2ML5A

Nmr structure of protein zp_02064002.1 from bacteroides ovatus atcc 8483
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
b'GDSELTTQDGEDFKSFLDKFTSSAAFQYTRVKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERITQEEGGIYVSKFTLNEPKHKIFEAGYEESEVDLRVEFELQADGKWYVVDCYTGWYGYDLPIGELKQTIQNVKEENAAFKEIHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of protein ZP_02064002.1 from Bacteroides ovatus ATCC 8483
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ml5A00
4R4KA 2ML5A 2ML6A
chains in the Genus database with same CATH superfamily
4LZIA 1FGQA 2K54A 3JUPA 3LH4A 1W00A 3BB9A 3LT8A 3DGLA 3LT9A 3Q1CA 3S29A 7GSPA 4FCZA 1J2BA 3I553 3WHOA 1OUNA 3DY5A 4KZ1A 1YGWA 1BNGA 3JUNA 4N6UA 2FXTA 8CHOA 1K734 1IT8A 2Y74A 1LQMB 5IW9A 5EEOA 1RGAA 3FG4A 1WNHA 5GSPA 1I8VA 1O7MB 1I2FA 3FSDA 3WOEB 1Q824 3GWRA 3NM7A 1TUHA 2GEYA 4FCJA 4I4KA 2ML5A 1NB3I 2IA7A 5AYSC 1E97A 1I2GA 1WMPA 1BSEA 1NNVA 3JVCA 1RNBA 1W01A 2Y73A 1B2XA 2H0GA 4FMAA 2GEXA 4MMXB 1ZGXA 4K61A 2F4YA 4KVHA 1JZDA 4BTXA 5IG5A 2BHMA 3FF2A 1YJ93 3MG1A 4LEHA 1FGRA 1N8R4 1SARA 3OV4A 5ELJA 1LNHA 1N9EA 1RRHA 2R4IA 3JUOA 5JPPA 1S5AA 1STFI 5AIIA 3CC73 1V58A 2SARA 2YX9A 1B2SA 3O8YA 2MC8A 1N9JA 1TU5A 1A90A 1MWTA 1KQS2 1BANA 1IDPA 2F98A 4GB5A 3EC9A 2CWVA 2ZA4A 5IG0A 3LTDA 3UNLA 1B27A 1STDA 2GBXB 2SBLA 3FGYA 5ELUA 1Q42A 6STDA 5IG4A 1FYSA 1Q814 1OHSA 1VZZA 3UB1A 4J8TA 1BSDA 3OWSA 1OCVA 4HYZA 2XRXB 2WO0A 4K1VA 3G4S3 4GL6A 2IUKA 1TFOA 4OK0A 1NU3A 1RHLA 1WQLB 3T8UA 2CFLA 3HX8A 2CFDA 3OWUA 1VQ93 4WYKA 5CXOA 1QAFA 1ROAA 2W56A 5IF6A 1EQKA 1FGOA 3LOYA 2XEPA 2OTL3 4KFDA 1GMPA 1TTOA 3RGRA 4XBYA 4N6NB 1QAKA 1MWRA 1GD4A 2ZL8A 5KP4A 1E3RA 3D4AA 2YFLB 1NB5I 6GSPA 2K0MA 1MWUA 1DYUA 3T8NA 4AEQA 3I563 1C54A 4LMIA 1UW1A 2ZDJA 4R4KA 4BU4A 3Q90A 3FKAA 1Q40B 1OHOA 3AGOA 3B4OA 1RTUA 1BNRA 3NUVA 3UJMA 1RSNA 2XSHB 4XB5A 3SXXA 2L1SA 4HM4B 6RNTA 3NM2A 4MEIA 2KXGA 3G713 3CCE3 3IPTA 4EYCA 2WOFA 1OH0A 3L0RA 3WA2X 3X42A 1VQ63 1LOVA 2OOVA 4ORLA 2BNGA 4LSOA 3LMLA 2L4VA 1JV2B 1GY5A 2W04A 3STDA 1SPUA 1Q864 1I3FA 1W2B2 1BSCA 1W2ZA 3WA3A 2P38A 2UX0A 1VQL3 1BUJA 3EN8A 1JJ22 4GSPA 4LYLB 3VSYA 1BRGA 3NBBA 5CF1A 4X2OA 3MG2A 1ISKA 2QGUA 3DGNA 7STDA 3HIIA 5AEWB 1I0VA 1BRKA 1IYYA 3ECFA 3NBJA 1CYUA 3HI7A 4KFEA 9RNTA 4EBGA 3CXC2 2IYJA 3B4PA 1MWSA 1FGTA 3V92A 3ALAA 3FF0A 3PGBA 3SX1A 3H3HA 4FMBA 3WDGB 3K9MC 5AIFA 2CW9A 2CHCA 2W6JH 5KP3A 4X2HA 5BXQA 5IEPA 1O7WB 1QALA 1W7CA 3TDGA 1SJWA 1TRQA 2IMJA 4WFOA 1BNJA 1LOXA 1JN5A 1VQP3 3EF8A 1AVKA 5LC7A 1BNEA 4ILFA 4IT7A 1BRIA 2JQ5A 1IVUA 3MG3A 3ZG0A 1NWWA 1BU4A 2P09A 3J7Yd 1UI7A 4R9KA 3FH1A 2LQVA 1N8QA 4JRFA 1JNQA 1FW7A 2CKFB 1DVCA 3EBTA 3GRDA 1AQZA 1D6YA 4EV5A 1UUVB 3SLUA 1OF5B 1OACA 4I5QA 2P0XA 4R9LA 3CME3 1K28A 1E3VA 1LOWA 4LGQA 2CX1A 1M1XB 4RBNA 2PNCA 4R80A 1A67A 2CG0A 2QEX3 1W6CA 3OXAA 1FA3A 2F99A 1RNTA 3KFQC 3PXMA 2Z77A 4H3UA 3WR2A 2BMOB 4KFFA 5AI1A 2XR8B 1UCKA 1M1K4 4WWUC 1RGFA 3F7SA 1OGZA 3PCSA 2ML6A 4HM0B 1D6UA 2HMKB 4WHAA 3KCHA 3CMA3 1AV4A 3KKGA 1HKXA 1OGXA 1Z1SA 3WODG 1RGLA 3PZWA 1PY3A 2GU3A 2Q07A 3RNTA 1S723 2CX0A 3LTAA 8RNTA 3X3XA 3NHXA 5A0OB 1ZS7A 3MKIA 1L5GB 3MSOA 1O7NB 4XM4A 2FNQA 1RN4A 2OQEC 4AKYA 4DKIA 2HOHA 7RNTA 4RZMA 1GYBA 3UL6A 1JBRA 1B20A 5HOHA 2W2CA 2CFWA 3D5IA 5M1AA 3PS8A 3QRDA 1LOYA 3DXOA 1HYFA 1AY7A 2OTJ3 1VQ83 5M19A 4TX4A 1IV9A 1U8CB 2O9UX 1JBTA 3HK4A 3JUMA 3N9HA 1SIHA 2E2UA 1IVWA 2BU4A 2HMJB 4PEJA 4RNZA 3ER7A 3K5TA 1KC84 1QVG2 5CK6A 4CJNA 1JBSA 4IPBA 3NBRA 4G1MB 1GMQA 1JB5A 5BIRA 3GAXA 1HU9A 1MGRA 2HMOB 1FUWA 3CD63 1YGEA 1VQ73 1OPYA 1Q7HA 2OWPA 1LXEA 1ZX2A 3F14A 1RJOA 2RFRA 1WTHA 3G16A 3K7CA 3N8BA 3F9SA 1VQN3 1UDII 1W02A 4J5GA 1WMOA 