3EB8A

Vira
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
334
Chain Sequence
b'AEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease-like virA
publication title Structural and functional studies indicate that Shigella VirA is not a protease and does not directly destabilize microtubules.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
total genus 99
structure length 334
sequence length 347
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3eb8A01
4FMBA 3PCSA 4FMCA 3Q1CA 4FMAA 3EB8A 4FMDA 3PCRA 3EE1A
chains in the Genus database with same CATH superfamily
1C54A 3MWZA 5EQLA 3SX1A 2CHCA 1RGKA 3NV0A 3EB8A 1MWUA 1TTOA 1UUWB 4GL6A 1SIIA 3HK4A 1TFKA 1CH0A 3S27A 3D5IA 1M1XB 1UW1A 3S67A 1TU5A 3BNDA 4I4KA 1T2HA 3EN1B 2XSOB 4MMXB 3OWYA 4R9KA 5KP4A 1US1A 3MSOA 1RDSA 5IERA 4PEJA 2WGOA 2OTJ3 1IV7A 4LZIA 1FGMA 1I0XA 1TUHA 2HMJB 2KAAA 4FR9A 4BU4A 3G4S3 1TIJA 3LYGA 1JN5A 1GMQA 1BSBA 5G2GA 4HOHA 1W7CA 2KCDA 1T3BA 4FMCA 1BNFA 4AKYA 1JB5A 4TX4A 1IV9A 1MWTA 4X2OA 3T8UA 4HM7B 3WDGB 1LXEA 3JUMA 4HYZA 1Q864 1QVG2 1Q40B 1W6CA 1YIJ3 3ZFZA 2CG0A 4IIAA 5M1AA 3FCSB 1LNIA 4XDWA 3CCJ3 1K9M4 1VQQA 2XRXB 1OCVA 1NB5I 2RGQA 5LC6A 5FW5A 1IDPA 5RNTA 5D83A 2P38A 2GEXA 1B2XA 4HM5B 3CME3 3HIGA 3K63A 1I3IA 2BMOB 1CQSA 3N54B 1J2BA 1FUWA 1BRGA 3STDA 1FUSA 2CH9A 4XM4A 1Q824 5IW9A 3F9SA 5G1KA 2GBXB 1V57A 1LNHA 2XSHB 2RSXA 3D5GA 2IY2A 1B2SA 4HJLB 3WR2A 3NHXA 3I563 3FF2A 2H0IA 2L1SA 5D81A 3CCQ3 1AV4A 1GD4A 1EEJA 3ZG5A 3Q2PA 2PZVA 3T0UA 3AMOA 3NM2A 3RNTA 1K41A 3BNEA 2MF7A 3V92A 2GEYA 1GY6A 1B21A 3MPHA 2MC8A 3SLUA 1IQXA 3SXXA 3K5TA 1W2B2 5IF6A 1IU7A 1I2GA 4HZBB 1Q7Y4 1Y4KA 1JN5B 1PYLA 2CWUA 2CG1A 3WHOA 4CPKA 2YFLB 1W4NA 2ML5A 1EG9B 2XF3A 1JNQA 1SQWA 2PNCA 3ALAA 1A90A 2OCTA 4O2HA 1UUVB 1QAFA 8RNTA 2D1WA 5ELUA 4EXRA 5IG4A 3CU3A 1GSPA 3MG1A 2A15A 2CK3H 4O8SA 4XDVA 1VQO3 3A5EA 4NPBA 4XBYA 3CNXA 1B2UA 3NQZA 5JPUA 1QVF2 1DMMA 1E3RA 3CCL3 1N5PA 1MGRA 1MWSA 1N9EA 1ZS7A 1DYUA 3KE7A 3LTDA 4G1MB 4HAAA 1ISKA 5HGRA 2GSPA 1GS3A 3OWSA 4HM8B 2OOVC 1EUIC 2SARA 1JRQA 1PY3A 4CDLA 3CCE3 2F5MA 3DY5A 5AIIA 4JF8A 1GOVA 3FLJA 1ULJB 2CFWA 1X1UA 1UCJA 1Z1SA 4CCVA 3GZYB 4DKIA 2F86B 5AEUB 2AADA 3AMOB 1RMSA 3BLZA 5AYRB 4WWUC 1NU3A 3IPTA 3OX9A 1CYVA 1JBRA 1YJN3 3F40A 1UGHI 1IT8A 1EKMA 2WOFA 3BNBA 2F98A 6STDA 1VQ73 3ER7A 1CYUA 1BRJA 1VQ63 4FCZA 1GMRA 3OW22 1JKGA 3LXUX 1LVNA 2H0GA 3BNCA 3T8NA 1RSNA 1ZGXA 2QEX3 3DM8A 2KF6A 3WOFB 1WMNA 4HZ9B 4HBRA 4EW5A 1BSDA 2GU1A 3WMDA 5BVBA 4STDA 5D82A 1KQS2 1IQYA 3DGMA 3K9MC 4LSOA 1TRQA 3GSPA 5CK6A 1WMOA 2FNQA 4WP5A 2HMOB 1I8VA 3DUKA 4LGQA 1STDA 3NUVA 4HM4B 3GZXB 1KSIA 2GBWB 2YFJB 4ILFA 3G8ZA 3HI7A 3EF8A 1WQLB 4K61A 1BSCA 4WHAA 2OQEC 2H0HA 2KF4A 4FMBA 1YNVX 1AVLA 1GYBA 3FKAA 1F8NA 3HZPA 1VQL3 4LMIA 5HOHA 2FXTA 4RNZA 2HMMB 1M1K4 4N6UA 2K54A 2IUKA 1YVBI 1A2PA 1YHQ3 2XFTA 1DMNA 1W2ZA 1W02A 3IJEB 1U8CB 7GSPA 1IQ8A 3I553 2UGIA 2B24B 4IPBA 4L8OA 8CHOA 3Q3FA 2O3OA 2QA43 1FW7A 1RCKA 2CFLA 3PXMA 3EHCA 2D42A 3PS8A 1NWWA 3NM7A 1JB2A 1RLSA 2F56A 3CPOA 4I5QA 1JZOA 1TRPA 1W6YA 2JQ5A 4N6TA 5CF2A 4BIRA 1YIT3 3MYTA 2INXA 4MEIA 1GOYA 4MJDA 1RNBA 1FGQA 4GSPA 5A0OB 4EYCA 3EX9A 3FG4A 3ROBA 1DMQA 3AGNA 5FGOA 1BRKA 1IVXA 2ZDJA 1AY7A 1DVCA 1FGTA 2W0QA 4RZMA 1IK3A 1LOVA 1Q9EA 3LTBA 1JBSA 3CMA3 3I0YA 1X1XA 4NREA 1RGHA 1HKXA 1A2VA 1LOWA 3NV0B 5BU4A 2JDIH 3JUQA 3CCU3 1M904 3HIIA 2CWVA 2M7OA 3KSED 1I0VA 4N6OB 4X2HA 3SYUA 4L7KA 1BNSA 1ULIB 5GSPA 1UUGB 1TP6A 2CKFB 2RCDA 1D6ZA 3B4PA 3D79A 4WYKA 1BNRA 1WMPA 3UL6A 2CW9A 2LYXA 2W03A 1DETA 3X3XA 4BTWA 4R9LA 1PU4A 3CC43 2E2TA 3EBYA 1ZO2A 3DGYA 3KIIA 1AQZA 1STFI 4ORLA 1ROAA 3QK9A 4QWTA 1JJ22 2HOHA 3BIRA 2F5WA 2HMKB 