ B;  5IG0 A;  2CG0 A;  1YI2 3;  4AKZ A;  1TU5 A;  3KSE D;  3CCV 3;  1OAC A;  3CCS 3;  3BND A;  3DGM A;  2W56 B;  3NBB A;  4JF8 A;  4BTX A;  1KSI A;  2ZL8 A;  3WOF B;  1AVK A;  1O7M B;  2P0M A;  3F8H A;  3L0R A;  2R4I A;  1LVN A;  3BNE A;  5D82 A;  1Q81 4;  3EBT A;  4XBT A;  4RBN A;  3BNC A;  1DYU A;  2OCT A;  4N6M A;  3DMC A;  1QJG A;  3Q90 A;  3FSD A;  2OWP A;  1MNL A;  3FF0 A;  5A0O B;  3CPW 2;  2XRX B;  1AVL A;  1G96 A;  5IG3 A;  1STD A;  3WA3 A;  4GB5 A;  1E3V A;  2W9P A;  3SOY A;  7STD A;  3JUP A;  1J2B A;  4HM4 B;  1A2K A;  2GXF A;  3X3X A;  5FW5 A;  1AR0 A;  1SIH A;  5IEO A;  1VQP 3;  3TDG A;  4R9L A;  1O7P B;  3LT9 A;  3NBJ A;  3K9M C;  1U5O A;  4HM8 B;  2CHC A;  1OGZ A;  1VQL 3;  3CCJ 3;  4KFE A;  3CC2 3;  3DXO A;  1PU4 A;  2RCD A;  1ROV A;  1RRL A;  5EVH A;  1RN7 A;  2OTJ 3;  2XFT A;  1DMN A;  1JV2 B;  1WMN A;  1W00 A;  1DMQ A;  4HM0 B;  1CYU A;  1VQ7 3;  3N9H A;  4K1U A;  4G1M B;  5JBS A;  3MYT A;  1VQ5 3;  2P38 A;  3EN8 A;  1LXE A;  4J8T A;  3KII A;  5AIH A;  5CF2 A;  3CME 3;  2GEX A;  1QAL A;  1JKG B;  3LTA A;  1S5A A;  2XFS A;  3CCU 3;  1IT8 A;  2E2T A;  4K90 B;  2O3O A;  3DUK A;  3ER7 A;  1WQL B;  4IPB A;  4HZB B;  4HM5 B;  2XH9 A;  2CWU A;  5LC6 A;  1YIJ 3;  3D9R A;  2Q07 A;  3NV0 A;  2HMM B;  3NQY A;  3OWS A;  1FGQ A;  1VQ6 3;  4XM4 A;  3G0K A;  1W2B 2;  3HIG A;  5CXO A;  4HVN A;  3KSP A;  4LEH A;  3V98 A;  5FGO A;  1RJO A;  1FGO A;  2CW9 A;  1ASK A;  2F98 A;  1W2Z A;  1YJW 3;  5IF6 A;  2CWV A;  4FCM A;  2BMO B;  2MC8 A;  3I56 3;  1K8A 4;  3KKG A;  1OHO A;  3GAX A;  1QAK A;  2IA7 A;  2UX0 A;  4HBR A;  4MMZ B;  2INX A;  1TFO A;  2FGT A;  3PS8 A;  3B7C A;  2P05 A;  4EC6 A;  4HM6 B;  3X40 A;  1K28 A;  2QGU A;  4HM1 B;  3GWR A;  4R9K A;  1Z1S A;  3JUM A;  1SQW A;  1O7G B;  3OWU A;  1GY7 A;  3HK4 A;  1RKY A;  2BT3 A;  3X3Y A;  3UB1 A;  1K9M 4;  3FF2 A;  1A90 A;  3BNB A;  4NHF A;  3OX9 A;  4R1K A;  5AYS C;  4XBY A;  2QEX 3;  3DM8 A;  3CD6 3;  2HML B;  1YJN 3;  1QMA A;  4IIA A;  2Z77 A;  3UJM A;  1TIJ A;  3DGL A;  1TFK A;  3GZR A;  3GZX B;  3EF8 A;  3NUV A;  2LYX A;  1Q7Y 4;  4WYK A;  2M7O A;  1STF I;  1D6U