2ML5A

Nmr structure of protein zp_02064002.1 from bacteroides ovatus atcc 8483
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
GDSELTTQDGEDFKSFLDKFTSSAAFQYTRVKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERITQEEGGIYVSKFTLNEPKHKIFEAGYEESEVDLRVEFELQADGKWYVVDCYTGWYGYDLPIGELKQTIQNVKEENAAFKEIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of protein ZP_02064002.1 from Bacteroides ovatus ATCC 8483
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ml5A00
2ML5A 2ML6A 4R4KA
chains in the Genus database with same CATH superfamily
2XSOB 3WR2A 3DH2A 1NU3A 1RDSA 9RNTA 3KSED 1OHSA 4HJLB 4KFEA 1JN5A 5FW5A 3VF1A 3H3HA 4EYCA 3T8UA 4WYKB 3AMOB 3MYTA 1YHQ3 1RN4A 1UUWB 4WWUC 3FF0A 1JKGA 1LOXA 2CW9A 5AI1A 2HMMB 1VQQA 1BNSA 3KN4A 3SYUA 2W03A 3LH4A 2WGOA 3U1WA 3WOEB 1N8QA 1RNTA 4IPBA 2CFKA 1EUIC 3ECFA 3OV4A 3X3ZA 1YGWA 4GHOA 1DETA 5AEWB 3DGYA 5IERA 1MOLA 3LTBA 1OGZA 1BIRA 4XDVA 1BNEA 2CX1A 2SARA 3MG1A 5CK6A 2XEPA 3JUOA 3MSOA 4XBXA 3PYJA 3Q3FA 3EN8A 3UL5A 2CWTA 1Q864 3OX9A 1PYLA 6STDA 2BMQB 3B8LA 1JBSA 1VQ93 3KKGA 3S28A 3DGLA 2YFLB 7RNTA 2B24B 4Q53A 1B2MA 1I2EA 1FGTA 4N6V0 2CX0A 3STDA 3SVAA 2CK3H 1AY7A 3CCQ3 1OF5A 1I3FA 1BRHA 1GMRA 3NHXA 4RBNA 2F98A 2F99A 3HOHA 4OK0A 4BTXA 5JPPA 1W2B2 4HVNA 4U13A 5BU4A 1OCVA 2AAEA 1GD3A 2BT3A 3AGOA 1RGCA 3NM2A 2ZDJA 2Q07A 1BRKA 2P38A 2HOHA 2KXGA 1IU7A 3HX8A 1YJN3 1Q42A 2ML5A 3G16A 1UUVB 3MKIA 1YVSA 2H0IA 5AYSC 1Q40A 4FMDA 3CXC2 3CC23 1BRNL 3PXMA 2GU3A 1S5AA 3WHOA 2CHCA 1K28A 1E3VA 2FXTA 1KD14 1VQL3 1JJ22 3FF2A 4KVHA 3IJEB 3K63A 3EBTA 4N6MA 5M19A 3F7XA 2ML6A 1L5GB 1LQGC 2E2VA 4I5QA 3CNMA 4LZIA 1SIHA 1C54A 1ULJB 5D82A 1BAOA 2BHMA 3CMA3 3KSPA 5AIFA 1RCKA 2W9PA 4FCMA 1JKGB 5KP4A 1GY5A 3NX0A 1JBTA 1PFPA 1UCLA 4EBGA 1IT8A 2QIYA 2BU4A 4HOHA 4RNZA 4GL6A 1BSEA 3JUNA 3AHWA 3SEDA 3X42A 2A15A 4AEQA 3CCJ3 1C7HA 4CJNA 4HM2B 4J5KA 3RNTA 1IVUA 1I2FA 3GAXA 2F56A 3JUQA 1U8CB 1AQZA 2J8XB 1BOXA 3LYGA 1G02A 3BNDA 3GZBA 1ZO2A 2V1LA 3MG2A 1KC84 1BRIA 3N8BA 3BU4A 2LQVA 1UI8A 3LTDA 2F4YA 1UUGB 1W6YA 4LGQA 3K7CA 3U97A 1BSAA 4BL2A 5RNTA 1Q7Y4 2WOHA 2XGNA 2CG0A 2AADA 5DREA 1AVKA 4HM3B 4MJDA 3CNXA 1BSBA 1BU4A 3H51A 1OF5B 1WTHA 1BNRA 2KF4A 8CHOA 3EHCA 2K3DA 3KIIA 3CCL3 3F8HA 5FGOA 2OTL3 5BIRA 2OQEA 4EV2A 2L1SA 5I97A 1UGIA 1SJWA 3EX9A 1DVCA 3WA3A 1GMQA 4HYZA 4HZ9B 1ROAA 1GSPA 3MG3A 1RLSA 4KFDA 3G6E3 1ULIB 3G4S3 1OUNA 1A2KA 2XFSA 1VQ43 3T8NA 2Y74A 1OHPA 3QRDA 1A67A 4N6NB 1VZZA 3HI7A 1TTOA 6RNTA 1IQYA 5ELUA 1F8NA 1LOVA 1Q40B 2H0GA 1TP6A 5HOHA 2GEYA 3NQYA 4L8PA 1QJGA 1SARA 1STFI 1M904 2GU1A 1ROVA 1WMPA 3I0YA 3D5IA 1M1XB 2CKFB 3X3YA 1LNIA 3FH1A 1CQSA 4RNYA 3WODG 1LVNA 2RFRA 3BIRA 3EC9A 1EG9B 3EQQB 3S29A 1TU5A 1LXEA 1QVG2 1K41A 2HMKB 1NDOB 1IVWA 2XR8B 4TX4A 5KP3A 5IW9A 2XGLA 4J8TA 3I553 1O7PB 1SQWA 2ZHXB 1SIIA 2BMRB 1R4YA 3CU3A 2RCDA 4JF8A 4N6OB 1BSCA 4X2HA 3NXJA 3J7Yd 4EXRA 3SLUA 1MWTA 1VQM3 1GD4A 1HU9A 4O8SA 4OUQA 4EC6A 1TIJA 2GEXA 1IK3A 2K54A 4LMIA 5EEOA 1MWUA 3ROBA 1GYBA 2CWUA 5IENA 1X1WA 2JDIH 2CFDA 2IA7A 1I0VA 3HIIA 1VQ73 4PEJA 5M18A 2BMOB 1LRAA 3EBYA 3OWUA 3DXOA 4JRFA 2HMJB 1RRHA 3IMAB 3ZG0A 1G96A 5IG5A 1QAFA 2Z76A 2OWPA 1ZGXA 1Q9EA 2INXA 1VQN3 1QMAA 1W2ZA 1BGSA 2RBIA 2L4VA 1IV9A 3A76A 4LYLB 1ZX2A 3LXUX 1JB5A 3DZLA 3I563 4BL3A 1GY7A 3OWYA 4MMZB 5EQLA 4R1KA 1Q7HA 3FZWA 3MHEA 3X40A 2W9QA 3LT8A 1GS3A 1TRPA 1B20A 1YGEA 4XM4A 1B2XA 4FMBA 4N6UA 2C4BA 4HM0B 5A0OB 1RGAA 1IQ8A 2GXFA 1FA3A 3D5GA 3LTCA 1BRGA 1JRQA 5STDA 3V92A 4N6TA 1MGWA 4ORLA 1X1UA 1BNIA 1O7MB 5M1AA 3S27A 1B2SA 4FMCA 3G713 2E2UA 1RSNA 3F8XA 1VQ83 3BNCA 1W7CA 5JPUA 2STDA 1GOYA 2XFTA 1T2HA 2PZVA 4STDA 1MNLA 4I4KA 1RN1A 3RDEA 1NO3A 1IVVA 