2BO9B 2E2VA 3DZLA 3EE1A 1RGKA 1W6YA 4HM7B 1BRHA 3CCL3 1GY7A 4NPBA 3CCV3 1CYVA 2LYXA 1W5ZA 4HVNA 1UI8A 3CCU3 1RCKA 1FUSA 3BIRA 1IVVA 1IQYA 3QK9A 4GHOA 2UUGC 3U1WA 2CC3A 4N3VA 3NQZA 1US1A 4FCMA 2F56A 2W9PA 4HM2B 3KSPA 5D82A 3Q2PA 1GOYA 4WYKB 3GSPA 1CH0A 4U13A 1UUGB 5BVBA 1IV7A 5BU4A 3LTCA 3S5CA 1I2EA 1B3SA 1RKYA 1JRQA 4FR9A 1QMAA 5KP1A 3ZG5A 1YNVX 3HOHA 1OHPA 3LTBA 3M8CA 4O2HA 5M18A 1AR0A 1IT7A 3FCSB 3CCQ3 1NO3A 2MF7A 3DGOA 2Z76A 2BMQB 2KF3A 3D5GA 5D81A 3MPHA 1JKGB 2WGOA 3A5EA 4MJDA 3ROBA 5FGOA 3RDEA 3KN4A 4BTYA 2RCDA 4HM8B 2CWTA 1K41A 4QWTA 3SOYA 5RNTA 3CCJ3 3OX9A 4HM5B 1CEWI 3CC43 1RN7A 4STDA 3SOAA 1I3IA 5I97A 4K1UA 1UGIA 1UGHI 1RDSA 1X1XA 2B24B 3KZTA 2W9QA 1BRSA 3NV0A 5G1KA 2ZHXB 5CLKA 3EQQB 4L8PA 3B8LA 3LXUX 3SEDA 2P0MA 4O3VA 1A2KA 1BIRA 2KF4A 1VQM3 2GU1A 3K63A 3CCM3 1DMQA 3CNMA 3GZYB 3HIGA 3G6E3 1RRLA 1RGCA 5AYRB 1YVBI 1BSAA 3CCR3 1GY6A 4RNTA 3S67A 3V99A 2OOVC 2UGIA 3KE7A 1T3BA 1ZO2A 3NQYA 1G0TA 5JPUA 1ULJB 2KCDA 1OF5A 3AMOB 2BIRA 1PU4A 1K8A4 3DGYA 4N6MA 5EQLA 1K9M4 3PCRA 3VGNA 3FLJA 2IUJA 2INXA 5G1LA 1TP6A 1NDOB 1BUQA 4EXRA 2GSPA 1UCJA 3OW22 4JF8A 1O7PB 1UCIA 2RBIA 3CNXA 1PYLA 4K90B 2CFGA 1IQ8A 1BNFA 1BRNL 1GS3A 3G8ZA 3FG1A 1KD14 1VQ43 1IQXA 1JN5B 1G96A 4NREA 1BSBA 1G02A 2F5MA 1VQK3 3F8HA 2O3OA 3N54B 3AHWA 1ROVA 3AHSA 4EC6A 1YJW3 1T2HA 4WP5A 4HJLB 2V1LA 1KWIA 2HMLB 3OWYA 1YVSA 3FZWA 4O02B 4XDVA 3S27A 2BT3A 4EW5A 4N6OB 1C7HA 1BNIA 5STDA 1T2IA 1JB2A 1UUWB 2WOHA 1EUIC 1QJGA 2YFJB 3LZAA 4N6LA 4CPKA 1AVLA 1SIIA 1RGGA 3D9RA 1X1YA 3NXJA 3CCS3 1CQSA 1EA2A 2W0QA 3EBYA 1HZ1A 1LQGC 2XH9A 3GZRA 4HOHA 1ASKA 1JZOA 2XGLA 1F8NA 3BNEA 5LC6A 4HM6B 2XFTA 2A15A 2H0IA 1GOUA 3I0YA 1FUTA 4HBRA 3MWZA 3IMAB 2KRTA 1B2MA 2XFSA 4OUQA 5TGNA 1Q7Y4 1A2PA 2RNTA 2STDA 2XSOB 4Q53A 3UL5A 3CPW2 3EHCA 1WMNA 2YFIB 3KIIA 4XDWA 3X3ZA 1FZUA 5EVHA 3EX9A 4BTWA 4HZBB 3U97A 2I9WA 1GD3A 1O7GB 3DUKA 4MMZB 1GSPA 3K0ZA 2F5WA 4L8OA 1Q40A 2CWUA 2XF3A 3CU3A 3D3LA 4HKVB 3GZXB 3SYUA 5CF2A 1BNSA 4HZ9B 3RGAA 2Z6BA 1X1WA 1BRJA 4OVMA 1SQWA 4H61A 2B1XB 2HMMB 1DVDA 2JDIH 2Z7AA 3VF1A 1I0XA 4HM3B 3CPOA 2IY2A 3E99A 3URPA 4CCVA 1LRAA 3DH2A 1YIJ3 1LVNA 3MHEA 1RN1A 1W4NA 1EEJA 2CFKA 4BIRA 1TRPA 2BMRB 4AKZA 1A2VA 1Y4KA 2M7OA 2C10A 2QIYA 5IENA 2W56B 2KF5A 3MYTA 3ZFZA 1YHQ3 1R4YA 3T0UA 1MNLA 2GBWB 5DREA 3X40A 3WMDA 3EJVA 3F7XA 3JUQA 5G2GA 1KSIA 1JKGA 1RGHA 2R41A 3EB8A 5HGRA 2WGQA 2H0HA 3WOFB 3B7CA 2F86B 1TJDA 1BGSA 2E2TA 5D83A 3FG3A 1YIT3 2KAAA 4FMDA 1BAOA 4RNYA 2W03A 1FGMA 1GMRA 3HZPA 1IU7A 1IVXA 2KF6A 2HMNB 3X3YA 3BNDA 1GOVA 1MOLA 1O7HB 4N6V0 1BVIA 1D6ZA 4BL3A 4IIAA 1YI23 4BL2A 1R4CA 2D1WA 3BNBA 4O8SA 1B2UA 5IEOA 1VQ53 2GXFA 1V57A 1TIJA 3NX0A 1QVF2 2CG1A 4XBXA 4KT3B 3SVAA 5FW5A 4HAAA 4EV2A 3F40A 3BNCA 1B21A 1M904 3EN1B 4ZM8A 2C11A 3DM8A 1DMNA 1DMMA 1DETA 5JBSA 2J8XB 3DMCA 5AIHA 3V98A 3X41A 3GZBA 4J5KA 4MMYB 1Q9EA 1W6GA 1N5PA 2AADA 2CIUA 1IK3A 1NJI4 3H51A 2FGTA 3D79A 2RGQA 3Q3FA 4XBTA 1X1UA 1TFKA 1EG9B 2RSXA 2XGNA 1B2ZA 1MGWA 1VQQA 3AMOA 3BU4A 4L7KA 3G0KA 1VQO3 1RLSA 3KSED 2K3DA 2C4BA 1RGEA 4N6TA 1V74A 3CC23 1U5OA 1ULIB 3A76A 2QA43 1YJN3 5DRVA 2P05A 3LYGA 1EKMA 4FMCA 2AAEA 2CK3H 4J9AA 4HM1B 3DGMA 1BOXA 1PFPA 3F8XA 2D42A 1JB4A 1I70A 1T5YA 4NHFA 3S28A 1LNIA 3NV0B 4CDLA 2OCTA 1UCLA 5AEUB 2PZVA 5IG3A 5AIGA 1RCLA 5IERA 1DE3A 1M9GA 2OQEA 1RMSA 4R1KA 3BLZA 1N5HA 3AGNA 2CH9A 3PYJA 3IJEB
chains in the Genus database with same CATH topology
