2ML5A

Nmr structure of protein zp_02064002.1 from bacteroides ovatus atcc 8483
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
GDSELTTQDGEDFKSFLDKFTSSAAFQYTRVKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERITQEEGGIYVSKFTLNEPKHKIFEAGYEESEVDLRVEFELQADGKWYVVDCYTGWYGYDLPIGELKQTIQNVKEENAAFKEIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title NMR structure of protein ZP_02064002.1 from Bacteroides ovatus ATCC 8483
rcsb
source organism Bacteroides ovatus
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.410 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ml5A00
2ML6A 2ML5A 4R4KA
chains in the Genus database with same CATH superfamily
2GBXB 3LTDA 3FG4A 3EQQB 3F8HA 1BNJA 1NNVA 2WO0A 3GZBA 1N5PA 1IK3A 1VQ83 3JVCA 3DUKA 5HGRA 5I97A 1GMPA 1ROAA 1DMNA 3MYTA 1NB3I 1IT8A 2GEYA 2HOHA 1BSCA 1OCVA 1TIJA 1UUWB 4NHFA 3OW22 1QVG2 1RJOA 4HYZA 3CXC2 1LOVA 3F7SA 2CK3H 3G16A 1RGEA 1TFKA 5LC6A 5CLKA 5IG4A 2YX9A 2RCDA 3DH2A 1LOXA 4R9LA 3X3XA 1RNBA 1SIHA 1B21A 3HOHA 4LYLB 3FCSB 1Q814 1M1K4 1RGLA 5IW9A 3PS8A 4FCZA 4KZ1A 5BXQA 3I0YA 3Q90A 4L8OA 4LSOA 2J8XB 3MG2A 3S27A 1O7MB 3AGNA 1DMMA 3DGMA 2LYXA 1AY7A 3JUNA 4J5GA 1BSBA 1I2EA 2CWUA 5TGNA 1MWRA 4N6MA 5KP3A 3D3LA 1JB2A 1HYFA 1IVVA 1RGKA 2CIUA 4I5QA 1DYUA 1PYLA 1SQWA 3V98A 1FUSA 2KF4A 3EF8A 5AEUB 1GS3A 1YGWA 1W00A 2OQEC 2XRXB 3CCU3 3N54B 3QK9A 2CX0A 3NX0A 2KAAA 3B8LA 2F56A 4EYCA 3G713 3F8XA 3WOFB 1O7WB 4HM0B 4RBNA 1X1XA 3S67A 2GXFA 4N6OB 3OWSA 3PCSA 5LC7A 4J9AA 1B3SA 1YJW3 3AHSA 4XDWA 3O8YA 2KF6A 1QMAA 1JNQA 3N9HA 1W02A 1SARA 5AIIA 4MEIA 3LZAA 1IU7A 1YI23 1K9M4 1ZS7A 4HM8B 5M1AA 3S28A 1A2VA 1E3VA 2WOHA 3AMOA 3D9RA 3FGYA 1DE3A 5JPPA 1CYVA 3STDA 3LT9A 1QAFA 5RNTA 1IVWA 1STDA 1UCKA 3EBYA 4RNYA 2QEX3 4FMCA 4IIAA 3BNDA 1NB5I 3EB8A 3LXUX 1TTOA 3SEDA 4X2HA 1LVNA 1T2IA 3BB9A 1AVKA 1T2HA 1BNRA 2E2TA 2CC3A 1JKGB 3DM8A 1V58A 2PZVA 5AYSC 3M8CA 1A2PA 2BIRA 4HM2B 4KT3B 4MMZB 4HZ9B 2C11A 5IG5A 5JPUA 1R4CA 4O8SA 3KE7A 1BNEA 3OWUA 3IPTA 4BL3A 1O7NB 2XH9A 3ZG0A 3FF2A 1QALA 1W7CA 2BMQB 1OACA 2XFSA 3GSPA 3RDEA 1I2FA 3U1WA 1N9JA 1I8VA 1D6YA 1O7GB 4CJNA 1OHPA 1UCIA 1TRPA 3CC23 3GZRA 3EE1A 8RNTA 3BIRA 1BOXA 1YIJ3 3PGBA 1Q824 4HM5B 5M18A 1UDII 3LMLA 5G1LA 2CHCA 1VZZA 1I2GA 4N6LA 1HZ1A 2KRTA 3SLUA 1K41A 1OGXA 3T0UA 1X1WA 1TJDA 1NJI4 3D79A 2W04A 3G8ZA 4HZBB 1DVCA 3X3YA 1RKYA 1I3IA 1MWSA 1W6GA 2KF3A 5EQLA 2CFKA 1W01A 2XEPA 2GU3A 3ER7A 4J8TA 4JRFA 1RHLA 3FG3A 1UUGB 5AIGA 4X2OA 3K9MC 3G4S3 4O3VA 1CH0A 2GBWB 3N8BA 1JJ22 2BT3A 1FGMA 1ULIB 3HIGA 2RBIA 3K0ZA 3FF0A 5AI1A 4H61A 3U97A 1ZX2A 4BL2A 3OV4A 2E2UA 3PZWA 1FZUA 1SJWA 1OF5A 1E3RA 2Z76A 3WA2X 1AQZA 1BRNL 1HU9A 3FLJA 2KCDA 3FH1A 1IVXA 3LH4A 2M7OA 3VF1A 1JBSA 4AKZA 4KFFA 2RNTA 1BGSA 3AGOA 3Q3FA 2MC8A 1W6YA 3CNMA 5EVHA 5G1KA 4EW5A 2I9WA 3URPA 5IEPA 1CQSA 2L4VA 4LMIA 1G02A 2CX1A 3NUVA 4WFOA 1IV7A 3K63A 3X42A 2F5WA 4JF8A 1TU5A 4WYKA 2Z77A 1ROVA 4FMAA 4GHOA 1RGGA 4L7KA 1OH0A 3HIIA 2JQ5A 3NV0A 3CCJ3 1JBTA 1FGOA 2CH9A 4WHAA 2Q07A 5ELUA 2XSOB 3S29A 4RNZA 5BVBA 7RNTA 7STDA 3CPW2 1GOUA 3T8UA 4GL6A 3NQZA 5D83A 3CC73 4ZM8A 1IV9A 4IT7A 1GY7A 1LNHA 2W56B 3H51A 2ZDJA 1NWWA 1Q40A 2LQVA 3OX9A 3KKGA 2HMMB 4BTYA 4HM6B 2HMNB 1RRLA 1A90A 1IQ8A 3ECFA 4AEQA 2SBLA 2BU4A 2RFRA 3CD63 1OPYA 1DMQA 4HM3B 1F8NA 2FGTA 2SARA 3CCQ3 1WQLB 2XGLA 4R4KA 1YVSA 1KD14 1FUWA 1RNTA 1Z1SA 2ML6A 3DGNA 2ML5A 3AMOB 3DZLA 5KP1A 1O7PB 3SYUA 1UUVB 1Q7Y4 3X3ZA 1GY6A 1JRQA 3IMAB 2ZA4A 2IUJA 2W56A 1LXEA 2OWPA 1B27A 3AHWA 1C7HA 4KFEA 1B2MA 3WHOA 4AKYA 2OTJ3 1BUJA 4TX4A 1US1A 1BSAA 5FW5A 2CFGA 3EN1B 1OGZA 1BRIA 5IG0A 2HMOB 1ZO2A 2O9UX 4EXRA 1BUQA 2E2VA 4K1VA 2MF7A 3CCM3 1LRAA 1WMOA 1W2ZA 