2ML5A

Nmr structure of protein zp_02064002.1 from bacteroides ovatus atcc 8483
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
GDSELTTQDGEDFKSFLDKFTSSAAFQYTRVKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERITQEEGGIYVSKFTLNEPKHKIFEAGYEESEVDLRVEFELQADGKWYVVDCYTGWYGYDLPIGELKQTIQNVKEENAAFKEIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of protein ZP_02064002.1 from Bacteroides ovatus ATCC 8483
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ml5A00
4R4KA 2ML6A 2ML5A
chains in the Genus database with same CATH superfamily
1OPYA 1JNQA 1X1XA 2KXGA 3NHXA 3FSDA 1A2VA 2IA7A 4HM7B 3CC73 1JJ22 3KE7A 1FGMA 2J8XB 4L7KA 3CCJ3 4N6MA 4L8PA 2ZHXB 2XSHB 4FCMA 3FLJA 3BIRA 3X3XA 2IYJA 2B24B 1OGZA 1IK3A 2F99A 2HOHA 4RBNA 1BOXA 3KIIA 4FMAA 2W0QA 1IVXA 2GBXB 2RBIA 3NBRA 1V57A 5IEOA 3T8NA 2OTL3 1HZ1A 1VQ43 1RGHA 1B27A 5KP4A 2CWVA 3EJVA 1LOWA 1M9GA 1Q40A 1I8VA 1BSBA 4X2OA 3KN4A 2A15A 4CDLA 2YFJB 2GXFA 1KD14 3BU4A 2F98A 4LEHA 5EVHA 1W5ZA 2YFLB 3K9MC 3WHOA 1BSDA 1LQGC 5IG5A 1BNSA 1JZOA 2P05A 3ECFA 2XR8B 4O8SA 1CYVA 1RGAA 4OK0A 3X3ZA 5CF1A 4XDVA 1YIJ3 4HOHA 3J7Yd 2CK3H 1GOYA 1T3BA 4FMCA 3ER7A 1BNEA 3GWRA 1BUQA 1EA2A 4XB5A 4HKVB 5D81A 3OXAA 3GRDA 3DXOA 2QEX3 4EBGA 2STDA 2UX0A 3F40A 3STDA 3T0UA 4XBTA 1RNTA 3NM7A 2F5WA 3EF8A 4PEJA 5KP1A 1D6UA 3CCE3 2WOFA 1WMPA 3B8LA 2LYXA 1JRQA 1UGHI 2GBWB 3FF0A 1Q864 1SQWA 3F7XA 3K63A 1I0VA 4LGQA 1W6GA 1OH0A 2SARA 1YGWA 1HYFA 4HBRA 1BGSA 4OVMA 1SARA 1IVUA 3LMLA 1B21A 3JUMA 3V99A 1VQK3 3LOYA 1GYBA 3D3LA 1WMOA 2P0MA 1OACA 3N54B 1YJN3 5G2GA 2XEPA 1IQXA 1BRHA 2CH9A 3EB8A 4IPBA 1LQMB 4CJNA 1YVSA 5JBSA 1TFKA 1M1XB 4NPBA 3X40A 3CCS3 3IPTA 1RRHA 3Q2PA 3F9SA 1YVBI 3OV4A 3MG1A 4XBXA 1VQP3 1GD3A 1BNGA 1RGLA 1FGTA 1RCLA 4R80A 1AQZA 1N9EA 1GOVA 3RGRA 2IUJA 1CQSA 2OOVC 2XFTA 3DGMA 1DMNA 2CG1A 3AMOA 3FZWA 1BNIA 1C54A 4I4KA 1LOYA 3CNMA 3JUQA 4BL2A 1O7MB 2BMQB 5FW5A 1NU3A 1ROAA 5M1AA 1A2KA 4BTWA 1BIRA 1RN7A 1X1YA 1B2SA 1STFI 4R4KA 3CCV3 3WOFB 3LXUX 2XH9A 1BVIA 1I70A 2W9PA 1RLSA 3VSYA 2IMJA 1WQLB 1RGGA 4RNZA 3MYTA 4K1VA 6GSPA 1N5PA 2IUKA 1JB4A 2Z6BA 3EC9A 3SEDA 3D5GA 1UI8A 1GY6A 2Z77A 2CFKA 2W6JH 1ZS7A 2Y73A 1JBRA 2BNGA 3PXMA 5BVBA 2RCDA 5D82A 1RJOA 3A5EA 3I0YA 4N3VA 1K28A 1RGCA 3HOHA 5JPUA 1B20A 1BSAA 1M904 1B2XA 2ML6A 1IQYA 4HYZA 2IY2A 1UCIA 3FG3A 1BRJA 2GEXA 4K1UA 2W2CA 3JUPA 4CPKA 1BUJA 1BRSA 4N6NB 2Y74A 1G96A 4BU4A 1A90A 1EG9B 3F8HA 1FZUA 1NWWA 5CXOA 1FW7A 1W6CA 3EBYA 1W2ZA 1SPUA 1BSCA 1UCLA 3EE1A 1GS3A 3RGAA 3UNLA 5CF2A 4QWTA 3BNBA 2R41A 4JRFA 1LOVA 1E97A 4GHOA 3Q1CA 1IV9A 4J8TA 1Q40B 4N6UA 5HOHA 1RRLA 1DE3A 1Q7HA 1UW1A 2CG0A 2RSXA 5AEWB 3MPHA 3S29A 5FGOA 1A2PA 1KWIA 3WOEB 1NJI4 4FMDA 1K8A4 1YHQ3 4G1MB 1L5GB 4H3UA 2UUGC 1U5OA 3PZWA 3H51A 2E2TA 1N5HA 1NNVA 5DREA 1Q9EA 1FUSA 1Q42A 1DVDA 3FCSB 1RGEA 3KKGA 4HJLB 3MWZA 1DYUA 1ZX2A 5M19A 1JBTA 1BNRA 4HM0B 2WGOA 1RNBA 1FGRA 1B2UA 1IT7A 2M7OA 4LMIA 1V58A 2CWTA 2FNQA 4MMYB 4WYKB 3UJMA 3X42A 1FYSA 3WR2A 1U8CB 2K3DA 2O9UX 5G1KA 3HIGA 3L0RA 3LYGA 4N6TA 3UB1A 4WYKA 1B2MA 5IW9A 1IDPA 3NXJA 3DY5A 1CH0A 4HM5B 3HIIA 3GZBA 2CKFB 1E3VA 2L4VA 4O2HA 9RNTA 1DVCA 3AGOA 1BU4A 3LTCA 3G0KA 4AKYA 1TU5A 1LXEA 1BRKA 2BT3A 2XGLA 1LOXA 3MG3A 1ISKA 2C4BA 4R9LA 3CC23 1W02A 3TDGA 1VQ53 1QAKA 1BNJA 2F5MA 3LT9A 3K7CA 2WO0A 5AIIA 1O7WB 2F86B 2KRTA 3PYJA 1DMQA 3EBTA 2JDIH 3EHCA 4IIAA 6STDA 1RKYA 2H0IA 1UUVB 2W9QA 2OQEA 3SOYA 3LTAA 5BU4A 2CHCA 2H0HA 5IERA 2FXTA 3BLZA 1YI23 7GSPA 3BNDA 3JUOA 5LC7A 3CCQ3 2OWPA 3WA2X 1G0TA 3ZFZA 2BU4A 5AIHA 3B4OA 1UI7A 2XFSA 3NBBA 4H61A 5G1LA 1I2EA 1JN5A 2KAAA 3Q90A 4Q53A 3M8CA 2XGNA 1JV2B 2XSOB 3T8UA 3SLUA 5STDA 1Q7Y4 4OUQA 1JN5B 4BIRA 