4LZIA 1FGQA 2K54A 3JUPA 3LH4A 1W00A 3BB9A 3LT8A 3DGLA 3LT9A 3Q1CA 3S29A 4FCZA 1J2BA 3I553 1OUNA 3DY5A 4KZ1A 3JUNA 4N6UA 2FXTA 8CHOA 1K734 1IT8A 2Y74A 5IW9A 5EEOA 3FG4A 1WNHA 1O7MB 3FSDA 3WOEB 1Q824 3GWRA 3NM7A 1TUHA 2GEYA 4FCJA 4I4KA 2ML5A 1NB3I 2IA7A 5AYSC 1E97A 1WMPA 3JVCA 1W01A 2Y73A 4FMAA 4MMXB 2GEXA 4K61A 4KVHA 4BTXA 5IG5A 2BHMA 3FF2A 1YJ93 3MG1A 4LEHA 1FGRA 1N8R4 3OV4A 5ELJA 1LNHA 1N9EA 1RRHA 2R4IA 3JUOA 5JPPA 1S5AA 1STFI 5AIIA 3CC73 1A90A 2YX9A 3O8YA 2MC8A 1N9JA 1TU5A 1KQS2 1IDPA 2F98A 4GB5A 3EC9A 2CWVA 5IG0A 3LTDA 3UNLA 1STDA 2GBXB 2SBLA 3FGYA 5ELUA 1Q42A 6STDA 5IG4A 1Q814 1OHSA 1VZZA 3UB1A 4J8TA 3OWSA 1OCVA 4HYZA 2XRXB 2WO0A 4K1VA 3G4S3 4GL6A 2IUKA 1TFOA 4OK0A 1NU3A 1WQLB 3T8UA 2CFLA 3HX8A 2CFDA 3OWUA 1VQ93 4WYKA 5CXOA 1QAFA 1ROAA 2W56A 5IF6A 1EQKA 1FGOA 3LOYA 2XEPA 2OTL3 4KFDA 3RGRA 4XBYA 4N6NB 1QAKA 1GD4A 2ZL8A 5KP4A 1E3RA 1NB5I 2YFLB 2K0MA 3I563 1DYUA 3T8NA 4AEQA 4LMIA 1UW1A 2ZDJA 4R4KA 3Q90A 3FKAA 1Q40B 1OHOA 3B4OA 3NUVA 3UJMA 2XSHB 4XB5A 3SXXA 4HM4B 3NM2A 4MEIA 2KXGA 3G713 3CCE3 3IPTA 4EYCA 2WOFA 1OH0A 3L0RA 3WA2X 3X42A 1VQ63 2OOVA 4ORLA 2BNGA 4LSOA 3LMLA 2L4VA 1JV2B 1GY5A 2W04A 3STDA 1SPUA 1Q864 1W2B2 1W2ZA 1VQL3 3WA3A 2P38A 2UX0A 3EN8A 1JJ22 3VSYA 3NBBA 4X2OA 3MG2A 1ISKA 2QGUA 3DGNA 7STDA 3HIIA 5AEWB 3ECFA 3NBJA 1CYUA 3HI7A 4KFEA 4EBGA 3CXC2 3B4PA 1FGTA 3V92A 3ALAA 3FF0A 3PGBA 3SX1A 3H3HA 4FMBA 3WDGB 3K9MC 5AIFA 2CW9A 2CHCA 2W6JH 5KP3A 4X2HA 5BXQA 5IEPA 1O7WB 1QALA 1W7CA 3TDGA 1SJWA 2IMJA 4WFOA 1LOXA 1JN5A 1VQP3 3EF8A 1AVKA 5LC7A 4IT7A 2JQ5A 1IVUA 3MG3A 1NWWA 2P09A 3J7Yd 1UI7A 4R9KA 3FH1A 2LQVA 1N8QA 4JRFA 1JNQA 2CKFB 1DVCA 3EBTA 3GRDA 1D6YA 4EV5A 1UUVB 3SLUA 1OF5B 1OACA 4R9LA 2P0XA 3CME3 1K28A 1E3VA 4LGQA 1M1XB 4RBNA 2PNCA 4R80A 1A67A 2CG0A 2QEX3 1W6CA 3OXAA 1FA3A 2F99A 3KFQC 4H3UA 3PXMA 2Z77A 2BMOB 4KFFA 5AI1A 2XR8B 1M1K4 4WWUC 3F7SA 1OGZA 3PCSA 2ML6A 4HM0B 1D6UA 2HMKB 4WHAA 3CMA3 1AV4A 3KKGA 1HKXA 1OGXA 1Z1SA 3WODG 3PZWA 2GU3A 2Q07A 1S723 3LTAA 3X3XA 3NHXA 5A0OB 3MKIA 1L5GB 3MSOA 1O7NB 4XM4A 2FNQA 2OQEC 4AKYA 4RZMA 1GYBA 3UL6A 2W2CA 2CFWA 3PS8A 3QRDA 3DXOA 2OTJ3 1VQ83 4TX4A 1IV9A 1U8CB 2O9UX 3HK4A 3JUMA 3N9HA 1SIHA 2E2UA 1IVWA 2HMJB 4PEJA 4RNZA 3ER7A 3K5TA 1KC84 1QVG2 5CK6A 4IPBA 3NBRA 4G1MB 1JB5A 3GAXA 1HU9A 2HMOB 1FUWA 3CD63 1YGEA 1VQ73 1OPYA 2OWPA 3F14A 1LXEA 1ZX2A 1RJOA 2RFRA 1WTHA 3G16A 3K7CA 3N8BA 3F9SA 1VQN3 1W02A 1WMOA 2BO9B 2E2VA 3DZLA 3EE1A 1W6YA 4HM7B 3CCL3 1GY7A 3CCV3 1CYVA 2LYXA 1W5ZA 4HVNA 1UI8A 3CCU3 1IVVA 1IQYA 3QK9A 3U1WA 2CC3A 4N3VA 3NQZA 1US1A 4FCMA 2W9PA 4HM2B 5D82A 3KSPA 3Q2PA 4WYKB 4U13A 5BVBA 1IV7A 3LTCA 3S5CA 1RKYA 1JRQA 4FR9A 1QMAA 5KP1A 1OHPA 3LTBA 3M8CA 4O2HA 1AR0A 1IT7A 3FCSB 3CCQ3 1NO3A 2MF7A 3DGOA 2Z76A 2BMQB 5D81A 3MPHA 1JKGB 2WGOA 4MJDA 3ROBA 5FGOA 3RDEA 3KN4A 4BTYA 2RCDA 4HM8B 2CWTA 1K41A 4QWTA 3SOYA 3CCJ3 3OX9A 4HM5B 1CEWI 3CC43 1RN7A 4STDA 3SOAA 5I97A 4K1UA 3KZTA 2B24B 2W9QA 3NV0A 5CLKA 3EQQB 4L8PA 3B8LA 3LXUX 3SEDA 2P0MA 4O3VA 1A2KA 1VQM3 2GU1A 3K63A 3CCM3 1DMQA 3CNMA 3GZYB 3HIGA 3G6E3 1RRLA 5AYRB 1YVBI 3CCR3 1GY6A 3S67A 3V99A 2OOVC 3KE7A 3NQYA 1ZO2A 5JPUA 1ULJB 2KCDA 1OF5A 3AMOB 1PU4A 1K8A4 4N6MA 5EQLA 1K9M4 3PCRA 3VGNA 3FLJA 2IUJA 2INXA 1TP6A 1NDOB 1BUQA 4EXRA 3OW22 4JF8A 1O7PB 3CNXA 4K90B 2CFGA 1IQ8A 1GS3A 3G8ZA 3FG1A 1KD14 1VQ43 1IQXA 1JN5B 1G96A 4NREA 1VQK3 3F8HA 2O3OA 3N54B 1ROVA 1YJW3 4EC6A 4WP5A 4HJLB 2V1LA 1KWIA 2HMLB 3OWYA 3FZWA 4O02B 4XDVA 3S27A 2BT3A 4N6OB 1C7HA 5STDA 1UUWB 1JB2A 2WOHA 3LZAA 1QJGA 5CF1A 2YFJB 4N6LA 1AVLA 1SIIA 3D9RA 3NXJA 3CCS3 1CQSA 1EA2A 2W0QA 3EBYA 2XH9A 3GZRA 1ASKA 2XGLA 1F8NA 3BNEA 5LC6A 4HM6B 2XFTA 2A15A 3I0YA 4HBRA 3MWZA 3IMAB 2KRTA 2XFSA 4OUQA 5TGNA 1Q7Y4 2STDA 2XSOB 4Q53A 3UL5A 3CPW2 3EHCA 1WMNA 2YFIB 3KIIA 4XDWA 3X3ZA 5EVHA 3EX9A 4BTWA 4HZBB 3U97A 2I9WA 1GD3A 1O7GB 3DUKA 4MMZB 3K0ZA 4L8OA 1Q40A 2CWUA 2XF3A 3CU3A 3D3LA 4HKVB 3GZXB 