1WNHA 1V57A 2W03A 1B2XA 3JUPA 1GOVA 1MGWA 1BSDA 2XF3A 3DGYA 4RNTA 3T8NA 5BU4A 1K8A4 1ZGXA 2XSHB 1JZOA 1BAOA 1SIIA 2FXTA 3DY5A 4FCMA 2P0MA 1RTUA 1GD3A 4CDLA 1VQ53 1Y4KA 1VQ93 2WOFA 3OWYA 3WOEB 1I70A 1U8CB 1YVBI 1EQKA 5CF1A 1IQYA 3BNBA 1W5ZA 1ASKA 4XBXA 5DRVA 1NU3A 1M904 1T5YA 4ILFA 9RNTA 3SOAA 4N3VA 2F98A 3BNCA 2FNQA 3NQYA 3WMDA 4H3UA 1QJGA 3NM7A 2YFJB 4FR9A 5EEOA 4BU4A 1S723 4G1MB 5IERA 1VQQA 3CCR3 3PYJA 3S5CA 2XGNA 1RMSA 2P0XA 3ZG5A 2C4BA 1C54A 4XBTA 4EBGA 4XM4A 4ORLA 1N8QA 3A76A 2YFLB 1LQGC 3DGLA 4OK0A 4EV5A 1ISKA 4CCVA 6RNTA 2OOVA 1DETA 3JUMA 3CME3 3BLZA 3G6E3 1FGTA 2CG0A 1V74A 2AADA 1VQ43 5D81A 2H0IA 4RZMA 2H0GA 5AIFA 1IT7A 1HKXA 3MSOA 5KP4A 1BNIA 1EG9B 5G2GA 8CHOA 3J7Yd 1OF5B 2UUGC 5HOHA 3BU4A 2C10A 2CFDA 2IY2A 2CWVA 3CC43 1G0TA 3B7CA 2D1WA 1BIRA 5AIHA 1M9GA 1WTHA 3BNEA 4HJLB 2V1LA 1YIT3 1LNIA 3V92A 3NM2A 2KXGA 3RGAA 1UGIA 4K61A 5FGOA 1UCJA 5GSPA 3JUQA 4WYKB 1FGRA 1MWUA 1TUHA 1O7HB 3FKAA 2F86B 2Y74A 1MOLA 3NV0B 3LOYA 3MWZA 4KFDA 4U13A 5CK6A 3F7XA 4HM1B 1JN5A 4N6TA 3GAXA 4KVHA 1OHOA 4R80A 1AVLA 1TP6A 3KSPA 1RCKA 4GSPA 4CPKA 2GU1A 1X1UA 2IMJA 1Q9EA 3CNXA 4HBRA 4FMBA 1Q40B 1RDSA 3JUOA 1BU4A 1N5HA 2BMRB 4OUQA 4R1KA 3Q1CA 1SPUA 2GSPA 3MPHA 1N8R4 3NXJA 1YHQ3 3H3HA 1M1XB 3SVAA 3SOYA 1I0VA 3HX8A 3KIIA 2INXA 3DMCA 3WDGB 3LT8A 1BRJA 2UX0A 3EBTA 2W2CA 2BNGA 3GRDA 2Z7AA 3LTBA 1B2ZA 3K7CA 3Q2PA 3G0KA 1EEJA 1VQK3 3NBJA 1LQMB 3X41A 3MKIA 3UNLA 4L8PA 1GOYA 1AR0A 2L1SA 3EHCA 1NO3A 3CCE3 1YJN3 2RGQA 3CMA3 2XR8B 3PCRA 4NPBA 1RGFA 3SX1A 1WMPA 5M19A 1PFPA 2HMJB 3SXXA 2YFIB 1GD4A 5A0OB 3RNTA 2OOVC 1TRQA 2K54A 3F14A 3FG1A 2WGOA 1GYBA 3WR2A 1KC84 3DXOA 1J2BA 1VQN3 1JBRA 3UJMA 1N9EA 3WA3A 3WODG 3QRDA 4EC6A 4OVMA 1Q7HA 2Z6BA 3I563 2ZL8A 1UGHI 4XBYA 3RGRA 1BRKA 2BHMA 1RN4A 2QGUA 3IJEB 2IYJA 4R9KA 6GSPA 2F4YA 1UCLA 4BIRA 4LGQA 2JDIH 7GSPA 5IENA 3CPOA 1CEWI 1BRHA 2HMKB 5STDA 1BRGA 1BRSA 3EN8A 2CFLA 1Q42A 1R4YA 1TFOA 5IF6A 1B2SA 3FSDA 3UL6A 4PEJA 3NHXA 1RGCA 4HKVB 6STDA 4K1UA 1U5OA 1A2KA 2WGQA 4LEHA 4N6V0 2GEXA 3A5EA 3GWRA 4O2HA 1BNSA 2R41A 1VQ73 4HM7B 3UL5A 1RLSA 2QA43 3EX9A 2A15A 2KF5A 4DKIA 1VQP3 3GZXB 4FCJA 4HOHA 1T3BA 1EKMA 1KQS2 1IDPA 1CYUA 3LYGA 3EC9A 3GZYB 1GMRA 2P09A 2RSXA 2K3DA 2STDA 4HVNA 5AYRB 3X40A 1FGQA 1X1YA 1RN7A 3KFQC 1IVUA 5IG3A 4I4KA 1D6UA 1FA3A 3KSED 2B1XB 3D4AA 3D5IA 3NBRA 1W4NA 2Y73A 5AEWB 3ROBA 4N6UA 3L0RA 1OHSA 5D82A 1QAKA 3DGOA 4STDA 1FYSA 2QIYA 1DVDA 3ALAA 3LTAA 1UI7A 4MMXB 3CU3A 2CFWA 4XB5A 5CF2A 4Q53A 3CCV3 1E97A 2AAEA 5JBSA 2O3OA 2P05A 1RGAA 1JB5A 2HMLB 1A67A 4LZIA 2W6JH 3HI7A 1VQL3 1FW7A 3F40A 3KN4A 1B20A 2UGIA 1I3FA 3MG1A 3OXAA 1RSNA 1L5GB 4O02B 2CG1A 3UB1A 2OCTA 1JV2B 1LOWA 3K5TA 3I553 4K90B 2PNCA 3V99A 4BTXA 1MNLA 1S5AA 1GSPA 2B24B 5BIRA 4BTWA 4WWUC 1JN5B 1BVIA 3KZTA 2F5MA 1K734 2K0MA 1VQO3 1LOYA 3HZPA 1IYYA 3D5GA 3LTCA 1MGRA 1KSIA 2F99A 3HK4A 4HM4B 1KWIA 3F9SA 4FMDA 5IEOA 1YJ93 1JKGA 1G96A 3VGNA 3PXMA 4GB5A 2CW9A 4MMYB 1GMQA 1YGEA 3ZFZA 1Q864 2IA7A 1WMNA 1GY5A 1YNVX 4QWTA 2IUKA 4WP5A 3MHEA 2D42A 2XFTA 2ZHXB 3CCL3 1I0XA 1K28A 1UW1A 1ULJB 1EUIC 3NBBA 1PY3A 1PU4A 2OQEA 4NREA 1W6CA 1VQM3 1BNFA 1NDOB 4EV2A 1D6ZA 4MJDA 4IPBA 3TDGA 1QVF2 3CCS3 3B4PA 5DREA 4J5KA 2R4IA 2OTL3 2W9QA 2W9PA 3E99A 2CKFB 1B2UA 1IQXA 3KCHA 1AV4A 2W0QA 4HAAA 3EJVA 1RCLA 2BMOB 1RN1A 2H0HA 1VQ63 2CWTA 4XDVA 1OUNA 1JB4A 3B4OA 4N6NB 1BNGA 1EA2A 3FZWA 1RGHA 2P38A 1UI8A 3MG3A 1FUTA 1W2B2 1BSEA 1MWTA 1STFI 1BANA 1JZDA 5ELJA 3VSYA 2BO9B 1RRHA 5CXOA
chains in the Genus database with same CATH topology
