2P05A

Structural insights into the evolution of a non-biological protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
b'KKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords a non-biological ATP binding protein 1819
publication title Structural insights into the evolution of a non-biological protein: importance of surface residues in protein fold optimization.
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 17
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2007-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p05A00
2P05A 2P09A 3LT9A 2P0XA 1UW1A 3DGNA 3LT8A 3DGLA 3DGOA 3DGMA 3LTCA 3LTDA 3LTAA 3LTBA
chains in the Genus database with same CATH superfamily
4EV2A 1Q7Y4 1FUWA 3T8NA 1LNHA 1OHPA 1PFPA 1RJOA 1IQYA 1TIJA 4MMYB 1CYUA 1O7GB 5D81A 4X2HA 1RGLA 1B2XA 1D6YA 1JRQA 1JNQA 2XGNA 3SYUA 5CF1A 1HYFA 2GU1A 1YIJ3 2QGUA 2GEYA 4WYKA 2WGOA 2Z77A 2E2UA 3MSOA 3X3XA 6RNTA 3RGRA 3UL5A 5FGOA 2LQVA 1YNVX 3AGOA 4KFDA 3F8HA 1O7WB 1K8A4 2YFLB 3EC9A 3UL6A 5RNTA 1LRAA 1BANA 5EVHA 3CNMA 3CC23 1BSEA 4IPBA 1HZ1A 4QWTA 3UJMA 3STDA 3CCR3 3CCM3 1O7NB 5AEUB 4Q53A 3S67A 3RDEA 1PYLA 3PYJA 4I4KA 4O3VA 1RMSA 1IVXA 1FZUA 3AMOA 3N9HA 1AY7A 4R9LA 1MWSA 5D83A 3DZLA 5ELUA 2CWTA 3NBRA 4BU4A 2CX1A 5M19A 3BNBA 1MWTA 3NHXA 3CCS3 1VQP3 1YJN3 4STDA 4HZ9B 2JQ5A 3NBJA 1N5HA 2RFRA 1NWWA 3LTAA 1ULIB 1TUHA 3F9SA 4KFEA 4MMZB 1I2FA 2CW9A 1UCIA 2ML5A 4AKZA 1ULJB 3CD63 1B2ZA 3DM8A 5AIHA 5IG0A 3I553 2WGQA 1KWIA 1IV9A 3PS8A 4XBYA 3D4AA 1JKGB 3VGNA 1ZS7A 1SJWA 2AAEA 1UGHI 3F7XA 1GOVA 1VQL3 3OV4A 2CG1A 1BGSA 1BRIA 5CXOA 2BMQB 1OGZA 1EA2A 3OXAA 1DETA 5M18A 2P05A 1RTUA 3LT8A 2W56B 3B8LA 4N6TA 3CCJ3 1W2B2 4N6UA 1YVSA 2E2TA 3FLJA 1UUWB 2XR8B 2KF5A 4CPKA 1GY7A 1UI7A 2V1LA 3CPW2 3G0KA 1RRHA 3QK9A 2E2VA 4L8OA 2F86B 2OOVC 3D9RA 3LYGA 4L8PA 1GMRA 3ROBA 3CCE3 1BNGA 2P09A 2BIRA 1W7CA 2RCDA 3BU4A 3B7CA 4J5GA 1ROAA 1T5YA 1QVF2 1IVWA 1BIRA 2RNTA 5HOHA 2XFSA 3LZAA 3K9MC 1VQ93 2B24B 2CWVA 2J8XB 4EC6A 3U1WA 1BOXA 3NM2A 1BVIA 1BRGA 2HMLB 4NPBA 1RGHA 3CCL3 2BHMA 3X3ZA 3DGYA 1K734 3HK4A 4EYCA 2P0MA 1T2HA 3VSYA 4U13A 2RGQA 4HJLB 2O3OA 4FMBA 1OPYA 1WTHA 3ZG0A 3KN4A 2HMKB 2A15A 3LMLA 3MHEA 1EUIC 1OUNA 3GSPA 3EF8A 6STDA 5IERA 2YFIB 2H0HA 7RNTA 1AV4A 8CHOA 4HOHA 3HI7A 2HOHA 1JZOA 3WOFB 5IG4A 3DMCA 3G4S3 1UDII 1M9GA 2XSHB 3EBTA 4KT3B 3G6E3 1Q864 1BRNL 3GZYB 1VQ53 3BLZA 1I3FA 1AQZA 3KKGA 4RZMA 3NBBA 4EXRA 5AIGA 1BRSA 2CC3A 4BIRA 4I5QA 5IG3A 4HM6B 1RGAA 5KP3A 3Q2PA 3CXC2 1UI8A 3NV0A 1D6ZA 4WYKB 4GHOA 5IEPA 1YJ93 1V57A 4HKVB 3F40A 1MGWA 2K54A 3IPTA 4MMXB 4ORLA 5BU4A 3CC43 4TX4A 1A2KA 2OQEC 1TJDA 1ISKA 7GSPA 1MWRA 3FF2A 3HZPA 1SARA 3S28A 3MG1A 4KZ1A 1YHQ3 1GOUA 2Y73A 3MG2A 1RN4A 4AEQA 1GYBA 3LT9A 4J5KA 2UGIA 1KSIA 2F5MA 4LEHA 1W6GA 2CKFB 1O7PB 1QVG2 1W6CA 1JZDA 2ZL8A 8RNTA 3DH2A 1GD3A 1I0XA 3EJVA 3EHCA 1BSCA 1OCVA 5KP4A 1IQ8A 1F8NA 3HX8A 1IYYA 1NJI4 3NUVA 4R9KA 5EQLA 2F56A 4G1MB 2SBLA 1PY3A 5IW9A 1QALA 1MGRA 1W01A 5AYRB 3CMA3 1BUQA 4EW5A 9RNTA 4BTWA 1I3IA 4HBRA 2QEX3 3ZG5A 1M1XB 3F8XA 2INXA 1BNJA 2F5WA 5AIFA 1QAFA 2F98A 4KVHA 1W02A 3MYTA 4XBXA 5AYSC 2W03A 3MG3A 3S29A 4HM4B 1Q40A 3FG4A 3PCSA 1RKYA 3BNEA 1VQQA 1ZGXA 3DGMA 4XDVA 3NX0A 1YGEA 1W5ZA 1U5OA 5LC6A 5G2GA 1OGXA 1VQO3 1UCKA 1VQM3 1FGMA 4RBNA 1WQLB 1FGQA 2KF6A 3LTDA 1OHOA 1FUTA 1DVDA 5IEOA 4L7KA 1Q814 3OWSA 3WOEB 3TDGA 2QA43 2KXGA 2SARA 3HOHA 2CH9A 2IUJA 2Z76A 3FF0A 1JBSA 1E3VA 2XF3A 3EN1B 5FW5A 1EQKA 3GWRA 1DMMA 3FZWA 2GBXB 1GSPA 4X2OA 1TFOA 3WODG 3B4PA 1VQ43 3D5IA 2K3DA 5JPPA 1EKMA 2OWPA 3SOAA 4EV5A 1V74A 3VF1A 1TP6A 1X1UA 1RN7A 1JJ22 1ASKA 1C54A 4OUQA 1SIHA 3V92A 3LOYA 1YGWA 2PZVA 2GU3A 2C11A 1RGFA 1YI23 3WR2A 1NB3I 3PGBA 