5CF2A 4HZ9B 3RGAA 2Z6BA 4OVMA 1SQWA 4H61A 2B1XB 2HMMB 1DVDA 2JDIH 2Z7AA 3VF1A 4CCVA 4HM3B 3CPOA 3E99A 1YIJ3 1LVNA 3MHEA 1W4NA 2CFKA 2BMRB 4AKZA 1A2VA 1Y4KA 2M7OA 2C10A 2QIYA 5IENA 2W56B 3MYTA 1YHQ3 3T0UA 1MNLA 2GBWB 5DREA 3X40A 3WMDA 3EJVA 3F7XA 3JUQA 5G2GA 1KSIA 1JKGA 3EB8A 5HGRA 2WGQA 3WOFB 3B7CA 2F86B 2E2TA 5D83A 3FG3A 1YIT3 4FMDA 4RNYA 2W03A 1FGMA 3HZPA 1IU7A 1IVXA 3X3YA 2HMNB 3BNDA 1MOLA 1O7HB 4N6V0 1D6ZA 4IIAA 1YI23 1R4CA 2D1WA 3BNBA 4O8SA 5IEOA 1VQ53 2GXFA 1TIJA 3NX0A 1QVF2 2CG1A 4XBXA 3SVAA 5FW5A 4EV2A 3F40A 3BNCA 1M904 3EN1B 4ZM8A 2C11A 3DM8A 1DMNA 1DMMA 5JBSA 3DMCA 5AIHA 3V98A 3X41A 3GZBA 4MMYB 1W6GA 1N5PA 2CIUA 1IK3A 1NJI4 3H51A 2FGTA 2RGQA 4XBTA 1TFKA 1EG9B 2RSXA 2XGNA 3AMOA 4L7KA 3G0KA 1VQO3 3KSED 4N6TA 1V74A 3CC23 3A76A 1U5OA 1ULIB 2QA43 1YJN3 5DRVA 2P05A 3LYGA 1EKMA 4FMCA 4J9AA 2CK3H 4HM1B 3DGMA 1PFPA 3F8XA 2D42A 1JB4A 4NHFA 1T5YA 3S28A 4CDLA 3NV0B 2OCTA 5AEUB 2PZVA 5IG3A 5AIGA 5IERA 1M9GA 2OQEA 4R1KA 3BLZA 1N5HA 2CH9A 3PYJA 3IJEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4K A;  2ML5 A;  2ML6 A; 
#chains in the Genus database with same CATH topology
 4LZI A;  1FGQ A;  2K54 A;  3JUP A;  3LH4 A;  1W00 A;  3BB9 A;  3LT8 A;  3DGL A;  3LT9 A;  3Q1C A;  3S29 A;  7GSP A;  4FCZ A;  1J2B A;  3I55 3;  3WHO A;  1OUN A;  3DY5 A;  4KZ1 A;  1YGW A;  1BNG A;  3JUN A;  4N6U A;  2FXT A;  8CHO A;  1K73 4;  1IT8 A;  2Y74 A;  1LQM B;  5IW9 A;  5EEO A;  1RGA A;  3FG4 A;  1WNH A;  5GSP A;  1I8V A;  1O7M B;  1I2F A;  3FSD A;  3WOE B;  1Q82 4;  3GWR A;  3NM7 A;  1TUH A;  2GEY A;  4FCJ A;  4I4K A;  2ML5 A;  1NB3 I;  2IA7 A;  5AYS C;  1E97 A;  1I2G A;  1WMP A;  1BSE A;  1NNV A;  3JVC A;  1RNB A;  1W01 A;  2Y73 A;  1B2X A;  2H0G A;  4FMA A;  2GEX A;  4MMX B;  1ZGX A;  4K61 A;  2F4Y A;  4KVH A;  1JZD A;  4BTX A;  5IG5 A;  2BHM A;  3FF2 A;  1YJ9 3;  3MG1 A;  4LEH A;  1FGR A;  1N8R 4;  1SAR A;  3OV4 A;  5ELJ A;  1LNH A;  1N9E A;  1RRH A;  2R4I A;  3JUO A;  5JPP A;  1S5A A;  1STF I;  5AII A;  3CC7 3;  1V58 A;  2SAR A;  2YX9 A;  1B2S A;  3O8Y A;  2MC8 A;  1N9J A;  1TU5 A;  1A90 A;  1MWT A;  1KQS 2;  1BAN A;  1IDP A;  2F98 A;  4GB5 A;  3EC9 A;  2CWV A;  2ZA4 A;  5IG0 A;  3LTD A;  3UNL A;  1B27 A;  1STD A;  2GBX B;  2SBL A;  3FGY A;  5ELU A;  1Q42 A;  6STD A;  5IG4 A;  1FYS A;  1Q81 4;  1OHS A;  1VZZ A;  3UB1 A;  4J8T A;  1BSD A;  3OWS A;  1OCV A;  4HYZ A;  2XRX B;  2WO0 A;  4K1V A;  3G4S 3;  4GL6 A;  2IUK A;  1TFO A;  4OK0 A;  1NU3 A;  1RHL A;  1WQL B;  3T8U A;  2CFL A;  3HX8 A;  2CFD A;  3OWU A;  1VQ9 3;  4WYK A;  5CXO A;  1QAF A;  1ROA A;  2W56 A;  5IF6 A;  1EQK A;  1FGO A;  3LOY A;  2XEP A;  2OTL 3;  4KFD A;  1GMP A;  1TTO A;  3RGR A;  4XBY A;  4N6N B;  1QAK A;  1MWR A;  1GD4 A;  2ZL8 A;  5KP4 A;  1E3R A;  3D4A A;  2YFL B;  1NB5 I;  6GSP A;  2K0M A;  1MWU A;  1DYU A;  3T8N A;  4AEQ A;  3I56 3;  1C54 A;  4LMI A;  1UW1 A;  2ZDJ A;  4R4K A;  4BU4 A;  3Q90 A;  3FKA A;  1Q40 B;  1OHO A;  3AGO A;  3B4O A;  1RTU A;  1BNR A;  3NUV A;  3UJM A;  1RSN A;  2XSH B;  4XB5 A;  3SXX A;  2L1S A;  4HM4 B;  6RNT A;  3NM2 A;  4MEI A;  2KXG A;  3G71 3;  3CCE 3;  3IPT A;  4EYC A;  2WOF A;  1OH0 A;  3L0R A;  3WA2 X;  3X42 A;  1VQ6 3;  1LOV A;  2OOV A;  4ORL A;  2BNG A;  4LSO A;  3LML A;  2L4V A;  1JV2 B;  1GY5 A;  2W04 A;  3STD A;  1SPU A;  1Q86 4;  1I3F A;  1W2B 2;  1BSC A;  1W2Z A;  3WA3 A;  2P38 A;  2UX0 A;  1VQL 3;  1BUJ A;  3EN8 A;  1JJ2 2;  4GSP A;  4LYL B;  3VSY A;  1BRG A;  3NBB A;  5CF1 A;  4X2O A;  3MG2 A;  1ISK A;  2QGU A;  3DGN A;  7STD A;  3HII A;  5AEW B;  1I0V A;  1BRK A;  1IYY A;  3ECF A;  3NBJ A;  1CYU A;  