2GBXB 3LTDA 3FG4A 3EQQB 3F8HA 2WO0A 3GZBA 1N5PA 1IK3A 1VQ83 3JVCA 3DUKA 5HGRA 5I97A 1ROAA 1DMNA 3MYTA 1NB3I 1IT8A 2GEYA 1OCVA 1TIJA 1UUWB 4NHFA 3OW22 1QVG2 1RJOA 4HYZA 3CXC2 3F7SA 2CK3H 3G16A 1TFKA 5LC6A 5CLKA 5IG4A 2YX9A 2RCDA 1LOXA 4R9LA 3X3XA 1SIHA 3FCSB 1Q814 1M1K4 5IW9A 3PS8A 4FCZA 4KZ1A 5BXQA 3I0YA 3Q90A 4L8OA 4LSOA 3MG2A 3S27A 1O7MB 3DGMA 1DMMA 3JUNA 2LYXA 2CWUA 5TGNA 5KP3A 4N6MA 3D3LA 1JB2A 1IVVA 2CIUA 3V98A 1DYUA 1SQWA 3EF8A 5AEUB 1GS3A 1W00A 2OQEC 2XRXB 3CCU3 3N54B 3QK9A 3NX0A 3B8LA 4EYCA 3G713 3F8XA 3WOFB 1O7WB 4HM0B 4RBNA 3S67A 2GXFA 4N6OB 3OWSA 3PCSA 5LC7A 4J9AA 1YJW3 4XDWA 3O8YA 1QMAA 1JNQA 3N9HA 1W02A 5AIIA 4MEIA 3LZAA 1IU7A 1YI23 1K9M4 4HM8B 3S28A 1A2VA 1E3VA 2WOHA 3AMOA 3D9RA 3FGYA 5JPPA 1CYVA 3STDA 3LT9A 1QAFA 1IVWA 1STDA 3EBYA 4RNYA 2QEX3 4FMCA 4IIAA 3BNDA 1NB5I 3EB8A 3LXUX 3SEDA 4X2HA 1LVNA 3BB9A 1AVKA 2E2TA 2CC3A 1JKGB 3DM8A 2PZVA 1RRHA 5AYSC 3M8CA 4HM2B 4MMZB 4HZ9B 2C11A 5IG5A 5JPUA 1R4CA 4O8SA 3KE7A 3OWUA 3IPTA 1O7NB 3FF2A 2XFSA 1QALA 1W7CA 1OACA 2BMQB 3RDEA 3U1WA 1N9JA 1D6YA 1O7GB 1OHPA 3CC23 3GZRA 3EE1A 1YIJ3 3PGBA 1Q824 4HM5B 3LMLA 2CHCA 1VZZA 4N6LA 2KRTA 3SLUA 1K41A 1OGXA 3T0UA 1NJI4 2W04A 3G8ZA 4HZBB 1DVCA 3X3YA 1RKYA 1W6GA 5EQLA 2CFKA 1W01A 2XEPA 2GU3A 3ER7A 4J8TA 4JRFA 3FG3A 5AIGA 4X2OA 3K9MC 3G4S3 4O3VA 2GBWB 3N8BA 1JJ22 2BT3A 1FGMA 1ULIB 3HIGA 3K0ZA 3FF0A 5AI1A 4H61A 3U97A 1ZX2A 3OV4A 2E2UA 3PZWA 1SJWA 1OF5A 1E3RA 2Z76A 3WA2X 1HU9A 3FLJA 2KCDA 3FH1A 1IVXA 3LH4A 2M7OA 3VF1A 4AKZA 4KFFA 2MC8A 1W6YA 3CNMA 5EVHA 2I9WA 5IEPA 1CQSA 2L4VA 4LMIA 3NUVA 4WFOA 1IV7A 3K63A 3X42A 4JF8A 1TU5A 4WYKA 2Z77A 1ROVA 4FMAA 4L7KA 1OH0A 3HIIA 2JQ5A 3NV0A 3CCJ3 1FGOA 2CH9A 4WHAA 2Q07A 5ELUA 2XSOB 3S29A 4RNZA 5BVBA 3CPW2 7STDA 3T8UA 4GL6A 3NQZA 5D83A 3CC73 4ZM8A 1IV9A 4IT7A 1GY7A 1LNHA 2W56B 3H51A 2ZDJA 1NWWA 1Q40A 2LQVA 3OX9A 3KKGA 2HMMB 4BTYA 4HM6B 2HMNB 1RRLA 1A90A 1IQ8A 3ECFA 4AEQA 2SBLA 2RFRA 3CD63 1OPYA 1DMQA 4HM3B 1F8NA 2FGTA 3CCQ3 1WQLB 2XGLA 4R4KA 1KD14 1FUWA 1Z1SA 5KP1A 2ML6A 3DGNA 2ML5A 3AMOB 3DZLA 1O7PB 1UUVB 1Q7Y4 3X3ZA 1GY6A 1JRQA 3IMAB 2IUJA 2W56A 1LXEA 2OWPA 1C7HA 4KFEA 4AKYA 2OTJ3 4TX4A 1US1A 5FW5A 2CFGA 3EN1B 1OGZA 5IG0A 2HMOB 1ZO2A 2O9UX 4EXRA 1BUQA 2E2VA 4K1VA 2MF7A 3CCM3 1WMOA 1W2ZA 1WNHA 2W03A 3JUPA 2XF3A 3T8NA 1K8A4 2XSHB 1SIIA 2FXTA 3DY5A 4FCMA 2P0MA 1GD3A 4CDLA 1VQ53 1Y4KA 1VQ93 2WOFA 3OWYA 3WOEB 1U8CB 1YVBI 1EQKA 5CF1A 1IQYA 3BNBA 1ASKA 1W5ZA 4XBXA 5DRVA 1NU3A 1M904 1T5YA 3SOAA 4N3VA 2F98A 3BNCA 2FNQA 3NQYA 3WMDA 4H3UA 1QJGA 3NM7A 2YFJB 4FR9A 5EEOA 1S723 4G1MB 5IERA 3CCR3 3PYJA 3S5CA 2XGNA 2P0XA 4XBTA 4EBGA 4XM4A 4ORLA 1N8QA 3A76A 2YFLB 3DGLA 4OK0A 4EV5A 1ISKA 4CCVA 2OOVA 3JUMA 3CME3 3BLZA 3G6E3 1FGTA 2CG0A 1V74A 1VQ43 5D81A 4RZMA 5AIFA 1IT7A 1HKXA 3MSOA 5KP4A 8CHOA 1EG9B 5G2GA 3J7Yd 1OF5B 2C10A 2CFDA 2CWVA 3CC43 3B7CA 2D1WA 5AIHA 1M9GA 1WTHA 3BNEA 4HJLB 2V1LA 1YIT3 3V92A 3NM2A 2KXGA 3RGAA 4K61A 5FGOA 3JUQA 4WYKB 1FGRA 1TUHA 1O7HB 3FKAA 2F86B 2Y74A 1MOLA 3NV0B 3LOYA 3MWZA 4KFDA 4U13A 5CK6A 3F7XA 4HM1B 1JN5A 4N6TA 3GAXA 4KVHA 1OHOA 4R80A 1AVLA 1TP6A 3KSPA 2GU1A 2IMJA 3CNXA 4HBRA 4FMBA 1Q40B 3JUOA 1N5HA 2BMRB 4OUQA 4R1KA 3Q1CA 1SPUA 3MPHA 1N8R4 3NXJA 1YHQ3 3H3HA 1M1XB 3SVAA 3SOYA 3HX8A 3KIIA 2INXA 3DMCA 3WDGB 3LT8A 2UX0A 3EBTA 2W2CA 2BNGA 3GRDA 2Z7AA 3LTBA 3K7CA 3Q2PA 3G0KA 1VQK3 3NBJA 3X41A 3MKIA 3UNLA 4L8PA 1AR0A 3EHCA 1NO3A 3CCE3 1YJN3 2RGQA 3CMA3 2XR8B 3PCRA 3SX1A 1WMPA 1PFPA 2HMJB 3SXXA 2YFIB 1GD4A 5A0OB 2OOVC 2K54A 3F14A 3FG1A 2WGOA 1GYBA 1J2BA 1KC84 3DXOA 1VQN3 3UJMA 1N9EA 3WA3A 3WODG 3QRDA 4EC6A 4OVMA 2Z6BA 3I563 2ZL8A 4XBYA 3RGRA 2BHMA 2QGUA 3IJEB 4R9KA 5IENA 4LGQA 2JDIH 3CPOA 1CEWI 2HMKB 5STDA 3EN8A 2CFLA 1Q42A 1TFOA 5IF6A 3FSDA 3UL6A 4PEJA 3NHXA 4HKVB 6STDA 4K1UA 1U5OA 1A2KA 2WGQA 4LEHA 4N6V0 2GEXA 3GWRA 4O2HA 