3EB8A

Vira
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
334
Chain Sequence
AEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies indicate that Shigella VirA is not a protease and does not directly destabilize microtubules.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
molecule keywords Cysteine protease-like virA
total genus 99
structure length 334
sequence length 347
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3eb8A01
4FMAA 3Q1CA 3EB8A 4FMCA 3EE1A 3PCSA 4FMDA 4FMBA 3PCRA
chains in the Genus database with same CATH superfamily
3AGOA 3WOEB 5FGOA 1JKGA 3VSYA 3FG4A 3MYTA 3LT8A 3DM8A 4HYZA 1RN1A 3EN1B 1VQ63 1T2IA 5LC7A 1IQYA 1VZZA 4MMXB 2R41A 3NQYA 2YFJB 1O7WB 2BT3A 4HM0B 3CC43 4R9KA 1RGEA 3G6E3 1BSBA 1ZX2A 3CME3 4L8PA 1RGKA 6GSPA 5KP4A 3VGNA 1UCLA 1K41A 4XDWA 1TU5A 1GY7A 2IY2A 3KIIA 4LGQA 2V1LA 3FZWA 3K7CA 4FMCA 2Z77A 5AIHA 1N5PA 1FUWA 1HU9A 3PS8A 4N6LA 1BNIA 3FH1A 1MOLA 3U97A 3V99A 3DH2A 3D79A 3EJVA 4JF8A 3NM7A 2Y74A 2CK3H 3MG3A 4HM3B 3S67A 3JUPA 1AQZA 3DGNA 3LTDA 1VQ73 1QJGA 1JZDA 4LSOA 1WMNA 3UJMA 1BSAA 2CFLA 2SBLA 3ALAA 8RNTA 1IDPA 1NWWA 3DGOA 1BRSA 3J7Yd 2QA43 1C54A 5IG4A 3DXOA 2CIUA 1LVNA 4GB5A 2HMMB 3DZLA 1IQ8A 1VQL3 1DMNA 3JUQA 2LYXA 1GSPA 3V92A 1DE3A 1RGCA 4X2OA 3CCR3 1RDSA 1BGSA 1GMPA 1UDII 4LYLB 3RDEA 4ZM8A 1S723 4FMBA 1Q7Y4 2D42A 3F14A 1FUTA 1FZUA 4R4KA 3LTAA 4XM4A 1I70A 1NJI4 2GBXB 4PEJA 3K5TA 3X3YA 2XSOB 2K54A 1Q40A 1LXEA 4RNTA 3EN8A 2B24B 1EEJA 2XH9A 1UCKA 1B2MA 1GMRA 1YGEA 2XEPA 3OXAA 5HGRA 2QIYA 1HKXA 4IIAA 3LZAA 3UL5A 4HOHA 5AYRB 4H3UA 1DETA 3ZFZA 1BUQA 1B21A 2I9WA 3F40A 3NM2A 3NUVA 4BL2A 3ROBA 1ROVA 3BNBA 3LTBA 1BIRA 2PZVA 2W56A 3T0UA 1VQO3 2P05A 1RSNA 3JUNA 1E97A 3CC73 1Q42A 3HIGA 1RGGA 3PCRA 1B3SA 3E99A 3F7XA 2XGNA 1T5YA 3JUMA 3FF0A 1I2FA 1GOUA 1IVUA 2F5WA 2K0MA 3FSDA 4K1UA 2GEYA 1YIT3 2CX0A 3GSPA 4I5QA 2CH9A 1TRPA 3AHWA 4WFOA 3AMOA 1W6CA 4XBYA 5IG0A 1W2ZA 4ILFA 4ORLA 3UL6A 2GEXA 4KZ1A 4L8OA 4NHFA 5CXOA 1IVXA 3OWSA 4BTWA 3PGBA 1RJOA 1LOWA 3GAXA 1M904 1UUVB 1B2SA 1O7HB 1OF5A 5RNTA 1RCLA 3KKGA 1RNBA 4RZMA 2IUJA 4X2HA 1KQS2 3SEDA 4HM2B 1YJN3 4TX4A 2XF3A 1O7MB 4MJDA 1CYVA 2KAAA 1JZOA 2MF7A 1B2XA 4GSPA 5LC6A 2P0XA 1HZ1A 2BNGA 1BNRA 4FCJA 3CNMA 1I8VA 1CQSA 3GZXB 3SX1A 4EYCA 1BANA 4HJLB 3V98A 3I553 1Z1SA 2STDA 1UUWB 2RFRA 4R1KA 7STDA 1BNGA 1VQN3 2K3DA 4STDA 4LEHA 2F5MA 2IA7A 5IF6A 2OTJ3 1GYBA 3PYJA 1RLSA 2B1XB 4J5GA 1E3VA 3MG1A 3DGYA 5JBSA 3KFQC 1GD4A 1ULIB 3PCSA 2KF4A 2CC3A 1B20A 1WQLB 3NBJA 1BU4A 4OUQA 1UCJA 1S5AA 4RNYA 3UB1A 2KF5A 2W56B 1VQ83 4N6OB 1BOXA 3G16A 3LT9A 4K1VA 8CHOA 1BSEA 1BRIA 1E3RA 3GZRA 1A2VA 5IG5A 1AV4A 2Y73A 2C4BA 3DGMA 3BNCA 5IEPA 2UX0A 2M7OA 3EF8A 4N6TA 1IVWA 3CCS3 3EQQB 1US1A 1V74A 5AIFA 2QGUA 3GRDA 1Q40B 1JBSA 3U1WA 2RSXA 1BRNL 1ZGXA 4N6UA 2E2TA 3EBTA 1NB5I 3ER7A 1FW7A 3WR2A 1BAOA 1W2B2 2HMKB 3IJEB 1GMQA 1I0VA 3FG1A 1NU3A 1VQ53 2C10A 1Q9EA 2GU3A 2OOVA 4R80A 5BXQA 2W04A 3Q90A 1MWUA 1Q7HA 2BHMA 3WHOA 1RGLA 3B4PA 5JPPA 3FLJA 5IG3A 1GD3A 3CXC2 1EG9B 1FGTA 2H0GA 1OCVA 4HM8B 1UGHI 1RGAA 1LOXA 2CHCA 1B2UA 3LMLA 3NX0A 2FXTA 3HZPA 2J8XB 1WMOA 2H0HA 3LYGA 4WWUC 1TUHA 3RGAA 3SLUA 3JVCA 5M19A 3FF2A 1MNLA 1N8QA 3QRDA 3BIRA 1AY7A 1EA2A 2OQEC 4J8TA 1BSDA 2O9UX 4CJNA 5BVBA 3EBYA 1A2PA 1O7PB 1LOVA 1X1XA 3AGNA 1MWRA 4WYKB 5IENA 3OWUA 4LZIA 3M8CA 3SYUA 3H3HA 1X1WA 4HM7B 1W6YA 1UI8A 2XRXB 2ZL8A 1Q824 2BMOB 4L7KA 1JKGB 2XFTA 5DREA 5TGNA 1W6GA 4OK0A 1M1K4 1SARA 3D4AA 3KSPA 1R4CA 5ELUA 2F4YA 2XGLA 5CLKA 3VF1A 2Z7AA 5HOHA 1LQMB 