3FSDA 3D4AA 3WOEB 2RNTA 3MKIA 2BHMA 1MWRA 3V98A 1ROVA 1LOYA 1TFOA 3DMCA 1NB3I 4AEQA 2CFKA 2L4VA 4ZM8A 1RGFA 1QMAA 1B2MA 1V74A 4L8PA 3OV4A 1B20A 4RBNA 3AHWA 3FH1A 2QIYA 1G96A 2WO0A 3Q1CA 3ZG0A 1AVKA 4LEHA 3FZWA 1D6YA 3CCM3 2XFSA 3PGBA 3CNMA 1FUTA 3HOHA 1DE3A 1UCIA 3LOYA 1R4YA 1BIRA 2W56A 2CX1A 3CXC2 3F8XA 1VZZA 2E2VA 1LOXA 5LC7A 4H3UA 2WOHA 1VQP3 3LT8A 1RGLA 1QAKA 1LQMB 4FMAA 3VSYA 3A76A 2RFRA 5G1LA 1O7NB 1UGIA 1UI7A 2C11A 2Z77A 3JUNA 4NHFA 5IG5A 1DVDA 1I2EA 3AHSA 5IENA 2Z7AA 4RNTA 1RRHA 4WYKB 3LT9A 5CLKA 3MG3A 1B2ZA 1OACA 3QRDA 3SOAA 3H3HA 1BRHA 2IYJA 3S29A 3V99A 3X41A 4H61A 1BSAA 1BNGA 4J9AA 4OK0A 1HYFA 1JZDA 5IG0A 4BL2A 2QGUA 1U5OA 4LYLB 3CCS3 3FGYA 5IEPA 1D6UA 2CIUA 1VQN3 1I3FA 9RNTA 4HVNA 1JBTA 2R41A 1TJDA 3KZTA 1N9JA 1C7HA 3MHEA 4MMYB 1BRNL 1BVIA 2E2UA 2KF5A 3OWUA 4HKVB 3KCHA 3WA3A 5BXQA 4EBGA 1KC84 2BMQB 1L5GB 1VQ43 3S28A 2R4IA 2W04A 3FG1A 3ECFA 3PCRA 2YX9A 3VF1A 3FF0A 3NBRA 1YVSA 2K0MA 1R4CA 4FCMA 1UCKA 2KRTA 1LRAA 2K3DA 5AEWB 1I2FA 4XBXA 2B1XB 2CC3A 6GSPA 3CD63 4K1UA 4FCJA 2W56B 1A67A 1BU4A 3B7CA 3N8BA 2Y73A 1GMPA 3KSPA 4R1KA 1EQKA 2J8XB 4O3VA 5DREA 1N8R4 1KD14 3BB9A 4EC6A 4BTXA 3CPW2 3LH4A 4K90B 4EV2A 4KFDA 3KN4A 1YJ93 2W9PA 4MMZB 4R80A 1YGWA 1O7HB 1PFPA 3HX8A 1X1YA 5CF1A 3WODG 1BNEA 1RHLA 2HMLB 1S723 1QJGA 4N6V0 1OHPA 1RGEA 3EQQB 1IVVA 3RDEA 1RJOA 3CC23 5JPPA 1RN1A 1UI8A 5AIGA 3X3ZA 4N3VA 1GY7A 3DZLA 3LTAA 1O7PB 1BNJA 3JVCA 1JKGB 3RGAA 1O7GB 3PYJA 1O7WB 2P09A 2STDA 1OUNA 1T5YA 1WTHA 3UL5A 3SVAA 1Q814 1BGSA 1OF5A 2GU3A 1W6GA 3EC9A 2LQVA 1T2IA 2XEPA 2WGQA 4HM6B 5EVHA 2V1LA 4KT3B 1YI23 1N8QA 3GZBA 1HU9A 2XGLA 4HM1B 3TDGA 4BTYA 4CJNA 5KP1A 4XB5A 5TGNA 2OOVA 1Q7HA 1S5AA 4U13A 1V58A 3Q90A 2YFIB 4WFOA 3EJVA 1YJW3 1B3SA 1BRSA 1A2KA 3EE1A 4K1VA 1OHSA 1IVUA 2OWPA 3S5CA 2IA7A 1UCLA 2UUGC 3CC73 4JRFA 1MNLA 2W6JH 4HM2B 1RGGA 1IYYA 3D9RA 2IUJA 1X1WA 5KP3A 1KWIA 3N9HA 1HZ1A 3K7CA 1FGRA 1NO3A 4FMDA 2CX0A 2GXFA 2Y74A 1BUQA 3DGOA 1Q42A 1ZX2A 3PCSA 1SJWA 4RNYA 3DGLA 3NX0A 1VQM3 1BRIA 1NNVA 2W9QA 2XGNA 3G0KA 1BUJA 3RGRA 4J8TA 2AAEA 5AIFA 1K8A4 3AGOA 3U1WA 3L0RA 2BO9B 1CEWI 2IMJA 4O02B 1VQ83 2BMRB 1N5HA 3GZRA 1AR0A 5IG3A 1I70A 2Z76A 4Q53A 1LQGC 2C10A 5DRVA 1NDOB 3NQYA 1GY5A 1RN4A 2ML6A 2SBLA 1O7MB 2ZA4A 3GWRA 3NXJA 3VGNA 2ZL8A 3LTCA 7STDA 1OF5B 1YGEA 5STDA 1K28A 1SARA 4J5KA 3CCV3 1EA2A 2I9WA 2ZHXB 5M18A 2CWTA 5AYSC 2Q07A 7RNTA 3JUOA 2OQEA 5IEOA 2O9UX 1BNIA 1OPYA 1MOLA 1IT7A 3B4OA 2F4YA 3DGNA 2P0MA 1W01A 2F99A 2RBIA 4N6MA 4N6LA 3X42A 5BIRA 3G713 2CFDA 5M19A 1FZUA 1IVWA 1OGZA 1FA3A 1BAOA 1QALA 2P0XA 1OGXA 3X3YA 1W5ZA 1BOXA 1FYSA 3O8YA 3GAXA 3M8CA 2BNGA 1K734 3UJMA 1G0TA 2C4BA 3F7XA 3IMAB 3SOYA 3B8LA 3DXOA 3F14A 2W2CA 4XBTA 1RRLA 5JBSA 3NBBA 5AI1A 4HM3B 3BU4A 3K0ZA 4IT7A 4OUQA 1BANA 2HMNB 4AKZA 4KZ1A 3PZWA 4GHOA 5I97A 4EV5A 3SEDA 1G02A 5CXOA 1ASKA 1BSEA 1SIHA 2KF3A 3EBTA 4GB5A 6RNTA 1RGCA 3MG2A 3G6E3 1VQK3 4OVMA 1OH0A 3NBJA 1VQ93 1RCLA 1MGWA 3UB1A 3CCR3 2Z6BA 2FGTA 1VQ53 2XH9A 3U97A 1E97A 1Q40A 4KFFA 5AIHA 1M9GA 1JV2B 2BU4A 5EEOA 4N6NB 3G16A 3UNLA 1JB4A 4BL3A 3LZAA 2UX0A 4J5GA 4R4KA 3DH2A 3EN8A 4KVHA 3WA2X 1RGAA 1RKYA 4HM0B 3GRDA 3X40A 3F7SA 3F8HA 2P05A 1W00A 2BT3A 3KKGA 3J7Yd 3LMLA 2KXGA 1OHOA 1E3VA 1SPUA 1WNHA 3H51A 2XR8B 5ELJA 3OXAA 2OTL3 4KFEA 3D3LA 1RTUA 3JUPA 1GD3A 1FGOA 1RN7A 1GOUA 1RNTA 2BIRA 3E99A 3FG3A 3KFQC 1NJI4 1UDII 2CFGA 1B27A 3URPA
chains in the Genus database with same CATH topology