1K734 3UL5A 1MWSA 1NB5I 3ZG0A 1ASKA 3LZAA 3SOAA 3WA3A 2F56A 3K5TA 1Z1SA 2YX9A 3EN8A 3NX0A 2XRXB 4KVHA 1CYUA 2SBLA 4J9AA 3MHEA 1SIHA 4WHAA 2OCTA 1HU9A 1IVWA 5HGRA 1E3RA 1T5YA 2AAEA 1QJGA 2KCDA 3CC43 3DH2A 3KSPA 4EXRA 1YJ93 1W4NA 1MGWA 4HM6B 3G6E3 2W04A 3WMDA 2QGUA 3JUNA 1VQL3 1O7GB 3CPOA 1OF5A 2YFIB 1GY7A 2KF3A 7STDA 1RGKA 3PCRA 5ELJA 3NM2A 4ZM8A 1WTHA 5I97A 1RMSA 3VGNA 2BHMA 2CX1A 5M18A 4K90B 1VQ83 1KSIA 3HZPA 4XBYA 1QVG2 5BIRA 2HMLB 5JPPA 3FF2A 2CFWA 5EEOA 4BL3A 1DMMA 1VQQA 1W2B2 1J2BA 3EN1B 1QVF2 1OUNA 2OQEC 3DM8A 4HAAA 4EV5A 3AHSA 1FUTA 1QAFA 5TGNA 3KSED 4EYCA 3CD63 3KFQC 1FGQA 3GZXB 4MMXB 1T2HA 3I553 1LRAA 2CFDA 4EV2A 3FH1A 3WODG 3H3HA 4HM4B 4KT3B 1C7HA 4HZBB 2BIRA 1JZDA 1LNIA 3DGNA 3B4PA 3VF1A 1GMPA 4KFEA 1W6YA 1GY5A 2V1LA 1OGXA 1F8NA 1SIIA 5EQLA 1AR0A 4N6V0 2RNTA 5BXQA 4GB5A 4MEIA 2H0GA 1SJWA 1MNLA 1R4YA 2JQ5A 1VQM3 1O7HB 3G16A 2OTJ3 1NO3A 3SXXA 3RNTA 3PGBA 3CXC2 1OHSA 1RSNA 1BSEA 1O7PB 1I3IA 3DZLA 3CMA3 2O3OA 1ULJB 1Q824 1MOLA 1T2IA 2CC3A 7RNTA 1YNVX 1RDSA 2MF7A 1IYYA 1W00A 4LYLB 1WNHA 2XF3A 4HVNA 1RN4A 3LTBA 1EQKA 2FGTA 3U97A 3V92A 4MJDA 1EEJA 1JB5A 1OF5B 1IT8A 3SYUA 5DRVA 1MWTA 4L8OA 2ML5A 4FR9A 3CCM3 1I2FA 4CCVA 1BAOA 4GSPA 3HI7A 1JKGA 1QMAA 2P38A 3CME3 1R4CA 4N6LA 1GSPA 2Z76A 3G8ZA 4KZ1A 4AKZA 3HX8A 2WGQA 1BRNL 4IT7A 2C11A 4N6OB 1GMRA 3FG1A 4LSOA 5AYRB 1MWUA 3BB9A 2E2VA 3OWSA 1UUWB 3S28A 1I0XA 2P0XA 4HZ9B 1X1WA 4WP5A 4RNYA 2GU1A 5AIFA 3GSPA 1IQ8A 3F8XA 3X3YA 1V74A 2HMOB 3MSOA 2W56B 4XM4A 1VQN3 3MKIA 3ROBA 1RTUA 1UCJA 1NDOB 4RZMA 1UDII 2CFLA 3X41A 5LC6A 3O8YA 3CU3A 1GD4A 4ILFA 2Z7AA 4MMZB 8CHOA 2BO9B 4WFOA 2CFGA 2ZDJA 3AMOB 1S723 2HMMB 5AYSC 1W01A 1Y4KA 1ZGXA 5A0OB 1N8QA 3OW22 4DKIA 1QALA 1RCKA 3S67A 2WOHA 1TFOA 3IJEB 2C10A 2HMNB 1D6ZA 4FMBA 3HK4A 3SVAA 1TTOA 4HM8B 3F14A 3RDEA 1ULIB 3CCL3 1STDA 2I9WA 1AY7A 1UUGB 3A76A 3OX9A 3CPW2 2CX0A 3LT8A 3UL6A 1K9M4 1US1A 3NV0A 1YGEA 3DGYA 1BRGA 1OHPA 1WMNA 3LH4A 1RN1A 4NREA 1FUWA 2W56A 6RNTA 4J5GA 5CLKA 1D6YA 5ELUA 2B1XB 2L1SA 3ZG5A 1ZO2A 2BMRB 1K41A 3GZRA 2CIUA 3MG2A 1JBSA 1TRPA 2KF4A 1B2ZA 4TX4A 3B7CA 1KQS2 2D1WA 1UGIA 1PY3A 1IVVA 2UGIA 1O7NB 1TUHA 1Q814 1JKGB 3JVCA 1BRIA 3IMAB 2F4YA 4XDWA 8RNTA 2OOVA 1VQ93 3G713 1GOUA 3N8BA 3SX1A 4EC6A 1TJDA 3G4S3 5CK6A 2GSPA 3N9HA 1M1K4 1I2GA 5AEUB 3KZTA 3CNXA 2PZVA 3I563 4R9KA 3FKAA 4LZIA 3S5CA 5IF6A 3BNEA 2RFRA 2AADA 2KF5A 3E99A 1W7CA 3NBJA 1VQ73 3DUKA 1LVNA 3URPA 4X2HA 1OCVA 1LNHA 1DETA 5D83A 3D9RA 1UCKA 3KCHA 1VQO3 4EW5A 1PFPA 3OWYA 2K0MA 4HM1B 4ORLA 1AVLA 5RNTA 3CCR3 4BTYA 4FCZA 2CWUA 1MGRA 2KF6A 3GAXA 3NQZA 3FG4A 3LTDA 2ZL8A 4I5QA 1GMQA 1N9JA 1FGOA 4BTXA 3ALAA 4NHFA 3NV0B 1OHOA 3DGLA 1A67A 5IENA 2K54A 4U13A 4R1KA 3V98A 1AVKA 1AV4A 3AGNA 3GZYB 3WDGB 3EQQB 2CW9A 1RGFA 2ZA4A 1BNFA 2INXA 1G02A 1NB3I 3NUVA 4O3VA 1VQ63 1I3FA 1HKXA 2R4IA 1PU4A 5IG0A 3QRDA 1EUIC 4FCJA 1BANA 2W03A 2P09A 4HM3B 3OWUA 2HMKB 2LQVA 3S27A 4HM2B 1MWRA 2RGQA 4AEQA 1X1UA 2QIYA 1YIT3 2HMJB 3D79A 4J5KA 4WWUC 2MC8A 1IV7A 3U1WA 1KC84 3K0ZA 5IG3A 3DGOA 3D5IA 1IU7A 4O02B 2PNCA 5IG4A 1TRQA 1ROVA 5IEPA 2BMOB 3DMCA 3Q3FA 5GSPA 1N8R4 5AIGA 3BNCA 3F7SA 1PYLA 2GEYA 3PCSA 3D4AA 4KFFA 5KP3A 4GL6A 2GU3A 5AI1A 3AHWA 3PS8A 1VZZA 2QA43 3NQYA 2Q07A 1YJW3 1FA3A 4STDA 4KFDA 3QK9A 2E2UA 1S5AA 1TP6A 1TIJA 3CCU3 4RNTA 1EKMA 1RHLA 1JB2A 3EX9A 2D42A 4K61A 1CEWI 1B3SA 3FGYA 4JF8A
chains in the Genus database with same CATH topology