3EB8A 3MKIA 4U13A 2H0IA 1KD14 1YHQ3 3K0ZA 4N6V0 1GOVA 1RN7A 3S27A 4I4KA 1D6ZA 3SOYA 3FGYA 1BRHA 5DRVA 1UW1A 2BMQB 5EQLA 1DVDA 2PNCA 1STDA 2IUKA 4HZBB 2D1WA 4MMYB 2OCTA 3OW22 3Q1CA 4BTYA 3FG3A 1AR0A 1YGWA 1PY3A 1YJW3 1SPUA 2CWVA 2AADA 2FNQA 4HM5B 4WP5A 4GL6A 4N6NB 2RBIA 1FUSA 1UUGB 1TRQA 3BB9A 4HM1B 1ASKA 5BU4A 3NXJA 1JNQA 2UUGC 3KE7A 3UNLA 1WNHA 1MGWA 1NDOB 3CPOA 2CFWA 2WOHA 5EEOA 5IERA 1KWIA 1BNJA 2E2UA 3GZBA 1U8CB 5GSPA 3I563 1JV2B 4MEIA 2W9PA 3T8NA 3X3ZA 3OX9A 1YJ93 1SJWA 5G1LA 1FGRA 3L0RA 3T8UA 4XBTA 3URPA 1RNTA 2UGIA 1TFOA 4RNZA 1CEWI 1JN5A 2SARA 2OTL3 2ML6A 2GXFA 1DVCA 4HBRA 1JB4A 1RHLA 3K9MC 3NV0B 2CWTA 1JN5B 1RCKA 1DYUA 4O3VA 1J2BA 4WYKA 3I0YA 3BLZA 3CCQ3 1T2HA 1BRKA 1G0TA 3QK9A 1W7CA 1QVF2 5AEUB 2FGTA 2HOHA 1K8A4 3EE1A 1IT7A 2W0QA 3SOAA 3F9SA 3Q3FA 5D81A 3X41A 1QAKA 3EHCA 1KC84 4HZ9B 3CMA3 1UGIA 3TDGA 1FYSA 2AAEA 3WOFB 1EKMA 4O2HA 1RRLA 3STDA 1OF5B 4MMZB 5A0OB 1JJ22 4IPBA 2HMNB 3ZG5A 5I97A 1V57A 6STDA 2CW9A 1QVG2 2Z6BA 4G1MB 3EX9A 1NNVA 4XB5A 1IT8A 1WTHA 2BO9B 2CX1A 4N6MA 3A5EA 2L1SA 3MG2A 1X1UA 1G96A 5KP3A 1CH0A 3CCJ3 2WO0A 4DKIA 1IU7A 1B27A 1R4YA 2OWPA 3N54B 3WDGB 1LRAA 3CCL3 1FGMA 1DMMA 4FR9A 1JBRA 3CNXA 5JPUA 2GBWB 3IMAB 3KSED 3S5CA 2LQVA 2F98A 4EV5A 2IMJA 2WGQA 2KCDA 2JDIH 3SXXA 3GWRA 1OPYA 2XSHB 4O8SA 4BTXA 3NBRA 3WA3A 3CD63 3ZG0A 3OV4A 3X40A 1BRGA 1YVBI 4O02B 2P0MA 1K734 1BNSA 1VQK3 1G02A 2KRTA 1YVSA 1OACA 1K28A 5CK6A 1ULJB 2BIRA 3S28A 1IYYA 3BNEA 1PFPA 5D82A 4EXRA 1AVLA 3B8LA 1QALA 5AIGA 5AIIA 1BSCA 2CWUA 4FMDA 4EC6A 2QEX3 1JB5A 1C7HA 7RNTA 1CYUA 2P38A 2KXGA 1SQWA 2BMRB 1BRJA 3DUKA 1BNEA 4KFFA 3CU3A 3IPTA 1X1YA 3NQZA 4KFEA 1IK3A 1MGRA 3BU4A 4NREA 5G2GA 3DY5A 3G713 1RTUA 5AI1A 2Q07A 1GY5A 1EQKA 1D6UA 5AEWB 2O3OA 2CG1A 1HYFA 5M18A 2R4IA 4K90B 3OWYA 3HK4A 3RGRA 3H51A 1NO3A 9RNTA 4HM6B 2KF6A 2XR8B 3B7CA 3A76A 4FCZA 4GHOA 3RNTA 3WODG 3F8HA 2OQEA 3X3XA 3HI7A 3KN4A 4J9AA 4CDLA 4AEQA 1W01A 2ZHXB 1FA3A 4Q53A 5BIRA 2HMOB 1KSIA 1ZO2A 3AMOB 3BNDA 3MSOA 1OHSA 3MHEA 1N9JA 1O7NB 5M1AA 3CC23 2YX9A 5IW9A 1YI23 2RCDA 2F86B 3NHXA 1N5HA 5IEOA 2OOVC 1BVIA 2HMLB 4K61A 1I0XA 1GOYA 1RGHA 2MC8A 3G0KA 3HX8A 1Q864 1TIJA 1QAFA 5FW5A 1IQXA 1TFKA 3LH4A 2L4VA 3WA2X 2BU4A 3D5GA 1YNVX 2CFGA 3LXUX 1NB3I 3NV0A 4XDVA 3PXMA 3WMDA 3AHSA 1LNIA 4AKYA 3G4S3 1EUIC 3HIIA 1IV7A 4KFDA 3D9RA 5CF1A 2IYJA 1Q814 1DMQA 1STFI 1AVKA 1T3BA 3SVAA 3FCSB 4H61A 4XBXA 1M1XB 1D6YA 3Q2PA 1W00A 1W4NA 6RNTA 3LTCA 4FMAA 4KVHA 1N8R4 2GU1A 3LOYA 1A67A 3DGLA 3D5IA 1SIIA 7GSPA 3EC9A 2W2CA 4LMIA 5STDA 4CPKA 1ISKA 3B4OA 3N8BA 5CF2A 5D83A 4R9LA 2RNTA 1OGZA 2KF3A 3CCU3 4CCVA 4EBGA 1BNFA 4BL3A 1QMAA 2WGOA 1ZS7A 5EVHA 3N9HA 2HMJB 1W5ZA 3D3LA 4BU4A 3HOHA 1I2GA 2C11A 3KZTA 3MPHA 3CPW2 4OVMA 4J5KA 3KCHA 1VQ93 1JBTA 5G1KA 1ROAA 1VQQA 1JB2A 4WHAA 1TTOA 2GSPA 4BIRA 1LOYA 2F99A 1OHPA 3CCV3 2W9QA 1OUNA 1IVVA 4HKVB 2CKFB 1GS3A 2ZDJA 2CFDA 3CCE3 1I3FA 1Y4KA 1IV9A 4HM4B 3FKAA 3NBBA 4KT3B 4FCMA 1W02A 3G8ZA 3O8YA 4JRFA 1OGXA 1GY6A 1I3IA 1UCIA 4NPBA 1MWTA 1L5GB 1RN4A 1PU4A 4EV2A 1U5OA 4N3VA 2F56A 1N9EA 1VQP3 1JRQA 3JUOA 1M9GA 1RGFA 1RKYA 1OH0A 2W6JH 1I2EA 2XFSA 3X42A 1F8NA 1VQ43 1K9M4 2YFLB 2JQ5A 5AYSC 3F8XA 1VQM3 1O7GB 1FGOA 1YIJ3 1FGQA 3MWZA 1OHOA 3CCM3 2WOFA 1A2KA 1V58A 1UI7A 2CFKA 1B2ZA 2P09A 1SIHA 4RBNA 4EW5A 1BUJA 4HVNA 1WMPA 2INXA 2ML5A 3GZYB 3S29A 1MWSA 2ZA4A 2Z76A 1LNHA 1LQGC 1RMSA 2A15A 4IT7A 2RGQA 3F7SA 1A90A 3DMCA 3ECFA 3K63A 1TJDA 4HAAA 3PZWA 5ELJA 2YFIB 1PYLA 4AKZA 1TP6A 5KP1A 1RRHA 4QWTA 2E2VA 2CG0A 2W03A