2OQEC 2E2TA 2B1XB 1W01A 2CC3A 1BNJA 4LSOA 2ZA4A 1MWSA 1R4CA 1JB4A 2ZL8A 3FG1A 1TFKA 2WGQA 4FCZA 1LOYA 1N5PA 1DVDA 8RNTA 1MGRA 1STDA 1O7WB 1FGMA 1OGXA 3DY5A 3UL6A 3EN1B 1MWRA 1IV7A 5G1LA 3GWRA 3G0KA 1E97A 3CCU3 1BVIA 4HM7B 1JB2A 5BXQA 1NNVA 1JZOA 4X2OA 3B4PA 2P0XA 3O8YA 4XDWA 1UCJA 1W5ZA 3CCM3 4RNTA 2XH9A 2R41A 1WQLB 1EA2A 3Q2PA 1A2VA 1O7GB 5DRVA 1JBRA 1YJW3 1W6GA 2CG1A 1I2GA 3WOFB 3FG4A 5IEOA 1D6UA 1A2PA 2Z6BA 3K9MC 1NWWA 3EE1A 3AHSA 4HKVB 1QVF2 1GOUA 3ALAA 2K0MA 3GZRA 3M8CA 1IT7A 4BU4A 4G1MB 3CC43 1YIJ3 2C10A 3K0ZA 5BVBA 1B21A 1AR0A 1FUTA 1FYSA 1J2BA 3QK9A 3F14A 2IUJA 4BTYA 2HMOB 4J5GA 3DMCA 3E99A 4CCVA 1UI7A 1DYUA 2CIUA 1B3SA 4ZM8A 4EW5A 1NB3I 3FGYA 4AKYA 1FGOA 3CPW2 2JQ5A 3B7CA 1RGGA 2PNCA 1NJI4 1UW1A 2P05A 2W2CA 2Z77A 4MMYB 5JBSA 1LQMB 1RJOA 2FNQA 5CF1A 4L7KA 2QGUA 3WMDA 1AV4A 3BNEA 1VQ53 1RGHA 5CXOA 3X3XA 2F5WA 1FGRA 1GMPA 2M7OA 3SX1A 2RNTA 2YFJB 3L0RA 4K90B 1YVBI 1CEWI 1UGHI 1KSIA 1UCIA 3DM8A 4O2HA 1HYFA 3S5CA 4L8OA 2KAAA 1DMMA 5IG0A 2CFGA 3PCSA 3N9HA 4K61A 5EVHA 4NREA 2F86B 2WOFA 4EV5A 1BNGA 3LMLA 4N3VA 3IPTA 2P0MA 3RGRA 5IG3A 1NB5I 3JVCA 1N5HA 2IUKA 1BNFA 2MF7A 3PGBA 1VQ63 2W56A 3KE7A 2W0QA 3V98A 2KF5A 1X1XA 7GSPA 1FW7A 3DGOA 4KFFA 1WMOA 2UGIA 1BANA 3MPHA 2KF3A 4HM1B 1YI23 1PY3A 3FKAA 4AKZA 1ISKA 1EEJA 1RKYA 3FG3A 1UCKA 4KT3B 4QWTA 5TGNA 1V58A 1WNHA 1W4NA 3PS8A 1YJ93 2I9WA 1I70A 3NBRA 2P09A 2Z7AA 3Q90A 2GSPA 3EJVA 5AIHA 1JV2B 1OHOA 1KWIA 3F40A 1UDII 4R9KA 1TFOA 3RGAA 6GSPA 2OCTA 4XBTA 2OOVC 3CME3 2XRXB 3D9RA 3HK4A 3G8ZA 3NM7A 3GSPA 3UB1A 3PZWA 1IVXA 1CH0A 4CDLA 4HM6B 1YIT3 1RGLA 2H0HA 1I3IA 3DGNA 3NBBA 4HM8B 3UNLA 3F7SA 1VQK3 1JZDA 3FSDA 2D42A 3TDGA 1CYUA 3ZG5A 3LZAA 1ZS7A 5IEPA 1T3BA 2C11A 1RNBA 4J9AA 4BIRA 4MEIA 2QEX3 1VQP3 3CCV3 2BIRA 1W00A 5LC6A 1M1K4 1WMNA 3D3LA 4GSPA 3VGNA 1OACA 1Z1SA 3GZXB 2BO9B 1QALA 2OTJ3 1BSDA 2KCDA 3AGNA 3CPOA 3CC73 2IYJA 3X41A 2XSHB 1HKXA 3CCE3 1K9M4 2XF3A 3N54B 1KQS2 4R80A 5IF6A 4ILFA 2UUGC 3V99A 3NBJA 3KCHA 4O02B 5D81A 1TRQA 3NV0A 4IT7A 4XB5A 3HZPA 1B2UA 3GRDA 3UJMA 1LNHA 3BLZA 1FZUA 3BNBA 1BUQA 2YFIB 1RGFA 4HAAA 2R4IA 5G1KA 3EB8A 2W6JH 2HMNB 2OOVA 1W02A 1IYYA 1HZ1A 1DMQA 3KZTA 7STDA 3ZFZA 3EF8A 2O9UX 5KP1A 4CPKA 3B4OA 2WO0A 1V74A 1I0XA 1EQKA 1I8VA 4OVMA 5AYRB 2GBXB 1TJDA 3CCS3 1DE3A 2UX0A 2Y73A 2W56B 2IMJA 1IQXA 2GBWB 3NUVA 3NQZA 3F9SA 4NPBA 5AIIA 3KFQC 1ASKA 3FLJA 3Q1CA 1B27A 4R4KA 1EKMA 1V57A 4R9LA 4XBYA 3S67A 2CH9A 1BRJA 3AMOA 3D4AA 3LTAA 2CFLA 2W04A 4HM5B 4WYKA 5D83A 1DMNA 4H3UA 1D6ZA 1T5YA 1K8A4 1O7HB 1N8R4 1JN5B 4WHAA 5G2GA 5AEUB 1GY6A 1RGKA 2YX9A 1M9GA 1YNVX 4H61A 1SPUA 3WDGB 4FMAA 3CCR3 4N6LA 1CYVA 2F5MA 1RMSA 1IDPA 2BNGA 4IIAA 3WA2X 2KF6A 5ELJA 5HGRA 4GB5A 1Q824 4O3VA 2RSXA 4WP5A 1G0TA 3LT9A 2FGTA 3FCSB 3MWZA 2MC8A 1A90A 1T2IA 1FGQA 1Y4KA 5LC7A 1TUHA 5CLKA 3SOAA 1W6CA 2HMLB 2IY2A 3HIGA 3A5EA 1RTUA 1D6YA 2SBLA 5AIGA 1JNQA 1VQO3 4KZ1A 1LOWA 3CD63 2O3OA 2CWVA 4NHFA 1O7NB 2QA43 1RCLA 3DUKA 3JUMA 1S723 3ER7A 4WFOA 1E3RA 1RN7A 3K5TA 3PCRA 4HZBB 2D1WA 4K1VA 3SXXA 2CFWA 3NV0B 1K734 3URPA 3T0UA 1FUWA 2RGQA 4FR9A 5GSPA 3VSYA 3OXAA 1BUJA 1U5OA 5IG4A 1AVLA 1N9EA 3BB9A 4HM4B 4RZMA 2LYXA 4LEHA 4HBRA 1RRLA 1BRSA 1OPYA 1RHLA 1X1YA 4BTWA 1Q814 1US1A 4DKIA 4FCJA 1N9JA 4MMXB 3SOYA 1GOVA 1FUSA 1B2ZA 2KRTA 4K1UA 3JUPA 3OWSA 1PU4A 1OH0A 1QAKA 1RGEA 3GZYB 3DGMA 3OW22 5CF2A 3D79A 3LOYA
chains in the Genus database with same CATH topology