3HI7 A;  4KFE A;  9RNT A;  4EBG A;  3CXC 2;  2IYJ A;  3B4P A;  1MWS A;  1FGT A;  3V92 A;  3ALA A;  3FF0 A;  3PGB A;  3SX1 A;  3H3H A;  4FMB A;  3WDG B;  3K9M C;  5AIF A;  2CW9 A;  2CHC A;  2W6J H;  5KP3 A;  4X2H A;  5BXQ A;  5IEP A;  1O7W B;  1QAL A;  1W7C A;  3TDG A;  1SJW A;  1TRQ A;  2IMJ A;  4WFO A;  1BNJ A;  1LOX A;  1JN5 A;  1VQP 3;  3EF8 A;  1AVK A;  5LC7 A;  1BNE A;  4ILF A;  4IT7 A;  1BRI A;  2JQ5 A;  1IVU A;  3MG3 A;  3ZG0 A;  1NWW A;  1BU4 A;  2P09 A;  3J7Y d;  1UI7 A;  4R9K A;  3FH1 A;  2LQV A;  1N8Q A;  4JRF A;  1JNQ A;  1FW7 A;  2CKF B;  1DVC A;  3EBT A;  3GRD A;  1AQZ A;  1D6Y A;  4EV5 A;  1UUV B;  3SLU A;  1OF5 B;  1OAC A;  4I5Q A;  2P0X A;  4R9L A;  3CME 3;  1K28 A;  1E3V A;  1LOW A;  4LGQ A;  2CX1 A;  1M1X B;  4RBN A;  2PNC A;  4R80 A;  1A67 A;  2CG0 A;  2QEX 3;  1W6C A;  3OXA A;  1FA3 A;  2F99 A;  1RNT A;  3KFQ C;  3PXM A;  2Z77 A;  4H3U A;  3WR2 A;  2BMO B;  4KFF A;  5AI1 A;  2XR8 B;  1UCK A;  1M1K 4;  4WWU C;  1RGF A;  3F7S A;  1OGZ A;  3PCS A;  2ML6 A;  4HM0 B;  1D6U A;  2HMK B;  4WHA A;  3KCH A;  3CMA 3;  1AV4 A;  3KKG A;  1HKX A;  1OGX A;  1Z1S A;  3WOD G;  1RGL A;  3PZW A;  1PY3 A;  2GU3 A;  2Q07 A;  3RNT A;  1S72 3;  2CX0 A;  3LTA A;  8RNT A;  3X3X A;  3NHX A;  5A0O B;  1ZS7 A;  3MKI A;  1L5G B;  3MSO A;  1O7N B;  4XM4 A;  2FNQ A;  1RN4 A;  2OQE C;  4AKY A;  4DKI A;  2HOH A;  7RNT A;  4RZM A;  1GYB A;  3UL6 A;  1JBR A;  1B20 A;  5HOH A;  2W2C A;  2CFW A;  3D5I A;  5M1A A;  3PS8 A;  3QRD A;  1LOY A;  3DXO A;  1HYF A;  1AY7 A;  2OTJ 3;  1VQ8 3;  5M19 A;  4TX4 A;  1IV9 A;  1U8C B;  2O9U X;  1JBT A;  3HK4 A;  3JUM A;  3N9H A;  1SIH A;  2E2U A;  1IVW A;  2BU4 A;  2HMJ B;  4PEJ A;  4RNZ A;  3ER7 A;  3K5T A;  1KC8 4;  1QVG 2;  5CK6 A;  4CJN A;  1JBS A;  4IPB A;  3NBR A;  4G1M B;  1GMQ A;  1JB5 A;  5BIR A;  3GAX A;  1HU9 A;  1MGR A;  2HMO B;  1FUW A;  3CD6 3;  1YGE A;  1VQ7 3;  1OPY A;  1Q7H A;  2OWP A;  1LXE A;  1ZX2 A;  3F14 A;  1RJO A;  2RFR A;  1WTH A;  3G16 A;  3K7C A;  3N8B A;  3F9S A;  1VQN 3;  1UDI I;  1W02 A;  4J5G A;  1WMO A;  2BO9 B;  2E2V A;  3DZL A;  3EE1 A;  1RGK A;  1W6Y A;  4HM7 B;  1BRH A;  3CCL 3;  1GY7 A;  4NPB A;  3CCV 3;  1CYV A;  2LYX A;  1W5Z A;  4HVN A;  1UI8 A;  3CCU 3;  1RCK A;  1FUS A;  3BIR A;  1IVV A;  1IQY A;  3QK9 A;  4GHO A;  2UUG C;  3U1W A;  2CC3 A;  4N3V A;  3NQZ A;  1US1 A;  4FCM A;  2F56 A;  2W9P A;  4HM2 B;  3KSP A;  5D82 A;  3Q2P A;  1GOY A;  4WYK B;  3GSP A;  1CH0 A;  4U13 A;  1UUG B;  5BVB A;  1IV7 A;  5BU4 A;  3LTC A;  3S5C A;  1I2E A;  1B3S A;  1RKY A;  1JRQ A;  4FR9 A;  1QMA A;  5KP1 A;  3ZG5 A;  1YNV X;  3HOH A;  1OHP A;  3LTB A;  3M8C A;  4O2H A;  5M18 A;  1AR0 A;  1IT7 A;  3FCS B;  3CCQ 3;  1NO3 A;  2MF7 A;  3DGO A;  2Z76 A;  2BMQ B;  2KF3 A;  3D5G A;  5D81 A;  3MPH A;  1JKG B;  2WGO A;  3A5E A;  4MJD A;  3ROB A;  5FGO A;  3RDE A;  3KN4 A;  4BTY A;  2RCD A;  4HM8 B;  2CWT A;  1K41 A;  4QWT A;  3SOY A;  5RNT A;  3CCJ 3;  3OX9 A;  4HM5 B;  1CEW I;  3CC4 3;  1RN7 A;  4STD A;  3SOA A;  1I3I A;  5I97 A;  4K1U A;  1UGI A;  1UGH I;  1RDS A;  1X1X A;  2B24 B;  3KZT A;  2W9Q A;  1BRS A;  3NV0 A;  5G1K A;  2ZHX B;  5CLK A;  3EQQ B;  4L8P A;  3B8L A;  3LXU X;  3SED A;  2P0M A;  4O3V A;  1A2K A;  1BIR A;  2KF4 A;  1VQM 3;  2GU1 A;  3K63 A;  3CCM 3;  1DMQ A;  3CNM A;  3GZY B;  3HIG A;  3G6E 3;  1RRL A;  1RGC A;  5AYR B;  1YVB I;  1BSA A;  3CCR 3;  1GY6 A;  4RNT A;  3S67 A;  3V99 A;  2OOV C;  2UGI A;  3KE7 A;  1T3B A;  1ZO2 A;  3NQY A;  1G0T A;  5JPU A;  1ULJ B;  2KCD A;  1OF5 A;  3AMO B;  2BIR A;  1PU4 A;  1K8A 4;  3DGY A;  4N6M A;  5EQL A;  