chains in the Genus database with same CATH topology
3WOEB 5FGOA 1JKGA 3VSYA 3FG4A 3MYTA 3LT8A 3DM8A 4HYZA 3EN1B 1VQ63 5LC7A 1IQYA 1VZZA 4MMXB 3NQYA 2YFJB 1O7WB 2BT3A 4HM0B 3CC43 4R9KA 3G6E3 3CME3 1ZX2A 4L8PA 5KP4A 3VGNA 1K41A 4XDWA 1TU5A 1GY7A 3KIIA 4LGQA 2V1LA 3FZWA 3K7CA 4FMCA 2Z77A 5AIHA 1N5PA 1FUWA 1HU9A 3PS8A 4N6LA 3FH1A 1MOLA 3U97A 3V99A 3EJVA 4JF8A 3NM7A 2Y74A 2CK3H 3MG3A 4HM3B 3S67A 3JUPA 3DGNA 3LTDA 1VQ73 1QJGA 4LSOA 1WMNA 3UJMA 2CFLA 2SBLA 3ALAA 3J7Yd 1IDPA 1NWWA 3DGOA 2QA43 5IG4A 3DXOA 2CIUA 1LVNA 4GB5A 2HMMB 3DZLA 1IQ8A 1VQL3 1DMNA 3JUQA 2LYXA 3V92A 3CCR3 4X2OA 3RDEA 1Q7Y4 4ZM8A 1S723 4FMBA 2D42A 3F14A 4R4KA 3LTAA 4XM4A 1NJI4 2GBXB 4PEJA 3K5TA 3X3YA 2XSOB 2K54A 1Q40A 1LXEA 3EN8A 2B24B 2XH9A 1YGEA 2XEPA 3OXAA 5HGRA 2QIYA 1HKXA 4IIAA 3LZAA 3UL5A 5AYRB 1BUQA 4H3UA 2I9WA 3F40A 3NM2A 3NUVA 3ROBA 1ROVA 3BNBA 3LTBA 2PZVA 2W56A 3T0UA 1VQO3 2P05A 3CC73 3JUNA 1E97A 1Q42A 3HIGA 3PCRA 3E99A 3F7XA 2XGNA 1T5YA 3JUMA 3FF0A 3FSDA 1IVUA 2K0MA 4K1UA 2GEYA 1YIT3 2CH9A 4WFOA 3AMOA 1W6CA 4XBYA 5IG0A 1W2ZA 4ORLA 3UL6A 2GEXA 4KZ1A 4L8OA 4NHFA 5CXOA 1IVXA 3OWSA 4BTWA 3PGBA 1RJOA 3GAXA 1M904 1UUVB 1O7HB 1OF5A 3KKGA 4RZMA 2IUJA 4X2HA 1KQS2 3SEDA 4HM2B 1YJN3 4TX4A 2XF3A 1O7MB 4MJDA 1CYVA 2MF7A 5LC6A 2P0XA 2BNGA 4FCJA 3CNMA 3GZXB 1CQSA 3SX1A 4EYCA 4HJLB 3V98A 3I553 1Z1SA 2STDA 1UUWB 2RFRA 4R1KA 7STDA 1VQN3 2OTJ3 4STDA 4LEHA 2IA7A 5IF6A 1GYBA 3PYJA 2B1XB 1E3VA 3MG1A 5JBSA 3KFQC 1GD4A 1ULIB 3PCSA 2CC3A 1WQLB 3NBJA 4OUQA 1S5AA 4RNYA 3UB1A 2W56B 1VQ83 4N6OB 3G16A 3LT9A 4K1VA 8CHOA 5IG5A 1E3RA 3GZRA 1A2VA 1AV4A 2Y73A 3DGMA 3BNCA 5IEPA 2UX0A 2M7OA 3EF8A 4N6TA 1IVWA 3CCS3 3EQQB 1US1A 1V74A 5AIFA 2QGUA 3GRDA 1Q40B 3U1WA 2RSXA 4N6UA 2E2TA 3EBTA 1NB5I 3ER7A 1W2B2 2HMKB 3IJEB 3FG1A 1VQ53 1NU3A 2C10A 2GU3A 2OOVA 4R80A 5BXQA 2W04A 3Q90A 2BHMA 3B4PA 5JPPA 3FLJA 5IG3A 1GD3A 3CXC2 1EG9B 1FGTA 4HM8B 1OCVA 1LOXA 2CHCA 3LMLA 3NX0A 2FXTA 3HZPA 1WMOA 3LYGA 4WWUC 1TUHA 3RGAA 3SLUA 3JVCA 3FF2A 1MNLA 1N8QA 3QRDA 1EA2A 2OQEC 4J8TA 5BVBA 2O9UX 3EBYA 1O7PB 4WYKB 5IENA 3OWUA 4LZIA 3M8CA 3H3HA 4HM7B 1W6YA 2ZL8A 1UI8A 2XRXB 1Q824 2BMOB 4L7KA 1JKGB 2XFTA 5DREA 5TGNA 1W6GA 4OK0A 1M1K4 3KSPA 1R4CA 5ELUA 2XGLA 3VF1A 5CLKA 2Z7AA 3EB8A 3MKIA 4U13A 1KD14 1YHQ3 3K0ZA 4N6V0 3S27A 1RN7A 4I4KA 1D6ZA 3SOYA 3FGYA 5DRVA 1UW1A 2BMQB 5EQLA 1DVDA 2PNCA 1STDA 2IUKA 4HZBB 2D1WA 4MMYB 2OCTA 3OW22 3Q1CA 4BTYA 3FG3A 1AR0A 1YJW3 1SPUA 2CWVA 2FNQA 4HM5B 4WP5A 4GL6A 4N6NB 3BB9A 4HM1B 1ASKA 6STDA 3NXJA 1JNQA 3KE7A 3UNLA 1WNHA 3CPOA 1NDOB 2CFWA 2WOHA 5EEOA 5IERA 1KWIA 2E2UA 3GZBA 1U8CB 3I563 1JV2B 4MEIA 2W9PA 3T8NA 3X3ZA 3OX9A 1YJ93 1SJWA 1FGRA 3L0RA 3T8UA 4XBTA 1TFOA 4RNZA 1CEWI 1JN5A 2OTL3 2ML6A 2GXFA 1DVCA 4HBRA 1JB4A 3K9MC 3NV0B 2CWTA 1JN5B 1DYUA 4O3VA 1J2BA 4WYKA 3I0YA 3BLZA 3CCQ3 3QK9A 1QVF2 1W7CA 5AEUB 2FGTA 1K8A4 3EE1A 1IT7A 2W0QA 3SOAA 3F9SA 5D81A 3X41A 1QAKA 3EHCA 1KC84 4HZ9B 3CMA3 3TDGA 3WOFB 1EKMA 4O2HA 1RRLA 3STDA 1OF5B 4MMZB 5A0OB 1JJ22 4IPBA 2HMNB 5I97A 2CW9A 1QVG2 2Z6BA 4G1MB 3EX9A 4XB5A 1IT8A 1WTHA 2BO9B 4N6MA 3MG2A 1G96A 5KP3A 3CCJ3 2WO0A 1IU7A 3CCL3 3N54B 2OWPA 3WDGB 1FGMA 1DMMA 4FR9A 3CNXA 5JPUA 2GBWB 3IMAB 3KSED 3S5CA 2LQVA 2F98A 4EV5A 2IMJA 2WGQA 2KCDA 2JDIH 3SXXA 3GWRA 1OPYA 2XSHB 4O8SA 4BTXA 3NBRA 3WA3A 3CD63 3OV4A 3X40A 1YVBI 4O02B 2P0MA 1K734 1VQK3 2KRTA 1OACA 1K28A 5CK6A 1ULJB 3S28A 3BNEA 1PFPA 5D82A 4EXRA 1AVLA 3B8LA 1QALA 5AIGA 5AIIA 4EC6A 2CWUA 4FMDA 2QEX3 1JB5A 1C7HA 1CYUA 2P38A 2KXGA 1SQWA 2BMRB 3DUKA 4KFFA 3CU3A 3IPTA 3NQZA 4KFEA 