1OPYA 1JNQA 2KXGA 3NHXA 3FSDA 1A2VA 2IA7A 4HM7B 3CC73 1JJ22 3KE7A 1FGMA 4L7KA 3CCJ3 4N6MA 4L8PA 2XSHB 4FCMA 3FLJA 3X3XA 1IK3A 2B24B 1OGZA 2F99A 4RBNA 3KIIA 4FMAA 2W0QA 1IVXA 2GBXB 3NBRA 5IEOA 3T8NA 2OTL3 1VQ43 5KP4A 2CWVA 3EJVA 1M9GA 1Q40A 4X2OA 3KN4A 2A15A 4CDLA 2YFJB 2GXFA 1KD14 2F98A 4LEHA 5EVHA 1W5ZA 2YFLB 3K9MC 5IG5A 2P05A 3ECFA 2XR8B 4O8SA 1CYVA 4OK0A 3X3ZA 5CF1A 4XDVA 1YIJ3 3J7Yd 2CK3H 4FMCA 3ER7A 3GWRA 1BUQA 1EA2A 4XB5A 4HKVB 5D81A 3OXAA 3GRDA 3DXOA 2QEX3 4EBGA 2STDA 2UX0A 3F40A 3STDA 3T0UA 4XBTA 3NM7A 4PEJA 3EF8A 5KP1A 1D6UA 3CCE3 2WOFA 1WMPA 3B8LA 2LYXA 1JRQA 2GBWB 3FF0A 1Q864 1SQWA 3F7XA 3K63A 4LGQA 1W6GA 1OH0A 4HBRA 4OVMA 1IVUA 3LMLA 3JUMA 3V99A 1VQK3 3LOYA 3D3LA 1GYBA 1WMOA 2P0MA 1OACA 3N54B 1YJN3 5G2GA 2XEPA 1IQXA 2CH9A 3EB8A 4IPBA 5JBSA 1TFKA 1M1XB 3X40A 3CCS3 3IPTA 1RRHA 3Q2PA 3F9SA 1YVBI 3OV4A 3MG1A 4XBXA 1VQP3 1GD3A 1FGTA 4R80A 1N9EA 3RGRA 2IUJA 1CQSA 2OOVC 2XFTA 3DGMA 1DMNA 2CG1A 3AMOA 3FZWA 4I4KA 3CNMA 3JUQA 1O7MB 2BMQB 5FW5A 1NU3A 1ROAA 1A2KA 4BTWA 1RN7A 1STFI 4R4KA 3CCV3 3WOFB 3LXUX 2XH9A 2W9PA 3VSYA 2IMJA 1WQLB 4RNZA 3MYTA 4K1VA 1N5PA 2IUKA 1JB4A 2Z6BA 3EC9A 3SEDA 1UI8A 1GY6A 2Z77A 2CFKA 2W6JH 2Y73A 2BNGA 3PXMA 5BVBA 2RCDA 5D82A 1RJOA 3I0YA 4N3VA 1K28A 5JPUA 1M904 2ML6A 1IQYA 4HYZA 3FG3A 2GEXA 4K1UA 2W2CA 3JUPA 4N6NB 2Y74A 1G96A 1A90A 1EG9B 3F8HA 1NWWA 5CXOA 1W6CA 3EBYA 1W2ZA 1SPUA 3EE1A 3RGAA 1GS3A 5CF2A 3UNLA 4QWTA 3BNBA 4JRFA 1E97A 4N6UA 3Q1CA 1IV9A 4J8TA 1Q40B 1RRLA 1UW1A 2CG0A 2RSXA 5AEWB 3MPHA 3S29A 5FGOA 1NJI4 1KWIA 3WOEB 4FMDA 1K8A4 1YHQ3 4G1MB 1L5GB 4H3UA 1U5OA 3PZWA 3H51A 2E2TA 1N5HA 5DREA 1Q42A 1DVDA 3FCSB 3KKGA 4HJLB 3MWZA 1DYUA 1ZX2A 4HM0B 2WGOA 1FGRA 1IT7A 2M7OA 4LMIA 4MMYB 2CWTA 2FNQA 4WYKB 3UJMA 3X42A 1U8CB 2O9UX 3HIGA 3L0RA 3LYGA 4N6TA 3UB1A 4WYKA 5IW9A 1IDPA 3NXJA 3DY5A 4HM5B 3HIIA 3GZBA 2CKFB 1E3VA 2L4VA 4O2HA 1DVCA 3LTCA 3G0KA 4AKYA 1TU5A 1LXEA 2BT3A 2XGLA 1LOXA 3MG3A 1ISKA 4R9LA 3CC23 1W02A 3TDGA 1VQ53 1QAKA 3LT9A 3K7CA 2WO0A 5AIIA 1O7WB 2F86B 2KRTA 3PYJA 1DMQA 3EBTA 2JDIH 3EHCA 4IIAA 6STDA 1RKYA 1UUVB 2W9QA 2OQEA 3SOYA 3LTAA 2CHCA 5IERA 2FXTA 3BLZA 1YI23 3BNDA 3JUOA 5LC7A 3CCQ3 2OWPA 3WA2X 5AIHA 3B4OA 1UI7A 2XFSA 3NBBA 4H61A 1JN5A 3Q90A 4Q53A 3M8CA 2XGNA 1JV2B 2XSOB 3T8UA 3SLUA 5STDA 1Q7Y4 4OUQA 1JN5B 1K734 3UL5A 1NB5I 1ASKA 3LZAA 3SOAA 3WA3A 3K5TA 1Z1SA 2YX9A 3EN8A 3NX0A 2XRXB 4KVHA 1CYUA 2SBLA 4J9AA 3MHEA 1SIHA 4WHAA 2OCTA 1HU9A 1IVWA 5HGRA 1E3RA 1T5YA 2KCDA 1QJGA 3CC43 3KSPA 4EXRA 1YJ93 1W4NA 4HM6B 3G6E3 2W04A 3WMDA 2QGUA 3JUNA 1VQL3 1O7GB 3CPOA 1OF5A 2YFIB 1GY7A 7STDA 3PCRA 5ELJA 3NM2A 4ZM8A 1WTHA 5I97A 3VGNA 1VQ83 2BHMA 4K90B 1KSIA 3HZPA 4XBYA 1QVG2 2HMLB 5JPPA 3FF2A 2CFWA 5EEOA 1DMMA 1W2B2 1J2BA 3EN1B 1QVF2 1OUNA 2OQEC 3DM8A 4EV5A 1QAFA 5TGNA 3KSED 4EYCA 3CD63 3KFQC 1FGQA 3GZXB 4MMXB 3I553 2CFDA 4EV2A 3FH1A 3WODG 3H3HA 4HM4B 1C7HA 4HZBB 3DGNA 3VF1A 3B4PA 4KFEA 1W6YA 1GY5A 2V1LA 1OGXA 1F8NA 1SIIA 5EQLA 1AR0A 4N6V0 5BXQA 4GB5A 4MEIA 2JQ5A 1SJWA 1MNLA 1VQM3 2OTJ3 1O7HB 3G16A 1NO3A 3SXXA 3CXC2 3PGBA 1OHSA 1O7PB 3DZLA 3CMA3 2O3OA 1ULJB 1Q824 1MOLA 2CC3A 2MF7A 1W00A 1WNHA 2XF3A 4HVNA 3LTBA 1EQKA 2FGTA 3U97A 3V92A 4MJDA 1JB5A 1OF5B 1IT8A 5DRVA 4L8OA 2ML5A 4FR9A 3CCM3 4CCVA 3HI7A 1JKGA 1QMAA 2P38A 3CME3 1R4CA 4N6LA 4AKZA 2Z76A 3G8ZA 4KZ1A 3HX8A 2WGQA 4IT7A 2C11A 4N6OB 3FG1A 4LSOA 5AYRB 3BB9A 2E2VA 3OWSA 1UUWB 3S28A 2P0XA 4HZ9B 4WP5A 4RNYA 2GU1A 5AIFA 3X3YA 1IQ8A 3F8XA 1V74A 2HMOB 3MSOA 2W56B 4XM4A 1VQN3 3MKIA 3ROBA 1NDOB 4RZMA 2CFLA 3X41A 5LC6A 3O8YA 3CU3A 1GD4A 2Z7AA 4MMZB 8CHOA 2BO9B 4WFOA 2CFGA 2ZDJA 3AMOB 1S723 2HMMB 5AYSC 1W01A 1Y4KA 5A0OB 1N8QA 3OW22 1QALA 3S67A 2WOHA 1TFOA 3IJEB 2C10A 2HMNB 1D6ZA 4FMBA 3HK4A 3SVAA 4HM8B 3F14A 3RDEA 1ULIB 3CCL3 1STDA 2I9WA 3A76A 3OX9A 3CPW2 1K9M4 3LT8A 3UL6A 1US1A 3NV0A 1YGEA 1OHPA 1WMNA 3LH4A 4NREA 1FUWA 2W56A 5CLKA 1D6YA 5ELUA 2B1XB 1ZO2A 