3MWZA 5EQLA 3SX1A 2CHCA 3NV0A 3EB8A 1UUWB 4GL6A 1SIIA 3HK4A 1TFKA 3S27A 1M1XB 1UW1A 3S67A 1TU5A 3BNDA 4I4KA 3EN1B 2XSOB 4MMXB 3OWYA 4R9KA 5KP4A 1US1A 3MSOA 4PEJA 2WGOA 2OTJ3 1IV7A 4LZIA 1FGMA 1TUHA 2HMJB 4FR9A 3G4S3 1TIJA 3LYGA 1JN5A 5G2GA 4AKYA 1W7CA 2KCDA 4FMCA 1JB5A 4TX4A 1IV9A 4X2OA 3T8UA 4HM7B 3WDGB 1LXEA 3JUMA 4HYZA 1Q864 1QVG2 1Q40B 1W6CA 1YIJ3 2CG0A 4IIAA 3FCSB 4XDWA 3CCJ3 1K9M4 2XRXB 1OCVA 1NB5I 2RGQA 5LC6A 5FW5A 1IDPA 5D83A 2P38A 2GEXA 4HM5B 3CME3 3HIGA 3K63A 2BMOB 1CQSA 3N54B 1J2BA 1FUWA 3STDA 2CH9A 4XM4A 1Q824 5IW9A 3F9SA 2GBXB 1LNHA 2XSHB 2RSXA 4HJLB 3NHXA 3I563 3FF2A 5D81A 3CCQ3 1AV4A 1GD4A 3Q2PA 2PZVA 3T0UA 3AMOA 3NM2A 1K41A 3BNEA 2MF7A 3V92A 2GEYA 1GY6A 3MPHA 2MC8A 3SLUA 1IQXA 3SXXA 3K5TA 1W2B2 5IF6A 1IU7A 4HZBB 1Q7Y4 1Y4KA 1JN5B 2CWUA 2CG1A 2YFLB 1W4NA 1EG9B 2XF3A 1JNQA 1SQWA 2PNCA 3ALAA 1A90A 2OCTA 4O2HA 1UUVB 1QAFA 2D1WA 5ELUA 4EXRA 5IG4A 3CU3A 3MG1A 2A15A 2CK3H 4O8SA 4XDVA 1VQO3 4XBYA 3CNXA 3NQZA 5JPUA 1QVF2 1DMMA 1E3RA 3CCL3 1N5PA 1N9EA 1DYUA 3KE7A 3LTDA 4G1MB 1ISKA 5HGRA 1GS3A 3OWSA 4HM8B 2OOVC 1JRQA 4CDLA 3CCE3 3DY5A 5AIIA 4JF8A 3FLJA 1ULJB 2CFWA 1Z1SA 4CCVA 3GZYB 2F86B 5AEUB 3AMOB 3BLZA 5AYRB 4WWUC 1NU3A 3IPTA 3OX9A 1CYVA 1YJN3 3F40A 1IT8A 1EKMA 2WOFA 3BNBA 2F98A 6STDA 1VQ73 3ER7A 1CYUA 1VQ63 4FCZA 3OW22 1JKGA 3LXUX 1LVNA 3BNCA 3T8NA 2QEX3 3DM8A 3WOFB 1WMNA 4HZ9B 4HBRA 5BVBA 2GU1A 3WMDA 4STDA 5D82A 1KQS2 1IQYA 3DGMA 3K9MC 4LSOA 5CK6A 1WMOA 2FNQA 4WP5A 2HMOB 3DUKA 4LGQA 1STDA 4HM4B 3GZXB 1KSIA 2GBWB 2YFJB 3G8ZA 3HI7A 3EF8A 1WQLB 4K61A 4WHAA 2OQEC 4FMBA 1AVLA 1GYBA 3FKAA 1F8NA 3HZPA 1VQL3 4LMIA 2FXTA 4RNZA 2HMMB 1M1K4 4N6UA 2K54A 2IUKA 1YVBI 1YHQ3 2XFTA 1DMNA 1W2ZA 1W02A 3IJEB 1U8CB 1IQ8A 3I553 2QA43 2B24B 4IPBA 4L8OA 8CHOA 2O3OA 2CFLA 3PXMA 3EHCA 2D42A 3PS8A 1NWWA 3NM7A 1JB2A 3CPOA 1W6YA 1YIT3 2JQ5A 4N6TA 5CF2A 3MYTA 2INXA 4MEIA 4MJDA 1FGQA 5A0OB 4EYCA 3EX9A 3FG4A 3ROBA 1DMQA 5FGOA 1IVXA 2ZDJA 1DVCA 1FGTA 2W0QA 4RZMA 1IK3A 3LTBA 3CMA3 3I0YA 4NREA 1HKXA 1A2VA 3NV0B 2JDIH 3JUQA 3CCU3 1M904 3HIIA 2CWVA 2M7OA 3KSED 4N6OB 4X2HA 4L7KA 1ULIB 1TP6A 2CKFB 2RCDA 1D6ZA 3B4PA 4WYKA 1WMPA 3UL6A 2CW9A 2LYXA 2W03A 3X3XA 4BTWA 1PU4A 4R9LA 3CC43 2E2TA 3EBYA 1ZO2A 3KIIA 1STFI 4ORLA 1ROAA 3QK9A 4QWTA 1JJ22 2HMKB 3FSDA 3WOEB 3MKIA 2BHMA 3V98A 1ROVA 1TFOA 3DMCA 1NB3I 4AEQA 2CFKA 2L4VA 4ZM8A 1QMAA 1V74A 4L8PA 3OV4A 4RBNA 3FH1A 2QIYA 1G96A 2WO0A 3Q1CA 1AVKA 4LEHA 3FZWA 1D6YA 3CCM3 2XFSA 3PGBA 3CNMA 3LOYA 2W56A 3CXC2 3F8XA 1VZZA 2E2VA 1LOXA 5LC7A 4H3UA 2WOHA 1VQP3 3LT8A 1QAKA 4FMAA 3VSYA 3A76A 2RFRA 1O7NB 1UI7A 2C11A 2Z77A 3JUNA 4NHFA 5IG5A 1DVDA 5IENA 2Z7AA 1RRHA 4WYKB 3LT9A 5CLKA 3MG3A 1OACA 3QRDA 3SOAA 3H3HA 3S29A 3V99A 3X41A 5IERA 4H61A 4J9AA 4OK0A 5IG0A 2QGUA 1U5OA 3CCS3 3FGYA 5IEPA 1D6UA 2CIUA 1VQN3 4HVNA 3KZTA 1N9JA 1C7HA 3MHEA 4MMYB 2E2UA 3WA3A 3OWUA 4HKVB 5BXQA 4EBGA 1KC84 2BMQB 1L5GB 1VQ43 3S28A 2R4IA 2W04A 3FG1A 3ECFA 3PCRA 2YX9A 3VF1A 3FF0A 3NBRA 2K0MA 4FCMA 1R4CA 2KRTA 5AEWB 4XBXA 2B1XB 2CC3A 3CD63 4K1UA 4FCJA 2W56B 1A67A 3B7CA 3N8BA 2Y73A 3KSPA 4R1KA 1EQKA 4O3VA 5DREA 1N8R4 1KD14 3BB9A 4EC6A 4BTXA 3CPW2 3LH4A 4K90B 4EV2A 4KFDA 3KN4A 1YJ93 2W9PA 4MMZB 4R80A 1O7HB 1PFPA 3HX8A 5CF1A 3WODG 2HMLB 1S723 1QJGA 4N6V0 1OHPA 3CC23 3EQQB 1IVVA 3RDEA 1RJOA 5JPPA 1UI8A 5AIGA 3X3ZA 4N3VA 1GY7A 3DZLA 3LTAA 1O7PB 3JVCA 1JKGB 3RGAA 1O7GB 3PYJA 1O7WB 2P09A 2STDA 1OUNA 1T5YA 1WTHA 3UL5A 3SVAA 1Q814 1OF5A 2GU3A 1W6GA 3EC9A 2LQVA 2XEPA 2WGQA 4HM6B 5EVHA 2V1LA 1YI23 1N8QA 3GZBA 1HU9A 2XGLA 4HM1B 3TDGA 4BTYA 5KP1A 4XB5A 5TGNA 2OOVA 1S5AA 4U13A 1YJW3 3Q90A 2YFIB 4WFOA 3EJVA 3EE1A 1A2KA 4K1VA 1OHSA 1IVUA 2OWPA 3S5CA 2IA7A 3CC73 4JRFA 1MNLA 2W6JH 4HM2B 3D9RA 2IUJA 5KP3A 1KWIA 3N9HA 3K7CA 1FGRA 1NO3A 4FMDA 2GXFA 2Y74A 1BUQA 3DGOA 1Q42A 1ZX2A 3PCSA 1SJWA 4RNYA 3DGLA 3NX0A 1VQM3 2W9QA 2XGNA 3G0KA 3RGRA 4J8TA 5AIFA 1K8A4 3U1WA 3L0RA 2BO9B 