1IK3A 5G2GA 4NREA 3G713 3DY5A 5AI1A 2Q07A 1GY5A 1EQKA 1D6UA 5AEWB 2O3OA 2CG1A 2R4IA 4K90B 3OWYA 3HK4A 3RGRA 3H51A 1NO3A 4HM6B 2XR8B 3B7CA 3A76A 4FCZA 3WODG 3F8HA 2OQEA 3X3XA 3HI7A 3KN4A 4J9AA 4CDLA 4AEQA 1W01A 1FA3A 4Q53A 2HMOB 1KSIA 3AMOB 1ZO2A 3BNDA 3MSOA 1OHSA 3MHEA 1N9JA 1O7NB 3CC23 2YX9A 5IW9A 1YI23 2RCDA 2F86B 3NHXA 1N5HA 5IEOA 2OOVC 2HMLB 4K61A 2MC8A 3G0KA 3HX8A 1Q864 1TIJA 1QAFA 5FW5A 1IQXA 1TFKA 3LH4A 2L4VA 3WA2X 3NV0A 3LXUX 2CFGA 1NB3I 4XDVA 3PXMA 3WMDA 4AKYA 3G4S3 3HIIA 1IV7A 4KFDA 3D9RA 5CF1A 1Q814 1DMQA 1STFI 1AVKA 3SVAA 3FCSB 4H61A 4XBXA 1M1XB 1D6YA 3Q2PA 1W00A 1W4NA 3LTCA 4FMAA 4KVHA 1N8R4 2GU1A 3LOYA 1A67A 3DGLA 1SIIA 3EC9A 2W2CA 4LMIA 5STDA 1ISKA 3B4OA 3N8BA 5CF2A 5D83A 4R9LA 1OGZA 3CCU3 4CCVA 4EBGA 1QMAA 2WGOA 5EVHA 3N9HA 2HMJB 1W5ZA 3D3LA 2C11A 3KZTA 3MPHA 3CPW2 4OVMA 1VQ93 1ROAA 1JB2A 4WHAA 3CCV3 2F99A 1OHPA 2W9QA 1OUNA 1IVVA 4HKVB 2CKFB 1GS3A 2ZDJA 2CFDA 3CCE3 1Y4KA 1IV9A 4HM4B 3FKAA 3NBBA 4FCMA 1W02A 3G8ZA 3O8YA 4JRFA 1OGXA 1GY6A 1L5GB 1PU4A 4EV2A 1U5OA 4N3VA 1N9EA 1VQP3 1JRQA 3JUOA 1M9GA 1RKYA 1OH0A 2W6JH 2XFSA 3X42A 1VQ43 1F8NA 1K9M4 2YFLB 2JQ5A 5AYSC 3F8XA 1VQM3 1O7GB 1FGOA 1YIJ3 1FGQA 3MWZA 1OHOA 3CCM3 2WOFA 1A2KA 2CFKA 1UI7A 2P09A 1SIHA 4RBNA 4HVNA 1WMPA 2INXA 2ML5A 3GZYB 3S29A 4IT7A 2Z76A 1LNHA 2A15A 2RGQA 3F7SA 1A90A 3DMCA 3ECFA 3K63A 3PZWA 5ELJA 2YFIB 4AKZA 1TP6A 5KP1A 1RRHA 4QWTA 2E2VA 2CG0A 2W03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMA A;  3Q1C A;  3EB8 A;  4FMC A;  3EE1 A;  3PCS A;  4FMD A;  4FMB A;  3PCR A; 
#chains in the Genus database with same CATH topology
 3AGO A;  3WOE B;  5FGO A;  1JKG A;  3VSY A;  3FG4 A;  3MYT A;  3LT8 A;  3DM8 A;  4HYZ A;  1RN1 A;  3EN1 B;  1VQ6 3;  1T2I A;  5LC7 A;  1IQY A;  1VZZ A;  4MMX B;  2R41 A;  3NQY A;  2YFJ B;  1O7W B;  2BT3 A;  4HM0 B;  3CC4 3;  4R9K A;  1RGE A;  3G6E 3;  1BSB A;  1ZX2 A;  3CME 3;  4L8P A;  1RGK A;  6GSP A;  5KP4 A;  3VGN A;  1UCL A;  1K41 A;  4XDW A;  1TU5 A;  1GY7 A;  2IY2 A;  3KII A;  4LGQ A;  2V1L A;  3FZW A;  3K7C A;  4FMC A;  2Z77 A;  5AIH A;  1N5P A;  1FUW A;  1HU9 A;  3PS8 A;  4N6L A;  1BNI A;  3FH1 A;  1MOL A;  3U97 A;  3V99 A;  3DH2 A;  3D79 A;  3EJV A;  4JF8 A;  3NM7 A;  2Y74 A;  2CK3 H;  3MG3 A;  4HM3 B;  3S67 A;  3JUP A;  1AQZ A;  3DGN A;  3LTD A;  1VQ7 3;  1QJG A;  1JZD A;  4LSO A;  1WMN A;  3UJM A;  1BSA A;  2CFL A;  2SBL A;  3ALA A;  8RNT A;  1IDP A;  1NWW A;  3DGO A;  1BRS A;  3J7Y d;  2QA4 3;  1C54 A;  5IG4 A;  3DXO A;  2CIU A;  1LVN A;  4GB5 A;  2HMM B;  3DZL A;  1IQ8 A;  1VQL 3;  1DMN A;  3JUQ A;  2LYX A;  1GSP A;  3V92 A;  1DE3 A;  1RGC A;  4X2O A;  3CCR 3;  1RDS A;  1BGS A;  1GMP A;  1UDI I;  4LYL B;  3RDE A;  4ZM8 A;  1S72 3;  4FMB A;  1Q7Y 4;  2D42 A;  3F14 A;  1FUT A;  1FZU A;  4R4K A;  3LTA A;  4XM4 A;  1I70 A;  1NJI 4;  2GBX B;  4PEJ A;  3K5T A;  3X3Y A;  2XSO B;  2K54 A;  1Q40 A;  1LXE A;  4RNT A;  3EN8 A;  2B24 B;  1EEJ A;  2XH9 A;  1UCK A;  1B2M A;  1GMR A;  1YGE A;  2XEP A;  3OXA A;  5HGR A;  2QIY A;  1HKX A;  4IIA A;  3LZA A;  3UL5 A;  4HOH A;  5AYR B;  4H3U A;  1DET A;  3ZFZ A;  1BUQ A;  1B21 A;  2I9W A;  3F40 A;  3NM2 A;  3NUV A;  4BL2 A;  3ROB A;  1ROV A;  3BNB A;  3LTB A;  1BIR A;  2PZV A;  2W56 A;  3T0U A;  1VQO 3;  2P05 A;  1RSN A;  3JUN A;  1E97 A;  3CC7 3;  1Q42 A;  3HIG A;  1RGG A;  3PCR A;  1B3S A;  3E99 A;  3F7X A;  2XGN A;  1T5Y A;  3JUM A;  3FF0 A;  1I2F A;  1GOU A;  1IVU A;  2F5W A;  2K0M A;  3FSD A;  4K1U A;  2GEY A;  1YIT 3;  