3X42A 7STDA 4WHAA 1I0VA 1GOYA 1CH0A 3WHOA 3OX9A 3EBYA 3X41A 1Q42A 2GSPA 4FCZA 2XH9A 4LGQA 3WMDA 1K41A 2IUKA 2Y74A 1I8VA 3QRDA 3G713 5TGNA 1Z1SA 1Q7HA 3N54B 1EEJA 2W9PA 3K0ZA 2Z7AA 3EE1A 1BSAA 3PZWA 4N6LA 1FA3A 1STFI 2W04A 3MWZA 3S5CA 5BVBA 5STDA 2FNQA 2CFLA 1R4YA 4HM3B 1UCLA 4O8SA 3SLUA 3V99A 1TRQA 2CG0A 1IQXA 1FYSA 3SVAA 1I2EA 2OTJ3 2YX9A 2BMOB 2O9UX 3JUOA 3KE7A 3M8CA 3WA2X 3H3HA 3BNDA 1AVKA 3KFQC 4N6OB 1A2VA 4R1KA 5G1KA 1RSNA 2CWUA 1D6UA 2L1SA 1J2BA 3IMAB 2UX0A 4GSPA 4H3UA 1EG9B 3RNTA 4AKYA 4HM1B 3E99A 1LXEA 1US1A 1U8CB 1YVBI 4RNYA 2W2CA 1BU4A 1OH0A 1OF5A 1RCKA 5BXQA 1JBTA 1IT8A 1W4NA 2W9QA 4NHFA 3MKIA 4BL3A 3SEDA 4CCVA 1HKXA 4FR9A 4HYZA 3V98A 1RN1A 2YFJB 1FGOA 2HMMB 2CFWA 1TRPA 4N3VA 1NU3A 1WMPA 1JKGA 1CQSA 3AGNA 3LXUX 3OWYA 4FMAA 2OOVA 1BNFA 3RGAA 2D1WA 4XBTA 1RNTA 2MF7A 2CFGA 1AR0A 3A5EA 5IG5A 4IT7A 1B21A 3DGLA 2K0MA 1VQK3 3O8YA 4OK0A 5CK6A 3CCU3 1JB5A 3AHSA 3EX9A 3NQYA 4BL2A 2RSXA 1MNLA 1MOLA 5LC7A 3LTBA 1IU7A 3BB9A 1LVNA 4GB5A 4O02B 5JBSA 3CC73 1B3SA 3J7Yd 5D82A 3G8ZA 3OW22 1K9M4 1Q824 1I70A 1TU5A 2L4VA 1DE3A 1RLSA 6GSPA 1IK3A 5KP1A 2CK3H 1M1K4 1BRKA 5G1LA 1N5PA 1UCJA 2XGLA 3JUQA 2XSOB 3AMOB 4HVNA 2BU4A 5I97A 3F14A 5IENA 1WMNA 2F4YA 4XB5A 2ZHXB 3GRDA 3DGOA 3BNCA 3SXXA 4HM8B 1ZO2A 1NDOB 2IYJA 3JUPA 4JF8A 1S723 3HIGA 3LH4A 1GS3A 1LOXA 2HMNB 1DMNA 3D5GA 1RDSA 3KSPA 3B4OA 1JB4A 1JN5A 4ILFA 5ELJA 1LNIA 2MC8A 1VQ73 1JB2A 1GMPA 3U97A 1V58A 2PNCA 4PEJA 1RNBA 1RGEA 2OQEA 1AVLA 2GEXA 1IVVA 3JUMA 1UW1A 2BNGA 1FGRA 1WNHA 3CCV3 2BO9B 4MJDA 3SOYA 1KC84 1LOYA 1BNRA 3X3YA 4WFOA 1IT7A 1E3RA 1SIIA 1SPUA 1IVUA 5CF2A 1W6YA 2I9WA 1CYVA 1HU9A 1LOWA 2CFDA 2M7OA 4LYLB 5GSPA 4N6MA 3DGNA 2WOFA 3N8BA 3UNLA 4HM5B 1LOVA 4LZIA 1RGKA 2WOHA 4N6V0 1KD14 1NNVA 4N6NB 1RGGA 1B27A 2WO0A 5HGRA 1B2SA 5CLKA 3F7SA 1B2MA 4R80A 1LQGC 1G02A 4CJNA 1VQN3 1BRJA 1ZX2A 2FXTA 1WMOA 2H0GA 1ROVA 1W00A 4FCMA 2Z6BA 1M904 5DRVA 3UB1A 2KF3A 3ALAA 1UGIA 1S5AA 1BNIA 4JRFA 1RRLA 3OWUA 2CHCA 2W0QA 2ML6A 3GAXA 2FGTA 3BIRA 3ZFZA 1BAOA 3K7CA 1GD4A 1BSDA 2R41A 4HM2B 1N8QA 1B2UA 2KF4A 1VQ63 4HM0B 2P0XA 4NREA 2Q07A 1T2IA 1OF5B 3LTCA 2BT3A 2RBIA 3JVCA 2C4BA 5IF6A 1STDA 3CCQ3 1PU4A 4EBGA 3Q90A 2KRTA 2C10A 3FG1A 4KFFA 2STDA 3FKAA 4O2HA 4K1UA 2QIYA 3EQQB 4HM7B 2HMOB 2LYXA 3GZXB 2IA7A 2D42A 2OCTA 3CPOA 3I563 1A90A 1VZZA 4IIAA 3H51A 1LQMB 4DKIA 3FCSB 1B20A 2IY2A 3NV0B 4R4KA 3K63A 2UUGC 3PXMA 4LMIA 3GZBA 4LSOA 4XDWA 4XM4A 1IV7A 3HIIA 1O7MB 1SQWA 4K90B 3ECFA 1X1WA 1MWUA 2GXFA 3D79A 3Q3FA 1R4CA 2KAAA 1A67A 1JBRA 3EB8A 1X1XA 4RNZA 5A0OB 2OTL3 2XEPA 1L5GB 2AADA 4BTXA 4J8TA 1A2PA 3URPA 2ZA4A 5AIIA 3KCHA 4RNTA 1JV2B 1IDPA 1C7HA 3D3LA 3PCRA 2P38A 1NO3A 1QMAA 3KIIA 1N9JA 3JUNA 1FUSA 1E97A 3WDGB 1I2GA 1GMQA 2R4IA 3S27A 3MPHA 3GZRA 1N8R4 2JDIH 4H61A 3SX1A 4HZBB 1X1YA 1TTOA 2B1XB 3A76A 4HAAA 3X40A 1VQ83 1BRHA 3CNXA 3EN8A 2W56A 4MEIA 3CME3 2HMJB 1Q9EA 1T3BA 1BNEA 3FSDA 2H0IA 4FMCA 1Y4KA 3L0RA 4FCJA 2CFKA 2CIUA 1TFKA 4BTYA 3NXJA 1Q40B 1JN5B 1UUGB 4ZM8A 1QAKA 2W6JH 2ZDJA 1BNSA 2BMRB 3FG3A 1FW7A 1K28A 3DY5A 3DUKA 3G16A 5DREA 1YJW3 1G96A 1DYUA 2KCDA 4WWUC 3WA3A 4J9AA 4FMDA 3KSED 3NQZA 1OHSA 5EEOA 1RCLA 4GL6A 5JPUA 2XRXB 3ER7A 2GBWB 1GY6A 1UUVB 4CDLA 3NM7A 4WP5A 1N9EA 1O7HB 1OACA 1RHLA 1W2ZA 2XFTA 3CU3A 1QJGA 3K5TA 4OVMA 1BSBA 5M1AA 5BIRA 1YIT3 1NB5I 2CX0A 1G0TA 3FGYA 5AI1A 3Q1CA 2IMJA 3IJEB 3KZTA 1DVCA 2F99A 3I0YA 1CEWI 3T0UA 3DXOA 1FGTA 1RGCA 1GY5A 1DMQA 3AHWA 1KQS2 3T8UA 5AEWB 1BUJA 4K1VA 3FH1A 4K61A
chains in the Genus database with same CATH topology