2XSOB 1NU3A 3KSED 1OHSA 4HJLB 4KFEA 1JN5A 5FW5A 3VF1A 3H3HA 4EYCA 3T8UA 4WYKB 3AMOB 3MYTA 1YHQ3 1UUWB 4WWUC 3FF0A 1JKGA 1LOXA 2CW9A 5AI1A 2HMMB 3KN4A 2W03A 3LH4A 2WGOA 3U1WA 3WOEB 1N8QA 4IPBA 2CFKA 3ECFA 3OV4A 3X3ZA 5AEWB 5IERA 1MOLA 3LTBA 1OGZA 4XDVA 3MG1A 5CK6A 2XEPA 3JUOA 3MSOA 4XBXA 3PYJA 3EN8A 3UL5A 2CWTA 1Q864 3OX9A 6STDA 2BMQB 3B8LA 1VQ93 3KKGA 3S28A 3DGLA 2YFLB 2B24B 4Q53A 1FGTA 4N6V0 3STDA 3SVAA 2CK3H 3CCQ3 1OF5A 3NHXA 4RBNA 2F98A 2F99A 4OK0A 4BTXA 5JPPA 1W2B2 4HVNA 4U13A 1OCVA 1GD3A 2BT3A 3NM2A 2ZDJA 2Q07A 2P38A 2KXGA 1IU7A 3HX8A 1YJN3 1Q42A 2ML5A 3G16A 1UUVB 3MKIA 5AYSC 1Q40A 4FMDA 3CXC2 3CC23 3PXMA 2GU3A 1S5AA 2CHCA 1K28A 1E3VA 2FXTA 1KD14 1VQL3 3FF2A 4KVHA 3IJEB 3K63A 3EBTA 4N6MA 3F7XA 2ML6A 1L5GB 2E2VA 3CNMA 4LZIA 1SIHA 1ULJB 5D82A 2BHMA 3CMA3 3KSPA 5AIFA 2W9PA 4FCMA 1JKGB 5KP4A 1GY5A 3NX0A 1PFPA 4EBGA 1IT8A 2QIYA 4RNZA 4GL6A 3JUNA 3SEDA 3X42A 2A15A 4AEQA 3CCJ3 1C7HA 4HM2B 1IVUA 3GAXA 3JUQA 1U8CB 3LYGA 3BNDA 3GZBA 3MG2A 1ZO2A 2V1LA 1KC84 3N8BA 2LQVA 1UI8A 3LTDA 1W6YA 4LGQA 3K7CA 3U97A 1Q7Y4 2WOHA 2XGNA 2CG0A 5DREA 1AVKA 4HM3B 4MJDA 3CNXA 3H51A 1OF5B 1WTHA 8CHOA 3EHCA 3KIIA 3CCL3 3F8HA 5FGOA 2OTL3 2OQEA 4EV2A 5I97A 1SJWA 3EX9A 1DVCA 3WA3A 4HYZA 4HZ9B 1ROAA 3MG3A 4KFDA 3G6E3 1ULIB 3G4S3 1OUNA 1A2KA 2XFSA 1VQ43 3T8NA 2Y74A 1OHPA 3QRDA 1A67A 4N6NB 1VZZA 3HI7A 1IQYA 5ELUA 1F8NA 1Q40B 1TP6A 2GEYA 3NQYA 4L8PA 1QJGA 1STFI 1M904 2GU1A 1ROVA 1WMPA 3I0YA 1M1XB 2CKFB 3X3YA 3FH1A 1CQSA 4RNYA 3WODG 1LVNA 2RFRA 3EC9A 3EQQB 1EG9B 3S29A 1LXEA 1QVG2 1K41A 2HMKB 1NDOB 1IVWA 2XR8B 4TX4A 5KP3A 5IW9A 2XGLA 4J8TA 3I553 1O7PB 1SQWA 1SIIA 2BMRB 3CU3A 2RCDA 4JF8A 4N6OB 4X2HA 3NXJA 3J7Yd 4EXRA 3SLUA 1VQM3 1GD4A 1HU9A 4O8SA 4OUQA 4EC6A 1TIJA 2GEXA 1IK3A 2K54A 4LMIA 5EEOA 3ROBA 1GYBA 2CWUA 5IENA 2JDIH 2CFDA 2IA7A 3HIIA 1VQ73 4PEJA 2BMOB 3EBYA 3OWUA 4JRFA 3DXOA 2HMJB 1RRHA 3IMAB 1G96A 5IG5A 1QAFA 2Z76A 2OWPA 2INXA 1VQN3 1QMAA 1W2ZA 2L4VA 1IV9A 3A76A 1ZX2A 3LXUX 1JB5A 3DZLA 3I563 1GY7A 3OWYA 4MMZB 5EQLA 4R1KA 3FZWA 3MHEA 3X40A 2W9QA 3LT8A 1GS3A 1YGEA 4XM4A 4FMBA 4N6UA 4HM0B 5A0OB 1IQ8A 2GXFA 1FA3A 3LTCA 3V92A 1JRQA 5STDA 4N6TA 4ORLA 1O7MB 3S27A 4FMCA 3G713 2E2UA 3F8XA 3BNCA 1W7CA 5JPUA 2STDA 4STDA 2XFTA 2PZVA 1VQ83 1MNLA 4I4KA 3RDEA 1NO3A 1IVVA 2OQEC 2E2TA 2B1XB 1W01A 2CC3A 4LSOA 1R4CA 2ZL8A 1JB4A 3FG1A 1TFKA 2WGQA 4FCZA 1N5PA 1DVDA 1STDA 1O7WB 1FGMA 1OGXA 3DY5A 3UL6A 3EN1B 1IV7A 3GWRA 3G0KA 1E97A 3CCU3 4HM7B 1JB2A 5BXQA 4XDWA 4X2OA 3B4PA 2P0XA 3O8YA 3CCM3 1W5ZA 2XH9A 1WQLB 1EA2A 3Q2PA 1A2VA 1O7GB 5DRVA 1YJW3 1W6GA 2CG1A 3WOFB 3FG4A 5IEOA 1D6UA 2Z6BA 3K9MC 1NWWA 3EE1A 4HKVB 1QVF2 3ALAA 2K0MA 3GZRA 3M8CA 1IT7A 4G1MB 3CC43 1YIJ3 2C10A 3K0ZA 5BVBA 1AR0A 1J2BA 3QK9A 3F14A 2IUJA 4BTYA 2HMOB 3DMCA 3E99A 4CCVA 1UI7A 1DYUA 2CIUA 4ZM8A 1NB3I 3FGYA 4AKYA 1FGOA 3CPW2 2JQ5A 3B7CA 2PNCA 1NJI4 1UW1A 2P05A 2W2CA 2Z77A 4MMYB 5JBSA 1RJOA 2FNQA 5CF1A 4L7KA 2QGUA 3WMDA 1AV4A 3BNEA 1VQ53 3X3XA 1FGRA 2M7OA 3SX1A 2YFJB 3L0RA 4O2HA 4K90B 1YVBI 1CEWI 3DM8A 1KSIA 5CXOA 1JJ22 3S5CA 4L8OA 1DMMA 5IG0A 2CFGA 3PCSA 3N9HA 4K61A 5EVHA 4NREA 2WOFA 2F86B 4EV5A 3LMLA 5IG3A 4N3VA 3IPTA 2P0MA 3RGRA 1NB5I 3JVCA 1N5HA 2IUKA 2MF7A 3PGBA 1VQ63 2W56A 3KE7A 2W0QA 3V98A 3DGOA 4KFFA 1WMOA 4HM1B 3MPHA 1YI23 4AKZA 3FKAA 1ISKA 1RKYA 3FG3A 5TGNA 4QWTA 1WNHA 1W4NA 3PS8A 1YJ93 2I9WA 3NBRA 3Q90A 2P09A 2Z7AA 3EJVA 5AIHA 1JV2B 1OHOA 1KWIA 3F40A 4R9KA 1TFOA 3RGAA 2OCTA 4XBTA 2OOVC 3CME3 2XRXB 3D9RA 3HK4A 3G8ZA 3NM7A 3UB1A 3PZWA 1IVXA 4CDLA 1YIT3 4HM6B 3NBBA 3DGNA 1VQK3 4HM8B 3UNLA 3F7SA 3FSDA 2D42A 3TDGA 1CYUA 3LZAA 5IEPA 2C11A 4J9AA 4MEIA 2QEX3 1VQP3 3CCV3 1W00A 5LC6A 1M1K4 1WMNA 3D3LA 3VGNA 2OTJ3 1OACA 1Z1SA 3GZXB 2BO9B 1QALA 2KCDA 3CPOA 3CC73 3X41A 2XSHB 1HKXA 3CCE3 1K9M4 2XF3A 3N54B 1KQS2 4R80A 5IF6A 3V99A 3NBJA 4O02B 5D81A 3NV0A 4IT7A 4XB5A 3HZPA 3GRDA 3UJMA 1LNHA 3BLZA 3BNBA 1BUQA 2YFIB 