1VQ73 4HM7B 3UL5A 2QA43 3EX9A 2A15A 1VQP3 3GZXB 4FCJA 1EKMA 1KQS2 1IDPA 1CYUA 3LYGA 3EC9A 3GZYB 2P09A 2RSXA 2STDA 4HVNA 5AYRB 3X40A 1FGQA 1RN7A 3KFQC 1IVUA 5IG3A 4I4KA 1D6UA 1FA3A 3KSED 2B1XB 3NBRA 1W4NA 2Y73A 5AEWB 3ROBA 4N6UA 3L0RA 1OHSA 5D82A 1QAKA 3DGOA 4STDA 2QIYA 1DVDA 3ALAA 3LTAA 1UI7A 4MMXB 3CU3A 2CFWA 4XB5A 5CF2A 4Q53A 3CCV3 1E97A 5JBSA 2O3OA 2P05A 1JB5A 2HMLB 1A67A 4LZIA 2W6JH 3HI7A 1VQL3 3F40A 3KN4A 3MG1A 3OXAA 1L5GB 4O02B 2CG1A 3UB1A 2OCTA 1JV2B 3K5TA 3I553 4K90B 2PNCA 3V99A 4BTXA 1MNLA 1S5AA 2B24B 4BTWA 4WWUC 1JN5B 3KZTA 1K734 2K0MA 1VQO3 3HZPA 3LTCA 5IEOA 2F99A 1KSIA 3HK4A 4HM4B 1YJ93 1KWIA 3F9SA 4FMDA 1JKGA 1G96A 3VGNA 3PXMA 4GB5A 2CW9A 4MMYB 1YGEA 1Q864 2IA7A 1WMNA 1GY5A 4QWTA 4WP5A 2IUKA 3MHEA 2D42A 2XFTA 3CCL3 1K28A 1UW1A 3NBBA 1ULJB 1PU4A 2OQEA 4NREA 1W6CA 1VQM3 1NDOB 4EV2A 1D6ZA 4MJDA 4IPBA 3TDGA 1QVF2 3CCS3 3B4PA 5DREA 2OTL3 2R4IA 2W9QA 2W9PA 3E99A 2CKFB 1IQXA 1AV4A 2W0QA 3EJVA 2BMOB 1VQ63 2CWTA 4XDVA 1OUNA 1JB4A 3B4OA 4N6NB 1EA2A 3FZWA 2P38A 1UI8A 3MG3A 1W2B2 1STFI 5ELJA 3VSYA 2BO9B 2XH9A 5CXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ML6 A;  2ML5 A;  4R4K A; 
#chains in the Genus database with same CATH topology
 2GBX B;  3LTD A;  3FG4 A;  3EQQ B;  3F8H A;  1BNJ A;  1NNV A;  2WO0 A;  3GZB A;  1N5P A;  1IK3 A;  1VQ8 3;  3JVC A;  3DUK A;  5HGR A;  5I97 A;  1GMP A;  1ROA A;  1DMN A;  3MYT A;  1NB3 I;  1IT8 A;  2GEY A;  2HOH A;  1BSC A;  1OCV A;  1TIJ A;  1UUW B;  4NHF A;  3OW2 2;  1QVG 2;  1RJO A;  4HYZ A;  3CXC 2;  1LOV A;  3F7S A;  2CK3 H;  3G16 A;  1RGE A;  1TFK A;  5LC6 A;  5CLK A;  5IG4 A;  2YX9 A;  2RCD A;  3DH2 A;  1LOX A;  4R9L A;  3X3X A;  1RNB A;  1SIH A;  1B21 A;  3HOH A;  4LYL B;  3FCS B;  1Q81 4;  1M1K 4;  1RGL A;  5IW9 A;  3PS8 A;  4FCZ A;  4KZ1 A;  5BXQ A;  3I0Y A;  3Q90 A;  4L8O A;  4LSO A;  2J8X B;  3MG2 A;  3S27 A;  1O7M B;  3AGN A;  1DMM A;  3DGM A;  2LYX A;  1AY7 A;  3JUN A;  4J5G A;  1BSB A;  1I2E A;  2CWU A;  5TGN A;  1MWR A;  4N6M A;  5KP3 A;  3D3L A;  1JB2 A;  1HYF A;  1IVV A;  1RGK A;  2CIU A;  4I5Q A;  1DYU A;  1PYL A;  1SQW A;  3V98 A;  1FUS A;  2KF4 A;  3EF8 A;  5AEU B;  1GS3 A;  1YGW A;  1W00 A;  2OQE C;  2XRX B;  3CCU 3;  3N54 B;  3QK9 A;  2CX0 A;  3NX0 A;  2KAA A;  3B8L A;  2F56 A;  4EYC A;  3G71 3;  3F8X A;  3WOF B;  1O7W B;  4HM0 B;  4RBN A;  1X1X A;  3S67 A;  2GXF A;  4N6O B;  3OWS A;  3PCS A;  5LC7 A;  4J9A A;  1B3S A;  1YJW 3;  3AHS A;  4XDW A;  3O8Y A;  2KF6 A;  1QMA A;  1JNQ A;  3N9H A;  1W02 A;  1SAR A;  5AII A;  4MEI A;  3LZA A;  1IU7 A;  1YI2 3;  1K9M 4;  1ZS7 A;  4HM8 B;  5M1A A;  3S28 A;  1A2V A;  1E3V A;  2WOH A;  3AMO A;  3D9R A;  3FGY A;  1DE3 A;  5JPP A;  1CYV A;  3STD A;  3LT9 A;  1QAF A;  5RNT A;  1IVW A;  1STD A;  1UCK A;  3EBY A;  4RNY A;  2QEX 3;  4FMC A;  4IIA A;  3BND A;  1NB5 I;  3EB8 A;  3LXU X;  1TTO A;  3SED A;  4X2H A;  1LVN A;  1T2I A;  3BB9 A;  1AVK A;  1T2H A;  1BNR A;  2E2T A;  2CC3 A;  1JKG B;  3DM8 A;  1V58 A;  2PZV A;  5AYS C;  3M8C A;  1A2P A;  2BIR A;  4HM2 B;  4KT3 B;  4MMZ B;  4HZ9 B;  2C11 A;  5IG5 A;  5JPU A;  1R4C A;  4O8S A;  3KE7 A;  1BNE A;  3OWU A;  3IPT A;  4BL3 A;  1O7N B;  2XH9 A;  3ZG0 A;  3FF2 A;  1QAL A;  1W7C A;  2BMQ B;  1OAC A;  2XFS A;  3GSP A;  3RDE A;  1I2F A;  3U1W A;  1N9J A;  1I8V A;  1D6Y A;  1O7G B;  4CJN A;  1OHP A;  1UCI A;  1TRP A;  3CC2 3;  3GZR A;  3EE1 A;  8RNT A;  3BIR A;  1BOX A;  1YIJ 3;  3PGB A;  1Q82 4;  4HM5 B;  5M18 A;  1UDI I;  3LML A;  5G1L A;  2CHC A;  1VZZ A;  1I2G A;  4N6L A;  1HZ1 A;  2KRT A;  3SLU A;  1K41 A;  1OGX A;  3T0U A;  1X1W A;  1TJD A;  1NJI 4;  3D79 A;  2W04 