4EV2A 1Q7Y4 1FUWA 3T8NA 1LNHA 1OHPA 1PFPA 1RJOA 1IQYA 1TIJA 4MMYB 1CYUA 1O7GB 5D81A 4X2HA 1D6YA 1JRQA 5CF1A 1JNQA 2XGNA 1YIJ3 2GU1A 2QGUA 2GEYA 4WYKA 2WGOA 2Z77A 2E2UA 3MSOA 3X3XA 3RGRA 3UL5A 5FGOA 2LQVA 4KFDA 3F8HA 1O7WB 1K8A4 2YFLB 3EC9A 3UL6A 3CCQ3 5EVHA 3CC23 3CNMA 4IPBA 4QWTA 3UJMA 3STDA 3CCR3 3CCM3 1O7NB 5AEUB 4Q53A 3S67A 3RDEA 3PYJA 4I4KA 4O3VA 1IVXA 3AMOA 3N9HA 4R9LA 5D83A 3DZLA 5ELUA 2CWTA 3NBRA 3BNBA 3CCS3 3NHXA 1VQP3 1YJN3 4STDA 4HZ9B 2JQ5A 3NBJA 1N5HA 2RFRA 1NWWA 3LTAA 1ULIB 1TUHA 3F9SA 4KFEA 4MMZB 2CW9A 2ML5A 4AKZA 1ULJB 3CD63 3DM8A 5AIHA 5IG0A 3I553 2WGQA 1KWIA 1IV9A 3PS8A 4XBYA 1JKGB 3VGNA 1SJWA 3F7XA 1VQL3 3OV4A 2CG1A 5CXOA 2BMQB 1OGZA 1EA2A 3OXAA 2P05A 3LT8A 2W56B 3B8LA 4N6TA 3CCJ3 1W2B2 4N6UA 2E2TA 3FLJA 1UUWB 2XR8B 1GY7A 1UI7A 2V1LA 3CPW2 3G0KA 1RRHA 3QK9A 2E2VA 4L8OA 2F86B 2OOVC 3D9RA 3LYGA 4L8PA 3ROBA 3CCE3 2P09A 1W7CA 2RCDA 3B7CA 1ROAA 1T5YA 1QVF2 1IVWA 2XFSA 3LZAA 3K9MC 1VQ93 2B24B 2CWVA 4EC6A 3U1WA 3NM2A 2HMLB 3CCL3 2BHMA 3X3ZA 1K734 3HK4A 4EYCA 2P0MA 3VSYA 4U13A 2RGQA 4HJLB 2O3OA 4FMBA 1OPYA 1WTHA 3KN4A 2HMKB 2A15A 3LMLA 3MHEA 1OUNA 3EF8A 6STDA 5IERA 2YFIB 1AV4A 8CHOA 3HI7A 3WOFB 5IG4A 3DMCA 3G4S3 2XSHB 1M9GA 3EBTA 3G6E3 1Q864 1VQ53 3GZYB 3BLZA 3KKGA 4RZMA 3NBBA 4EXRA 5AIGA 2CC3A 5IG3A 4HM6B 5KP3A 3CXC2 3Q2PA 1UI8A 3NV0A 1D6ZA 4WYKB 5IEPA 1YJ93 4HKVB 3F40A 4MMXB 2K54A 3IPTA 4ORLA 3CC43 4TX4A 1A2KA 2OQEC 1ISKA 3FF2A 3HZPA 3S28A 3MG1A 4KZ1A 1YHQ3 2Y73A 3MG2A 4AEQA 1GYBA 3LT9A 1KSIA 4LEHA 1W6GA 2CKFB 1O7PB 1QVG2 1W6CA 2ZL8A 1GD3A 3EJVA 3EHCA 1OCVA 5KP4A 1IQ8A 1F8NA 3HX8A 1NJI4 3NUVA 4R9KA 5EQLA 4G1MB 2SBLA 5IW9A 1QALA 1W01A 5AYRB 3CMA3 1BUQA 4BTWA 4HBRA 2QEX3 1M1XB 3F8XA 2INXA 5AIFA 1QAFA 2F98A 4KVHA 1W02A 3MYTA 4XBXA 5AYSC 2W03A 3MG3A 3S29A 4HM4B 1Q40A 3FG4A 3PCSA 1RKYA 3BNEA 3DGMA 4XDVA 3NX0A 1YGEA 1W5ZA 1U5OA 5LC6A 5G2GA 1OGXA 1VQO3 1VQM3 1FGMA 4RBNA 1FGQA 1WQLB 3LTDA 1OHOA 1DVDA 5IEOA 4L7KA 1Q814 3OWSA 3WOEB 3TDGA 2QA43 2KXGA 2CH9A 2IUJA 2Z76A 3FF0A 1E3VA 2XF3A 3EN1B 5FW5A 1EQKA 3GWRA 1DMMA 3FZWA 2GBXB 4X2OA 1TFOA 3WODG 3B4PA 1VQ43 5JPPA 1EKMA 2OWPA 3SOAA 4EV5A 1V74A 3VF1A 1TP6A 1RN7A 1JJ22 1ASKA 4OUQA 1SIHA 3V92A 3LOYA 2PZVA 2GU3A 2C11A 1YI23 1NB3I 3PGBA 3X42A 7STDA 4WHAA 3OX9A 3EBYA 3X41A 1Q42A 4FCZA 4LGQA 2XH9A 3WMDA 1K41A 2IUKA 2Y74A 3G713 3QRDA 5TGNA 1Z1SA 3N54B 2W9PA 3K0ZA 2Z7AA 3EE1A 3PZWA 4N6LA 1FA3A 1STFI 2W04A 3MWZA 3S5CA 5BVBA 5STDA 2FNQA 2CFLA 4HM3B 4O8SA 3SLUA 3V99A 2CG0A 1IQXA 3SVAA 2OTJ3 2YX9A 2BMOB 2O9UX 3JUOA 3KE7A 3M8CA 3WA2X 3H3HA 3BNDA 1AVKA 3KFQC 4N6OB 1A2VA 4R1KA 2CWUA 1D6UA 1J2BA 3IMAB 2UX0A 4H3UA 1EG9B 4AKYA 4HM1B 3E99A 1LXEA 1US1A 1U8CB 1YVBI 4RNYA 2W2CA 1OH0A 1OF5A 5BXQA 1IT8A 1W4NA 2W9QA 4NHFA 3MKIA 4CCVA 3SEDA 1HKXA 4FR9A 4HYZA 3V98A 2YFJB 1FGOA 2HMMB 2CFWA 4N3VA 1NU3A 1WMPA 1JKGA 1CQSA 3LXUX 3OWYA 4FMAA 2OOVA 3RGAA 2D1WA 4XBTA 2MF7A 2CFGA 1AR0A 4IT7A 3DGLA 2K0MA 1VQK3 3O8YA 4OK0A 5CK6A 3CCU3 1JB5A 3EX9A 3NQYA 2RSXA 1MNLA 1MOLA 5LC7A 3LTBA 1IU7A 3BB9A 1LVNA 4GB5A 4O02B 5JBSA 3CC73 3J7Yd 5D82A 3G8ZA 3OW22 1K9M4 1Q824 1TU5A 2L4VA 1IK3A 5KP1A 2CK3H 1M1K4 1N5PA 2XGLA 3JUQA 2XSOB 3AMOB 4HVNA 5I97A 3F14A 5IENA 1WMNA 4XB5A 3GRDA 3DGOA 3BNCA 3SXXA 4HM8B 1ZO2A 1NDOB 3JUPA 4JF8A 1S723 3HIGA 3LH4A 1GS3A 1LOXA 2HMNB 1DMNA 3KSPA 3B4OA 1JB4A 1JN5A 2MC8A 5ELJA 1VQ73 1JB2A 3U97A 2PNCA 4PEJA 2OQEA 1AVLA 2GEXA 1IVVA 3JUMA 1UW1A 2BNGA 1FGRA 1WNHA 3CCV3 2BO9B 4MJDA 3SOYA 1KC84 3X3YA 4WFOA 1IT7A 1E3RA 1SIIA 1SPUA 1IVUA 5CF2A 1W6YA 2I9WA 1CYVA 1HU9A 2CFDA 2M7OA 4N6MA 3DGNA 2WOFA 3N8BA 3UNLA 4HM5B 4LZIA 2WOHA 4N6V0 1KD14 4N6NB 2WO0A 5HGRA 5CLKA 3F7SA 4R80A 1VQN3 1ZX2A 2FXTA 1WMOA 1ROVA 1W00A 4FCMA 2Z6BA 1M904 5DRVA 3UB1A 3ALAA 1S5AA 4JRFA 1RRLA 3OWUA 2CHCA 2W0QA 2ML6A 3GAXA 2FGTA 3K7CA 1GD4A 4HM2B 1N8QA 1VQ63 4HM0B 2P0XA 4NREA 2Q07A 1OF5B 3LTCA 