2R4IA 3EB8A 2W6JH 2HMNB 2OOVA 1W02A 1DMQA 3KZTA 7STDA 3EF8A 2O9UX 5KP1A 3B4OA 2WO0A 1V74A 1EQKA 4OVMA 5AYRB 2GBXB 3CCS3 2UX0A 2Y73A 2W56B 2IMJA 1IQXA 2GBWB 3NUVA 3NQZA 3F9SA 5AIIA 3KFQC 1ASKA 3FLJA 3Q1CA 4XBYA 4R4KA 1EKMA 4R9LA 3S67A 2CH9A 3AMOA 3LTAA 4HM5B 4WYKA 2CFLA 2W04A 1TU5A 5D83A 1DMNA 4H3UA 1D6ZA 1T5YA 1K8A4 1O7HB 1N8R4 1JN5B 4WHAA 5G2GA 5AEUB 1GY6A 2YX9A 1M9GA 4H61A 1SPUA 3WDGB 4FMAA 3CCR3 4N6LA 1CYVA 1IDPA 2BNGA 4IIAA 3WA2X 5ELJA 5HGRA 4GB5A 1Q824 4O3VA 2RSXA 4WP5A 3LT9A 2FGTA 3FCSB 3MWZA 2MC8A 1A90A 1FGQA 1Y4KA 5LC7A 1TUHA 5CLKA 3SOAA 1W6CA 2HMLB 3HIGA 1D6YA 2SBLA 5AIGA 1JNQA 1VQO3 4KZ1A 3CD63 2O3OA 2CWVA 4NHFA 1O7NB 2QA43 3DUKA 3JUMA 1S723 3ER7A 4WFOA 1E3RA 1RN7A 3K5TA 3PCRA 4HZBB 2D1WA 4K1VA 3SXXA 2CFWA 3NV0B 1K734 1FUWA 3T0UA 2RGQA 4FR9A 3VSYA 3OXAA 1U5OA 5IG4A 1AVLA 1N9EA 3BB9A 4HM4B 4RZMA 2LYXA 4LEHA 4HBRA 1RRLA 1OPYA 4BTWA 1Q814 1US1A 4FCJA 1N9JA 4MMXB 3SOYA 2KRTA 4K1UA 3JUPA 3OWSA 1PU4A 1OH0A 1QAKA 3GZYB 3OW22 3DGMA 5CF2A 3LOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML5 A;  2ML6 A;  4R4K A; 
#chains in the Genus database with same CATH topology
 2XSO B;  3WR2 A;  3DH2 A;  1NU3 A;  1RDS A;  9RNT A;  3KSE D;  1OHS A;  4HJL B;  4KFE A;  1JN5 A;  5FW5 A;  3VF1 A;  3H3H A;  4EYC A;  3T8U A;  4WYK B;  3AMO B;  3MYT A;  1YHQ 3;  1RN4 A;  1UUW B;  4WWU C;  3FF0 A;  1JKG A;  1LOX A;  2CW9 A;  5AI1 A;  2HMM B;  1VQQ A;  1BNS A;  3KN4 A;  3SYU A;  2W03 A;  3LH4 A;  2WGO A;  3U1W A;  3WOE B;  1N8Q A;  1RNT A;  4IPB A;  2CFK A;  1EUI C;  3ECF A;  3OV4 A;  3X3Z A;  1YGW A;  4GHO A;  1DET A;  5AEW B;  3DGY A;  5IER A;  1MOL A;  3LTB A;  1OGZ A;  1BIR A;  4XDV A;  1BNE A;  2CX1 A;  2SAR A;  3MG1 A;  5CK6 A;  2XEP A;  3JUO A;  3MSO A;  4XBX A;  3PYJ A;  3Q3F A;  3EN8 A;  3UL5 A;  2CWT A;  1Q86 4;  3OX9 A;  1PYL A;  6STD A;  2BMQ B;  3B8L A;  1JBS A;  1VQ9 3;  3KKG A;  3S28 A;  3DGL A;  2YFL B;  7RNT A;  2B24 B;  4Q53 A;  1B2M A;  1I2E A;  1FGT A;  4N6V 0;  2CX0 A;  3STD A;  3SVA A;  2CK3 H;  1AY7 A;  3CCQ 3;  1OF5 A;  1I3F A;  1BRH A;  1GMR A;  3NHX A;  4RBN A;  2F98 A;  2F99 A;  3HOH A;  4OK0 A;  4BTX A;  5JPP A;  1W2B 2;  4HVN A;  4U13 A;  5BU4 A;  1OCV A;  2AAE A;  1GD3 A;  2BT3 A;  3AGO A;  1RGC A;  3NM2 A;  2ZDJ A;  2Q07 A;  1BRK A;  2P38 A;  2HOH A;  2KXG A;  1IU7 A;  3HX8 A;  1YJN 3;  1Q42 A;  2ML5 A;  3G16 A;  1UUV B;  3MKI A;  1YVS A;  2H0I A;  5AYS C;  1Q40 A;  4FMD A;  3CXC 2;  3CC2 3;  1BRN L;  3PXM A;  2GU3 A;  1S5A A;  3WHO A;  2CHC A;  1K28 A;  1E3V A;  2FXT A;  1KD1 4;  1VQL 3;  1JJ2 2;  3FF2 A;  4KVH A;  3IJE B;  3K63 A;  3EBT A;  4N6M A;  5M19 A;  3F7X A;  2ML6 A;  1L5G B;  1LQG C;  2E2V A;  4I5Q A;  3CNM A;  4LZI A;  1SIH A;  1C54 A;  1ULJ B;  5D82 A;  1BAO A;  2BHM A;  3CMA 3;  3KSP A;  5AIF A;  1RCK A;  2W9P A;  4FCM A;  1JKG B;  5KP4 A;  1GY5 A;  3NX0 A;  1JBT A;  1PFP A;  1UCL A;  4EBG A;  1IT8 A;  2QIY A;  2BU4 A;  4HOH A;  4RNZ A;  4GL6 A;  1BSE A;  3JUN A;  3AHW A;  3SED A;  3X42 A;  2A15 A;  4AEQ A;  3CCJ 3;  1C7H A;  4CJN A;  4HM2 B;  4J5K A;  3RNT A;  1IVU A;  1I2F A;  3GAX A;  2F56 A;  3JUQ A;  1U8C B;  1AQZ A;  2J8X B;  1BOX A;  3LYG A;  1G02 A;  3BND A;  3GZB A;  1ZO2 A;  2V1L A;  3MG2 A;  1KC8 4;  1BRI A;  3N8B A;  3BU4 A;  2LQV A;  1UI8 A;  3LTD A;  2F4Y A;  1UUG B;  1W6Y A;  4LGQ A;  3K7C A;  3U97 A;  1BSA A;  4BL2 A;  5RNT A;  1Q7Y 4;  2WOH A;  2XGN A;  2CG0 A;  2AAD A;  5DRE A;  1AVK A;  4HM3 B;  4MJD A;  3CNX A;  1BSB A;  1BU4 A;  3H51 A;  1OF5 B;  1WTH A;  1BNR A;  2KF4 A;  8CHO A;  3EHC A;  2K3D A;  3KII A;  3CCL 3;  3F8H A;  5FGO A;  2OTL 3;  