2CX0 A;  3GSP A;  4I5Q A;  2CH9 A;  1TRP A;  3AHW A;  4WFO A;  3AMO A;  1W6C A;  4XBY A;  5IG0 A;  1W2Z A;  4ILF A;  4ORL A;  3UL6 A;  2GEX A;  4KZ1 A;  4L8O A;  4NHF A;  5CXO A;  1IVX A;  3OWS A;  4BTW A;  3PGB A;  1RJO A;  1LOW A;  3GAX A;  1M90 4;  1UUV B;  1B2S A;  1O7H B;  1OF5 A;  5RNT A;  1RCL A;  3KKG A;  1RNB A;  4RZM A;  2IUJ A;  4X2H A;  1KQS 2;  3SED A;  4HM2 B;  1YJN 3;  4TX4 A;  2XF3 A;  1O7M B;  4MJD A;  1CYV A;  2KAA A;  1JZO A;  2MF7 A;  1B2X A;  4GSP A;  5LC6 A;  2P0X A;  1HZ1 A;  2BNG A;  1BNR A;  4FCJ A;  3CNM A;  1I8V A;  1CQS A;  3GZX B;  3SX1 A;  4EYC A;  1BAN A;  4HJL B;  3V98 A;  3I55 3;  1Z1S A;  2STD A;  1UUW B;  2RFR A;  4R1K A;  7STD A;  1BNG A;  1VQN 3;  2K3D A;  4STD A;  4LEH A;  2F5M A;  2IA7 A;  5IF6 A;  2OTJ 3;  1GYB A;  3PYJ A;  1RLS A;  2B1X B;  4J5G A;  1E3V A;  3MG1 A;  3DGY A;  5JBS A;  3KFQ C;  1GD4 A;  1ULI B;  3PCS A;  2KF4 A;  2CC3 A;  1B20 A;  1WQL B;  3NBJ A;  1BU4 A;  4OUQ A;  1UCJ A;  1S5A A;  4RNY A;  3UB1 A;  2KF5 A;  2W56 B;  1VQ8 3;  4N6O B;  1BOX A;  3G16 A;  3LT9 A;  4K1V A;  8CHO A;  1BSE A;  1BRI A;  1E3R A;  3GZR A;  1A2V A;  5IG5 A;  1AV4 A;  2Y73 A;  2C4B A;  3DGM A;  3BNC A;  5IEP A;  2UX0 A;  2M7O A;  3EF8 A;  4N6T A;  1IVW A;  3CCS 3;  3EQQ B;  1US1 A;  1V74 A;  5AIF A;  2QGU A;  3GRD A;  1Q40 B;  1JBS A;  3U1W A;  2RSX A;  1BRN L;  1ZGX A;  4N6U A;  2E2T A;  3EBT A;  1NB5 I;  3ER7 A;  1FW7 A;  3WR2 A;  1BAO A;  1W2B 2;  2HMK B;  3IJE B;  1GMQ A;  1I0V A;  3FG1 A;  1NU3 A;  1VQ5 3;  2C10 A;  1Q9E A;  2GU3 A;  2OOV A;  4R80 A;  5BXQ A;  2W04 A;  3Q90 A;  1MWU A;  1Q7H A;  2BHM A;  3WHO A;  1RGL A;  3B4P A;  5JPP A;  3FLJ A;  5IG3 A;  1GD3 A;  3CXC 2;  1EG9 B;  1FGT A;  2H0G A;  1OCV A;  4HM8 B;  1UGH I;  1RGA A;  1LOX A;  2CHC A;  1B2U A;  3LML A;  3NX0 A;  2FXT A;  3HZP A;  2J8X B;  1WMO A;  2H0H A;  3LYG A;  4WWU C;  1TUH A;  3RGA A;  3SLU A;  3JVC A;  5M19 A;  3FF2 A;  1MNL A;  1N8Q A;  3QRD A;  3BIR A;  1AY7 A;  1EA2 A;  2OQE C;  4J8T A;  1BSD A;  2O9U X;  4CJN A;  5BVB A;  3EBY A;  1A2P A;  1O7P B;  1LOV A;  1X1X A;  3AGN A;  1MWR A;  4WYK B;  5IEN A;  3OWU A;  4LZI A;  3M8C A;  3SYU A;  3H3H A;  1X1W A;  4HM7 B;  1W6Y A;  1UI8 A;  2XRX B;  2ZL8 A;  1Q82 4;  2BMO B;  4L7K A;  1JKG B;  2XFT A;  5DRE A;  5TGN A;  1W6G A;  4OK0 A;  1M1K 4;  1SAR A;  3D4A A;  3KSP A;  1R4C A;  5ELU A;  2F4Y A;  2XGL A;  5CLK A;  3VF1 A;  2Z7A A;  5HOH A;  1LQM B;  3EB8 A;  3MKI A;  4U13 A;  2H0I A;  1KD1 4;  1YHQ 3;  3K0Z A;  4N6V 0;  1GOV A;  1RN7 A;  3S27 A;  4I4K A;  1D6Z A;  3SOY A;  3FGY A;  1BRH A;  5DRV A;  1UW1 A;  2BMQ B;  5EQL A;  1DVD A;  2PNC A;  1STD A;  2IUK A;  4HZB B;  2D1W A;  4MMY B;  2OCT A;  3OW2 2;  3Q1C A;  4BTY A;  3FG3 A;  1AR0 A;  1YGW A;  1PY3 A;  1YJW 3;  1SPU A;  2CWV A;  2AAD A;  2FNQ A;  4HM5 B;  4WP5 A;  4GL6 A;  4N6N B;  2RBI A;  1FUS A;  1UUG B;  1TRQ A;  3BB9 A;  4HM1 B;  1ASK A;  5BU4 A;  3NXJ A;  1JNQ A;  2UUG C;  3KE7 A;  3UNL A;  1WNH A;  1MGW A;  1NDO B;  3CPO A;  2CFW A;  2WOH A;  5EEO A;  5IER A;  1KWI A;  1BNJ A;  2E2U A;  3GZB A;  1U8C B;  5GSP A;  3I56 3;  1JV2 B;  4MEI A;  2W9P A;  3T8N A;  3X3Z A;  3OX9 A;  1YJ9 3;  1SJW A;  5G1L A;  1FGR A;  3L0R A;  3T8U A;  4XBT A;  3URP A;  1RNT A;  2UGI A;  1TFO A;  4RNZ A;  1CEW I;  1JN5 A;  2SAR A;  2OTL 3;  2ML6 A;  2GXF A;  1DVC A;  4HBR A;  1JB4 A;  1RHL A;  3K9M C;  3NV0 B;  2CWT A;  1JN5 B;  1RCK A;  1DYU A;  4O3V A;  1J2B A;  4WYK A;  