2BT3A 3JVCA 5IF6A 1STDA 1PU4A 4EBGA 3Q90A 2KRTA 2C10A 3FG1A 4KFFA 2STDA 3FKAA 4O2HA 4K1UA 2QIYA 3EQQB 4HM7B 2HMOB 2LYXA 3GZXB 2IA7A 2D42A 2OCTA 3CPOA 3I563 1A90A 1VZZA 4IIAA 3H51A 3FCSB 3NV0B 4R4KA 3K63A 3PXMA 4LMIA 3GZBA 4LSOA 4XDWA 4XM4A 1IV7A 3HIIA 1O7MB 1SQWA 4K90B 3ECFA 2GXFA 1R4CA 1A67A 3EB8A 4RNZA 2OTL3 5A0OB 2XEPA 1L5GB 4BTXA 4J8TA 5AIIA 1JV2B 1IDPA 1C7HA 3D3LA 3PCRA 2P38A 1NO3A 1QMAA 3KIIA 1N9JA 3JUNA 1E97A 3WDGB 2R4IA 3S27A 3MPHA 3GZRA 1N8R4 2JDIH 4H61A 3SX1A 4HZBB 2B1XB 3X40A 1VQ83 3A76A 3CNXA 3EN8A 2W56A 4MEIA 3CME3 2HMJB 3FSDA 4FMCA 1Y4KA 3L0RA 4FCJA 2CFKA 2CIUA 1TFKA 4BTYA 3NXJA 1Q40B 1JN5B 4ZM8A 1QAKA 2W6JH 2ZDJA 2BMRB 3FG3A 1K28A 3DY5A 3DUKA 3G16A 5DREA 1YJW3 1G96A 1DYUA 2KCDA 4WWUC 3WA3A 4J9AA 4FMDA 3KSED 3NQZA 1OHSA 5EEOA 4GL6A 5JPUA 2XRXB 3ER7A 2GBWB 1GY6A 1UUVB 4CDLA 3NM7A 4WP5A 1N9EA 1O7HB 1OACA 1W2ZA 2XFTA 3CU3A 3K5TA 1QJGA 1YIT3 4OVMA 1NB5I 3FGYA 5AI1A 3Q1CA 2IMJA 3IJEB 3KZTA 1DVCA 2F99A 3I0YA 1CEWI 3T0UA 3DXOA 1FGTA 5IG5A 1GY5A 1DMQA 1KQS2 3T8UA 5AEWB 4K1VA 3FH1A 4K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P05 A;  2P09 A;  3LT9 A;  2P0X A;  1UW1 A;  3DGN A;  3LT8 A;  3DGL A;  3DGO A;  3DGM A;  3LTC A;  3LTD A;  3LTA A;  3LTB A; 
#chains in the Genus database with same CATH topology
 4EV2 A;  1Q7Y 4;  1FUW A;  3T8N A;  1LNH A;  1OHP A;  1PFP A;  1RJO A;  1IQY A;  1TIJ A;  4MMY B;  1CYU A;  1O7G B;  5D81 A;  4X2H A;  1RGL A;  1B2X A;  1D6Y A;  1JRQ A;  1JNQ A;  2XGN A;  3SYU A;  5CF1 A;  1HYF A;  2GU1 A;  1YIJ 3;  2QGU A;  2GEY A;  4WYK A;  2WGO A;  2Z77 A;  2E2U A;  3MSO A;  3X3X A;  6RNT A;  3RGR A;  3UL5 A;  5FGO A;  2LQV A;  1YNV X;  3AGO A;  4KFD A;  3F8H A;  1O7W B;  1K8A 4;  2YFL B;  3EC9 A;  3UL6 A;  5RNT A;  1LRA A;  1BAN A;  5EVH A;  3CNM A;  3CC2 3;  1BSE A;  4IPB A;  1HZ1 A;  4QWT A;  3UJM A;  3STD A;  3CCR 3;  3CCM 3;  1O7N B;  5AEU B;  4Q53 A;  3S67 A;  3RDE A;  1PYL A;  3PYJ A;  4I4K A;  4O3V A;  1RMS A;  1IVX A;  1FZU A;  3AMO A;  3N9H A;  1AY7 A;  4R9L A;  1MWS A;  5D83 A;  3DZL A;  5ELU A;  2CWT A;  3NBR A;  4BU4 A;  2CX1 A;  5M19 A;  3BNB A;  1MWT A;  3NHX A;  3CCS 3;  1VQP 3;  1YJN 3;  4STD A;  4HZ9 B;  2JQ5 A;  3NBJ A;  1N5H A;  2RFR A;  1NWW A;  3LTA A;  1ULI B;  1TUH A;  3F9S A;  4KFE A;  4MMZ B;  1I2F A;  2CW9 A;  1UCI A;  2ML5 A;  4AKZ A;  1ULJ B;  3CD6 3;  1B2Z A;  3DM8 A;  5AIH A;  5IG0 A;  3I55 3;  2WGQ A;  1KWI A;  1IV9 A;  3PS8 A;  4XBY A;  3D4A A;  1JKG B;  3VGN A;  1ZS7 A;  1SJW A;  2AAE A;  1UGH I;  3F7X A;  1GOV A;  1VQL 3;  3OV4 A;  2CG1 A;  1BGS A;  1BRI A;  5CXO A;  2BMQ B;  1OGZ A;  1EA2 A;  3OXA A;  1DET A;  5M18 A;  2P05 A;  1RTU A;  3LT8 A;  2W56 B;  3B8L A;  4N6T A;  3CCJ 3;  1W2B 2;  4N6U A;  1YVS A;  2E2T A;  3FLJ A;  1UUW B;  2XR8 B;  2KF5 A;  4CPK A;  1GY7 A;  1UI7 A;  2V1L A;  3CPW 2;  3G0K A;  1RRH A;  3QK9 A;  2E2V A;  4L8O A;  2F86 B;  2OOV C;  3D9R A;  3LYG A;  4L8P A;  1GMR A;  3ROB A;  3CCE 3;  1BNG A;  2P09 A;  2BIR A;  1W7C A;  2RCD A;  3BU4 A;  3B7C A;  4J5G A;  1ROA A;  1T5Y A;  1QVF 2;  1IVW A;  1BIR A;  2RNT A;  5HOH A;  2XFS A;  3LZA A;  3K9M C;  1VQ9 3;  2B24 B;  2CWV A;  2J8X B;  4EC6 A;  3U1W A;  1BOX A;  3NM2 A;  1BVI A;  1BRG A;  2HML B;  4NPB A;  1RGH A;  3CCL 3;  2BHM A;  3X3Z A;  3DGY A;  1K73 4;  3HK4 A;  4EYC A;  2P0M A;  1T2H A;  3VSY A;  4U13 A;  2RGQ A;  4HJL B;  2O3O A;  4FMB A;  1OPY A;  1WTH A;  3ZG0 A;  3KN4 A;  2HMK B;  2A15 A;  3LML A;  3MHE A;  1EUI C;  1OUN A;  3GSP A;  3EF8 A;  6STD A;  5IER A;  2YFI B;  2H0H A;  7RNT A;  1AV4 A;  8CHO A;  4HOH A;  3HI7 A;  2HOH A;  1JZO A;  3WOF B;  5IG4 A;  3DMC A;  3G4S 