1CEWI 2IMJA 4O02B 1VQ83 2BMRB 1N5HA 3GZRA 1AR0A 5IG3A 2Z76A 4Q53A 2C10A 5DRVA 1NDOB 3NQYA 1GY5A 2ML6A 2SBLA 1O7MB 3GWRA 3NXJA 3VGNA 2ZL8A 3LTCA 7STDA 1OF5B 1YGEA 5STDA 1K28A 3CCV3 1EA2A 2I9WA 2CWTA 5AYSC 2Q07A 3JUOA 2OQEA 5IEOA 2O9UX 1OPYA 1MOLA 1IT7A 3B4OA 3DGNA 2P0MA 1W01A 2F99A 4N6MA 3X42A 3G713 2CFDA 1IVWA 1OGZA 1FA3A 1QALA 2P0XA 1OGXA 3X3YA 1W5ZA 3O8YA 3GAXA 3M8CA 2BNGA 1K734 3UJMA 3F7XA 3IMAB 3SOYA 3B8LA 3DXOA 3F14A 2W2CA 4XBTA 1RRLA 5JBSA 3NBBA 5AI1A 4HM3B 4IT7A 3K0ZA 4OUQA 2HMNB 4AKZA 4KZ1A 3PZWA 5I97A 4EV5A 3SEDA 5CXOA 1ASKA 3G6E3 1SIHA 3EBTA 4GB5A 3MG2A 1VQK3 4OVMA 1OH0A 3NBJA 1VQ93 3CCR3 3UB1A 2Z6BA 2FGTA 1VQ53 2XH9A 3U97A 1E97A 1Q40A 4KFFA 5AIHA 1M9GA 1JV2B 5EEOA 4N6NB 3G16A 3UNLA 1JB4A 3LZAA 2UX0A 4R4KA 3EN8A 4KVHA 3WA2X 1RKYA 4HM0B 3GRDA 3X40A 3F7SA 3F8HA 2P05A 1W00A 2BT3A 3KKGA 3J7Yd 3LMLA 2KXGA 1OHOA 1E3VA 1SPUA 1WNHA 3H51A 2XR8B 5ELJA 3OXAA 2OTL3 4KFEA 3D3LA 3JUPA 1GD3A 1FGOA 1RN7A 3E99A 3KFQC 3NUVA 4N6LA 3FG3A 1NJI4 2CFGA 2ML5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMB A;  3PCS A;  4FMC A;  3Q1C A;  4FMA A;  3EB8 A;  4FMD A;  3PCR A;  3EE1 A; 
#chains in the Genus database with same CATH topology
 1C54 A;  3MWZ A;  5EQL A;  3SX1 A;  2CHC A;  1RGK A;  3NV0 A;  3EB8 A;  1MWU A;  1TTO A;  1UUW B;  4GL6 A;  1SII A;  3HK4 A;  1TFK A;  1CH0 A;  3S27 A;  3D5I A;  1M1X B;  1UW1 A;  3S67 A;  1TU5 A;  3BND A;  4I4K A;  1T2H A;  3EN1 B;  2XSO B;  4MMX B;  3OWY A;  4R9K A;  5KP4 A;  1US1 A;  3MSO A;  1RDS A;  5IER A;  4PEJ A;  2WGO A;  2OTJ 3;  1IV7 A;  4LZI A;  1FGM A;  1I0X A;  1TUH A;  2HMJ B;  2KAA A;  4FR9 A;  4BU4 A;  3G4S 3;  1TIJ A;  3LYG A;  1JN5 A;  1GMQ A;  1BSB A;  5G2G A;  4HOH A;  1W7C A;  2KCD A;  1T3B A;  4FMC A;  1BNF A;  4AKY A;  1JB5 A;  4TX4 A;  1IV9 A;  1MWT A;  4X2O A;  3T8U A;  4HM7 B;  3WDG B;  1LXE A;  3JUM A;  4HYZ A;  1Q86 4;  1QVG 2;  1Q40 B;  1W6C A;  1YIJ 3;  3ZFZ A;  2CG0 A;  4IIA A;  5M1A A;  3FCS B;  1LNI A;  4XDW A;  3CCJ 3;  1K9M 4;  1VQQ A;  2XRX B;  1OCV A;  1NB5 I;  2RGQ A;  5LC6 A;  5FW5 A;  1IDP A;  5RNT A;  5D83 A;  2P38 A;  2GEX A;  1B2X A;  4HM5 B;  3CME 3;  3HIG A;  3K63 A;  1I3I A;  2BMO B;  1CQS A;  3N54 B;  1J2B A;  1FUW A;  1BRG A;  3STD A;  1FUS A;  2CH9 A;  4XM4 A;  1Q82 4;  5IW9 A;  3F9S A;  5G1K A;  2GBX B;  1V57 A;  1LNH A;  2XSH B;  2RSX A;  3D5G A;  2IY2 A;  1B2S A;  4HJL B;  3WR2 A;  3NHX A;  3I56 3;  3FF2 A;  2H0I A;  2L1S A;  5D81 A;  3CCQ 3;  1AV4 A;  1GD4 A;  1EEJ A;  3ZG5 A;  3Q2P A;  2PZV A;  3T0U A;  3AMO A;  3NM2 A;  3RNT A;  1K41 A;  3BNE A;  2MF7 A;  3V92 A;  2GEY A;  1GY6 A;  1B21 A;  3MPH A;  2MC8 A;  3SLU A;  1IQX A;  3SXX A;  3K5T A;  1W2B 2;  5IF6 A;  1IU7 A;  1I2G A;  4HZB B;  1Q7Y 4;  1Y4K A;  1JN5 B;  1PYL A;  2CWU A;  2CG1 A;  3WHO A;  4CPK A;  2YFL B;  1W4N A;  2ML5 A;  1EG9 B;  2XF3 A;  1JNQ A;  1SQW A;  2PNC A;  3ALA A;  1A90 A;  2OCT A;  4O2H A;  1UUV B;  1QAF A;  8RNT A;  2D1W A;  5ELU A;  4EXR A;  5IG4 A;  3CU3 A;  1GSP A;  3MG1 A;  2A15 A;  2CK3 H;  4O8S A;  4XDV A;  1VQO 3;  3A5E A;  4NPB A;  4XBY A;  3CNX A;  1B2U A;  3NQZ A;  5JPU A;  1QVF 2;  1DMM A;  1E3R A;  3CCL 3;  1N5P A;  1MGR A;  1MWS A;  1N9E A;  1ZS7 A;  1DYU A;  3KE7 A;  3LTD A;  4G1M B;  4HAA A;  1ISK A;  5HGR A;  2GSP A;  1GS3 A;  3OWS A;  4HM8 B;  2OOV C;  1EUI C;  2SAR A;  1JRQ A;  1PY3 A;  4CDL A;  3CCE 3;  2F5M A;  3DY5 A;  5AII A;  4JF8 A;  1GOV A;  3FLJ A;  1ULJ B;  2CFW A;  1X1U A;  1UCJ A;  1Z1S A;  4CCV A;  3GZY B;  4DKI A;  2F86 B;  5AEU B;  2AAD A;  3AMO B;  1RMS A;  3BLZ A;  5AYR B;  4WWU C;  1NU3 A;  3IPT A;  3OX9 A;  1CYV A;  