2BMRB 1K41A 3GZRA 2CIUA 3MG2A 4TX4A 3B7CA 1KQS2 2D1WA 1IVVA 1O7NB 1TUHA 1Q814 1JKGB 3JVCA 3IMAB 4XDWA 2OOVA 1VQ93 3G713 3N8BA 3SX1A 4EC6A 3G4S3 5CK6A 3N9HA 1M1K4 5AEUB 3KZTA 3CNXA 2PZVA 3I563 4R9KA 3FKAA 4LZIA 3S5CA 5IF6A 3BNEA 2RFRA 3E99A 1W7CA 3NBJA 1VQ73 3DUKA 1LVNA 4X2HA 1OCVA 1LNHA 5D83A 3D9RA 1VQO3 1PFPA 3OWYA 2K0MA 4HM1B 4ORLA 1AVLA 3CCR3 4BTYA 4FCZA 2CWUA 3GAXA 3NQZA 3FG4A 3LTDA 2ZL8A 1N9JA 1FGOA 4BTXA 3ALAA 4NHFA 3NV0B 1OHOA 3DGLA 1A67A 5IENA 2K54A 4U13A 4R1KA 3V98A 1AVKA 1AV4A 3GZYB 3WDGB 3EQQB 2CW9A 2INXA 1NB3I 3NUVA 4O3VA 1VQ63 1HKXA 2R4IA 1PU4A 5IG0A 3QRDA 4FCJA 2W03A 2P09A 4HM3B 3OWUA 2HMKB 2LQVA 3S27A 4HM2B 2RGQA 4AEQA 2QIYA 1YIT3 2HMJB 4WWUC 2MC8A 1IV7A 3U1WA 1KC84 3K0ZA 5IG3A 3DGOA 1IU7A 4O02B 2PNCA 5IG4A 1ROVA 5IEPA 2BMOB 3DMCA 1N8R4 5AIGA 3BNCA 3F7SA 2GEYA 3PCSA 4KFFA 5KP3A 4GL6A 2GU3A 5AI1A 3PS8A 1VZZA 2QA43 3NQYA 2Q07A 1YJW3 1FA3A 4STDA 4KFDA 3QK9A 2E2UA 1S5AA 1TP6A 1TIJA 3CCU3 1EKMA 1JB2A 3EX9A 2D42A 4K61A 1CEWI 3FGYA 4JF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4K A;  2ML6 A;  2ML5 A; 
#chains in the Genus database with same CATH topology
 1OPY A;  1JNQ A;  1X1X A;  2KXG A;  3NHX A;  3FSD A;  1A2V A;  2IA7 A;  4HM7 B;  3CC7 3;  1JJ2 2;  3KE7 A;  1FGM A;  2J8X B;  4L7K A;  3CCJ 3;  4N6M A;  4L8P A;  2ZHX B;  2XSH B;  4FCM A;  3FLJ A;  3BIR A;  3X3X A;  2IYJ A;  2B24 B;  1OGZ A;  1IK3 A;  2F99 A;  2HOH A;  4RBN A;  1BOX A;  3KII A;  4FMA A;  2W0Q A;  1IVX A;  2GBX B;  2RBI A;  3NBR A;  1V57 A;  5IEO A;  3T8N A;  2OTL 3;  1HZ1 A;  1VQ4 3;  1RGH A;  1B27 A;  5KP4 A;  2CWV A;  3EJV A;  1LOW A;  1M9G A;  1Q40 A;  1I8V A;  1BSB A;  4X2O A;  3KN4 A;  2A15 A;  4CDL A;  2YFJ B;  2GXF A;  1KD1 4;  3BU4 A;  2F98 A;  4LEH A;  5EVH A;  1W5Z A;  2YFL B;  3K9M C;  3WHO A;  1BSD A;  1LQG C;  5IG5 A;  1BNS A;  1JZO A;  2P05 A;  3ECF A;  2XR8 B;  4O8S A;  1CYV A;  1RGA A;  4OK0 A;  3X3Z A;  5CF1 A;  4XDV A;  1YIJ 3;  4HOH A;  3J7Y d;  2CK3 H;  1GOY A;  1T3B A;  4FMC A;  3ER7 A;  1BNE A;  3GWR A;  1BUQ A;  1EA2 A;  4XB5 A;  4HKV B;  5D81 A;  3OXA A;  3GRD A;  3DXO A;  2QEX 3;  4EBG A;  2STD A;  2UX0 A;  3F40 A;  3STD A;  3T0U A;  4XBT A;  1RNT A;  3NM7 A;  2F5W A;  3EF8 A;  4PEJ A;  5KP1 A;  1D6U A;  3CCE 3;  2WOF A;  1WMP A;  3B8L A;  2LYX A;  1JRQ A;  1UGH I;  2GBW B;  3FF0 A;  1Q86 4;  1SQW A;  3F7X A;  3K63 A;  1I0V A;  4LGQ A;  1W6G A;  1OH0 A;  2SAR A;  1YGW A;  1HYF A;  4HBR A;  1BGS A;  4OVM A;  1SAR A;  1IVU A;  3LML A;  1B21 A;  3JUM A;  3V99 A;  1VQK 3;  3LOY A;  1GYB A;  3D3L A;  1WMO A;  2P0M A;  1OAC A;  3N54 B;  1YJN 3;  5G2G A;  2XEP A;  1IQX A;  1BRH A;  2CH9 A;  3EB8 A;  4IPB A;  1LQM B;  4CJN A;  1YVS A;  5JBS A;  1TFK A;  1M1X B;  4NPB A;  3X40 A;  3CCS 3;  3IPT A;  1RRH A;  3Q2P A;  3F9S A;  1YVB I;  3OV4 A;  3MG1 A;  4XBX A;  1VQP 3;  1GD3 A;  1BNG A;  1RGL A;  1FGT A;  1RCL A;  4R80 A;  1AQZ A;  1N9E A;  1GOV A;  3RGR A;  2IUJ A;  1CQS A;  2OOV C;  2XFT A;  3DGM A;  1DMN A;  2CG1 A;  3AMO A;  3FZW A;  1BNI A;  1C54 A;  4I4K A;  1LOY A;  3CNM A;  3JUQ A;  4BL2 A;  1O7M B;  2BMQ B;  5FW5 A;  1NU3 A;  1ROA A;  5M1A A;  1A2K A;  4BTW A;  1BIR A;  1RN7 A;  1X1Y A;  1B2S A;  1STF I;  4R4K A;  3CCV 3;  3WOF B;  3LXU X;  2XH9 A;  1BVI A;  1I70 A;  2W9P A;  1RLS A;  3VSY A;  2IMJ A;  1WQL B;  1RGG A;  4RNZ A;  3MYT A;  4K1V A;  6GSP A;  1N5P A;  2IUK A;  1JB4 A;  2Z6B A;  3EC9 A;  3SED A;  3D5G A;  1UI8 A;  1GY6 A;  2Z77 A;  2CFK A;  2W6J H;  1ZS7 A;  2Y73 A;  1JBR A;  2BNG A;  3PXM A;  5BVB A;  2RCD A;  5D82 A;  1RJO A;  3A5E A;  3I0Y A;  4N3V A;  1K28 A;  1RGC A;  