A;  3G8Z A;  4HZB B;  1DVC A;  3X3Y A;  1RKY A;  1I3I A;  1MWS A;  1W6G A;  2KF3 A;  5EQL A;  2CFK A;  1W01 A;  2XEP A;  2GU3 A;  3ER7 A;  4J8T A;  4JRF A;  1RHL A;  3FG3 A;  1UUG B;  5AIG A;  4X2O A;  3K9M C;  3G4S 3;  4O3V A;  1CH0 A;  2GBW B;  3N8B A;  1JJ2 2;  2BT3 A;  1FGM A;  1ULI B;  3HIG A;  2RBI A;  3K0Z A;  3FF0 A;  5AI1 A;  4H61 A;  3U97 A;  1ZX2 A;  4BL2 A;  3OV4 A;  2E2U A;  3PZW A;  1FZU A;  1SJW A;  1OF5 A;  1E3R A;  2Z76 A;  3WA2 X;  1AQZ A;  1BRN L;  1HU9 A;  3FLJ A;  2KCD A;  3FH1 A;  1IVX A;  3LH4 A;  2M7O A;  3VF1 A;  1JBS A;  4AKZ A;  4KFF A;  2RNT A;  1BGS A;  3AGO A;  3Q3F A;  2MC8 A;  1W6Y A;  3CNM A;  5EVH A;  5G1K A;  4EW5 A;  2I9W A;  3URP A;  5IEP A;  1CQS A;  2L4V A;  4LMI A;  1G02 A;  2CX1 A;  3NUV A;  4WFO A;  1IV7 A;  3K63 A;  3X42 A;  2F5W A;  4JF8 A;  1TU5 A;  4WYK A;  2Z77 A;  1ROV A;  4FMA A;  4GHO A;  1RGG A;  4L7K A;  1OH0 A;  3HII A;  2JQ5 A;  3NV0 A;  3CCJ 3;  1JBT A;  1FGO A;  2CH9 A;  4WHA A;  2Q07 A;  5ELU A;  2XSO B;  3S29 A;  4RNZ A;  5BVB A;  7RNT A;  7STD A;  3CPW 2;  1GOU A;  3T8U A;  4GL6 A;  3NQZ A;  5D83 A;  3CC7 3;  4ZM8 A;  1IV9 A;  4IT7 A;  1GY7 A;  1LNH A;  2W56 B;  3H51 A;  2ZDJ A;  1NWW A;  1Q40 A;  2LQV A;  3OX9 A;  3KKG A;  2HMM B;  4BTY A;  4HM6 B;  2HMN B;  1RRL A;  1A90 A;  1IQ8 A;  3ECF A;  4AEQ A;  2SBL A;  2BU4 A;  2RFR A;  3CD6 3;  1OPY A;  1DMQ A;  4HM3 B;  1F8N A;  2FGT A;  2SAR A;  3CCQ 3;  1WQL B;  2XGL A;  4R4K A;  1YVS A;  1KD1 4;  1FUW A;  1RNT A;  1Z1S A;  2ML6 A;  3DGN A;  2ML5 A;  3AMO B;  3DZL A;  5KP1 A;  1O7P B;  3SYU A;  1UUV B;  1Q7Y 4;  3X3Z A;  1GY6 A;  1JRQ A;  3IMA B;  2ZA4 A;  2IUJ A;  2W56 A;  1LXE A;  2OWP A;  1B27 A;  3AHW A;  1C7H A;  4KFE A;  1B2M A;  3WHO A;  4AKY A;  2OTJ 3;  1BUJ A;  4TX4 A;  1US1 A;  1BSA A;  5FW5 A;  2CFG A;  3EN1 B;  1OGZ A;  1BRI A;  5IG0 A;  2HMO B;  1ZO2 A;  2O9U X;  4EXR A;  1BUQ A;  2E2V A;  4K1V A;  2MF7 A;  3CCM 3;  1LRA A;  1WMO A;  1W2Z A;  1WNH A;  1V57 A;  2W03 A;  1B2X A;  3JUP A;  1GOV A;  1MGW A;  1BSD A;  2XF3 A;  3DGY A;  4RNT A;  3T8N A;  5BU4 A;  1K8A 4;  1ZGX A;  2XSH B;  1JZO A;  1BAO A;  1SII A;  2FXT A;  3DY5 A;  4FCM A;  2P0M A;  1RTU A;  1GD3 A;  4CDL A;  1VQ5 3;  1Y4K A;  1VQ9 3;  2WOF A;  3OWY A;  3WOE B;  1I70 A;  1U8C B;  1YVB I;  1EQK A;  5CF1 A;  1IQY A;  3BNB A;  1W5Z A;  1ASK A;  4XBX A;  5DRV A;  1NU3 A;  1M90 4;  1T5Y A;  4ILF A;  9RNT A;  3SOA A;  4N3V A;  2F98 A;  3BNC A;  2FNQ A;  3NQY A;  3WMD A;  4H3U A;  1QJG A;  3NM7 A;  2YFJ B;  4FR9 A;  5EEO A;  4BU4 A;  1S72 3;  4G1M B;  5IER A;  1VQQ A;  3CCR 3;  3PYJ A;  3S5C A;  2XGN A;  1RMS A;  2P0X A;  3ZG5 A;  2C4B A;  1C54 A;  4XBT A;  4EBG A;  4XM4 A;  4ORL A;  1N8Q A;  3A76 A;  2YFL B;  1LQG C;  3DGL A;  4OK0 A;  4EV5 A;  1ISK A;  4CCV A;  6RNT A;  2OOV A;  1DET A;  3JUM A;  3CME 3;  3BLZ A;  3G6E 3;  1FGT A;  2CG0 A;  1V74 A;  2AAD A;  1VQ4 3;  5D81 A;  2H0I A;  4RZM A;  2H0G A;  5AIF A;  1IT7 A;  1HKX A;  3MSO A;  5KP4 A;  1BNI A;  1EG9 B;  5G2G A;  8CHO A;  3J7Y d;  1OF5 B;  2UUG C;  5HOH A;  3BU4 A;  2C10 A;  2CFD A;  2IY2 A;  2CWV A;  3CC4 3;  1G0T A;  3B7C A;  2D1W A;  1BIR A;  5AIH A;  1M9G A;  1WTH A;  3BNE A;  4HJL B;  2V1L A;  1YIT 3;  1LNI A;  3V92 A;  3NM2 A;  2KXG A;  3RGA A;  1UGI A;  4K61 A;  5FGO A;  1UCJ A;  5GSP A;  3JUQ A;  4WYK B;  1FGR A;  1MWU A;  1TUH A;  1O7H B;  3FKA A;  2F86 B;  2Y74 A;  1MOL A;  3NV0 B;  3LOY A;  3MWZ A;  4KFD A;  4U13 A;  5CK6 A;  3F7X A;  4HM1 B;  1JN5 A;  4N6T A;  3GAX A;  4KVH A;  1OHO A;  4R80 A;  1AVL A;  1TP6 A;  3KSP A;  1RCK A;  4GSP A;  4CPK A;  2GU1 A;  1X1U