1JBR A;  1YJN 3;  3F40 A;  1UGH I;  1IT8 A;  1EKM A;  2WOF A;  3BNB A;  2F98 A;  6STD A;  1VQ7 3;  3ER7 A;  1CYU A;  1BRJ A;  1VQ6 3;  4FCZ A;  1GMR A;  3OW2 2;  1JKG A;  3LXU X;  1LVN A;  2H0G A;  3BNC A;  3T8N A;  1RSN A;  1ZGX A;  2QEX 3;  3DM8 A;  2KF6 A;  3WOF B;  1WMN A;  4HZ9 B;  4HBR A;  4EW5 A;  1BSD A;  2GU1 A;  3WMD A;  5BVB A;  4STD A;  5D82 A;  1KQS 2;  1IQY A;  3DGM A;  3K9M C;  4LSO A;  1TRQ A;  3GSP A;  5CK6 A;  1WMO A;  2FNQ A;  4WP5 A;  2HMO B;  1I8V A;  3DUK A;  4LGQ A;  1STD A;  3NUV A;  4HM4 B;  3GZX B;  1KSI A;  2GBW B;  2YFJ B;  4ILF A;  3G8Z A;  3HI7 A;  3EF8 A;  1WQL B;  4K61 A;  1BSC A;  4WHA A;  2OQE C;  2H0H A;  2KF4 A;  4FMB A;  1YNV X;  1AVL A;  1GYB A;  3FKA A;  1F8N A;  3HZP A;  1VQL 3;  4LMI A;  5HOH A;  2FXT A;  4RNZ A;  2HMM B;  1M1K 4;  4N6U A;  2K54 A;  2IUK A;  1YVB I;  1A2P A;  1YHQ 3;  2XFT A;  1DMN A;  1W2Z A;  1W02 A;  3IJE B;  1U8C B;  7GSP A;  1IQ8 A;  3I55 3;  2UGI A;  2B24 B;  4IPB A;  4L8O A;  8CHO A;  3Q3F A;  2O3O A;  2QA4 3;  1FW7 A;  1RCK A;  2CFL A;  3PXM A;  3EHC A;  2D42 A;  3PS8 A;  1NWW A;  3NM7 A;  1JB2 A;  1RLS A;  2F56 A;  3CPO A;  4I5Q A;  1JZO A;  1TRP A;  1W6Y A;  2JQ5 A;  4N6T A;  5CF2 A;  4BIR A;  1YIT 3;  3MYT A;  2INX A;  4MEI A;  1GOY A;  4MJD A;  1RNB A;  1FGQ A;  4GSP A;  5A0O B;  4EYC A;  3EX9 A;  3FG4 A;  3ROB A;  1DMQ A;  3AGN A;  5FGO A;  1BRK A;  1IVX A;  2ZDJ A;  1AY7 A;  1DVC A;  1FGT A;  2W0Q A;  4RZM A;  1IK3 A;  1LOV A;  1Q9E A;  3LTB A;  1JBS A;  3CMA 3;  3I0Y A;  1X1X A;  4NRE A;  1RGH A;  1HKX A;  1A2V A;  1LOW A;  3NV0 B;  5BU4 A;  2JDI H;  3JUQ A;  3CCU 3;  1M90 4;  3HII A;  2CWV A;  2M7O A;  3KSE D;  1I0V A;  4N6O B;  4X2H A;  3SYU A;  4L7K A;  1BNS A;  1ULI B;  5GSP A;  1UUG B;  1TP6 A;  2CKF B;  2RCD A;  1D6Z A;  3B4P A;  3D79 A;  4WYK A;  1BNR A;  1WMP A;  3UL6 A;  2CW9 A;  2LYX A;  2W03 A;  1DET A;  3X3X A;  4BTW A;  4R9L A;  1PU4 A;  3CC4 3;  2E2T A;  3EBY A;  1ZO2 A;  3DGY A;  3KII A;  1AQZ A;  1STF I;  4ORL A;  1ROA A;  3QK9 A;  4QWT A;  1JJ2 2;  2HOH A;  3BIR A;  2F5W A;  2HMK B;  3FSD A;  3D4A A;  3WOE B;  2RNT A;  3MKI A;  2BHM A;  1MWR A;  3V98 A;  1ROV A;  1LOY A;  1TFO A;  3DMC A;  1NB3 I;  4AEQ A;  2CFK A;  2L4V A;  4ZM8 A;  1RGF A;  1QMA A;  1B2M A;  1V74 A;  4L8P A;  3OV4 A;  1B20 A;  4RBN A;  3AHW A;  3FH1 A;  2QIY A;  1G96 A;  2WO0 A;  3Q1C A;  3ZG0 A;  1AVK A;  4LEH A;  3FZW A;  1D6Y A;  3CCM 3;  2XFS A;  3PGB A;  3CNM A;  1FUT A;  3HOH A;  1DE3 A;  1UCI A;  3LOY A;  1R4Y A;  1BIR A;  2W56 A;  2CX1 A;  3CXC 2;  3F8X A;  1VZZ A;  2E2V A;  1LOX A;  5LC7 A;  4H3U A;  2WOH A;  1VQP 3;  3LT8 A;  1RGL A;  1QAK A;  1LQM B;  4FMA A;  3VSY A;  3A76 A;  2RFR A;  5G1L A;  1O7N B;  1UGI A;  1UI7 A;  2C11 A;  2Z77 A;  3JUN A;  4NHF A;  5IG5 A;  1DVD A;  1I2E A;  3AHS A;  5IEN A;  2Z7A A;  4RNT A;  1RRH A;  4WYK B;  3LT9 A;  5CLK A;  3MG3 A;  1B2Z A;  1OAC A;  3QRD A;  3SOA A;  3H3H A;  1BRH A;  2IYJ A;  3S29 A;  3V99 A;  3X41 A;  4H61 A;  1BSA A;  1BNG A;  4J9A A;  4OK0 A;  1HYF A;  1JZD A;  5IG0 A;  4BL2 A;  2QGU A;  1U5O A;  4LYL B;  3CCS 3;  3FGY A;  5IEP A;  1D6U A;  2CIU A;  1VQN 3;  1I3F A;  9RNT A;  4HVN A;  1JBT A;  2R41 A;  1TJD A;  3KZT A;  1N9J A;  1C7H A;  3MHE A;  4MMY B;  1BRN L;  1BVI A;  2E2U A;  2KF5 A;  3OWU A;  4HKV B;  3KCH A;  3WA3 A;  5BXQ A;  4EBG A;  1KC8 4;  2BMQ B;  1L5G B;  1VQ4 3;  3S28 A;  2R4I A;  2W04 A;  3FG1 A;  3ECF A;  3PCR A;  2YX9 A;  3VF1 A;  3FF0 A;  3NBR A;  1YVS A;  2K0M A;  1R4C A;  4FCM A;  1UCK A;  2KRT A;  1LRA A;  2K3D A;  5AEW B;  1I2F A;  4XBX A;  2B1X B;  2CC3 A;  6GSP