3HOH A;  5JPU A;  1B20 A;  1BSA A;  1M90 4;  1B2X A;  2ML6 A;  1IQY A;  4HYZ A;  2IY2 A;  1UCI A;  3FG3 A;  1BRJ A;  2GEX A;  4K1U A;  2W2C A;  3JUP A;  4CPK A;  1BUJ A;  1BRS A;  4N6N B;  2Y74 A;  1G96 A;  4BU4 A;  1A90 A;  1EG9 B;  3F8H A;  1FZU A;  1NWW A;  5CXO A;  1FW7 A;  1W6C A;  3EBY A;  1W2Z A;  1SPU A;  1BSC A;  1UCL A;  3EE1 A;  1GS3 A;  3RGA A;  3UNL A;  5CF2 A;  4QWT A;  3BNB A;  2R41 A;  4JRF A;  1LOV A;  1E97 A;  4GHO A;  3Q1C A;  1IV9 A;  4J8T A;  1Q40 B;  4N6U A;  5HOH A;  1RRL A;  1DE3 A;  1Q7H A;  1UW1 A;  2CG0 A;  2RSX A;  5AEW B;  3MPH A;  3S29 A;  5FGO A;  1A2P A;  1KWI A;  3WOE B;  1NJI 4;  4FMD A;  1K8A 4;  1YHQ 3;  4G1M B;  1L5G B;  4H3U A;  2UUG C;  1U5O A;  3PZW A;  3H51 A;  2E2T A;  1N5H A;  1NNV A;  5DRE A;  1Q9E A;  1FUS A;  1Q42 A;  1DVD A;  3FCS B;  1RGE A;  3KKG A;  4HJL B;  3MWZ A;  1DYU A;  1ZX2 A;  5M19 A;  1JBT A;  1BNR A;  4HM0 B;  2WGO A;  1RNB A;  1FGR A;  1B2U A;  1IT7 A;  2M7O A;  4LMI A;  1V58 A;  2CWT A;  2FNQ A;  4MMY B;  4WYK B;  3UJM A;  3X42 A;  1FYS A;  3WR2 A;  1U8C B;  2K3D A;  2O9U X;  5G1K A;  3HIG A;  3L0R A;  3LYG A;  4N6T A;  3UB1 A;  4WYK A;  1B2M A;  5IW9 A;  1IDP A;  3NXJ A;  3DY5 A;  1CH0 A;  4HM5 B;  3HII A;  3GZB A;  2CKF B;  1E3V A;  2L4V A;  4O2H A;  9RNT A;  1DVC A;  3AGO A;  1BU4 A;  3LTC A;  3G0K A;  4AKY A;  1TU5 A;  1LXE A;  1BRK A;  2BT3 A;  2XGL A;  1LOX A;  3MG3 A;  1ISK A;  2C4B A;  4R9L A;  3CC2 3;  1W02 A;  3TDG A;  1VQ5 3;  1QAK A;  1BNJ A;  2F5M A;  3LT9 A;  3K7C A;  2WO0 A;  5AII A;  1O7W B;  2F86 B;  2KRT A;  3PYJ A;  1DMQ A;  3EBT A;  2JDI H;  3EHC A;  4IIA A;  6STD A;  1RKY A;  2H0I A;  1UUV B;  2W9Q A;  2OQE A;  3SOY A;  3LTA A;  5BU4 A;  2CHC A;  2H0H A;  5IER A;  2FXT A;  3BLZ A;  1YI2 3;  7GSP A;  3BND A;  3JUO A;  5LC7 A;  3CCQ 3;  2OWP A;  3WA2 X;  1G0T A;  3ZFZ A;  2BU4 A;  5AIH A;  3B4O A;  1UI7 A;  2XFS A;  3NBB A;  4H61 A;  5G1L A;  1I2E A;  1JN5 A;  2KAA A;  3Q90 A;  4Q53 A;  3M8C A;  2XGN A;  1JV2 B;  2XSO B;  3T8U A;  3SLU A;  5STD A;  1Q7Y 4;  4OUQ A;  1JN5 B;  4BIR A;  1K73 4;  3UL5 A;  1MWS A;  1NB5 I;  3ZG0 A;  1ASK A;  3LZA A;  3SOA A;  3WA3 A;  2F56 A;  3K5T A;  1Z1S A;  2YX9 A;  3EN8 A;  3NX0 A;  2XRX B;  4KVH A;  1CYU A;  2SBL A;  4J9A A;  3MHE A;  1SIH A;  4WHA A;  2OCT A;  1HU9 A;  1IVW A;  5HGR A;  1E3R A;  1T5Y A;  2AAE A;  1QJG A;  2KCD A;  3CC4 3;  3DH2 A;  3KSP A;  4EXR A;  1YJ9 3;  1W4N A;  1MGW A;  4HM6 B;  3G6E 3;  2W04 A;  3WMD A;  2QGU A;  3JUN A;  1VQL 3;  1O7G B;  3CPO A;  1OF5 A;  2YFI B;  1GY7 A;  2KF3 A;  7STD A;  1RGK A;  3PCR A;  5ELJ A;  3NM2 A;  4ZM8 A;  1WTH A;  5I97 A;  1RMS A;  3VGN A;  2BHM A;  2CX1 A;  5M18 A;  4K90 B;  1VQ8 3;  1KSI A;  3HZP A;  4XBY A;  1QVG 2;  5BIR A;  2HML B;  5JPP A;  3FF2 A;  2CFW A;  5EEO A;  4BL3 A;  1DMM A;  1VQQ A;  1W2B 2;  1J2B A;  3EN1 B;  1QVF 2;  1OUN A;  2OQE C;  3DM8 A;  4HAA A;  4EV5 A;  3AHS A;  1FUT A;  1QAF A;  5TGN A;  3KSE D;  4EYC A;  3CD6 3;  3KFQ C;  1FGQ A;  3GZX B;  4MMX B;  1T2H A;  3I55 3;  1LRA A;  2CFD A;  4EV2 A;  3FH1 A;  3WOD G;  3H3H A;  4HM4 B;  4KT3 B;  1C7H A;  4HZB B;  2BIR A;  1JZD A;  1LNI A;  3DGN A;  3B4P A;  3VF1 A;  1GMP A;  4KFE A;  1W6Y A;  1GY5 A;  2V1L A;  1OGX A;  1F8N A;  1SII A;  5EQL A;  1AR0 A;  4N6V 0;  2RNT A;  5BXQ A;  4GB5 A;  4MEI A;  2H0G A;  1SJW A;  1MNL A;  1R4Y A;  2JQ5 A;  1VQM 3;  1O7H B;  3G16 A;  2OTJ 3;  1NO3 A;  3SXX A;  3RNT A;  3PGB A;  3CXC 2;  1OHS A;  1RSN A;  1BSE A;  1O7P B;  1I3I A;  3DZL A;  3CMA 3;  2O3O A;  1ULJ B;  1Q82 4;  1MOL A;  1T2I A;  2CC3 A;  7RNT A;  1YNV X;  1RDS