5BIR A;  2OQE A;  4EV2 A;  2L1S A;  5I97 A;  1UGI A;  1SJW A;  3EX9 A;  1DVC A;  3WA3 A;  1GMQ A;  4HYZ A;  4HZ9 B;  1ROA A;  1GSP A;  3MG3 A;  1RLS A;  4KFD A;  3G6E 3;  1ULI B;  3G4S 3;  1OUN A;  1A2K A;  2XFS A;  1VQ4 3;  3T8N A;  2Y74 A;  1OHP A;  3QRD A;  1A67 A;  4N6N B;  1VZZ A;  3HI7 A;  1TTO A;  6RNT A;  1IQY A;  5ELU A;  1F8N A;  1LOV A;  1Q40 B;  2H0G A;  1TP6 A;  5HOH A;  2GEY A;  3NQY A;  4L8P A;  1QJG A;  1SAR A;  1STF I;  1M90 4;  2GU1 A;  1ROV A;  1WMP A;  3I0Y A;  3D5I A;  1M1X B;  2CKF B;  3X3Y A;  1LNI A;  3FH1 A;  1CQS A;  4RNY A;  3WOD G;  1LVN A;  2RFR A;  3BIR A;  3EC9 A;  1EG9 B;  3EQQ B;  3S29 A;  1TU5 A;  1LXE A;  1QVG 2;  1K41 A;  2HMK B;  1NDO B;  1IVW A;  2XR8 B;  4TX4 A;  5KP3 A;  5IW9 A;  2XGL A;  4J8T A;  3I55 3;  1O7P B;  1SQW A;  2ZHX B;  1SII A;  2BMR B;  1R4Y A;  3CU3 A;  2RCD A;  4JF8 A;  4N6O B;  1BSC A;  4X2H A;  3NXJ A;  3J7Y d;  4EXR A;  3SLU A;  1MWT A;  1VQM 3;  1GD4 A;  1HU9 A;  4O8S A;  4OUQ A;  4EC6 A;  1TIJ A;  2GEX A;  1IK3 A;  2K54 A;  4LMI A;  5EEO A;  1MWU A;  3ROB A;  1GYB A;  2CWU A;  5IEN A;  1X1W A;  2JDI H;  2CFD A;  2IA7 A;  1I0V A;  3HII A;  1VQ7 3;  4PEJ A;  5M18 A;  2BMO B;  1LRA A;  3EBY A;  3OWU A;  3DXO A;  4JRF A;  2HMJ B;  1RRH A;  3IMA B;  3ZG0 A;  1G96 A;  5IG5 A;  1QAF A;  2Z76 A;  2OWP A;  1ZGX A;  1Q9E A;  2INX A;  1VQN 3;  1QMA A;  1W2Z A;  1BGS A;  2RBI A;  2L4V A;  1IV9 A;  3A76 A;  4LYL B;  1ZX2 A;  3LXU X;  1JB5 A;  3DZL A;  3I56 3;  4BL3 A;  1GY7 A;  3OWY A;  4MMZ B;  5EQL A;  4R1K A;  1Q7H A;  3FZW A;  3MHE A;  3X40 A;  2W9Q A;  3LT8 A;  1GS3 A;  1TRP A;  1B20 A;  1YGE A;  4XM4 A;  1B2X A;  4FMB A;  4N6U A;  2C4B A;  4HM0 B;  5A0O B;  1RGA A;  1IQ8 A;  2GXF A;  1FA3 A;  3D5G A;  3LTC A;  1BRG A;  1JRQ A;  5STD A;  3V92 A;  4N6T A;  1MGW A;  4ORL A;  1X1U A;  1BNI A;  1O7M B;  5M1A A;  3S27 A;  1B2S A;  4FMC A;  3G71 3;  2E2U A;  1RSN A;  3F8X A;  1VQ8 3;  3BNC A;  1W7C A;  5JPU A;  2STD A;  1GOY A;  2XFT A;  1T2H A;  2PZV A;  4STD A;  1MNL A;  4I4K A;  1RN1 A;  3RDE A;  1NO3 A;  1IVV A;  2OQE C;  2E2T A;  2B1X B;  1W01 A;  2CC3 A;  1BNJ A;  4LSO A;  2ZA4 A;  1MWS A;  1R4C A;  1JB4 A;  2ZL8 A;  3FG1 A;  1TFK A;  2WGQ A;  4FCZ A;  1LOY A;  1N5P A;  1DVD A;  8RNT A;  1MGR A;  1STD A;  1O7W B;  1FGM A;  1OGX A;  3DY5 A;  3UL6 A;  3EN1 B;  1MWR A;  1IV7 A;  5G1L A;  3GWR A;  3G0K A;  1E97 A;  3CCU 3;  1BVI A;  4HM7 B;  1JB2 A;  5BXQ A;  1NNV A;  1JZO A;  4X2O A;  3B4P A;  2P0X A;  3O8Y A;  4XDW A;  1UCJ A;  1W5Z A;  3CCM 3;  4RNT A;  2XH9 A;  2R41 A;  1WQL B;  1EA2 A;  3Q2P A;  1A2V A;  1O7G B;  5DRV A;  1JBR A;  1YJW 3;  1W6G A;  2CG1 A;  1I2G A;  3WOF B;  3FG4 A;  5IEO A;  1D6U A;  1A2P A;  2Z6B A;  3K9M C;  1NWW A;  3EE1 A;  3AHS A;  4HKV B;  1QVF 2;  1GOU A;  3ALA A;  2K0M A;  3GZR A;  3M8C A;  1IT7 A;  4BU4 A;  4G1M B;  3CC4 3;  1YIJ 3;  2C10 A;  3K0Z A;  5BVB A;  1B21 A;  1AR0 A;  1FUT A;  1FYS A;  1J2B A;  3QK9 A;  3F14 A;  2IUJ A;  4BTY A;  2HMO B;  4J5G A;  3DMC A;  3E99 A;  4CCV A;  1UI7 A;  1DYU A;  2CIU A;  1B3S A;  4ZM8 A;  4EW5 A;  1NB3 I;  3FGY A;  4AKY A;  1FGO A;  3CPW 2;  2JQ5 A;  3B7C A;  1RGG A;  2PNC A;  1NJI 4;  1UW1 A;  2P05 A;  2W2C A;  2Z77 A;  4MMY B;  5JBS A;  1LQM B;  1RJO A;  2FNQ A;  5CF1 A;  4L7K A;  2QGU A;  3WMD A;  1AV4 A;  3BNE A;  1VQ5 3;  1RGH A;  5CXO A;  3X3X A;  2F5W A;  1FGR A;  1GMP A;  2M7O A;  3SX1 A;  2RNT A;  2YFJ B;  3L0R A;  4K90 B;  1YVB I;  1CEW I;  1UGH I;  1KSI A;  1UCI A;  3DM8 A;  4O2H A;  1HYF A;  3S5C A;  4L8O A;  2KAA A;  1DMM A;  5IG0 A;  2CFG A;  3PCS A;  3N9H A;  