A;  3CD6 3;  4K1U A;  4FCJ A;  2W56 B;  1A67 A;  1BU4 A;  3B7C A;  3N8B A;  2Y73 A;  1GMP A;  3KSP A;  4R1K A;  1EQK A;  2J8X B;  4O3V A;  5DRE A;  1N8R 4;  1KD1 4;  3BB9 A;  4EC6 A;  4BTX A;  3CPW 2;  3LH4 A;  4K90 B;  4EV2 A;  4KFD A;  3KN4 A;  1YJ9 3;  2W9P A;  4MMZ B;  4R80 A;  1YGW A;  1O7H B;  1PFP A;  3HX8 A;  1X1Y A;  5CF1 A;  3WOD G;  1BNE A;  1RHL A;  2HML B;  1S72 3;  1QJG A;  4N6V 0;  1OHP A;  1RGE A;  3EQQ B;  1IVV A;  3RDE A;  1RJO A;  3CC2 3;  5JPP A;  1RN1 A;  1UI8 A;  5AIG A;  3X3Z A;  4N3V A;  1GY7 A;  3DZL A;  3LTA A;  1O7P B;  1BNJ A;  3JVC A;  1JKG B;  3RGA A;  1O7G B;  3PYJ A;  1O7W B;  2P09 A;  2STD A;  1OUN A;  1T5Y A;  1WTH A;  3UL5 A;  3SVA A;  1Q81 4;  1BGS A;  1OF5 A;  2GU3 A;  1W6G A;  3EC9 A;  2LQV A;  1T2I A;  2XEP A;  2WGQ A;  4HM6 B;  5EVH A;  2V1L A;  4KT3 B;  1YI2 3;  1N8Q A;  3GZB A;  1HU9 A;  2XGL A;  4HM1 B;  3TDG A;  4BTY A;  4CJN A;  5KP1 A;  4XB5 A;  5TGN A;  2OOV A;  1Q7H A;  1S5A A;  4U13 A;  1V58 A;  3Q90 A;  2YFI B;  4WFO A;  3EJV A;  1YJW 3;  1B3S A;  1BRS A;  1A2K A;  3EE1 A;  4K1V A;  1OHS A;  1IVU A;  2OWP A;  3S5C A;  2IA7 A;  1UCL A;  2UUG C;  3CC7 3;  4JRF A;  1MNL A;  2W6J H;  4HM2 B;  1RGG A;  1IYY A;  3D9R A;  2IUJ A;  1X1W A;  5KP3 A;  1KWI A;  3N9H A;  1HZ1 A;  3K7C A;  1FGR A;  1NO3 A;  4FMD A;  2CX0 A;  2GXF A;  2Y74 A;  1BUQ A;  3DGO A;  1Q42 A;  1ZX2 A;  3PCS A;  1SJW A;  4RNY A;  3DGL A;  3NX0 A;  1VQM 3;  1BRI A;  1NNV A;  2W9Q A;  2XGN A;  3G0K A;  1BUJ A;  3RGR A;  4J8T A;  2AAE A;  5AIF A;  1K8A 4;  3AGO A;  3U1W A;  3L0R A;  2BO9 B;  1CEW I;  2IMJ A;  4O02 B;  1VQ8 3;  2BMR B;  1N5H A;  3GZR A;  1AR0 A;  5IG3 A;  1I70 A;  2Z76 A;  4Q53 A;  1LQG C;  2C10 A;  5DRV A;  1NDO B;  3NQY A;  1GY5 A;  1RN4 A;  2ML6 A;  2SBL A;  1O7M B;  2ZA4 A;  3GWR A;  3NXJ A;  3VGN A;  2ZL8 A;  3LTC A;  7STD A;  1OF5 B;  1YGE A;  5STD A;  1K28 A;  1SAR A;  4J5K A;  3CCV 3;  1EA2 A;  2I9W A;  2ZHX B;  5M18 A;  2CWT A;  5AYS C;  2Q07 A;  7RNT A;  3JUO A;  2OQE A;  5IEO A;  2O9U X;  1BNI A;  1OPY A;  1MOL A;  1IT7 A;  3B4O A;  2F4Y A;  3DGN A;  2P0M A;  1W01 A;  2F99 A;  2RBI A;  4N6M A;  4N6L A;  3X42 A;  5BIR A;  3G71 3;  2CFD A;  5M19 A;  1FZU A;  1IVW A;  1OGZ A;  1FA3 A;  1BAO A;  1QAL A;  2P0X A;  1OGX A;  3X3Y A;  1W5Z A;  1BOX A;  1FYS A;  3O8Y A;  3GAX A;  3M8C A;  2BNG A;  1K73 4;  3UJM A;  1G0T A;  2C4B A;  3F7X A;  3IMA B;  3SOY A;  3B8L A;  3DXO A;  3F14 A;  2W2C A;  4XBT A;  1RRL A;  5JBS A;  3NBB A;  5AI1 A;  4HM3 B;  3BU4 A;  3K0Z A;  4IT7 A;  4OUQ A;  1BAN A;  2HMN B;  4AKZ A;  4KZ1 A;  3PZW A;  4GHO A;  5I97 A;  4EV5 A;  3SED A;  1G02 A;  5CXO A;  1ASK A;  1BSE A;  1SIH A;  2KF3 A;  3EBT A;  4GB5 A;  6RNT A;  1RGC A;  3MG2 A;  3G6E 3;  1VQK 3;  4OVM A;  1OH0 A;  3NBJ A;  1VQ9 3;  1RCL A;  1MGW A;  3UB1 A;  3CCR 3;  2Z6B A;  2FGT A;  1VQ5 3;  2XH9 A;  3U97 A;  1E97 A;  1Q40 A;  4KFF A;  5AIH A;  1M9G A;  1JV2 B;  2BU4 A;  5EEO A;  4N6N B;  3G16 A;  3UNL A;  1JB4 A;  4BL3 A;  3LZA A;  2UX0 A;  4J5G A;  4R4K A;  3DH2 A;  3EN8 A;  4KVH A;  3WA2 X;  1RGA A;  1RKY A;  4HM0 B;  3GRD A;  3X40 A;  3F7S A;  3F8H A;  2P05 A;  1W00 A;  2BT3 A;  3KKG A;  3J7Y d;  3LML A;  2KXG A;  1OHO A;  1E3V A;  1SPU A;  1WNH A;  3H51 A;  2XR8 B;  5ELJ A;  3OXA A;  2OTL 3;  4KFE A;  3D3L A;  1RTU A;  3JUP A;  1GD3 A;  1FGO A;  1RN7 A;  1GOU A;  1RNT A;  2BIR A;  3E99 A;  3FG3 A;  3KFQ C;  1NJI 4;  1UDI I;  2CFG A;  1B27 A;  3URP A; 
#chains in the Genus database with same CATH homology