3;  1UDI I;  1M9G A;  2XSH B;  3EBT A;  4KT3 B;  3G6E 3;  1Q86 4;  1BRN L;  3GZY B;  1VQ5 3;  3BLZ A;  1I3F A;  1AQZ A;  3KKG A;  4RZM A;  3NBB A;  4EXR A;  5AIG A;  1BRS A;  2CC3 A;  4BIR A;  4I5Q A;  5IG3 A;  4HM6 B;  1RGA A;  5KP3 A;  3Q2P A;  3CXC 2;  1UI8 A;  3NV0 A;  1D6Z A;  4WYK B;  4GHO A;  5IEP A;  1YJ9 3;  1V57 A;  4HKV B;  3F40 A;  1MGW A;  2K54 A;  3IPT A;  4MMX B;  4ORL A;  5BU4 A;  3CC4 3;  4TX4 A;  1A2K A;  2OQE C;  1TJD A;  1ISK A;  7GSP A;  1MWR A;  3FF2 A;  3HZP A;  1SAR A;  3S28 A;  3MG1 A;  4KZ1 A;  1YHQ 3;  1GOU A;  2Y73 A;  3MG2 A;  1RN4 A;  4AEQ A;  1GYB A;  3LT9 A;  4J5K A;  2UGI A;  1KSI A;  2F5M A;  4LEH A;  1W6G A;  2CKF B;  1O7P B;  1QVG 2;  1W6C A;  1JZD A;  2ZL8 A;  8RNT A;  3DH2 A;  1GD3 A;  1I0X A;  3EJV A;  3EHC A;  1BSC A;  1OCV A;  5KP4 A;  1IQ8 A;  1F8N A;  3HX8 A;  1IYY A;  1NJI 4;  3NUV A;  4R9K A;  5EQL A;  2F56 A;  4G1M B;  2SBL A;  1PY3 A;  5IW9 A;  1QAL A;  1MGR A;  1W01 A;  5AYR B;  3CMA 3;  1BUQ A;  4EW5 A;  9RNT A;  4BTW A;  1I3I A;  4HBR A;  2QEX 3;  3ZG5 A;  1M1X B;  3F8X A;  2INX A;  1BNJ A;  2F5W A;  5AIF A;  1QAF A;  2F98 A;  4KVH A;  1W02 A;  3MYT A;  4XBX A;  5AYS C;  2W03 A;  3MG3 A;  3S29 A;  4HM4 B;  1Q40 A;  3FG4 A;  3PCS A;  1RKY A;  3BNE A;  1VQQ A;  1ZGX A;  3DGM A;  4XDV A;  3NX0 A;  1YGE A;  1W5Z A;  1U5O A;  5LC6 A;  5G2G A;  1OGX A;  1VQO 3;  1UCK A;  1VQM 3;  1FGM A;  4RBN A;  1WQL B;  1FGQ A;  2KF6 A;  3LTD A;  1OHO A;  1FUT A;  1DVD A;  5IEO A;  4L7K A;  1Q81 4;  3OWS A;  3WOE B;  3TDG A;  2QA4 3;  2KXG A;  2SAR A;  3HOH A;  2CH9 A;  2IUJ A;  2Z76 A;  3FF0 A;  1JBS A;  1E3V A;  2XF3 A;  3EN1 B;  5FW5 A;  1EQK A;  3GWR A;  1DMM A;  3FZW A;  2GBX B;  1GSP A;  4X2O A;  1TFO A;  3WOD G;  3B4P A;  1VQ4 3;  3D5I A;  2K3D A;  5JPP A;  1EKM A;  2OWP A;  3SOA A;  4EV5 A;  1V74 A;  3VF1 A;  1TP6 A;  1X1U A;  1RN7 A;  1JJ2 2;  1ASK A;  1C54 A;  4OUQ A;  1SIH A;  3V92 A;  3LOY A;  1YGW A;  2PZV A;  2GU3 A;  2C11 A;  1RGF A;  1YI2 3;  3WR2 A;  1NB3 I;  3PGB A;  3X42 A;  7STD A;  4WHA A;  1I0V A;  1GOY A;  1CH0 A;  3WHO A;  3OX9 A;  3EBY A;  3X41 A;  1Q42 A;  2GSP A;  4FCZ A;  2XH9 A;  4LGQ A;  3WMD A;  1K41 A;  2IUK A;  2Y74 A;  1I8V A;  3QRD A;  3G71 3;  5TGN A;  1Z1S A;  1Q7H A;  3N54 B;  1EEJ A;  2W9P A;  3K0Z A;  2Z7A A;  3EE1 A;  1BSA A;  3PZW A;  4N6L A;  1FA3 A;  1STF I;  2W04 A;  3MWZ A;  3S5C A;  5BVB A;  5STD A;  2FNQ A;  2CFL A;  1R4Y A;  4HM3 B;  1UCL A;  4O8S A;  3SLU A;  3V99 A;  1TRQ A;  2CG0 A;  1IQX A;  1FYS A;  3SVA A;  1I2E A;  2OTJ 3;  2YX9 A;  2BMO B;  2O9U X;  3JUO A;  3KE7 A;  3M8C A;  3WA2 X;  3H3H A;  3BND A;  1AVK A;  3KFQ C;  4N6O B;  1A2V A;  4R1K A;  5G1K A;  1RSN A;  2CWU A;  1D6U A;  2L1S A;  1J2B A;  3IMA B;  2UX0 A;  4GSP A;  4H3U A;  1EG9 B;  3RNT A;  4AKY A;  4HM1 B;  3E99 A;  1LXE A;  1US1 A;  1U8C B;  1YVB I;  4RNY A;  2W2C A;  1BU4 A;  1OH0 A;  1OF5 A;  1RCK A;  5BXQ A;  1JBT A;  1IT8 A;  1W4N A;  2W9Q A;  4NHF A;  3MKI A;  4BL3 A;  3SED A;  4CCV A;  1HKX A;  4FR9 A;  4HYZ A;  3V98 A;  1RN1 A;  2YFJ B;  1FGO A;  2HMM B;  2CFW A;  1TRP A;  4N3V A;  1NU3 A;  1WMP A;  1JKG A;  1CQS A;  3AGN A;  3LXU X;  3OWY A;  4FMA A;  2OOV A;  1BNF A;  3RGA A;  2D1W A;  4XBT A;  1RNT A;  2MF7 A;  2CFG A;  1AR0 A;  3A5E A;  5IG5 A;  4IT7 A;  1B21 A;  3DGL A;  2K0M A;  1VQK 3;  3O8Y A;  4OK0 A;  5CK6 A;  3CCU 3;  1JB5 A;  3AHS A;  3EX9 A;  3NQY A;  4BL2 A;  2RSX A;  1MNL A;  1MOL A;  5LC7 A;  3LTB A;  1IU7 A;  3BB9 A;  1LVN A;  4GB5 A;  4O02 B;  5JBS A;  3CC7 3;  1B3S A;  3J7Y d;  5D82 A;  3G8Z A;  3OW2 2;  1K9M 4;  1Q82 4;  1I70 A;  1TU5 A;  2L4V A;  