4K61 A;  5EVH A;  4NRE A;  2F86 B;  2WOF A;  4EV5 A;  1BNG A;  3LML A;  4N3V A;  3IPT A;  2P0M A;  3RGR A;  5IG3 A;  1NB5 I;  3JVC A;  1N5H A;  2IUK A;  1BNF A;  2MF7 A;  3PGB A;  1VQ6 3;  2W56 A;  3KE7 A;  2W0Q A;  3V98 A;  2KF5 A;  1X1X A;  7GSP A;  1FW7 A;  3DGO A;  4KFF A;  1WMO A;  2UGI A;  1BAN A;  3MPH A;  2KF3 A;  4HM1 B;  1YI2 3;  1PY3 A;  3FKA A;  4AKZ A;  1ISK A;  1EEJ A;  1RKY A;  3FG3 A;  1UCK A;  4KT3 B;  4QWT A;  5TGN A;  1V58 A;  1WNH A;  1W4N A;  3PS8 A;  1YJ9 3;  2I9W A;  1I70 A;  3NBR A;  2P09 A;  2Z7A A;  3Q90 A;  2GSP A;  3EJV A;  5AIH A;  1JV2 B;  1OHO A;  1KWI A;  3F40 A;  1UDI I;  4R9K A;  1TFO A;  3RGA A;  6GSP A;  2OCT A;  4XBT A;  2OOV C;  3CME 3;  2XRX B;  3D9R A;  3HK4 A;  3G8Z A;  3NM7 A;  3GSP A;  3UB1 A;  3PZW A;  1IVX A;  1CH0 A;  4CDL A;  4HM6 B;  1YIT 3;  1RGL A;  2H0H A;  1I3I A;  3DGN A;  3NBB A;  4HM8 B;  3UNL A;  3F7S A;  1VQK 3;  1JZD A;  3FSD A;  2D42 A;  3TDG A;  1CYU A;  3ZG5 A;  3LZA A;  1ZS7 A;  5IEP A;  1T3B A;  2C11 A;  1RNB A;  4J9A A;  4BIR A;  4MEI A;  2QEX 3;  1VQP 3;  3CCV 3;  2BIR A;  1W00 A;  5LC6 A;  1M1K 4;  1WMN A;  3D3L A;  4GSP A;  3VGN A;  1OAC A;  1Z1S A;  3GZX B;  2BO9 B;  1QAL A;  2OTJ 3;  1BSD A;  2KCD A;  3AGN A;  3CPO A;  3CC7 3;  2IYJ A;  3X41 A;  2XSH B;  1HKX A;  3CCE 3;  1K9M 4;  2XF3 A;  3N54 B;  1KQS 2;  4R80 A;  5IF6 A;  4ILF A;  2UUG C;  3V99 A;  3NBJ A;  3KCH A;  4O02 B;  5D81 A;  1TRQ A;  3NV0 A;  4IT7 A;  4XB5 A;  3HZP A;  1B2U A;  3GRD A;  3UJM A;  1LNH A;  3BLZ A;  1FZU A;  3BNB A;  1BUQ A;  2YFI B;  1RGF A;  4HAA A;  2R4I A;  5G1K A;  3EB8 A;  2W6J H;  2HMN B;  2OOV A;  1W02 A;  1IYY A;  1HZ1 A;  1DMQ A;  3KZT A;  7STD A;  3ZFZ A;  3EF8 A;  2O9U X;  5KP1 A;  4CPK A;  3B4O A;  2WO0 A;  1V74 A;  1I0X A;  1EQK A;  1I8V A;  4OVM A;  5AYR B;  2GBX B;  1TJD A;  3CCS 3;  1DE3 A;  2UX0 A;  2Y73 A;  2W56 B;  2IMJ A;  1IQX A;  2GBW B;  3NUV A;  3NQZ A;  3F9S A;  4NPB A;  5AII A;  3KFQ C;  1ASK A;  3FLJ A;  3Q1C A;  1B27 A;  4R4K A;  1EKM A;  1V57 A;  4R9L A;  4XBY A;  3S67 A;  2CH9 A;  1BRJ A;  3AMO A;  3D4A A;  3LTA A;  2CFL A;  2W04 A;  4HM5 B;  4WYK A;  5D83 A;  1DMN A;  4H3U A;  1D6Z A;  1T5Y A;  1K8A 4;  1O7H B;  1N8R 4;  1JN5 B;  4WHA A;  5G2G A;  5AEU B;  1GY6 A;  1RGK A;  2YX9 A;  1M9G A;  1YNV X;  4H61 A;  1SPU A;  3WDG B;  4FMA A;  3CCR 3;  4N6L A;  1CYV A;  2F5M A;  1RMS A;  1IDP A;  2BNG A;  4IIA A;  3WA2 X;  2KF6 A;  5ELJ A;  5HGR A;  4GB5 A;  1Q82 4;  4O3V A;  2RSX A;  4WP5 A;  1G0T A;  3LT9 A;  2FGT A;  3FCS B;  3MWZ A;  2MC8 A;  1A90 A;  1T2I A;  1FGQ A;  1Y4K A;  5LC7 A;  1TUH A;  5CLK A;  3SOA A;  1W6C A;  2HML B;  2IY2 A;  3HIG A;  3A5E A;  1RTU A;  1D6Y A;  2SBL A;  5AIG A;  1JNQ A;  1VQO 3;  4KZ1 A;  1LOW A;  3CD6 3;  2O3O A;  2CWV A;  4NHF A;  1O7N B;  2QA4 3;  1RCL A;  3DUK A;  3JUM A;  1S72 3;  3ER7 A;  4WFO A;  1E3R A;  1RN7 A;  3K5T A;  3PCR A;  4HZB B;  2D1W A;  4K1V A;  3SXX A;  2CFW A;  3NV0 B;  1K73 4;  3URP A;  3T0U A;  1FUW A;  2RGQ A;  4FR9 A;  5GSP A;  3VSY A;  3OXA A;  1BUJ A;  1U5O A;  5IG4 A;  1AVL A;  1N9E A;  3BB9 A;  4HM4 B;  4RZM A;  2LYX A;  4LEH A;  4HBR A;  1RRL A;  1BRS A;  1OPY A;  1RHL A;  1X1Y A;  4BTW A;  1Q81 4;  1US1 A;  4DKI A;  4FCJ A;  1N9J A;  4MMX B;  3SOY A;  1GOV A;  1FUS A;  1B2Z A;  2KRT A;  4K1U A;  3JUP A;  3OWS A;  1PU4 A;  1OH0 A;  1QAK A;  1RGE A;  3GZY B;  3DGM A;  3OW2 2;  5CF2 A;  3D79 A;  3LOY A; 
#chains in the Genus database with same CATH homology