A;  2MF7 A;  1IYY A;  1W00 A;  4LYL B;  1WNH A;  2XF3 A;  4HVN A;  1RN4 A;  3LTB A;  1EQK A;  2FGT A;  3U97 A;  3V92 A;  4MJD A;  1EEJ A;  1JB5 A;  1OF5 B;  1IT8 A;  3SYU A;  5DRV A;  1MWT A;  4L8O A;  2ML5 A;  4FR9 A;  3CCM 3;  1I2F A;  4CCV A;  1BAO A;  4GSP A;  3HI7 A;  1JKG A;  1QMA A;  2P38 A;  3CME 3;  1R4C A;  4N6L A;  1GSP A;  2Z76 A;  3G8Z A;  4KZ1 A;  4AKZ A;  3HX8 A;  2WGQ A;  1BRN L;  4IT7 A;  2C11 A;  4N6O B;  1GMR A;  3FG1 A;  4LSO A;  5AYR B;  1MWU A;  3BB9 A;  2E2V A;  3OWS A;  1UUW B;  3S28 A;  1I0X A;  2P0X A;  4HZ9 B;  1X1W A;  4WP5 A;  4RNY A;  2GU1 A;  5AIF A;  3GSP A;  1IQ8 A;  3F8X A;  3X3Y A;  1V74 A;  2HMO B;  3MSO A;  2W56 B;  4XM4 A;  1VQN 3;  3MKI A;  3ROB A;  1RTU A;  1UCJ A;  1NDO B;  4RZM A;  1UDI I;  2CFL A;  3X41 A;  5LC6 A;  3O8Y A;  3CU3 A;  1GD4 A;  4ILF A;  2Z7A A;  4MMZ B;  8CHO A;  2BO9 B;  4WFO A;  2CFG A;  2ZDJ A;  3AMO B;  1S72 3;  2HMM B;  5AYS C;  1W01 A;  1Y4K A;  1ZGX A;  5A0O B;  1N8Q A;  3OW2 2;  4DKI A;  1QAL A;  1RCK A;  3S67 A;  2WOH A;  1TFO A;  3IJE B;  2C10 A;  2HMN B;  1D6Z A;  4FMB A;  3HK4 A;  3SVA A;  1TTO A;  4HM8 B;  3F14 A;  3RDE A;  1ULI B;  3CCL 3;  1STD A;  2I9W A;  1AY7 A;  1UUG B;  3A76 A;  3OX9 A;  3CPW 2;  2CX0 A;  3LT8 A;  3UL6 A;  1K9M 4;  1US1 A;  3NV0 A;  1YGE A;  3DGY A;  1BRG A;  1OHP A;  1WMN A;  3LH4 A;  1RN1 A;  4NRE A;  1FUW A;  2W56 A;  6RNT A;  4J5G A;  5CLK A;  1D6Y A;  5ELU A;  2B1X B;  2L1S A;  3ZG5 A;  1ZO2 A;  2BMR B;  1K41 A;  3GZR A;  2CIU A;  3MG2 A;  1JBS A;  1TRP A;  2KF4 A;  1B2Z A;  4TX4 A;  3B7C A;  1KQS 2;  2D1W A;  1UGI A;  1PY3 A;  1IVV A;  2UGI A;  1O7N B;  1TUH A;  1Q81 4;  1JKG B;  3JVC A;  1BRI A;  3IMA B;  2F4Y A;  4XDW A;  8RNT A;  2OOV A;  1VQ9 3;  3G71 3;  1GOU A;  3N8B A;  3SX1 A;  4EC6 A;  1TJD A;  3G4S 3;  5CK6 A;  2GSP A;  3N9H A;  1M1K 4;  1I2G A;  5AEU B;  3KZT A;  3CNX A;  2PZV A;  3I56 3;  4R9K A;  3FKA A;  4LZI A;  3S5C A;  5IF6 A;  3BNE A;  2RFR A;  2AAD A;  2KF5 A;  3E99 A;  1W7C A;  3NBJ A;  1VQ7 3;  3DUK A;  1LVN A;  3URP A;  4X2H A;  1OCV A;  1LNH A;  1DET A;  5D83 A;  3D9R A;  1UCK A;  3KCH A;  1VQO 3;  4EW5 A;  1PFP A;  3OWY A;  2K0M A;  4HM1 B;  4ORL A;  1AVL A;  5RNT A;  3CCR 3;  4BTY A;  4FCZ A;  2CWU A;  1MGR A;  2KF6 A;  3GAX A;  3NQZ A;  3FG4 A;  3LTD A;  2ZL8 A;  4I5Q A;  1GMQ A;  1N9J A;  1FGO A;  4BTX A;  3ALA A;  4NHF A;  3NV0 B;  1OHO A;  3DGL A;  1A67 A;  5IEN A;  2K54 A;  4U13 A;  4R1K A;  3V98 A;  1AVK A;  1AV4 A;  3AGN A;  3GZY B;  3WDG B;  3EQQ B;  2CW9 A;  1RGF A;  2ZA4 A;  1BNF A;  2INX A;  1G02 A;  1NB3 I;  3NUV A;  4O3V A;  1VQ6 3;  1I3F A;  1HKX A;  2R4I A;  1PU4 A;  5IG0 A;  3QRD A;  1EUI C;  4FCJ A;  1BAN A;  2W03 A;  2P09 A;  4HM3 B;  3OWU A;  2HMK B;  2LQV A;  3S27 A;  4HM2 B;  1MWR A;  2RGQ A;  4AEQ A;  1X1U A;  2QIY A;  1YIT 3;  2HMJ B;  3D79 A;  4J5K A;  4WWU C;  2MC8 A;  1IV7 A;  3U1W A;  1KC8 4;  3K0Z A;  5IG3 A;  3DGO A;  3D5I A;  1IU7 A;  4O02 B;  2PNC A;  5IG4 A;  1TRQ A;  1ROV A;  5IEP A;  2BMO B;  3DMC A;  3Q3F A;  5GSP A;  1N8R 4;  5AIG A;  3BNC A;  3F7S A;  1PYL A;  2GEY A;  3PCS A;  3D4A A;  4KFF A;  5KP3 A;  4GL6 A;  2GU3 A;  5AI1 A;  3AHW A;  3PS8 A;  1VZZ A;  2QA4 3;  3NQY A;  2Q07 A;  1YJW 3;  1FA3 A;  4STD A;  4KFD A;  3QK9 A;  2E2U A;  1S5A A;  1TP6 A;  1TIJ A;  3CCU 3;  4RNT A;  1EKM A;  1RHL A;  1JB2 A;  3EX9 A;  2D42 A;  4K61 A;  1CEW I;  1B3S A;  3FGY A;  4JF8 A; 
#chains in the Genus database with same CATH homology