 3MWZ A;  5EQL A;  3SX1 A;  2CHC A;  3NV0 A;  3EB8 A;  1UUW B;  4GL6 A;  1SII A;  3HK4 A;  1TFK A;  3S27 A;  1M1X B;  1UW1 A;  3S67 A;  1TU5 A;  3BND A;  4I4K A;  3EN1 B;  2XSO B;  4MMX B;  3OWY A;  4R9K A;  5KP4 A;  1US1 A;  3MSO A;  4PEJ A;  2WGO A;  2OTJ 3;  1IV7 A;  4LZI A;  1FGM A;  1TUH A;  2HMJ B;  4FR9 A;  3G4S 3;  1TIJ A;  3LYG A;  1JN5 A;  5G2G A;  4AKY A;  1W7C A;  2KCD A;  4FMC A;  1JB5 A;  4TX4 A;  1IV9 A;  4X2O A;  3T8U A;  4HM7 B;  3WDG B;  1LXE A;  3JUM A;  4HYZ A;  1Q86 4;  1QVG 2;  1Q40 B;  1W6C A;  1YIJ 3;  2CG0 A;  4IIA A;  3FCS B;  4XDW A;  3CCJ 3;  1K9M 4;  2XRX B;  1OCV A;  1NB5 I;  2RGQ A;  5LC6 A;  5FW5 A;  1IDP A;  5D83 A;  2P38 A;  2GEX A;  4HM5 B;  3CME 3;  3HIG A;  3K63 A;  2BMO B;  1CQS A;  3N54 B;  1J2B A;  1FUW A;  3STD A;  2CH9 A;  4XM4 A;  1Q82 4;  5IW9 A;  3F9S A;  2GBX B;  1LNH A;  2XSH B;  2RSX A;  4HJL B;  3NHX A;  3I56 3;  3FF2 A;  5D81 A;  3CCQ 3;  1AV4 A;  1GD4 A;  3Q2P A;  2PZV A;  3T0U A;  3AMO A;  3NM2 A;  1K41 A;  3BNE A;  2MF7 A;  3V92 A;  2GEY A;  1GY6 A;  3MPH A;  2MC8 A;  3SLU A;  1IQX A;  3SXX A;  3K5T A;  1W2B 2;  5IF6 A;  1IU7 A;  4HZB B;  1Q7Y 4;  1Y4K A;  1JN5 B;  2CWU A;  2CG1 A;  2YFL B;  1W4N A;  1EG9 B;  2XF3 A;  1JNQ A;  1SQW A;  2PNC A;  3ALA A;  1A90 A;  2OCT A;  4O2H A;  1UUV B;  1QAF A;  2D1W A;  5ELU A;  4EXR A;  5IG4 A;  3CU3 A;  3MG1 A;  2A15 A;  2CK3 H;  4O8S A;  4XDV A;  1VQO 3;  4XBY A;  3CNX A;  3NQZ A;  5JPU A;  1QVF 2;  1DMM A;  1E3R A;  3CCL 3;  1N5P A;  1N9E A;  1DYU A;  3KE7 A;  3LTD A;  4G1M B;  1ISK A;  5HGR A;  1GS3 A;  3OWS A;  4HM8 B;  2OOV C;  1JRQ A;  4CDL A;  3CCE 3;  3DY5 A;  5AII A;  4JF8 A;  3FLJ A;  1ULJ B;  2CFW A;  1Z1S A;  4CCV A;  3GZY B;  2F86 B;  5AEU B;  3AMO B;  3BLZ A;  5AYR B;  4WWU C;  1NU3 A;  3IPT A;  3OX9 A;  1CYV A;  1YJN 3;  3F40 A;  1IT8 A;  1EKM A;  2WOF A;  3BNB A;  2F98 A;  6STD A;  1VQ7 3;  3ER7 A;  1CYU A;  1VQ6 3;  4FCZ A;  3OW2 2;  1JKG A;  3LXU X;  1LVN A;  3BNC A;  3T8N A;  2QEX 3;  3DM8 A;  3WOF B;  1WMN A;  4HZ9 B;  4HBR A;  5BVB A;  2GU1 A;  3WMD A;  4STD A;  5D82 A;  1KQS 2;  1IQY A;  3DGM A;  3K9M C;  4LSO A;  5CK6 A;  1WMO A;  2FNQ A;  4WP5 A;  2HMO B;  3DUK A;  4LGQ A;  1STD A;  4HM4 B;  3GZX B;  1KSI A;  2GBW B;  2YFJ B;  3G8Z A;  3HI7 A;  3EF8 A;  1WQL B;  4K61 A;  4WHA A;  2OQE C;  4FMB A;  1AVL A;  1GYB A;  3FKA A;  1F8N A;  3HZP A;  1VQL 3;  4LMI A;  2FXT A;  4RNZ A;  2HMM B;  1M1K 4;  4N6U A;  2K54 A;  2IUK A;  1YVB I;  1YHQ 3;  2XFT A;  1DMN A;  1W2Z A;  1W02 A;  3IJE B;  1U8C B;  1IQ8 A;  3I55 3;  2QA4 3;  2B24 B;  4IPB A;  4L8O A;  8CHO A;  2O3O A;  2CFL A;  3PXM A;  3EHC A;  2D42 A;  3PS8 A;  1NWW A;  3NM7 A;  1JB2 A;  3CPO A;  1W6Y A;  1YIT 3;  2JQ5 A;  4N6T A;  5CF2 A;  3MYT A;  2INX A;  4MEI A;  4MJD A;  1FGQ A;  5A0O B;  4EYC A;  3EX9 A;  3FG4 A;  3ROB A;  1DMQ A;  5FGO A;  1IVX A;  2ZDJ A;  1DVC A;  1FGT A;  2W0Q A;  4RZM A;  1IK3 A;  3LTB A;  3CMA 3;  3I0Y A;  4NRE A;  1HKX A;  1A2V A;  3NV0 B;  2JDI H;  3JUQ A;  3CCU 3;  1M90 4;  3HII A;  2CWV A;  2M7O A;  3KSE D;  4N6O B;  4X2H A;  4L7K A;  1ULI B;  1TP6 A;  2CKF B;  2RCD A;  1D6Z A;  3B4P A;  4WYK A;  1WMP A;  3UL6 A;  2CW9 A;  2LYX A;  2W03 A;  3X3X A;  4BTW A;  1PU4 A;  4R9L A;  3CC4 3;  2E2T A;  3EBY A;  1ZO2 A;  3KII A;  1STF I;  4ORL A;  1ROA A;  3QK9 A;  4QWT A;  1JJ2 2;  2HMK B;  3FSD A;  3WOE B;  3MKI A;  2BHM A;  3V98 A;  1ROV A;  1TFO A;  3DMC A;  1NB3 I;  4AEQ A;  2CFK A;  2L4V A;  4ZM8 A;  1QMA A;  1V74 A;  4L8P A;  3OV4 A;  4RBN A;  3FH1 A;  2QIY A;  1G96 A;  2WO0 A;  3Q1C A;  1AVK A;  4LEH A;  3FZW A;  1D6Y A;  3CCM 3;  2XFS A;  3PGB A;  3CNM A;  3LOY A;  2W56 A;  3CXC 2;  3F8X A;  1VZZ A;  2E2V