A;  2IMJ A;  1Q9E A;  3CNX A;  4HBR A;  4FMB A;  1Q40 B;  1RDS A;  3JUO A;  1BU4 A;  1N5H A;  2BMR B;  4OUQ A;  4R1K A;  3Q1C A;  1SPU A;  2GSP A;  3MPH A;  1N8R 4;  3NXJ A;  1YHQ 3;  3H3H A;  1M1X B;  3SVA A;  3SOY A;  1I0V A;  3HX8 A;  3KII A;  2INX A;  3DMC A;  3WDG B;  3LT8 A;  1BRJ A;  2UX0 A;  3EBT A;  2W2C A;  2BNG A;  3GRD A;  2Z7A A;  3LTB A;  1B2Z A;  3K7C A;  3Q2P A;  3G0K A;  1EEJ A;  1VQK 3;  3NBJ A;  1LQM B;  3X41 A;  3MKI A;  3UNL A;  4L8P A;  1GOY A;  1AR0 A;  2L1S A;  3EHC A;  1NO3 A;  3CCE 3;  1YJN 3;  2RGQ A;  3CMA 3;  2XR8 B;  3PCR A;  4NPB A;  1RGF A;  3SX1 A;  1WMP A;  5M19 A;  1PFP A;  2HMJ B;  3SXX A;  2YFI B;  1GD4 A;  5A0O B;  3RNT A;  2OOV C;  1TRQ A;  2K54 A;  3F14 A;  3FG1 A;  2WGO A;  1GYB A;  3WR2 A;  1KC8 4;  3DXO A;  1J2B A;  1VQN 3;  1JBR A;  3UJM A;  1N9E A;  3WA3 A;  3WOD G;  3QRD A;  4EC6 A;  4OVM A;  1Q7H A;  2Z6B A;  3I56 3;  2ZL8 A;  1UGH I;  4XBY A;  3RGR A;  1BRK A;  2BHM A;  1RN4 A;  2QGU A;  3IJE B;  2IYJ A;  4R9K A;  6GSP A;  2F4Y A;  1UCL A;  4BIR A;  4LGQ A;  2JDI H;  7GSP A;  5IEN A;  3CPO A;  1CEW I;  1BRH A;  2HMK B;  5STD A;  1BRG A;  1BRS A;  3EN8 A;  2CFL A;  1Q42 A;  1R4Y A;  1TFO A;  5IF6 A;  1B2S A;  3FSD A;  3UL6 A;  4PEJ A;  3NHX A;  1RGC A;  4HKV B;  6STD A;  4K1U A;  1U5O A;  1A2K A;  2WGQ A;  4LEH A;  4N6V 0;  2GEX A;  3A5E A;  3GWR A;  4O2H A;  1BNS A;  2R41 A;  1VQ7 3;  4HM7 B;  3UL5 A;  1RLS A;  2QA4 3;  3EX9 A;  2A15 A;  2KF5 A;  4DKI A;  1VQP 3;  3GZX B;  4FCJ A;  4HOH A;  1T3B A;  1EKM A;  1KQS 2;  1IDP A;  1CYU A;  3LYG A;  3EC9 A;  3GZY B;  1GMR A;  2P09 A;  2RSX A;  2K3D A;  2STD A;  4HVN A;  5AYR B;  3X40 A;  1FGQ A;  1X1Y A;  1RN7 A;  3KFQ C;  1IVU A;  5IG3 A;  4I4K A;  1D6U A;  1FA3 A;  3KSE D;  2B1X B;  3D4A A;  3D5I A;  3NBR A;  1W4N A;  2Y73 A;  5AEW B;  3ROB A;  4N6U A;  3L0R A;  1OHS A;  5D82 A;  1QAK A;  3DGO A;  4STD A;  1FYS A;  2QIY A;  1DVD A;  3ALA A;  3LTA A;  1UI7 A;  4MMX B;  3CU3 A;  2CFW A;  4XB5 A;  5CF2 A;  4Q53 A;  3CCV 3;  1E97 A;  2AAE A;  5JBS A;  2O3O A;  2P05 A;  1RGA A;  1JB5 A;  2HML B;  1A67 A;  4LZI A;  2W6J H;  3HI7 A;  1VQL 3;  1FW7 A;  3F40 A;  3KN4 A;  1B20 A;  2UGI A;  1I3F A;  3MG1 A;  3OXA A;  1RSN A;  1L5G B;  4O02 B;  2CG1 A;  3UB1 A;  2OCT A;  1JV2 B;  1LOW A;  3K5T A;  3I55 3;  4K90 B;  2PNC A;  3V99 A;  4BTX A;  1MNL A;  1S5A A;  1GSP A;  2B24 B;  5BIR A;  4BTW A;  4WWU C;  1JN5 B;  1BVI A;  3KZT A;  2F5M A;  1K73 4;  2K0M A;  1VQO 3;  1LOY A;  3HZP A;  1IYY A;  3D5G A;  3LTC A;  1MGR A;  1KSI A;  2F99 A;  3HK4 A;  4HM4 B;  1KWI A;  3F9S A;  4FMD A;  5IEO A;  1YJ9 3;  1JKG A;  1G96 A;  3VGN A;  3PXM A;  4GB5 A;  2CW9 A;  4MMY B;  1GMQ A;  1YGE A;  3ZFZ A;  1Q86 4;  2IA7 A;  1WMN A;  1GY5 A;  1YNV X;  4QWT A;  2IUK A;  4WP5 A;  3MHE A;  2D42 A;  2XFT A;  2ZHX B;  3CCL 3;  1I0X A;  1K28 A;  1UW1 A;  1ULJ B;  1EUI C;  3NBB A;  1PY3 A;  1PU4 A;  2OQE A;  4NRE A;  1W6C A;  1VQM 3;  1BNF A;  1NDO B;  4EV2 A;  1D6Z A;  4MJD A;  4IPB A;  3TDG A;  1QVF 2;  3CCS 3;  3B4P A;  5DRE A;  4J5K A;  2R4I A;  2OTL 3;  2W9Q A;  2W9P A;  3E99 A;  2CKF B;  1B2U A;  1IQX A;  3KCH A;  1AV4 A;  2W0Q A;  4HAA A;  3EJV A;  1RCL A;  2BMO B;  1RN1 A;  2H0H A;  1VQ6 3;  2CWT A;  4XDV A;  1OUN A;  1JB4 A;  3B4O A;  4N6N B;  1BNG A;  1EA2 A;  3FZW A;  1RGH A;  2P38 A;  1UI8 A;  3MG3 A;  1FUT A;  1W2B 2;  1BSE A;  1MWT A;  1STF I;  1BAN A;  1JZD A;  5ELJ A;  3VSY A;  2BO9 B;  1RRH A;  5CXO A; 
#chains in the Genus database with same CATH homology