3I0Y A;  3BLZ A;  3CCQ 3;  1T2H A;  1BRK A;  1G0T A;  3QK9 A;  1W7C A;  1QVF 2;  5AEU B;  2FGT A;  2HOH A;  1K8A 4;  3EE1 A;  1IT7 A;  2W0Q A;  3SOA A;  3F9S A;  3Q3F A;  5D81 A;  3X41 A;  1QAK A;  3EHC A;  1KC8 4;  4HZ9 B;  3CMA 3;  1UGI A;  3TDG A;  1FYS A;  2AAE A;  3WOF B;  1EKM A;  4O2H A;  1RRL A;  3STD A;  1OF5 B;  4MMZ B;  5A0O B;  1JJ2 2;  4IPB A;  2HMN B;  3ZG5 A;  5I97 A;  1V57 A;  6STD A;  2CW9 A;  1QVG 2;  2Z6B A;  4G1M B;  3EX9 A;  1NNV A;  4XB5 A;  1IT8 A;  1WTH A;  2BO9 B;  2CX1 A;  4N6M A;  3A5E A;  2L1S A;  3MG2 A;  1X1U A;  1G96 A;  5KP3 A;  1CH0 A;  3CCJ 3;  2WO0 A;  4DKI A;  1IU7 A;  1B27 A;  1R4Y A;  2OWP A;  3N54 B;  3WDG B;  1LRA A;  3CCL 3;  1FGM A;  1DMM A;  4FR9 A;  1JBR A;  3CNX A;  5JPU A;  2GBW B;  3IMA B;  3KSE D;  3S5C A;  2LQV A;  2F98 A;  4EV5 A;  2IMJ A;  2WGQ A;  2KCD A;  2JDI H;  3SXX A;  3GWR A;  1OPY A;  2XSH B;  4O8S A;  4BTX A;  3NBR A;  3WA3 A;  3CD6 3;  3ZG0 A;  3OV4 A;  3X40 A;  1BRG A;  1YVB I;  4O02 B;  2P0M A;  1K73 4;  1BNS A;  1VQK 3;  1G02 A;  2KRT A;  1YVS A;  1OAC A;  1K28 A;  5CK6 A;  1ULJ B;  2BIR A;  3S28 A;  1IYY A;  3BNE A;  1PFP A;  5D82 A;  4EXR A;  1AVL A;  3B8L A;  1QAL A;  5AIG A;  5AII A;  1BSC A;  2CWU A;  4FMD A;  4EC6 A;  2QEX 3;  1JB5 A;  1C7H A;  7RNT A;  1CYU A;  2P38 A;  2KXG A;  1SQW A;  2BMR B;  1BRJ A;  3DUK A;  1BNE A;  4KFF A;  3CU3 A;  3IPT A;  1X1Y A;  3NQZ A;  4KFE A;  1IK3 A;  1MGR A;  3BU4 A;  4NRE A;  5G2G A;  3DY5 A;  3G71 3;  1RTU A;  5AI1 A;  2Q07 A;  1GY5 A;  1EQK A;  1D6U A;  5AEW B;  2O3O A;  2CG1 A;  1HYF A;  5M18 A;  2R4I A;  4K90 B;  3OWY A;  3HK4 A;  3RGR A;  3H51 A;  1NO3 A;  9RNT A;  4HM6 B;  2KF6 A;  2XR8 B;  3B7C A;  3A76 A;  4FCZ A;  4GHO A;  3RNT A;  3WOD G;  3F8H A;  2OQE A;  3X3X A;  3HI7 A;  3KN4 A;  4J9A A;  4CDL A;  4AEQ A;  1W01 A;  2ZHX B;  1FA3 A;  4Q53 A;  5BIR A;  2HMO B;  1KSI A;  1ZO2 A;  3AMO B;  3BND A;  3MSO A;  1OHS A;  3MHE A;  1N9J A;  1O7N B;  5M1A A;  3CC2 3;  2YX9 A;  5IW9 A;  1YI2 3;  2RCD A;  2F86 B;  3NHX A;  1N5H A;  5IEO A;  2OOV C;  1BVI A;  2HML B;  4K61 A;  1I0X A;  1GOY A;  1RGH A;  2MC8 A;  3G0K A;  3HX8 A;  1Q86 4;  1TIJ A;  1QAF A;  5FW5 A;  1IQX A;  1TFK A;  3LH4 A;  2L4V A;  3WA2 X;  2BU4 A;  3D5G A;  1YNV X;  2CFG A;  3LXU X;  1NB3 I;  3NV0 A;  4XDV A;  3PXM A;  3WMD A;  3AHS A;  1LNI A;  4AKY A;  3G4S 3;  1EUI C;  3HII A;  1IV7 A;  4KFD A;  3D9R A;  5CF1 A;  2IYJ A;  1Q81 4;  1DMQ A;  1STF I;  1AVK A;  1T3B A;  3SVA A;  3FCS B;  4H61 A;  4XBX A;  1M1X B;  1D6Y A;  3Q2P A;  1W00 A;  1W4N A;  6RNT A;  3LTC A;  4FMA A;  4KVH A;  1N8R 4;  2GU1 A;  3LOY A;  1A67 A;  3DGL A;  3D5I A;  1SII A;  7GSP A;  3EC9 A;  2W2C A;  4LMI A;  5STD A;  4CPK A;  1ISK A;  3B4O A;  3N8B A;  5CF2 A;  5D83 A;  4R9L A;  2RNT A;  1OGZ A;  2KF3 A;  3CCU 3;  4CCV A;  4EBG A;  1BNF A;  4BL3 A;  1QMA A;  2WGO A;  1ZS7 A;  5EVH A;  3N9H A;  2HMJ B;  1W5Z A;  3D3L A;  4BU4 A;  3HOH A;  1I2G A;  2C11 A;  3KZT A;  3MPH A;  3CPW 2;  4OVM A;  4J5K A;  3KCH A;  1VQ9 3;  1JBT A;  5G1K A;  1ROA A;  1VQQ A;  1JB2 A;  4WHA A;  1TTO A;  2GSP A;  4BIR A;  1LOY A;  2F99 A;  1OHP A;  3CCV 3;  2W9Q A;  1OUN A;  1IVV A;  4HKV B;  2CKF B;  1GS3 A;  2ZDJ A;  2CFD A;  3CCE 3;  1I3F A;  1Y4K A;  1IV9 A;  4HM4 B;  3FKA A;  3NBB A;  4KT3 B;  4FCM A;  1W02 A;  3G8Z A;  3O8Y A;  4JRF A;  1OGX A;  1GY6 A;  1I3I A;  1UCI A;  4NPB A;  1MWT A;  1L5G B;  1RN4 A;  1PU4 A;  4EV2 A;  1U5O A;  4N3V A;  2F56 