A;  1LOX A;  5LC7 A;  4H3U A;  2WOH A;  1VQP 3;  3LT8 A;  1QAK A;  4FMA A;  3VSY A;  3A76 A;  2RFR A;  1O7N B;  1UI7 A;  2C11 A;  2Z77 A;  3JUN A;  4NHF A;  5IG5 A;  1DVD A;  5IEN A;  2Z7A A;  1RRH A;  4WYK B;  3LT9 A;  5CLK A;  3MG3 A;  1OAC A;  3QRD A;  3SOA A;  3H3H A;  3S29 A;  3V99 A;  3X41 A;  5IER A;  4H61 A;  4J9A A;  4OK0 A;  5IG0 A;  2QGU A;  1U5O A;  3CCS 3;  3FGY A;  5IEP A;  1D6U A;  2CIU A;  1VQN 3;  4HVN A;  3KZT A;  1N9J A;  1C7H A;  3MHE A;  4MMY B;  2E2U A;  3WA3 A;  3OWU A;  4HKV B;  5BXQ A;  4EBG A;  1KC8 4;  2BMQ B;  1L5G B;  1VQ4 3;  3S28 A;  2R4I A;  2W04 A;  3FG1 A;  3ECF A;  3PCR A;  2YX9 A;  3VF1 A;  3FF0 A;  3NBR A;  2K0M A;  4FCM A;  1R4C A;  2KRT A;  5AEW B;  4XBX A;  2B1X B;  2CC3 A;  3CD6 3;  4K1U A;  4FCJ A;  2W56 B;  1A67 A;  3B7C A;  3N8B A;  2Y73 A;  3KSP A;  4R1K A;  1EQK A;  4O3V A;  5DRE A;  1N8R 4;  1KD1 4;  3BB9 A;  4EC6 A;  4BTX A;  3CPW 2;  3LH4 A;  4K90 B;  4EV2 A;  4KFD A;  3KN4 A;  1YJ9 3;  2W9P A;  4MMZ B;  4R80 A;  1O7H B;  1PFP A;  3HX8 A;  5CF1 A;  3WOD G;  2HML B;  1S72 3;  1QJG A;  4N6V 0;  1OHP A;  3CC2 3;  3EQQ B;  1IVV A;  3RDE A;  1RJO A;  5JPP A;  1UI8 A;  5AIG A;  3X3Z A;  4N3V A;  1GY7 A;  3DZL A;  3LTA A;  1O7P B;  3JVC A;  1JKG B;  3RGA A;  1O7G B;  3PYJ A;  1O7W B;  2P09 A;  2STD A;  1OUN A;  1T5Y A;  1WTH A;  3UL5 A;  3SVA A;  1Q81 4;  1OF5 A;  2GU3 A;  1W6G A;  3EC9 A;  2LQV A;  2XEP A;  2WGQ A;  4HM6 B;  5EVH A;  2V1L A;  1YI2 3;  1N8Q A;  3GZB A;  1HU9 A;  2XGL A;  4HM1 B;  3TDG A;  4BTY A;  5KP1 A;  4XB5 A;  5TGN A;  2OOV A;  1S5A A;  4U13 A;  1YJW 3;  3Q90 A;  2YFI B;  4WFO A;  3EJV A;  3EE1 A;  1A2K A;  4K1V A;  1OHS A;  1IVU A;  2OWP A;  3S5C A;  2IA7 A;  3CC7 3;  4JRF A;  1MNL A;  2W6J H;  4HM2 B;  3D9R A;  2IUJ A;  5KP3 A;  1KWI A;  3N9H A;  3K7C A;  1FGR A;  1NO3 A;  4FMD A;  2GXF A;  2Y74 A;  1BUQ A;  3DGO A;  1Q42 A;  1ZX2 A;  3PCS A;  1SJW A;  4RNY A;  3DGL A;  3NX0 A;  1VQM 3;  2W9Q A;  2XGN A;  3G0K A;  3RGR A;  4J8T A;  5AIF A;  1K8A 4;  3U1W A;  3L0R A;  2BO9 B;  1CEW I;  2IMJ A;  4O02 B;  1VQ8 3;  2BMR B;  1N5H A;  3GZR A;  1AR0 A;  5IG3 A;  2Z76 A;  4Q53 A;  2C10 A;  5DRV A;  1NDO B;  3NQY A;  1GY5 A;  2ML6 A;  2SBL A;  1O7M B;  3GWR A;  3NXJ A;  3VGN A;  2ZL8 A;  3LTC A;  7STD A;  1OF5 B;  1YGE A;  5STD A;  1K28 A;  3CCV 3;  1EA2 A;  2I9W A;  2CWT A;  5AYS C;  2Q07 A;  3JUO A;  2OQE A;  5IEO A;  2O9U X;  1OPY A;  1MOL A;  1IT7 A;  3B4O A;  3DGN A;  2P0M A;  1W01 A;  2F99 A;  4N6M A;  3X42 A;  3G71 3;  2CFD A;  1IVW A;  1OGZ A;  1FA3 A;  1QAL A;  2P0X A;  1OGX A;  3X3Y A;  1W5Z A;  3O8Y A;  3GAX A;  3M8C A;  2BNG A;  1K73 4;  3UJM A;  3F7X A;  3IMA B;  3SOY A;  3B8L A;  3DXO A;  3F14 A;  2W2C A;  4XBT A;  1RRL A;  5JBS A;  3NBB A;  5AI1 A;  4HM3 B;  4IT7 A;  3K0Z A;  4OUQ A;  2HMN B;  4AKZ A;  4KZ1 A;  3PZW A;  5I97 A;  4EV5 A;  3SED A;  5CXO A;  1ASK A;  3G6E 3;  1SIH A;  3EBT A;  4GB5 A;  3MG2 A;  1VQK 3;  4OVM A;  1OH0 A;  3NBJ A;  1VQ9 3;  3CCR 3;  3UB1 A;  2Z6B A;  2FGT A;  1VQ5 3;  2XH9 A;  3U97 A;  1E97 A;  1Q40 A;  4KFF A;  5AIH A;  1M9G A;  1JV2 B;  5EEO A;  4N6N B;  3G16 A;  3UNL A;  1JB4 A;  3LZA A;  2UX0 A;  4R4K A;  3EN8 A;  4KVH A;  3WA2 X;  1RKY A;  4HM0 B;  3GRD A;  3X40 A;  3F7S A;  3F8H A;  2P05 A;  1W00 A;  2BT3 A;  3KKG A;  3J7Y d;  3LML A;  2KXG A;  1OHO A;  1E3V A;  1SPU A;  1WNH A;  3H51 A;  2XR8 B;  5ELJ A;  3OXA A;  2OTL 3;  4KFE A;  3D3L A;  3JUP A;  1GD3 A;  1FGO A;  1RN7 A;  3E99 A;  3KFQ C;  3NUV A;  4N6L A;  3FG3 A;  1NJI 4;  2CFG A;  2ML5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...