1DE3 A;  1RLS A;  6GSP A;  1IK3 A;  5KP1 A;  2CK3 H;  1M1K 4;  1BRK A;  5G1L A;  1N5P A;  1UCJ A;  2XGL A;  3JUQ A;  2XSO B;  3AMO B;  4HVN A;  2BU4 A;  5I97 A;  3F14 A;  5IEN A;  1WMN A;  2F4Y A;  4XB5 A;  2ZHX B;  3GRD A;  3DGO A;  3BNC A;  3SXX A;  4HM8 B;  1ZO2 A;  1NDO B;  2IYJ A;  3JUP A;  4JF8 A;  1S72 3;  3HIG A;  3LH4 A;  1GS3 A;  1LOX A;  2HMN B;  1DMN A;  3D5G A;  1RDS A;  3KSP A;  3B4O A;  1JB4 A;  1JN5 A;  4ILF A;  5ELJ A;  1LNI A;  2MC8 A;  1VQ7 3;  1JB2 A;  1GMP A;  3U97 A;  1V58 A;  2PNC A;  4PEJ A;  1RNB A;  1RGE A;  2OQE A;  1AVL A;  2GEX A;  1IVV A;  3JUM A;  1UW1 A;  2BNG A;  1FGR A;  1WNH A;  3CCV 3;  2BO9 B;  4MJD A;  3SOY A;  1KC8 4;  1LOY A;  1BNR A;  3X3Y A;  4WFO A;  1IT7 A;  1E3R A;  1SII A;  1SPU A;  1IVU A;  5CF2 A;  1W6Y A;  2I9W A;  1CYV A;  1HU9 A;  1LOW A;  2CFD A;  2M7O A;  4LYL B;  5GSP A;  4N6M A;  3DGN A;  2WOF A;  3N8B A;  3UNL A;  4HM5 B;  1LOV A;  4LZI A;  1RGK A;  2WOH A;  4N6V 0;  1KD1 4;  1NNV A;  4N6N B;  1RGG A;  1B27 A;  2WO0 A;  5HGR A;  1B2S A;  5CLK A;  3F7S A;  1B2M A;  4R80 A;  1LQG C;  1G02 A;  4CJN A;  1VQN 3;  1BRJ A;  1ZX2 A;  2FXT A;  1WMO A;  2H0G A;  1ROV A;  1W00 A;  4FCM A;  2Z6B A;  1M90 4;  5DRV A;  3UB1 A;  2KF3 A;  3ALA A;  1UGI A;  1S5A A;  1BNI A;  4JRF A;  1RRL A;  3OWU A;  2CHC A;  2W0Q A;  2ML6 A;  3GAX A;  2FGT A;  3BIR A;  3ZFZ A;  1BAO A;  3K7C A;  1GD4 A;  1BSD A;  2R41 A;  4HM2 B;  1N8Q A;  1B2U A;  2KF4 A;  1VQ6 3;  4HM0 B;  2P0X A;  4NRE A;  2Q07 A;  1T2I A;  1OF5 B;  3LTC A;  2BT3 A;  2RBI A;  3JVC A;  2C4B A;  5IF6 A;  1STD A;  3CCQ 3;  1PU4 A;  4EBG A;  3Q90 A;  2KRT A;  2C10 A;  3FG1 A;  4KFF A;  2STD A;  3FKA A;  4O2H A;  4K1U A;  2QIY A;  3EQQ B;  4HM7 B;  2HMO B;  2LYX A;  3GZX B;  2IA7 A;  2D42 A;  2OCT A;  3CPO A;  3I56 3;  1A90 A;  1VZZ A;  4IIA A;  3H51 A;  1LQM B;  4DKI A;  3FCS B;  1B20 A;  2IY2 A;  3NV0 B;  4R4K A;  3K63 A;  2UUG C;  3PXM A;  4LMI A;  3GZB A;  4LSO A;  4XDW A;  4XM4 A;  1IV7 A;  3HII A;  1O7M B;  1SQW A;  4K90 B;  3ECF A;  1X1W A;  1MWU A;  2GXF A;  3D79 A;  3Q3F A;  1R4C A;  2KAA A;  1A67 A;  1JBR A;  3EB8 A;  1X1X A;  4RNZ A;  5A0O B;  2OTL 3;  2XEP A;  1L5G B;  2AAD A;  4BTX A;  4J8T A;  1A2P A;  3URP A;  2ZA4 A;  5AII A;  3KCH A;  4RNT A;  1JV2 B;  1IDP A;  1C7H A;  3D3L A;  3PCR A;  2P38 A;  1NO3 A;  1QMA A;  3KII A;  1N9J A;  3JUN A;  1FUS A;  1E97 A;  3WDG B;  1I2G A;  1GMQ A;  2R4I A;  3S27 A;  3MPH A;  3GZR A;  1N8R 4;  2JDI H;  4H61 A;  3SX1 A;  4HZB B;  1X1Y A;  1TTO A;  2B1X B;  3A76 A;  4HAA A;  3X40 A;  1VQ8 3;  1BRH A;  3CNX A;  3EN8 A;  2W56 A;  4MEI A;  3CME 3;  2HMJ B;  1Q9E A;  1T3B A;  1BNE A;  3FSD A;  2H0I A;  4FMC A;  1Y4K A;  3L0R A;  4FCJ A;  2CFK A;  2CIU A;  1TFK A;  4BTY A;  3NXJ A;  1Q40 B;  1JN5 B;  1UUG B;  4ZM8 A;  1QAK A;  2W6J H;  2ZDJ A;  1BNS A;  2BMR B;  3FG3 A;  1FW7 A;  1K28 A;  3DY5 A;  3DUK A;  3G16 A;  5DRE A;  1YJW 3;  1G96 A;  1DYU A;  2KCD A;  4WWU C;  3WA3 A;  4J9A A;  4FMD A;  3KSE D;  3NQZ A;  1OHS A;  5EEO A;  1RCL A;  4GL6 A;  5JPU A;  2XRX B;  3ER7 A;  2GBW B;  1GY6 A;  1UUV B;  4CDL A;  3NM7 A;  4WP5 A;  1N9E A;  1O7H B;  1OAC A;  1RHL A;  1W2Z A;  2XFT A;  3CU3 A;  1QJG A;  3K5T A;  4OVM A;  1BSB A;  5M1A A;  5BIR A;  1YIT 3;  1NB5 I;  2CX0 A;  1G0T A;  3FGY A;  5AI1 A;  3Q1C A;  2IMJ A;  3IJE B;  3KZT A;  1DVC A;  2F99 A;  3I0Y A;  1CEW I;  3T0U A;  3DXO A;  1FGT A;  1RGC A;  1GY5 A;  1DMQ A;  3AHW A;  1KQS 2;  3T8U A;  5AEW B;  1BUJ A;  4K1V A;  3FH1 A;  4K61 A; 
#chains in the Genus database with same CATH homology