A;  1N9E A;  1VQP 3;  1JRQ A;  3JUO A;  1M9G A;  1RGF A;  1RKY A;  1OH0 A;  2W6J H;  1I2E A;  2XFS A;  3X42 A;  1F8N A;  1VQ4 3;  1K9M 4;  2YFL B;  2JQ5 A;  5AYS C;  3F8X A;  1VQM 3;  1O7G B;  1FGO A;  1YIJ 3;  1FGQ A;  3MWZ A;  1OHO A;  3CCM 3;  2WOF A;  1A2K A;  1V58 A;  1UI7 A;  2CFK A;  1B2Z A;  2P09 A;  1SIH A;  4RBN A;  4EW5 A;  1BUJ A;  4HVN A;  1WMP A;  2INX A;  2ML5 A;  3GZY B;  3S29 A;  1MWS A;  2ZA4 A;  2Z76 A;  1LNH A;  1LQG C;  1RMS A;  2A15 A;  4IT7 A;  2RGQ A;  3F7S A;  1A90 A;  3DMC A;  3ECF A;  3K63 A;  1TJD A;  4HAA A;  3PZW A;  5ELJ A;  2YFI B;  1PYL A;  4AKZ A;  1TP6 A;  5KP1 A;  1RRH A;  4QWT A;  2E2V A;  2CG0 A;  2W03 A; 
#chains in the Genus database with same CATH homology
 3WOE B;  5FGO A;  1JKG A;  3VSY A;  3FG4 A;  3MYT A;  3LT8 A;  3DM8 A;  4HYZ A;  3EN1 B;  1VQ6 3;  5LC7 A;  1IQY A;  1VZZ A;  4MMX B;  3NQY A;  2YFJ B;  1O7W B;  2BT3 A;  4HM0 B;  3CC4 3;  4R9K A;  3G6E 3;  3CME 3;  1ZX2 A;  4L8P A;  5KP4 A;  3VGN A;  1K41 A;  4XDW A;  1TU5 A;  1GY7 A;  3KII A;  4LGQ A;  2V1L A;  3FZW A;  3K7C A;  4FMC A;  2Z77 A;  5AIH A;  1N5P A;  1FUW A;  1HU9 A;  3PS8 A;  4N6L A;  3FH1 A;  1MOL A;  3U97 A;  3V99 A;  3EJV A;  4JF8 A;  3NM7 A;  2Y74 A;  2CK3 H;  3MG3 A;  4HM3 B;  3S67 A;  3JUP A;  3DGN A;  3LTD A;  1VQ7 3;  1QJG A;  4LSO A;  1WMN A;  3UJM A;  2CFL A;  2SBL A;  3ALA A;  3J7Y d;  1IDP A;  1NWW A;  3DGO A;  2QA4 3;  5IG4 A;  3DXO A;  2CIU A;  1LVN A;  4GB5 A;  2HMM B;  3DZL A;  1IQ8 A;  1VQL 3;  1DMN A;  3JUQ A;  2LYX A;  3V92 A;  3CCR 3;  4X2O A;  3RDE A;  1Q7Y 4;  4ZM8 A;  1S72 3;  4FMB A;  2D42 A;  3F14 A;  4R4K A;  3LTA A;  4XM4 A;  1NJI 4;  2GBX B;  4PEJ A;  3K5T A;  3X3Y A;  2XSO B;  2K54 A;  1Q40 A;  1LXE A;  3EN8 A;  2B24 B;  2XH9 A;  1YGE A;  2XEP A;  3OXA A;  5HGR A;  2QIY A;  1HKX A;  4IIA A;  3LZA A;  3UL5 A;  5AYR B;  1BUQ A;  4H3U A;  2I9W A;  3F40 A;  3NM2 A;  3NUV A;  3ROB A;  1ROV A;  3BNB A;  3LTB A;  2PZV A;  2W56 A;  3T0U A;  1VQO 3;  2P05 A;  3CC7 3;  3JUN A;  1E97 A;  1Q42 A;  3HIG A;  3PCR A;  3E99 A;  3F7X A;  2XGN A;  1T5Y A;  3JUM A;  3FF0 A;  3FSD A;  1IVU A;  2K0M A;  4K1U A;  2GEY A;  1YIT 3;  2CH9 A;  4WFO A;  3AMO A;  1W6C A;  4XBY A;  5IG0 A;  1W2Z A;  4ORL A;  3UL6 A;  2GEX A;  4KZ1 A;  4L8O A;  4NHF A;  5CXO A;  1IVX A;  3OWS A;  4BTW A;  3PGB A;  1RJO A;  3GAX A;  1M90 4;  1UUV B;  1O7H B;  1OF5 A;  3KKG A;  4RZM A;  2IUJ A;  4X2H A;  1KQS 2;  3SED A;  4HM2 B;  1YJN 3;  4TX4 A;  2XF3 A;  1O7M B;  4MJD A;  1CYV A;  2MF7 A;  5LC6 A;  2P0X A;  2BNG A;  4FCJ A;  3CNM A;  3GZX B;  1CQS A;  3SX1 A;  4EYC A;  4HJL B;  3V98 A;  3I55 3;  1Z1S A;  2STD A;  1UUW B;  2RFR A;  4R1K A;  7STD A;  1VQN 3;  2OTJ 3;  4STD A;  4LEH A;  2IA7 A;  5IF6 A;  1GYB A;  3PYJ A;  2B1X B;  1E3V A;  3MG1 A;  5JBS A;  3KFQ C;  1GD4 A;  1ULI B;  3PCS A;  2CC3 A;  1WQL B;  3NBJ A;  4OUQ A;  1S5A A;  4RNY A;  3UB1 A;  2W56 B;  1VQ8 3;  4N6O B;  3G16 A;  3LT9 A;  4K1V A;  8CHO A;  5IG5 A;  1E3R A;  3GZR A;  1A2V A;  1AV4 A;  2Y73 A;  3DGM A;  3BNC A;  5IEP A;  2UX0 A;  2M7O A;  3EF8 A;  4N6T A;  1IVW A;  3CCS 3;  3EQQ B;  1US1 A;  1V74 A;  5AIF A;  2QGU A;  3GRD A;  1Q40 B;  3U1W A;  2RSX A;  4N6U A;  2E2T A;  3EBT A;  1NB5 I;  3ER7 A;  1W2B 2;  2HMK B;  3IJE B;  3FG1 A;  1VQ5 3;  1NU3 A;  2C10 A;  2GU3 A;  2OOV A;  4R80 A;  5BXQ A;  2W04 A;  3Q90 A;  2BHM A;  3B4P A;  5JPP A;  3FLJ A;  5IG3 A;  1GD3 A;  3CXC 2;  1EG9 B;  1FGT A;  4HM8 B;  1OCV