 2XSO B;  1NU3 A;  3KSE D;  1OHS A;  4HJL B;  4KFE A;  1JN5 A;  5FW5 A;  3VF1 A;  3H3H A;  4EYC A;  3T8U A;  4WYK B;  3AMO B;  3MYT A;  1YHQ 3;  1UUW B;  4WWU C;  3FF0 A;  1JKG A;  1LOX A;  2CW9 A;  5AI1 A;  2HMM B;  3KN4 A;  2W03 A;  3LH4 A;  2WGO A;  3U1W A;  3WOE B;  1N8Q A;  4IPB A;  2CFK A;  3ECF A;  3OV4 A;  3X3Z A;  5AEW B;  5IER A;  1MOL A;  3LTB A;  1OGZ A;  4XDV A;  3MG1 A;  5CK6 A;  2XEP A;  3JUO A;  3MSO A;  4XBX A;  3PYJ A;  3EN8 A;  3UL5 A;  2CWT A;  1Q86 4;  3OX9 A;  6STD A;  2BMQ B;  3B8L A;  1VQ9 3;  3KKG A;  3S28 A;  3DGL A;  2YFL B;  2B24 B;  4Q53 A;  1FGT A;  4N6V 0;  3STD A;  3SVA A;  2CK3 H;  3CCQ 3;  1OF5 A;  3NHX A;  4RBN A;  2F98 A;  2F99 A;  4OK0 A;  4BTX A;  5JPP A;  1W2B 2;  4HVN A;  4U13 A;  1OCV A;  1GD3 A;  2BT3 A;  3NM2 A;  2ZDJ A;  2Q07 A;  2P38 A;  2KXG A;  1IU7 A;  3HX8 A;  1YJN 3;  1Q42 A;  2ML5 A;  3G16 A;  1UUV B;  3MKI A;  5AYS C;  1Q40 A;  4FMD A;  3CXC 2;  3CC2 3;  3PXM A;  2GU3 A;  1S5A A;  2CHC A;  1K28 A;  1E3V A;  2FXT A;  1KD1 4;  1VQL 3;  3FF2 A;  4KVH A;  3IJE B;  3K63 A;  3EBT A;  4N6M A;  3F7X A;  2ML6 A;  1L5G B;  2E2V A;  3CNM A;  4LZI A;  1SIH A;  1ULJ B;  5D82 A;  2BHM A;  3CMA 3;  3KSP A;  5AIF A;  2W9P A;  4FCM A;  1JKG B;  5KP4 A;  1GY5 A;  3NX0 A;  1PFP A;  4EBG A;  1IT8 A;  2QIY A;  4RNZ A;  4GL6 A;  3JUN A;  3SED A;  3X42 A;  2A15 A;  4AEQ A;  3CCJ 3;  1C7H A;  4HM2 B;  1IVU A;  3GAX A;  3JUQ A;  1U8C B;  3LYG A;  3BND A;  3GZB A;  3MG2 A;  1ZO2 A;  2V1L A;  1KC8 4;  3N8B A;  2LQV A;  1UI8 A;  3LTD A;  1W6Y A;  4LGQ A;  3K7C A;  3U97 A;  1Q7Y 4;  2WOH A;  2XGN A;  2CG0 A;  5DRE A;  1AVK A;  4HM3 B;  4MJD A;  3CNX A;  3H51 A;  1OF5 B;  1WTH A;  8CHO A;  3EHC A;  3KII A;  3CCL 3;  3F8H A;  5FGO A;  2OTL 3;  2OQE A;  4EV2 A;  5I97 A;  1SJW A;  3EX9 A;  1DVC A;  3WA3 A;  4HYZ A;  4HZ9 B;  1ROA A;  3MG3 A;  4KFD A;  3G6E 3;  1ULI B;  3G4S 3;  1OUN A;  1A2K A;  2XFS A;  1VQ4 3;  3T8N A;  2Y74 A;  1OHP A;  3QRD A;  1A67 A;  4N6N B;  1VZZ A;  3HI7 A;  1IQY A;  5ELU A;  1F8N A;  1Q40 B;  1TP6 A;  2GEY A;  3NQY A;  4L8P A;  1QJG A;  1STF I;  1M90 4;  2GU1 A;  1ROV A;  1WMP A;  3I0Y A;  1M1X B;  2CKF B;  3X3Y A;  3FH1 A;  1CQS A;  4RNY A;  3WOD G;  1LVN A;  2RFR A;  3EC9 A;  3EQQ B;  1EG9 B;  3S29 A;  1LXE A;  1QVG 2;  1K41 A;  2HMK B;  1NDO B;  1IVW A;  2XR8 B;  4TX4 A;  5KP3 A;  5IW9 A;  2XGL A;  4J8T A;  3I55 3;  1O7P B;  1SQW A;  1SII A;  2BMR B;  3CU3 A;  2RCD A;  4JF8 A;  4N6O B;  4X2H A;  3NXJ A;  3J7Y d;  4EXR A;  3SLU A;  1VQM 3;  1GD4 A;  1HU9 A;  4O8S A;  4OUQ A;  4EC6 A;  1TIJ A;  2GEX A;  1IK3 A;  2K54 A;  4LMI A;  5EEO A;  3ROB A;  1GYB A;  2CWU A;  5IEN A;  2JDI H;  2CFD A;  2IA7 A;  3HII A;  1VQ7 3;  4PEJ A;  2BMO B;  3EBY A;  3OWU A;  4JRF A;  3DXO A;  2HMJ B;  1RRH A;  3IMA B;  1G96 A;  5IG5 A;  1QAF A;  2Z76 A;  2OWP A;  2INX A;  1VQN 3;  1QMA A;  1W2Z A;  2L4V A;  1IV9 A;  3A76 A;  1ZX2 A;  3LXU X;  1JB5 A;  3DZL A;  3I56 3;  1GY7 A;  3OWY A;  4MMZ B;  5EQL A;  4R1K A;  3FZW A;  3MHE A;  3X40 A;  2W9Q A;  3LT8 A;  1GS3 A;  1YGE A;  4XM4 A;  4FMB A;  4N6U A;  4HM0 B;  5A0O B;  1IQ8 A;  2GXF A;  1FA3 A;  3LTC A;  3V92 A;  1JRQ A;  5STD A;  4N6T A;  4ORL A;  1O7M B;  3S27 A;  4FMC A;  3G71 3;  2E2U A;  3F8X A;  3BNC A;  1W7C A;  5JPU A;  2STD A;  4STD A;  2XFT A;  2PZV A;  1VQ8 3;  1MNL A;  4I4K A;  3RDE A;  1NO3 A;  1IVV A;  2OQE C;  2E2T A;  2B1X B;  1W01 A;  2CC3 A;  4LSO A;  1R4C A;  2ZL8 A;  1JB4 A;  3FG1 A;  1TFK A;  2WGQ A;  4FCZ A;  1N5P A;  1DVD A;  1STD A;  1O7W B;  1FGM A;  1OGX A;  3DY5 A;  3UL6 A;  3EN1 B;  1IV7 A;  3GWR A;  3G0K A;  1E97 A;  3CCU 3;  4HM7 B;  1JB2 A;  5BXQ A;  4XDW A;  4X2O A;  3B4P A;  2P0X A;  3O8Y A;  3CCM 