 4EV2 A;  1Q7Y 4;  1FUW A;  3T8N A;  1LNH A;  1OHP A;  1PFP A;  1RJO A;  1IQY A;  1TIJ A;  4MMY B;  1CYU A;  1O7G B;  5D81 A;  4X2H A;  1D6Y A;  1JRQ A;  5CF1 A;  1JNQ A;  2XGN A;  1YIJ 3;  2GU1 A;  2QGU A;  2GEY A;  4WYK A;  2WGO A;  2Z77 A;  2E2U A;  3MSO A;  3X3X A;  3RGR A;  3UL5 A;  5FGO A;  2LQV A;  4KFD A;  3F8H A;  1O7W B;  1K8A 4;  2YFL B;  3EC9 A;  3UL6 A;  3CCQ 3;  5EVH A;  3CC2 3;  3CNM A;  4IPB A;  4QWT A;  3UJM A;  3STD A;  3CCR 3;  3CCM 3;  1O7N B;  5AEU B;  4Q53 A;  3S67 A;  3RDE A;  3PYJ A;  4I4K A;  4O3V A;  1IVX A;  3AMO A;  3N9H A;  4R9L A;  5D83 A;  3DZL A;  5ELU A;  2CWT A;  3NBR A;  3BNB A;  3CCS 3;  3NHX A;  1VQP 3;  1YJN 3;  4STD A;  4HZ9 B;  2JQ5 A;  3NBJ A;  1N5H A;  2RFR A;  1NWW A;  3LTA A;  1ULI B;  1TUH A;  3F9S A;  4KFE A;  4MMZ B;  2CW9 A;  2ML5 A;  4AKZ A;  1ULJ B;  3CD6 3;  3DM8 A;  5AIH A;  5IG0 A;  3I55 3;  2WGQ A;  1KWI A;  1IV9 A;  3PS8 A;  4XBY A;  1JKG B;  3VGN A;  1SJW A;  3F7X A;  1VQL 3;  3OV4 A;  2CG1 A;  5CXO A;  2BMQ B;  1OGZ A;  1EA2 A;  3OXA A;  2P05 A;  3LT8 A;  2W56 B;  3B8L A;  4N6T A;  3CCJ 3;  1W2B 2;  4N6U A;  2E2T A;  3FLJ A;  1UUW B;  2XR8 B;  1GY7 A;  1UI7 A;  2V1L A;  3CPW 2;  3G0K A;  1RRH A;  3QK9 A;  2E2V A;  4L8O A;  2F86 B;  2OOV C;  3D9R A;  3LYG A;  4L8P A;  3ROB A;  3CCE 3;  2P09 A;  1W7C A;  2RCD A;  3B7C A;  1ROA A;  1T5Y A;  1QVF 2;  1IVW A;  2XFS A;  3LZA A;  3K9M C;  1VQ9 3;  2B24 B;  2CWV A;  4EC6 A;  3U1W A;  3NM2 A;  2HML B;  3CCL 3;  2BHM A;  3X3Z A;  1K73 4;  3HK4 A;  4EYC A;  2P0M A;  3VSY A;  4U13 A;  2RGQ A;  4HJL B;  2O3O A;  4FMB A;  1OPY A;  1WTH A;  3KN4 A;  2HMK B;  2A15 A;  3LML A;  3MHE A;  1OUN A;  3EF8 A;  6STD A;  5IER A;  2YFI B;  1AV4 A;  8CHO A;  3HI7 A;  3WOF B;  5IG4 A;  3DMC A;  3G4S 3;  2XSH B;  1M9G A;  3EBT A;  3G6E 3;  1Q86 4;  1VQ5 3;  3GZY B;  3BLZ A;  3KKG A;  4RZM A;  3NBB A;  4EXR A;  5AIG A;  2CC3 A;  5IG3 A;  4HM6 B;  5KP3 A;  3CXC 2;  3Q2P A;  1UI8 A;  3NV0 A;  1D6Z A;  4WYK B;  5IEP A;  1YJ9 3;  4HKV B;  3F40 A;  4MMX B;  2K54 A;  3IPT A;  4ORL A;  3CC4 3;  4TX4 A;  1A2K A;  2OQE C;  1ISK A;  3FF2 A;  3HZP A;  3S28 A;  3MG1 A;  4KZ1 A;  1YHQ 3;  2Y73 A;  3MG2 A;  4AEQ A;  1GYB A;  3LT9 A;  1KSI A;  4LEH A;  1W6G A;  2CKF B;  1O7P B;  1QVG 2;  1W6C A;  2ZL8 A;  1GD3 A;  3EJV A;  3EHC A;  1OCV A;  5KP4 A;  1IQ8 A;  1F8N A;  3HX8 A;  1NJI 4;  3NUV A;  4R9K A;  5EQL A;  4G1M B;  2SBL A;  5IW9 A;  1QAL A;  1W01 A;  5AYR B;  3CMA 3;  1BUQ A;  4BTW A;  4HBR A;  2QEX 3;  1M1X B;  3F8X A;  2INX A;  5AIF A;  1QAF A;  2F98 A;  4KVH A;  1W02 A;  3MYT A;  4XBX A;  5AYS C;  2W03 A;  3MG3 A;  3S29 A;  4HM4 B;  1Q40 A;  3FG4 A;  3PCS A;  1RKY A;  3BNE A;  3DGM A;  4XDV A;  3NX0 A;  1YGE A;  1W5Z A;  1U5O A;  5LC6 A;  5G2G A;  1OGX A;  1VQO 3;  1VQM 3;  1FGM A;  4RBN A;  1FGQ A;  1WQL B;  3LTD A;  1OHO A;  1DVD A;  5IEO A;  4L7K A;  1Q81 4;  3OWS A;  3WOE B;  3TDG A;  2QA4 3;  2KXG A;  2CH9 A;  2IUJ A;  2Z76 A;  3FF0 A;  1E3V A;  2XF3 A;  3EN1 B;  5FW5 A;  1EQK A;  3GWR A;  1DMM A;  3FZW A;  2GBX B;  4X2O A;  1TFO A;  3WOD G;  3B4P A;  1VQ4 3;  5JPP A;  1EKM A;  2OWP A;  3SOA A;  4EV5 A;  1V74 A;  3VF1 A;  1TP6 A;  1RN7 A;  1JJ2 2;  1ASK A;  4OUQ A;  1SIH A;  3V92 A;  3LOY A;  2PZV A;  2GU3 A;  2C11 A;  1YI2 3;  1NB3 I;  3PGB A;  3X42 A;  7STD A;  4WHA A;  3OX9 A;  3EBY A;  3X41 A;  1Q42 A;  4FCZ A;  4LGQ A;  2XH9 A;  3WMD A;  1K41 A;  2IUK A;  2Y74 A;  3G71 3;  3QRD A;  5TGN A;  1Z1S A;  3N54 B;  2W9P A;  3K0Z A;  2Z7A A;  3EE1 A;  3PZW A;  4N6L A;  1FA3 A;  1STF I;  2W04 A;  3MWZ A;  3S5C A;  5BVB A;  5STD A;  2FNQ A;  2CFL A;  4HM3 B;  4O8S A;  3SLU A;  3V99 A;  2CG0 A;  1IQX A;  