1K9M 4;  3PCR A;  3VGN A;  3FLJ A;  2IUJ A;  2INX A;  5G1L A;  1TP6 A;  1NDO B;  1BUQ A;  4EXR A;  2GSP A;  1UCJ A;  3OW2 2;  4JF8 A;  1O7P B;  1UCI A;  2RBI A;  3CNX A;  1PYL A;  4K90 B;  2CFG A;  1IQ8 A;  1BNF A;  1BRN L;  1GS3 A;  3G8Z A;  3FG1 A;  1KD1 4;  1VQ4 3;  1IQX A;  1JN5 B;  1G96 A;  4NRE A;  1BSB A;  1G02 A;  2F5M A;  1VQK 3;  3F8H A;  2O3O A;  3N54 B;  3AHW A;  1ROV A;  3AHS A;  4EC6 A;  1YJW 3;  1T2H A;  4WP5 A;  4HJL B;  2V1L A;  1KWI A;  2HML B;  3OWY A;  1YVS A;  3FZW A;  4O02 B;  4XDV A;  3S27 A;  2BT3 A;  4EW5 A;  4N6O B;  1C7H A;  1BNI A;  5STD A;  1T2I A;  1JB2 A;  1UUW B;  2WOH A;  1EUI C;  1QJG A;  2YFJ B;  3LZA A;  4N6L A;  4CPK A;  1AVL A;  1SII A;  1RGG A;  3D9R A;  1X1Y A;  3NXJ A;  3CCS 3;  1CQS A;  1EA2 A;  2W0Q A;  3EBY A;  1HZ1 A;  1LQG C;  2XH9 A;  3GZR A;  4HOH A;  1ASK A;  1JZO A;  2XGL A;  1F8N A;  3BNE A;  5LC6 A;  4HM6 B;  2XFT A;  2A15 A;  2H0I A;  1GOU A;  3I0Y A;  1FUT A;  4HBR A;  3MWZ A;  3IMA B;  2KRT A;  1B2M A;  2XFS A;  4OUQ A;  5TGN A;  1Q7Y 4;  1A2P A;  2RNT A;  2STD A;  2XSO B;  4Q53 A;  3UL5 A;  3CPW 2;  3EHC A;  1WMN A;  2YFI B;  3KII A;  4XDW A;  3X3Z A;  1FZU A;  5EVH A;  3EX9 A;  4BTW A;  4HZB B;  3U97 A;  2I9W A;  1GD3 A;  1O7G B;  3DUK A;  4MMZ B;  1GSP A;  3K0Z A;  2F5W A;  4L8O A;  1Q40 A;  2CWU A;  2XF3 A;  3CU3 A;  3D3L A;  4HKV B;  3GZX B;  3SYU A;  5CF2 A;  1BNS A;  4HZ9 B;  3RGA A;  2Z6B A;  1X1W A;  1BRJ A;  4OVM A;  1SQW A;  4H61 A;  2B1X B;  2HMM B;  1DVD A;  2JDI H;  2Z7A A;  3VF1 A;  1I0X A;  4HM3 B;  3CPO A;  2IY2 A;  3E99 A;  3URP A;  4CCV A;  1LRA A;  3DH2 A;  1YIJ 3;  1LVN A;  3MHE A;  1RN1 A;  1W4N A;  1EEJ A;  2CFK A;  4BIR A;  1TRP A;  2BMR B;  4AKZ A;  1A2V A;  1Y4K A;  2M7O A;  2C10 A;  2QIY A;  5IEN A;  2W56 B;  2KF5 A;  3MYT A;  3ZFZ A;  1YHQ 3;  1R4Y A;  3T0U A;  1MNL A;  2GBW B;  5DRE A;  3X40 A;  3WMD A;  3EJV A;  3F7X A;  3JUQ A;  5G2G A;  1KSI A;  1JKG A;  1RGH A;  2R41 A;  3EB8 A;  5HGR A;  2WGQ A;  2H0H A;  3WOF B;  3B7C A;  2F86 B;  1TJD A;  1BGS A;  2E2T A;  5D83 A;  3FG3 A;  1YIT 3;  2KAA A;  4FMD A;  1BAO A;  4RNY A;  2W03 A;  1FGM A;  1GMR A;  3HZP A;  1IU7 A;  1IVX A;  2KF6 A;  2HMN B;  3X3Y A;  3BND A;  1GOV A;  1MOL A;  1O7H B;  4N6V 0;  1BVI A;  1D6Z A;  4BL3 A;  4IIA A;  1YI2 3;  4BL2 A;  1R4C A;  2D1W A;  3BNB A;  4O8S A;  1B2U A;  5IEO A;  1VQ5 3;  2GXF A;  1V57 A;  1TIJ A;  3NX0 A;  1QVF 2;  2CG1 A;  4XBX A;  4KT3 B;  3SVA A;  5FW5 A;  4HAA A;  4EV2 A;  3F40 A;  3BNC A;  1B21 A;  1M90 4;  3EN1 B;  4ZM8 A;  2C11 A;  3DM8 A;  1DMN A;  1DMM A;  1DET A;  5JBS A;  2J8X B;  3DMC A;  5AIH A;  3V98 A;  3X41 A;  3GZB A;  4J5K A;  4MMY B;  1Q9E A;  1W6G A;  1N5P A;  2AAD A;  2CIU A;  1IK3 A;  1NJI 4;  3H51 A;  2FGT A;  3D79 A;  2RGQ A;  3Q3F A;  4XBT A;  1X1U A;  1TFK A;  1EG9 B;  2RSX A;  2XGN A;  1B2Z A;  1MGW A;  1VQQ A;  3AMO A;  3BU4 A;  4L7K A;  3G0K A;  1VQO 3;  1RLS A;  3KSE D;  2K3D A;  2C4B A;  1RGE A;  4N6T A;  1V74 A;  3CC2 3;  1U5O A;  1ULI B;  3A76 A;  2QA4 3;  1YJN 3;  5DRV A;  2P05 A;  3LYG A;  1EKM A;  4FMC A;  2AAE A;  2CK3 H;  4J9A A;  4HM1 B;  3DGM A;  1BOX A;  1PFP A;  3F8X A;  2D42 A;  1JB4 A;  1I70 A;  1T5Y A;  4NHF A;  3S28 A;  1LNI A;  3NV0 B;  4CDL A;  2OCT A;  1UCL A;  5AEU B;  2PZV A;  5IG3 A;  5AIG A;  1RCL A;  5IER A;  1DE3 A;  1M9G A;  2OQE A;  1RMS A;  4R1K A;  3BLZ A;  1N5H A;  3AGN A;  2CH9 A;  3PYJ A;  3IJE B; 
#chains in the Genus database with same CATH homology