3;  1W5Z A;  2XH9 A;  1WQL B;  1EA2 A;  3Q2P A;  1A2V A;  1O7G B;  5DRV A;  1YJW 3;  1W6G A;  2CG1 A;  3WOF B;  3FG4 A;  5IEO A;  1D6U A;  2Z6B A;  3K9M C;  1NWW A;  3EE1 A;  4HKV B;  1QVF 2;  3ALA A;  2K0M A;  3GZR A;  3M8C A;  1IT7 A;  4G1M B;  3CC4 3;  1YIJ 3;  2C10 A;  3K0Z A;  5BVB A;  1AR0 A;  1J2B A;  3QK9 A;  3F14 A;  2IUJ A;  4BTY A;  2HMO B;  3DMC A;  3E99 A;  4CCV A;  1UI7 A;  1DYU A;  2CIU A;  4ZM8 A;  1NB3 I;  3FGY A;  4AKY A;  1FGO A;  3CPW 2;  2JQ5 A;  3B7C A;  2PNC A;  1NJI 4;  1UW1 A;  2P05 A;  2W2C A;  2Z77 A;  4MMY B;  5JBS A;  1RJO A;  2FNQ A;  5CF1 A;  4L7K A;  2QGU A;  3WMD A;  1AV4 A;  3BNE A;  1VQ5 3;  3X3X A;  1FGR A;  2M7O A;  3SX1 A;  2YFJ B;  3L0R A;  4O2H A;  4K90 B;  1YVB I;  1CEW I;  3DM8 A;  1KSI A;  5CXO A;  1JJ2 2;  3S5C A;  4L8O A;  1DMM A;  5IG0 A;  2CFG A;  3PCS A;  3N9H A;  4K61 A;  5EVH A;  4NRE A;  2WOF A;  2F86 B;  4EV5 A;  3LML A;  5IG3 A;  4N3V A;  3IPT A;  2P0M A;  3RGR A;  1NB5 I;  3JVC A;  1N5H A;  2IUK A;  2MF7 A;  3PGB A;  1VQ6 3;  2W56 A;  3KE7 A;  2W0Q A;  3V98 A;  3DGO A;  4KFF A;  1WMO A;  4HM1 B;  3MPH A;  1YI2 3;  4AKZ A;  3FKA A;  1ISK A;  1RKY A;  3FG3 A;  5TGN A;  4QWT A;  1WNH A;  1W4N A;  3PS8 A;  1YJ9 3;  2I9W A;  3NBR A;  3Q90 A;  2P09 A;  2Z7A A;  3EJV A;  5AIH A;  1JV2 B;  1OHO A;  1KWI A;  3F40 A;  4R9K A;  1TFO A;  3RGA A;  2OCT A;  4XBT A;  2OOV C;  3CME 3;  2XRX B;  3D9R A;  3HK4 A;  3G8Z A;  3NM7 A;  3UB1 A;  3PZW A;  1IVX A;  4CDL A;  1YIT 3;  4HM6 B;  3NBB A;  3DGN A;  1VQK 3;  4HM8 B;  3UNL A;  3F7S A;  3FSD A;  2D42 A;  3TDG A;  1CYU A;  3LZA A;  5IEP A;  2C11 A;  4J9A A;  4MEI A;  2QEX 3;  1VQP 3;  3CCV 3;  1W00 A;  5LC6 A;  1M1K 4;  1WMN A;  3D3L A;  3VGN A;  2OTJ 3;  1OAC A;  1Z1S A;  3GZX B;  2BO9 B;  1QAL A;  2KCD A;  3CPO A;  3CC7 3;  3X41 A;  2XSH B;  1HKX A;  3CCE 3;  1K9M 4;  2XF3 A;  3N54 B;  1KQS 2;  4R80 A;  5IF6 A;  3V99 A;  3NBJ A;  4O02 B;  5D81 A;  3NV0 A;  4IT7 A;  4XB5 A;  3HZP A;  3GRD A;  3UJM A;  1LNH A;  3BLZ A;  3BNB A;  1BUQ A;  2YFI B;  2R4I A;  3EB8 A;  2W6J H;  2HMN B;  2OOV A;  1W02 A;  1DMQ A;  3KZT A;  7STD A;  3EF8 A;  2O9U X;  5KP1 A;  3B4O A;  2WO0 A;  1V74 A;  1EQK A;  4OVM A;  5AYR B;  2GBX B;  3CCS 3;  2UX0 A;  2Y73 A;  2W56 B;  2IMJ A;  1IQX A;  2GBW B;  3NUV A;  3NQZ A;  3F9S A;  5AII A;  3KFQ C;  1ASK A;  3FLJ A;  3Q1C A;  4XBY A;  4R4K A;  1EKM A;  4R9L A;  3S67 A;  2CH9 A;  3AMO A;  3LTA A;  4HM5 B;  4WYK A;  2CFL A;  2W04 A;  1TU5 A;  5D83 A;  1DMN A;  4H3U A;  1D6Z A;  1T5Y A;  1K8A 4;  1O7H B;  1N8R 4;  1JN5 B;  4WHA A;  5G2G A;  5AEU B;  1GY6 A;  2YX9 A;  1M9G A;  4H61 A;  1SPU A;  3WDG B;  4FMA A;  3CCR 3;  4N6L A;  1CYV A;  1IDP A;  2BNG A;  4IIA A;  3WA2 X;  5ELJ A;  5HGR A;  4GB5 A;  1Q82 4;  4O3V A;  2RSX A;  4WP5 A;  3LT9 A;  2FGT A;  3FCS B;  3MWZ A;  2MC8 A;  1A90 A;  1FGQ A;  1Y4K A;  5LC7 A;  1TUH A;  5CLK A;  3SOA A;  1W6C A;  2HML B;  3HIG A;  1D6Y A;  2SBL A;  5AIG A;  1JNQ A;  1VQO 3;  4KZ1 A;  3CD6 3;  2O3O A;  2CWV A;  4NHF A;  1O7N B;  2QA4 3;  3DUK A;  3JUM A;  1S72 3;  3ER7 A;  4WFO A;  1E3R A;  1RN7 A;  3K5T A;  3PCR A;  4HZB B;  2D1W A;  4K1V A;  3SXX A;  2CFW A;  3NV0 B;  1K73 4;  1FUW A;  3T0U A;  2RGQ A;  4FR9 A;  3VSY A;  3OXA A;  1U5O A;  5IG4 A;  1AVL A;  1N9E A;  3BB9 A;  4HM4 B;  4RZM A;  2LYX A;  4LEH A;  4HBR A;  1RRL A;  1OPY A;  4BTW A;  1Q81 4;  1US1 A;  4FCJ A;  1N9J A;  4MMX B;  3SOY A;  2KRT A;  4K1U A;  3JUP A;  3OWS A;  1PU4 A;  1OH0 A;  1QAK A;  3GZY B;  3OW2 2;  3DGM A;  5CF2 A;  3LOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...