 1OPY A;  1JNQ A;  2KXG A;  3NHX A;  3FSD A;  1A2V A;  2IA7 A;  4HM7 B;  3CC7 3;  1JJ2 2;  3KE7 A;  1FGM A;  4L7K A;  3CCJ 3;  4N6M A;  4L8P A;  2XSH B;  4FCM A;  3FLJ A;  3X3X A;  1IK3 A;  2B24 B;  1OGZ A;  2F99 A;  4RBN A;  3KII A;  4FMA A;  2W0Q A;  1IVX A;  2GBX B;  3NBR A;  5IEO A;  3T8N A;  2OTL 3;  1VQ4 3;  5KP4 A;  2CWV A;  3EJV A;  1M9G A;  1Q40 A;  4X2O A;  3KN4 A;  2A15 A;  4CDL A;  2YFJ B;  2GXF A;  1KD1 4;  2F98 A;  4LEH A;  5EVH A;  1W5Z A;  2YFL B;  3K9M C;  5IG5 A;  2P05 A;  3ECF A;  2XR8 B;  4O8S A;  1CYV A;  4OK0 A;  3X3Z A;  5CF1 A;  4XDV A;  1YIJ 3;  3J7Y d;  2CK3 H;  4FMC A;  3ER7 A;  3GWR A;  1BUQ A;  1EA2 A;  4XB5 A;  4HKV B;  5D81 A;  3OXA A;  3GRD A;  3DXO A;  2QEX 3;  4EBG A;  2STD A;  2UX0 A;  3F40 A;  3STD A;  3T0U A;  4XBT A;  3NM7 A;  4PEJ A;  3EF8 A;  5KP1 A;  1D6U A;  3CCE 3;  2WOF A;  1WMP A;  3B8L A;  2LYX A;  1JRQ A;  2GBW B;  3FF0 A;  1Q86 4;  1SQW A;  3F7X A;  3K63 A;  4LGQ A;  1W6G A;  1OH0 A;  4HBR A;  4OVM A;  1IVU A;  3LML A;  3JUM A;  3V99 A;  1VQK 3;  3LOY A;  3D3L A;  1GYB A;  1WMO A;  2P0M A;  1OAC A;  3N54 B;  1YJN 3;  5G2G A;  2XEP A;  1IQX A;  2CH9 A;  3EB8 A;  4IPB A;  5JBS A;  1TFK A;  1M1X B;  3X40 A;  3CCS 3;  3IPT A;  1RRH A;  3Q2P A;  3F9S A;  1YVB I;  3OV4 A;  3MG1 A;  4XBX A;  1VQP 3;  1GD3 A;  1FGT A;  4R80 A;  1N9E A;  3RGR A;  2IUJ A;  1CQS A;  2OOV C;  2XFT A;  3DGM A;  1DMN A;  2CG1 A;  3AMO A;  3FZW A;  4I4K A;  3CNM A;  3JUQ A;  1O7M B;  2BMQ B;  5FW5 A;  1NU3 A;  1ROA A;  1A2K A;  4BTW A;  1RN7 A;  1STF I;  4R4K A;  3CCV 3;  3WOF B;  3LXU X;  2XH9 A;  2W9P A;  3VSY A;  2IMJ A;  1WQL B;  4RNZ A;  3MYT A;  4K1V A;  1N5P A;  2IUK A;  1JB4 A;  2Z6B A;  3EC9 A;  3SED A;  1UI8 A;  1GY6 A;  2Z77 A;  2CFK A;  2W6J H;  2Y73 A;  2BNG A;  3PXM A;  5BVB A;  2RCD A;  5D82 A;  1RJO A;  3I0Y A;  4N3V A;  1K28 A;  5JPU A;  1M90 4;  2ML6 A;  1IQY A;  4HYZ A;  3FG3 A;  2GEX A;  4K1U A;  2W2C A;  3JUP A;  4N6N B;  2Y74 A;  1G96 A;  1A90 A;  1EG9 B;  3F8H A;  1NWW A;  5CXO A;  1W6C A;  3EBY A;  1W2Z A;  1SPU A;  3EE1 A;  3RGA A;  1GS3 A;  5CF2 A;  3UNL A;  4QWT A;  3BNB A;  4JRF A;  1E97 A;  4N6U A;  3Q1C A;  1IV9 A;  4J8T A;  1Q40 B;  1RRL A;  1UW1 A;  2CG0 A;  2RSX A;  5AEW B;  3MPH A;  3S29 A;  5FGO A;  1NJI 4;  1KWI A;  3WOE B;  4FMD A;  1K8A 4;  1YHQ 3;  4G1M B;  1L5G B;  4H3U A;  1U5O A;  3PZW A;  3H51 A;  2E2T A;  1N5H A;  5DRE A;  1Q42 A;  1DVD A;  3FCS B;  3KKG A;  4HJL B;  3MWZ A;  1DYU A;  1ZX2 A;  4HM0 B;  2WGO A;  1FGR A;  1IT7 A;  2M7O A;  4LMI A;  4MMY B;  2CWT A;  2FNQ A;  4WYK B;  3UJM A;  3X42 A;  1U8C B;  2O9U X;  3HIG A;  3L0R A;  3LYG A;  4N6T A;  3UB1 A;  4WYK A;  5IW9 A;  1IDP A;  3NXJ A;  3DY5 A;  4HM5 B;  3HII A;  3GZB A;  2CKF B;  1E3V A;  2L4V A;  4O2H A;  1DVC A;  3LTC A;  3G0K A;  4AKY A;  1TU5 A;  1LXE A;  2BT3 A;  2XGL A;  1LOX A;  3MG3 A;  1ISK A;  4R9L A;  3CC2 3;  1W02 A;  3TDG A;  1VQ5 3;  1QAK A;  3LT9 A;  3K7C A;  2WO0 A;  5AII A;  1O7W B;  2F86 B;  2KRT A;  3PYJ A;  1DMQ A;  3EBT A;  2JDI H;  3EHC A;  4IIA A;  6STD A;  1RKY A;  1UUV B;  2W9Q A;  2OQE A;  3SOY A;  3LTA A;  2CHC A;  5IER A;  2FXT A;  3BLZ A;  1YI2 3;  3BND A;  3JUO A;  5LC7 A;  3CCQ 3;  2OWP A;  3WA2 X;  5AIH A;  3B4O A;  1UI7 A;  2XFS A;  3NBB A;  4H61 A;  1JN5 A;  3Q90 A;  4Q53 A;  3M8C A;  2XGN A;  1JV2 B;  2XSO B;  3T8U A;  3SLU A;  5STD A;  1Q7Y 4;  4OUQ A;  1JN5 B;  1K73 4;  3UL5 A;  1NB5 I;  1ASK A;  3LZA A;  3SOA A;  3WA3 A;  3K5T A;  1Z1S A;  2YX9 A;  3EN8 A;  3NX0 A;  2XRX B;  4KVH A;  1CYU A;  2SBL A;  4J9A A;  3MHE A;  1SIH A;  4WHA A;  2OCT A;  1HU9 A;  1IVW A;  5HGR A;  1E3R A;  1T5Y A;  2KCD A;  1QJG A;  3CC4 3;  3KSP A;  4EXR A;  1YJ9 3;  1W4N