 4LZI A;  1FGQ A;  2K54 A;  3JUP A;  3LH4 A;  1W00 A;  3BB9 A;  3LT8 A;  3DGL A;  3LT9 A;  3Q1C A;  3S29 A;  4FCZ A;  1J2B A;  3I55 3;  1OUN A;  3DY5 A;  4KZ1 A;  3JUN A;  4N6U A;  2FXT A;  8CHO A;  1K73 4;  1IT8 A;  2Y74 A;  5IW9 A;  5EEO A;  3FG4 A;  1WNH A;  1O7M B;  3FSD A;  3WOE B;  1Q82 4;  3GWR A;  3NM7 A;  1TUH A;  2GEY A;  4FCJ A;  4I4K A;  2ML5 A;  1NB3 I;  2IA7 A;  5AYS C;  1E97 A;  1WMP A;  3JVC A;  1W01 A;  2Y73 A;  4FMA A;  4MMX B;  2GEX A;  4K61 A;  4KVH A;  4BTX A;  5IG5 A;  2BHM A;  3FF2 A;  1YJ9 3;  3MG1 A;  4LEH A;  1FGR A;  1N8R 4;  3OV4 A;  5ELJ A;  1LNH A;  1N9E A;  1RRH A;  2R4I A;  3JUO A;  5JPP A;  1S5A A;  1STF I;  5AII A;  3CC7 3;  1A90 A;  2YX9 A;  3O8Y A;  2MC8 A;  1N9J A;  1TU5 A;  1KQS 2;  1IDP A;  2F98 A;  4GB5 A;  3EC9 A;  2CWV A;  5IG0 A;  3LTD A;  3UNL A;  1STD A;  2GBX B;  2SBL A;  3FGY A;  5ELU A;  1Q42 A;  6STD A;  5IG4 A;  1Q81 4;  1OHS A;  1VZZ A;  3UB1 A;  4J8T A;  3OWS A;  1OCV A;  4HYZ A;  2XRX B;  2WO0 A;  4K1V A;  3G4S 3;  4GL6 A;  2IUK A;  1TFO A;  4OK0 A;  1NU3 A;  1WQL B;  3T8U A;  2CFL A;  3HX8 A;  2CFD A;  3OWU A;  1VQ9 3;  4WYK A;  5CXO A;  1QAF A;  1ROA A;  2W56 A;  5IF6 A;  1EQK A;  1FGO A;  3LOY A;  2XEP A;  2OTL 3;  4KFD A;  3RGR A;  4XBY A;  4N6N B;  1QAK A;  1GD4 A;  2ZL8 A;  5KP4 A;  1E3R A;  1NB5 I;  2YFL B;  2K0M A;  3I56 3;  1DYU A;  3T8N A;  4AEQ A;  4LMI A;  1UW1 A;  2ZDJ A;  4R4K A;  3Q90 A;  3FKA A;  1Q40 B;  1OHO A;  3B4O A;  3NUV A;  3UJM A;  2XSH B;  4XB5 A;  3SXX A;  4HM4 B;  3NM2 A;  4MEI A;  2KXG A;  3G71 3;  3CCE 3;  3IPT A;  4EYC A;  2WOF A;  1OH0 A;  3L0R A;  3WA2 X;  3X42 A;  1VQ6 3;  2OOV A;  4ORL A;  2BNG A;  4LSO A;  3LML A;  2L4V A;  1JV2 B;  1GY5 A;  2W04 A;  3STD A;  1SPU A;  1Q86 4;  1W2B 2;  1W2Z A;  1VQL 3;  3WA3 A;  2P38 A;  2UX0 A;  3EN8 A;  1JJ2 2;  3VSY A;  3NBB A;  4X2O A;  3MG2 A;  1ISK A;  2QGU A;  3DGN A;  7STD A;  3HII A;  5AEW B;  3ECF A;  3NBJ A;  1CYU A;  3HI7 A;  4KFE A;  4EBG A;  3CXC 2;  3B4P A;  1FGT A;  3V92 A;  3ALA A;  3FF0 A;  3PGB A;  3SX1 A;  3H3H A;  4FMB A;  3WDG B;  3K9M C;  5AIF A;  2CW9 A;  2CHC A;  2W6J H;  5KP3 A;  4X2H A;  5BXQ A;  5IEP A;  1O7W B;  1QAL A;  1W7C A;  3TDG A;  1SJW A;  2IMJ A;  4WFO A;  1LOX A;  1JN5 A;  1VQP 3;  3EF8 A;  1AVK A;  5LC7 A;  4IT7 A;  2JQ5 A;  1IVU A;  3MG3 A;  1NWW A;  2P09 A;  3J7Y d;  1UI7 A;  4R9K A;  3FH1 A;  2LQV A;  1N8Q A;  4JRF A;  1JNQ A;  2CKF B;  1DVC A;  3EBT A;  3GRD A;  1D6Y A;  4EV5 A;  1UUV B;  3SLU A;  1OF5 B;  1OAC A;  4R9L A;  2P0X A;  3CME 3;  1K28 A;  1E3V A;  4LGQ A;  1M1X B;  4RBN A;  2PNC A;  4R80 A;  1A67 A;  2CG0 A;  2QEX 3;  1W6C A;  3OXA A;  1FA3 A;  2F99 A;  3KFQ C;  4H3U A;  3PXM A;  2Z77 A;  2BMO B;  4KFF A;  5AI1 A;  2XR8 B;  1M1K 4;  4WWU C;  3F7S A;  1OGZ A;  3PCS A;  2ML6 A;  4HM0 B;  1D6U A;  2HMK B;  4WHA A;  3CMA 3;  1AV4 A;  3KKG A;  1HKX A;  1OGX A;  1Z1S A;  3WOD G;  3PZW A;  2GU3 A;  2Q07 A;  1S72 3;  3LTA A;  3X3X A;  3NHX A;  5A0O B;  3MKI A;  1L5G B;  3MSO A;  1O7N B;  4XM4 A;  2FNQ A;  2OQE C;  4AKY A;  4RZM A;  1GYB A;  3UL6 A;  2W2C A;  2CFW A;  3PS8 A;  3QRD A;  3DXO A;  2OTJ 3;  1VQ8 3;  4TX4 A;  1IV9 A;  1U8C B;  2O9U X;  3HK4 A;  3JUM A;  3N9H A;  1SIH A;  2E2U A;  1IVW A;  2HMJ B;  4PEJ A;  4RNZ A;  3ER7 A;  3K5T A;  1KC8 4;  1QVG 2;  5CK6 A;  4IPB A;  3NBR A;  4G1M B;  1JB5 A;  3GAX A;  1HU9 A;  2HMO B;  1FUW A;  3CD6 3;  1YGE A;  1VQ7 3;  1OPY A;  2OWP A;  3F14 A;  1LXE A;  1ZX2 A;  1RJO A;  2RFR A;  1WTH A;  3G16 A;  3K7C A;  3N8B A;  3F9S A;  1VQN 3;  1W02 A;  1WMO A;  2BO9 B;  2E2V A;  3DZL A;  3EE1 A;  1W6Y A;  4HM7 B;  3CCL 3;  1GY7 A;  3CCV 3;  1CYV A;  2LYX A;  1W5Z A;  4HVN A;  1UI8 A;  3CCU 3;  1IVV