 2GBX B;  3LTD A;  3FG4 A;  3EQQ B;  3F8H A;  2WO0 A;  3GZB A;  1N5P A;  1IK3 A;  1VQ8 3;  3JVC A;  3DUK A;  5HGR A;  5I97 A;  1ROA A;  1DMN A;  3MYT A;  1NB3 I;  1IT8 A;  2GEY A;  1OCV A;  1TIJ A;  1UUW B;  4NHF A;  3OW2 2;  1QVG 2;  1RJO A;  4HYZ A;  3CXC 2;  3F7S A;  2CK3 H;  3G16 A;  1TFK A;  5LC6 A;  5CLK A;  5IG4 A;  2YX9 A;  2RCD A;  1LOX A;  4R9L A;  3X3X A;  1SIH A;  3FCS B;  1Q81 4;  1M1K 4;  5IW9 A;  3PS8 A;  4FCZ A;  4KZ1 A;  5BXQ A;  3I0Y A;  3Q90 A;  4L8O A;  4LSO A;  3MG2 A;  3S27 A;  1O7M B;  3DGM A;  1DMM A;  3JUN A;  2LYX A;  2CWU A;  5TGN A;  5KP3 A;  4N6M A;  3D3L A;  1JB2 A;  1IVV A;  2CIU A;  3V98 A;  1DYU A;  1SQW A;  3EF8 A;  5AEU B;  1GS3 A;  1W00 A;  2OQE C;  2XRX B;  3CCU 3;  3N54 B;  3QK9 A;  3NX0 A;  3B8L A;  4EYC A;  3G71 3;  3F8X A;  3WOF B;  1O7W B;  4HM0 B;  4RBN A;  3S67 A;  2GXF A;  4N6O B;  3OWS A;  3PCS A;  5LC7 A;  4J9A A;  1YJW 3;  4XDW A;  3O8Y A;  1QMA A;  1JNQ A;  3N9H A;  1W02 A;  5AII A;  4MEI A;  3LZA A;  1IU7 A;  1YI2 3;  1K9M 4;  4HM8 B;  3S28 A;  1A2V A;  1E3V A;  2WOH A;  3AMO A;  3D9R A;  3FGY A;  5JPP A;  1CYV A;  3STD A;  3LT9 A;  1QAF A;  1IVW A;  1STD A;  3EBY A;  4RNY A;  2QEX 3;  4FMC A;  4IIA A;  3BND A;  1NB5 I;  3EB8 A;  3LXU X;  3SED A;  4X2H A;  1LVN A;  3BB9 A;  1AVK A;  2E2T A;  2CC3 A;  1JKG B;  3DM8 A;  2PZV A;  1RRH A;  5AYS C;  3M8C A;  4HM2 B;  4MMZ B;  4HZ9 B;  2C11 A;  5IG5 A;  5JPU A;  1R4C A;  4O8S A;  3KE7 A;  3OWU A;  3IPT A;  1O7N B;  3FF2 A;  2XFS A;  1QAL A;  1W7C A;  1OAC A;  2BMQ B;  3RDE A;  3U1W A;  1N9J A;  1D6Y A;  1O7G B;  1OHP A;  3CC2 3;  3GZR A;  3EE1 A;  1YIJ 3;  3PGB A;  1Q82 4;  4HM5 B;  3LML A;  2CHC A;  1VZZ A;  4N6L A;  2KRT A;  3SLU A;  1K41 A;  1OGX A;  3T0U A;  1NJI 4;  2W04 A;  3G8Z A;  4HZB B;  1DVC A;  3X3Y A;  1RKY A;  1W6G A;  5EQL A;  2CFK A;  1W01 A;  2XEP A;  2GU3 A;  3ER7 A;  4J8T A;  4JRF A;  3FG3 A;  5AIG A;  4X2O A;  3K9M C;  3G4S 3;  4O3V A;  2GBW B;  3N8B A;  1JJ2 2;  2BT3 A;  1FGM A;  1ULI B;  3HIG A;  3K0Z A;  3FF0 A;  5AI1 A;  4H61 A;  3U97 A;  1ZX2 A;  3OV4 A;  2E2U A;  3PZW A;  1SJW A;  1OF5 A;  1E3R A;  2Z76 A;  3WA2 X;  1HU9 A;  3FLJ A;  2KCD A;  3FH1 A;  1IVX A;  3LH4 A;  2M7O A;  3VF1 A;  4AKZ A;  4KFF A;  2MC8 A;  1W6Y A;  3CNM A;  5EVH A;  2I9W A;  5IEP A;  1CQS A;  2L4V A;  4LMI A;  3NUV A;  4WFO A;  1IV7 A;  3K63 A;  3X42 A;  4JF8 A;  1TU5 A;  4WYK A;  2Z77 A;  1ROV A;  4FMA A;  4L7K A;  1OH0 A;  3HII A;  2JQ5 A;  3NV0 A;  3CCJ 3;  1FGO A;  2CH9 A;  4WHA A;  2Q07 A;  5ELU A;  2XSO B;  3S29 A;  4RNZ A;  5BVB A;  3CPW 2;  7STD A;  3T8U A;  4GL6 A;  3NQZ A;  5D83 A;  3CC7 3;  4ZM8 A;  1IV9 A;  4IT7 A;  1GY7 A;  1LNH A;  2W56 B;  3H51 A;  2ZDJ A;  1NWW A;  1Q40 A;  2LQV A;  3OX9 A;  3KKG A;  2HMM B;  4BTY A;  4HM6 B;  2HMN B;  1RRL A;  1A90 A;  1IQ8 A;  3ECF A;  4AEQ A;  2SBL A;  2RFR A;  3CD6 3;  1OPY A;  1DMQ A;  4HM3 B;  1F8N A;  2FGT A;  3CCQ 3;  1WQL B;  2XGL A;  4R4K A;  1KD1 4;  1FUW A;  1Z1S A;  5KP1 A;  2ML6 A;  3DGN A;  2ML5 A;  3AMO B;  3DZL A;  1O7P B;  1UUV B;  1Q7Y 4;  3X3Z A;  1GY6 A;  1JRQ A;  3IMA B;  2IUJ A;  2W56 A;  1LXE A;  2OWP A;  1C7H A;  4KFE A;  4AKY A;  2OTJ 3;  4TX4 A;  1US1 A;  5FW5 A;  2CFG A;  3EN1 B;  1OGZ A;  5IG0 A;  2HMO B;  1ZO2 A;  2O9U X;  4EXR A;  1BUQ A;  2E2V A;  4K1V A;  2MF7 A;  3CCM 3;  1WMO A;  1W2Z A;  1WNH A;  2W03 A;  3JUP A;  2XF3 A;  3T8N A;  1K8A 4;  2XSH B;  1SII A;  2FXT A;  3DY5 A;  4FCM A;  2P0M A;  1GD3 A;  4CDL A;  1VQ5 3;  1Y4K A;  1VQ9 3;  2WOF A;  3OWY A;  3WOE B;  1U8C B;  1YVB I;  1EQK A;  5CF1 A;  1IQY A;  3BNB A;  1ASK A;  1W5Z A;  4XBX A;  5DRV A;  1NU3 A;  1M90 4;  1T5Y A;  3SOA A;  4N3V A;  2F98 A;  3BNC