A;  4HM6 B;  3G6E 3;  2W04 A;  3WMD A;  2QGU A;  3JUN A;  1VQL 3;  1O7G B;  3CPO A;  1OF5 A;  2YFI B;  1GY7 A;  7STD A;  3PCR A;  5ELJ A;  3NM2 A;  4ZM8 A;  1WTH A;  5I97 A;  3VGN A;  1VQ8 3;  2BHM A;  4K90 B;  1KSI A;  3HZP A;  4XBY A;  1QVG 2;  2HML B;  5JPP A;  3FF2 A;  2CFW A;  5EEO A;  1DMM A;  1W2B 2;  1J2B A;  3EN1 B;  1QVF 2;  1OUN A;  2OQE C;  3DM8 A;  4EV5 A;  1QAF A;  5TGN A;  3KSE D;  4EYC A;  3CD6 3;  3KFQ C;  1FGQ A;  3GZX B;  4MMX B;  3I55 3;  2CFD A;  4EV2 A;  3FH1 A;  3WOD G;  3H3H A;  4HM4 B;  1C7H A;  4HZB B;  3DGN A;  3VF1 A;  3B4P A;  4KFE A;  1W6Y A;  1GY5 A;  2V1L A;  1OGX A;  1F8N A;  1SII A;  5EQL A;  1AR0 A;  4N6V 0;  5BXQ A;  4GB5 A;  4MEI A;  2JQ5 A;  1SJW A;  1MNL A;  1VQM 3;  2OTJ 3;  1O7H B;  3G16 A;  1NO3 A;  3SXX A;  3CXC 2;  3PGB A;  1OHS A;  1O7P B;  3DZL A;  3CMA 3;  2O3O A;  1ULJ B;  1Q82 4;  1MOL A;  2CC3 A;  2MF7 A;  1W00 A;  1WNH A;  2XF3 A;  4HVN A;  3LTB A;  1EQK A;  2FGT A;  3U97 A;  3V92 A;  4MJD A;  1JB5 A;  1OF5 B;  1IT8 A;  5DRV A;  4L8O A;  2ML5 A;  4FR9 A;  3CCM 3;  4CCV A;  3HI7 A;  1JKG A;  1QMA A;  2P38 A;  3CME 3;  1R4C A;  4N6L A;  4AKZ A;  2Z76 A;  3G8Z A;  4KZ1 A;  3HX8 A;  2WGQ A;  4IT7 A;  2C11 A;  4N6O B;  3FG1 A;  4LSO A;  5AYR B;  3BB9 A;  2E2V A;  3OWS A;  1UUW B;  3S28 A;  2P0X A;  4HZ9 B;  4WP5 A;  4RNY A;  2GU1 A;  5AIF A;  3X3Y A;  1IQ8 A;  3F8X A;  1V74 A;  2HMO B;  3MSO A;  2W56 B;  4XM4 A;  1VQN 3;  3MKI A;  3ROB A;  1NDO B;  4RZM A;  2CFL A;  3X41 A;  5LC6 A;  3O8Y A;  3CU3 A;  1GD4 A;  2Z7A A;  4MMZ B;  8CHO A;  2BO9 B;  4WFO A;  2CFG A;  2ZDJ A;  3AMO B;  1S72 3;  2HMM B;  5AYS C;  1W01 A;  1Y4K A;  5A0O B;  1N8Q A;  3OW2 2;  1QAL A;  3S67 A;  2WOH A;  1TFO A;  3IJE B;  2C10 A;  2HMN B;  1D6Z A;  4FMB A;  3HK4 A;  3SVA A;  4HM8 B;  3F14 A;  3RDE A;  1ULI B;  3CCL 3;  1STD A;  2I9W A;  3A76 A;  3OX9 A;  3CPW 2;  1K9M 4;  3LT8 A;  3UL6 A;  1US1 A;  3NV0 A;  1YGE A;  1OHP A;  1WMN A;  3LH4 A;  4NRE A;  1FUW A;  2W56 A;  5CLK A;  1D6Y A;  5ELU A;  2B1X B;  1ZO2 A;  2BMR B;  1K41 A;  3GZR A;  2CIU A;  3MG2 A;  4TX4 A;  3B7C A;  1KQS 2;  2D1W A;  1IVV A;  1O7N B;  1TUH A;  1Q81 4;  1JKG B;  3JVC A;  3IMA B;  4XDW A;  2OOV A;  1VQ9 3;  3G71 3;  3N8B A;  3SX1 A;  4EC6 A;  3G4S 3;  5CK6 A;  3N9H A;  1M1K 4;  5AEU B;  3KZT A;  3CNX A;  2PZV A;  3I56 3;  4R9K A;  3FKA A;  4LZI A;  3S5C A;  5IF6 A;  3BNE A;  2RFR A;  3E99 A;  1W7C A;  3NBJ A;  1VQ7 3;  3DUK A;  1LVN A;  4X2H A;  1OCV A;  1LNH A;  5D83 A;  3D9R A;  1VQO 3;  1PFP A;  3OWY A;  2K0M A;  4HM1 B;  4ORL A;  1AVL A;  3CCR 3;  4BTY A;  4FCZ A;  2CWU A;  3GAX A;  3NQZ A;  3FG4 A;  3LTD A;  2ZL8 A;  1N9J A;  1FGO A;  4BTX A;  3ALA A;  4NHF A;  3NV0 B;  1OHO A;  3DGL A;  1A67 A;  5IEN A;  2K54 A;  4U13 A;  4R1K A;  3V98 A;  1AVK A;  1AV4 A;  3GZY B;  3WDG B;  3EQQ B;  2CW9 A;  2INX A;  1NB3 I;  3NUV A;  4O3V A;  1VQ6 3;  1HKX A;  2R4I A;  1PU4 A;  5IG0 A;  3QRD A;  4FCJ A;  2W03 A;  2P09 A;  4HM3 B;  3OWU A;  2HMK B;  2LQV A;  3S27 A;  4HM2 B;  2RGQ A;  4AEQ A;  2QIY A;  1YIT 3;  2HMJ B;  4WWU C;  2MC8 A;  1IV7 A;  3U1W A;  1KC8 4;  3K0Z A;  5IG3 A;  3DGO A;  1IU7 A;  4O02 B;  2PNC A;  5IG4 A;  1ROV A;  5IEP A;  2BMO B;  3DMC A;  1N8R 4;  5AIG A;  3BNC A;  3F7S A;  2GEY A;  3PCS A;  4KFF A;  5KP3 A;  4GL6 A;  2GU3 A;  5AI1 A;  3PS8 A;  1VZZ A;  2QA4 3;  3NQY A;  2Q07 A;  1YJW 3;  1FA3 A;  4STD A;  4KFD A;  3QK9 A;  2E2U A;  1S5A A;  1TP6 A;  1TIJ A;  3CCU 3;  1EKM A;  1JB2 A;  3EX9 A;  2D42 A;  4K61 A;  1CEW I;  3FGY A;  4JF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...