A;  1IQY A;  3QK9 A;  3U1W A;  2CC3 A;  4N3V A;  3NQZ A;  1US1 A;  4FCM A;  2W9P A;  4HM2 B;  5D82 A;  3KSP A;  3Q2P A;  4WYK B;  4U13 A;  5BVB A;  1IV7 A;  3LTC A;  3S5C A;  1RKY A;  1JRQ A;  4FR9 A;  1QMA A;  5KP1 A;  1OHP A;  3LTB A;  3M8C A;  4O2H A;  1AR0 A;  1IT7 A;  3FCS B;  3CCQ 3;  1NO3 A;  2MF7 A;  3DGO A;  2Z76 A;  2BMQ B;  5D81 A;  3MPH A;  1JKG B;  2WGO A;  4MJD A;  3ROB A;  5FGO A;  3RDE A;  3KN4 A;  4BTY A;  2RCD A;  4HM8 B;  2CWT A;  1K41 A;  4QWT A;  3SOY A;  3CCJ 3;  3OX9 A;  4HM5 B;  1CEW I;  3CC4 3;  1RN7 A;  4STD A;  3SOA A;  5I97 A;  4K1U A;  3KZT A;  2B24 B;  2W9Q A;  3NV0 A;  5CLK A;  3EQQ B;  4L8P A;  3B8L A;  3LXU X;  3SED A;  2P0M A;  4O3V A;  1A2K A;  1VQM 3;  2GU1 A;  3K63 A;  3CCM 3;  1DMQ A;  3CNM A;  3GZY B;  3HIG A;  3G6E 3;  1RRL A;  5AYR B;  1YVB I;  3CCR 3;  1GY6 A;  3S67 A;  3V99 A;  2OOV C;  3KE7 A;  3NQY A;  1ZO2 A;  5JPU A;  1ULJ B;  2KCD A;  1OF5 A;  3AMO B;  1PU4 A;  1K8A 4;  4N6M A;  5EQL A;  1K9M 4;  3PCR A;  3VGN A;  3FLJ A;  2IUJ A;  2INX A;  1TP6 A;  1NDO B;  1BUQ A;  4EXR A;  3OW2 2;  4JF8 A;  1O7P B;  3CNX A;  4K90 B;  2CFG A;  1IQ8 A;  1GS3 A;  3G8Z A;  3FG1 A;  1KD1 4;  1VQ4 3;  1IQX A;  1JN5 B;  1G96 A;  4NRE A;  1VQK 3;  3F8H A;  2O3O A;  3N54 B;  1ROV A;  1YJW 3;  4EC6 A;  4WP5 A;  4HJL B;  2V1L A;  1KWI A;  2HML B;  3OWY A;  3FZW A;  4O02 B;  4XDV A;  3S27 A;  2BT3 A;  4N6O B;  1C7H A;  5STD A;  1UUW B;  1JB2 A;  2WOH A;  3LZA A;  1QJG A;  5CF1 A;  2YFJ B;  4N6L A;  1AVL A;  1SII A;  3D9R A;  3NXJ A;  3CCS 3;  1CQS A;  1EA2 A;  2W0Q A;  3EBY A;  2XH9 A;  3GZR A;  1ASK A;  2XGL A;  1F8N A;  3BNE A;  5LC6 A;  4HM6 B;  2XFT A;  2A15 A;  3I0Y A;  4HBR A;  3MWZ A;  3IMA B;  2KRT A;  2XFS A;  4OUQ A;  5TGN A;  1Q7Y 4;  2STD A;  2XSO B;  4Q53 A;  3UL5 A;  3CPW 2;  3EHC A;  1WMN A;  2YFI B;  3KII A;  4XDW A;  3X3Z A;  5EVH A;  3EX9 A;  4BTW A;  4HZB B;  3U97 A;  2I9W A;  1GD3 A;  1O7G B;  3DUK A;  4MMZ B;  3K0Z A;  4L8O A;  1Q40 A;  2CWU A;  2XF3 A;  3CU3 A;  3D3L A;  4HKV B;  3GZX B;  5CF2 A;  4HZ9 B;  3RGA A;  2Z6B A;  4OVM A;  1SQW A;  4H61 A;  2B1X B;  2HMM B;  1DVD A;  2JDI H;  2Z7A A;  3VF1 A;  4CCV A;  4HM3 B;  3CPO A;  3E99 A;  1YIJ 3;  1LVN A;  3MHE A;  1W4N A;  2CFK A;  2BMR B;  4AKZ A;  1A2V A;  1Y4K A;  2M7O A;  2C10 A;  2QIY A;  5IEN A;  2W56 B;  3MYT A;  1YHQ 3;  3T0U A;  1MNL A;  2GBW B;  5DRE A;  3X40 A;  3WMD A;  3EJV A;  3F7X A;  3JUQ A;  5G2G A;  1KSI A;  1JKG A;  3EB8 A;  5HGR A;  2WGQ A;  3WOF B;  3B7C A;  2F86 B;  2E2T A;  5D83 A;  3FG3 A;  1YIT 3;  4FMD A;  4RNY A;  2W03 A;  1FGM A;  3HZP A;  1IU7 A;  1IVX A;  3X3Y A;  2HMN B;  3BND A;  1MOL A;  1O7H B;  4N6V 0;  1D6Z A;  4IIA A;  1YI2 3;  1R4C A;  2D1W A;  3BNB A;  4O8S A;  5IEO A;  1VQ5 3;  2GXF A;  1TIJ A;  3NX0 A;  1QVF 2;  2CG1 A;  4XBX A;  3SVA A;  5FW5 A;  4EV2 A;  3F40 A;  3BNC A;  1M90 4;  3EN1 B;  4ZM8 A;  2C11 A;  3DM8 A;  1DMN A;  1DMM A;  5JBS A;  3DMC A;  5AIH A;  3V98 A;  3X41 A;  3GZB A;  4MMY B;  1W6G A;  1N5P A;  2CIU A;  1IK3 A;  1NJI 4;  3H51 A;  2FGT A;  2RGQ A;  4XBT A;  1TFK A;  1EG9 B;  2RSX A;  2XGN A;  3AMO A;  4L7K A;  3G0K A;  1VQO 3;  3KSE D;  4N6T A;  1V74 A;  3CC2 3;  3A76 A;  1U5O A;  1ULI B;  2QA4 3;  1YJN 3;  5DRV A;  2P05 A;  3LYG A;  1EKM A;  4FMC A;  4J9A A;  2CK3 H;  4HM1 B;  3DGM A;  1PFP A;  3F8X A;  2D42 A;  1JB4 A;  4NHF A;  1T5Y A;  3S28 A;  4CDL A;  3NV0 B;  2OCT A;  5AEU B;  2PZV A;  5IG3 A;  5AIG A;  5IER A;  1M9G A;  2OQE A;  4R1K A;  3BLZ A;  1N5H A;  2CH9 A;  3PYJ A;  3IJE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...