A;  2FNQ A;  3NQY A;  3WMD A;  4H3U A;  1QJG A;  3NM7 A;  2YFJ B;  4FR9 A;  5EEO A;  1S72 3;  4G1M B;  5IER A;  3CCR 3;  3PYJ A;  3S5C A;  2XGN A;  2P0X A;  4XBT A;  4EBG A;  4XM4 A;  4ORL A;  1N8Q A;  3A76 A;  2YFL B;  3DGL A;  4OK0 A;  4EV5 A;  1ISK A;  4CCV A;  2OOV A;  3JUM A;  3CME 3;  3BLZ A;  3G6E 3;  1FGT A;  2CG0 A;  1V74 A;  1VQ4 3;  5D81 A;  4RZM A;  5AIF A;  1IT7 A;  1HKX A;  3MSO A;  5KP4 A;  8CHO A;  1EG9 B;  5G2G A;  3J7Y d;  1OF5 B;  2C10 A;  2CFD A;  2CWV A;  3CC4 3;  3B7C A;  2D1W A;  5AIH A;  1M9G A;  1WTH A;  3BNE A;  4HJL B;  2V1L A;  1YIT 3;  3V92 A;  3NM2 A;  2KXG A;  3RGA A;  4K61 A;  5FGO A;  3JUQ A;  4WYK B;  1FGR A;  1TUH A;  1O7H B;  3FKA A;  2F86 B;  2Y74 A;  1MOL A;  3NV0 B;  3LOY A;  3MWZ A;  4KFD A;  4U13 A;  5CK6 A;  3F7X A;  4HM1 B;  1JN5 A;  4N6T A;  3GAX A;  4KVH A;  1OHO A;  4R80 A;  1AVL A;  1TP6 A;  3KSP A;  2GU1 A;  2IMJ A;  3CNX A;  4HBR A;  4FMB A;  1Q40 B;  3JUO A;  1N5H A;  2BMR B;  4OUQ A;  4R1K A;  3Q1C A;  1SPU A;  3MPH A;  1N8R 4;  3NXJ A;  1YHQ 3;  3H3H A;  1M1X B;  3SVA A;  3SOY A;  3HX8 A;  3KII A;  2INX A;  3DMC A;  3WDG B;  3LT8 A;  2UX0 A;  3EBT A;  2W2C A;  2BNG A;  3GRD A;  2Z7A A;  3LTB A;  3K7C A;  3Q2P A;  3G0K A;  1VQK 3;  3NBJ A;  3X41 A;  3MKI A;  3UNL A;  4L8P A;  1AR0 A;  3EHC A;  1NO3 A;  3CCE 3;  1YJN 3;  2RGQ A;  3CMA 3;  2XR8 B;  3PCR A;  3SX1 A;  1WMP A;  1PFP A;  2HMJ B;  3SXX A;  2YFI B;  1GD4 A;  5A0O B;  2OOV C;  2K54 A;  3F14 A;  3FG1 A;  2WGO A;  1GYB A;  1J2B A;  1KC8 4;  3DXO A;  1VQN 3;  3UJM A;  1N9E A;  3WA3 A;  3WOD G;  3QRD A;  4EC6 A;  4OVM A;  2Z6B A;  3I56 3;  2ZL8 A;  4XBY A;  3RGR A;  2BHM A;  2QGU A;  3IJE B;  4R9K A;  5IEN A;  4LGQ A;  2JDI H;  3CPO A;  1CEW I;  2HMK B;  5STD A;  3EN8 A;  2CFL A;  1Q42 A;  1TFO A;  5IF6 A;  3FSD A;  3UL6 A;  4PEJ A;  3NHX A;  4HKV B;  6STD A;  4K1U A;  1U5O A;  1A2K A;  2WGQ A;  4LEH A;  4N6V 0;  2GEX A;  3GWR A;  4O2H A;  1VQ7 3;  4HM7 B;  3UL5 A;  2QA4 3;  3EX9 A;  2A15 A;  1VQP 3;  3GZX B;  4FCJ A;  1EKM A;  1KQS 2;  1IDP A;  1CYU A;  3LYG A;  3EC9 A;  3GZY B;  2P09 A;  2RSX A;  2STD A;  4HVN A;  5AYR B;  3X40 A;  1FGQ A;  1RN7 A;  3KFQ C;  1IVU A;  5IG3 A;  4I4K A;  1D6U A;  1FA3 A;  3KSE D;  2B1X B;  3NBR A;  1W4N A;  2Y73 A;  5AEW B;  3ROB A;  4N6U A;  3L0R A;  1OHS A;  5D82 A;  1QAK A;  3DGO A;  4STD A;  2QIY A;  1DVD A;  3ALA A;  3LTA A;  1UI7 A;  4MMX B;  3CU3 A;  2CFW A;  4XB5 A;  5CF2 A;  4Q53 A;  3CCV 3;  1E97 A;  5JBS A;  2O3O A;  2P05 A;  1JB5 A;  2HML B;  1A67 A;  4LZI A;  2W6J H;  3HI7 A;  1VQL 3;  3F40 A;  3KN4 A;  3MG1 A;  3OXA A;  1L5G B;  4O02 B;  2CG1 A;  3UB1 A;  2OCT A;  1JV2 B;  3K5T A;  3I55 3;  4K90 B;  2PNC A;  3V99 A;  4BTX A;  1MNL A;  1S5A A;  2B24 B;  4BTW A;  4WWU C;  1JN5 B;  3KZT A;  1K73 4;  2K0M A;  1VQO 3;  3HZP A;  3LTC A;  5IEO A;  2F99 A;  1KSI A;  3HK4 A;  4HM4 B;  1YJ9 3;  1KWI A;  3F9S A;  4FMD A;  1JKG A;  1G96 A;  3VGN A;  3PXM A;  4GB5 A;  2CW9 A;  4MMY B;  1YGE A;  1Q86 4;  2IA7 A;  1WMN A;  1GY5 A;  4QWT A;  4WP5 A;  2IUK A;  3MHE A;  2D42 A;  2XFT A;  3CCL 3;  1K28 A;  1UW1 A;  3NBB A;  1ULJ B;  1PU4 A;  2OQE A;  4NRE A;  1W6C A;  1VQM 3;  1NDO B;  4EV2 A;  1D6Z A;  4MJD A;  4IPB A;  3TDG A;  1QVF 2;  3CCS 3;  3B4P A;  5DRE A;  2OTL 3;  2R4I A;  2W9Q A;  2W9P A;  3E99 A;  2CKF B;  1IQX A;  1AV4 A;  2W0Q A;  3EJV A;  2BMO B;  1VQ6 3;  2CWT A;  4XDV A;  1OUN A;  1JB4 A;  3B4O A;  4N6N B;  1EA2 A;  3FZW A;  2P38 A;  1UI8 A;  3MG3 A;  1W2B 2;  1STF I;  5ELJ A;  3VSY A;  2BO9 B;  2XH9 A;  5CXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...