3SVA A;  2OTJ 3;  2YX9 A;  2BMO B;  2O9U X;  3JUO A;  3KE7 A;  3M8C A;  3WA2 X;  3H3H A;  3BND A;  1AVK A;  3KFQ C;  4N6O B;  1A2V A;  4R1K A;  2CWU A;  1D6U A;  1J2B A;  3IMA B;  2UX0 A;  4H3U A;  1EG9 B;  4AKY A;  4HM1 B;  3E99 A;  1LXE A;  1US1 A;  1U8C B;  1YVB I;  4RNY A;  2W2C A;  1OH0 A;  1OF5 A;  5BXQ A;  1IT8 A;  1W4N A;  2W9Q A;  4NHF A;  3MKI A;  4CCV A;  3SED A;  1HKX A;  4FR9 A;  4HYZ A;  3V98 A;  2YFJ B;  1FGO A;  2HMM B;  2CFW A;  4N3V A;  1NU3 A;  1WMP A;  1JKG A;  1CQS A;  3LXU X;  3OWY A;  4FMA A;  2OOV A;  3RGA A;  2D1W A;  4XBT A;  2MF7 A;  2CFG A;  1AR0 A;  4IT7 A;  3DGL A;  2K0M A;  1VQK 3;  3O8Y A;  4OK0 A;  5CK6 A;  3CCU 3;  1JB5 A;  3EX9 A;  3NQY A;  2RSX A;  1MNL A;  1MOL A;  5LC7 A;  3LTB A;  1IU7 A;  3BB9 A;  1LVN A;  4GB5 A;  4O02 B;  5JBS A;  3CC7 3;  3J7Y d;  5D82 A;  3G8Z A;  3OW2 2;  1K9M 4;  1Q82 4;  1TU5 A;  2L4V A;  1IK3 A;  5KP1 A;  2CK3 H;  1M1K 4;  1N5P A;  2XGL A;  3JUQ A;  2XSO B;  3AMO B;  4HVN A;  5I97 A;  3F14 A;  5IEN A;  1WMN A;  4XB5 A;  3GRD A;  3DGO A;  3BNC A;  3SXX A;  4HM8 B;  1ZO2 A;  1NDO B;  3JUP A;  4JF8 A;  1S72 3;  3HIG A;  3LH4 A;  1GS3 A;  1LOX A;  2HMN B;  1DMN A;  3KSP A;  3B4O A;  1JB4 A;  1JN5 A;  2MC8 A;  5ELJ A;  1VQ7 3;  1JB2 A;  3U97 A;  2PNC A;  4PEJ A;  2OQE A;  1AVL A;  2GEX A;  1IVV A;  3JUM A;  1UW1 A;  2BNG A;  1FGR A;  1WNH A;  3CCV 3;  2BO9 B;  4MJD A;  3SOY A;  1KC8 4;  3X3Y A;  4WFO A;  1IT7 A;  1E3R A;  1SII A;  1SPU A;  1IVU A;  5CF2 A;  1W6Y A;  2I9W A;  1CYV A;  1HU9 A;  2CFD A;  2M7O A;  4N6M A;  3DGN A;  2WOF A;  3N8B A;  3UNL A;  4HM5 B;  4LZI A;  2WOH A;  4N6V 0;  1KD1 4;  4N6N B;  2WO0 A;  5HGR A;  5CLK A;  3F7S A;  4R80 A;  1VQN 3;  1ZX2 A;  2FXT A;  1WMO A;  1ROV A;  1W00 A;  4FCM A;  2Z6B A;  1M90 4;  5DRV A;  3UB1 A;  3ALA A;  1S5A A;  4JRF A;  1RRL A;  3OWU A;  2CHC A;  2W0Q A;  2ML6 A;  3GAX A;  2FGT A;  3K7C A;  1GD4 A;  4HM2 B;  1N8Q A;  1VQ6 3;  4HM0 B;  2P0X A;  4NRE A;  2Q07 A;  1OF5 B;  3LTC A;  2BT3 A;  3JVC A;  5IF6 A;  1STD A;  1PU4 A;  4EBG A;  3Q90 A;  2KRT A;  2C10 A;  3FG1 A;  4KFF A;  2STD A;  3FKA A;  4O2H A;  4K1U A;  2QIY A;  3EQQ B;  4HM7 B;  2HMO B;  2LYX A;  3GZX B;  2IA7 A;  2D42 A;  2OCT A;  3CPO A;  3I56 3;  1A90 A;  1VZZ A;  4IIA A;  3H51 A;  3FCS B;  3NV0 B;  4R4K A;  3K63 A;  3PXM A;  4LMI A;  3GZB A;  4LSO A;  4XDW A;  4XM4 A;  1IV7 A;  3HII A;  1O7M B;  1SQW A;  4K90 B;  3ECF A;  2GXF A;  1R4C A;  1A67 A;  3EB8 A;  4RNZ A;  2OTL 3;  5A0O B;  2XEP A;  1L5G B;  4BTX A;  4J8T A;  5AII A;  1JV2 B;  1IDP A;  1C7H A;  3D3L A;  3PCR A;  2P38 A;  1NO3 A;  1QMA A;  3KII A;  1N9J A;  3JUN A;  1E97 A;  3WDG B;  2R4I A;  3S27 A;  3MPH A;  3GZR A;  1N8R 4;  2JDI H;  4H61 A;  3SX1 A;  4HZB B;  2B1X B;  3X40 A;  1VQ8 3;  3A76 A;  3CNX A;  3EN8 A;  2W56 A;  4MEI A;  3CME 3;  2HMJ B;  3FSD A;  4FMC A;  1Y4K A;  3L0R A;  4FCJ A;  2CFK A;  2CIU A;  1TFK A;  4BTY A;  3NXJ A;  1Q40 B;  1JN5 B;  4ZM8 A;  1QAK A;  2W6J H;  2ZDJ A;  2BMR B;  3FG3 A;  1K28 A;  3DY5 A;  3DUK A;  3G16 A;  5DRE A;  1YJW 3;  1G96 A;  1DYU A;  2KCD A;  4WWU C;  3WA3 A;  4J9A A;  4FMD A;  3KSE D;  3NQZ A;  1OHS A;  5EEO A;  4GL6 A;  5JPU A;  2XRX B;  3ER7 A;  2GBW B;  1GY6 A;  1UUV B;  4CDL A;  3NM7 A;  4WP5 A;  1N9E A;  1O7H B;  1OAC A;  1W2Z A;  2XFT A;  3CU3 A;  3K5T A;  1QJG A;  1YIT 3;  4OVM A;  1NB5 I;  3FGY A;  5AI1 A;  3Q1C A;  2IMJ A;  3IJE B;  3KZT A;  1DVC A;  2F99 A;  3I0Y A;  1CEW I;  3T0U A;  3DXO A;  1FGT A;  5IG5 A;  1GY5 A;  1DMQ A;  1KQS 2;  3T8U A;  5AEW B;  4K1V A;  3FH1 A;  4K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...