A;  2ML5 A;  1IVU A;  2PZV A;  4N6U A;  4X2H A;  5IER A;  4LGQ A;  3CCE 3;  1W4N A;  5CLK A;  3CCQ 3;  5DRV A;  1VQ9 3;  1GS3 A;  1WTH A;  3CU3 A;  3MSO A;  1IQX A;  4CDL A;  3EB8 A;  3WA2 X;  2FNQ A;  4N6O B;  5AII A;  2K0M A;  3EJV A;  2BMQ B;  3O8Y A;  2RSX A;  1V74 A;  1IV7 A;  3PCS A;  1W6Y A;  1BUQ A;  2W0Q A;  4TX4 A;  1SPU A;  3NX0 A;  2CKF B;  3G4S 3;  1N9E A;  1IU7 A;  1FGT A;  4KZ1 A;  4K1V A;  3EQQ B;  1Q42 A;  5KP3 A;  3NV0 B;  3T8U A;  3FZW A;  1OUN A;  2WGQ A;  1DVD A;  4LZI A;  1JNQ A;  2ML6 A;  3S67 A;  2CIU A;  1OCV A;  2W9Q A;  1YVB I;  2LQV A;  3F9S A;  3PCR A;  4HKV B;  3GRD A;  2WOH A;  3BLZ A;  3MG2 A;  2XR8 B;  2KRT A;  3FG3 A;  5AYR B;  4FMA A;  1M1X B;  3K0Z A;  4KFF A;  3U1W A;  1VQ4 3;  1D6Y A;  5EQL A;  1WNH A;  2STD A;  6STD A;  4L8O A;  4ZM8 A;  3LYG A;  1AV4 A;  3RDE A;  4HJL B;  4O3V A;  1TUH A;  5LC7 A;  2Z7A A;  3CCR 3;  4XB5 A;  2OTL 3;  1NJI 4;  5ELJ A;  1KC8 4;  5AIG A;  2QIY A;  2XGN A;  3NM7 A;  1UI7 A;  3F40 A;  1QVF 2;  1MOL A;  2XSH B;  2YFI B;  2IUK A;  1UW1 A;  1NB5 I;  4N6L A;  4U13 A;  1NO3 A;  5IG5 A;  1YHQ 3;  4WHA A;  3CCM 3;  3EC9 A;  3SED A;  4HM7 B;  4K61 A;  4FMD A;  1C7H A;  2K54 A;  1IQ8 A;  2C11 A;  2GU1 A;  3AMO B;  3X41 A;  1KWI A;  1KD1 4;  3ALA A;  2CK3 H;  1JB4 A;  3Q1C A;  3NBR A;  3UL5 A;  3NHX A;  4N3V A;  3VF1 A;  2I9W A;  4XDW A;  3KFQ C;  2HMO B;  2XF3 A;  4N6V 0;  4WYK B;  1GD3 A;  2GEY A;  2HMK B;  2L4V A;  4J9A A;  1HU9 A;  4FCZ A;  3WMD A;  5HGR A;  4Q53 A;  4RNY A;  4OK0 A;  4JRF A;  2RFR A;  3FG1 A;  2A15 A;  4FR9 A;  3K5T A;  3NQZ A;  3CNM A;  3LXU X;  1FA3 A;  1O7W B;  4HM2 B;  4OVM A;  2W04 A;  3RGR A;  3MG3 A;  1A2V A;  3LT8 A;  4AEQ A;  2XGL A;  1U8C B;  3BB9 A;  3GZY B;  1N8Q A;  3FGY A;  1W6C A;  2GBX B;  3OXA A;  3LTB A;  1IVX A;  1VZZ A;  4N6N B;  3JUO A;  3FG4 A;  5BVB A;  3S29 A;  1LNH A;  5AEW B;  1HKX A;  3F7X A;  3JUN A;  5D83 A;  3GZB A;  3X3Z A;  1YJ9 3;  1K41 A;  1OGX A;  3SXX A;  4BTW A;  1ULI B;  1WMP A;  2Z6B A;  4ORL A;  1IDP A;  3DZL A;  4OUQ A;  4AKY A;  3FCS B;  3LZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...