A;  1LOX A;  2CHC A;  3LML A;  3NX0 A;  2FXT A;  3HZP A;  1WMO A;  3LYG A;  4WWU C;  1TUH A;  3RGA A;  3SLU A;  3JVC A;  3FF2 A;  1MNL A;  1N8Q A;  3QRD A;  1EA2 A;  2OQE C;  4J8T A;  5BVB A;  2O9U X;  3EBY A;  1O7P B;  4WYK B;  5IEN A;  3OWU A;  4LZI A;  3M8C A;  3H3H A;  4HM7 B;  1W6Y A;  2ZL8 A;  1UI8 A;  2XRX B;  1Q82 4;  2BMO B;  4L7K A;  1JKG B;  2XFT A;  5DRE A;  5TGN A;  1W6G A;  4OK0 A;  1M1K 4;  3KSP A;  1R4C A;  5ELU A;  2XGL A;  3VF1 A;  5CLK A;  2Z7A A;  3EB8 A;  3MKI A;  4U13 A;  1KD1 4;  1YHQ 3;  3K0Z A;  4N6V 0;  3S27 A;  1RN7 A;  4I4K A;  1D6Z A;  3SOY A;  3FGY A;  5DRV A;  1UW1 A;  2BMQ B;  5EQL A;  1DVD A;  2PNC A;  1STD A;  2IUK A;  4HZB B;  2D1W A;  4MMY B;  2OCT A;  3OW2 2;  3Q1C A;  4BTY A;  3FG3 A;  1AR0 A;  1YJW 3;  1SPU A;  2CWV A;  2FNQ A;  4HM5 B;  4WP5 A;  4GL6 A;  4N6N B;  3BB9 A;  4HM1 B;  1ASK A;  6STD A;  3NXJ A;  1JNQ A;  3KE7 A;  3UNL A;  1WNH A;  3CPO A;  1NDO B;  2CFW A;  2WOH A;  5EEO A;  5IER A;  1KWI A;  2E2U A;  3GZB A;  1U8C B;  3I56 3;  1JV2 B;  4MEI A;  2W9P A;  3T8N A;  3X3Z A;  3OX9 A;  1YJ9 3;  1SJW A;  1FGR A;  3L0R A;  3T8U A;  4XBT A;  1TFO A;  4RNZ A;  1CEW I;  1JN5 A;  2OTL 3;  2ML6 A;  2GXF A;  1DVC A;  4HBR A;  1JB4 A;  3K9M C;  3NV0 B;  2CWT A;  1JN5 B;  1DYU A;  4O3V A;  1J2B A;  4WYK A;  3I0Y A;  3BLZ A;  3CCQ 3;  3QK9 A;  1QVF 2;  1W7C A;  5AEU B;  2FGT A;  1K8A 4;  3EE1 A;  1IT7 A;  2W0Q A;  3SOA A;  3F9S A;  5D81 A;  3X41 A;  1QAK A;  3EHC A;  1KC8 4;  4HZ9 B;  3CMA 3;  3TDG A;  3WOF B;  1EKM A;  4O2H A;  1RRL A;  3STD A;  1OF5 B;  4MMZ B;  5A0O B;  1JJ2 2;  4IPB A;  2HMN B;  5I97 A;  2CW9 A;  1QVG 2;  2Z6B A;  4G1M B;  3EX9 A;  4XB5 A;  1IT8 A;  1WTH A;  2BO9 B;  4N6M A;  3MG2 A;  1G96 A;  5KP3 A;  3CCJ 3;  2WO0 A;  1IU7 A;  3CCL 3;  3N54 B;  2OWP A;  3WDG B;  1FGM A;  1DMM A;  4FR9 A;  3CNX A;  5JPU A;  2GBW B;  3IMA B;  3KSE D;  3S5C A;  2LQV A;  2F98 A;  4EV5 A;  2IMJ A;  2WGQ A;  2KCD A;  2JDI H;  3SXX A;  3GWR A;  1OPY A;  2XSH B;  4O8S A;  4BTX A;  3NBR A;  3WA3 A;  3CD6 3;  3OV4 A;  3X40 A;  1YVB I;  4O02 B;  2P0M A;  1K73 4;  1VQK 3;  2KRT A;  1OAC A;  1K28 A;  5CK6 A;  1ULJ B;  3S28 A;  3BNE A;  1PFP A;  5D82 A;  4EXR A;  1AVL A;  3B8L A;  1QAL A;  5AIG A;  5AII A;  4EC6 A;  2CWU A;  4FMD A;  2QEX 3;  1JB5 A;  1C7H A;  1CYU A;  2P38 A;  2KXG A;  1SQW A;  2BMR B;  3DUK A;  4KFF A;  3CU3 A;  3IPT A;  3NQZ A;  4KFE A;  1IK3 A;  5G2G A;  4NRE A;  3G71 3;  3DY5 A;  5AI1 A;  2Q07 A;  1GY5 A;  1EQK A;  1D6U A;  5AEW B;  2O3O A;  2CG1 A;  2R4I A;  4K90 B;  3OWY A;  3HK4 A;  3RGR A;  3H51 A;  1NO3 A;  4HM6 B;  2XR8 B;  3B7C A;  3A76 A;  4FCZ A;  3WOD G;  3F8H A;  2OQE A;  3X3X A;  3HI7 A;  3KN4 A;  4J9A A;  4CDL A;  4AEQ A;  1W01 A;  1FA3 A;  4Q53 A;  2HMO B;  1KSI A;  3AMO B;  1ZO2 A;  3BND A;  3MSO A;  1OHS A;  3MHE A;  1N9J A;  1O7N B;  3CC2 3;  2YX9 A;  5IW9 A;  1YI2 3;  2RCD A;  2F86 B;  3NHX A;  1N5H A;  5IEO A;  2OOV C;  2HML B;  4K61 A;  2MC8 A;  3G0K A;  3HX8 A;  1Q86 4;  1TIJ A;  1QAF A;  5FW5 A;  1IQX A;  1TFK A;  3LH4 A;  2L4V A;  3WA2 X;  3NV0 A;  3LXU X;  2CFG A;  1NB3 I;  4XDV A;  3PXM A;  3WMD A;  4AKY A;  3G4S 3;  3HII A;  1IV7 A;  4KFD A;  3D9R A;  5CF1 A;  1Q81 4;  1DMQ A;  1STF I;  1AVK A;  3SVA A;  3FCS B;  4H61 A;  4XBX A;  1M1X B;  1D6Y A;  3Q2P A;  1W00 A;  1W4N A;  3LTC A;  4FMA A;  4KVH A;  1N8R 4;  2GU1 A;  3LOY A;  1A67 A;  3DGL A;  1SII A;  3EC9 A;  2W2C A;  4LMI A;  5STD A;  1ISK A;  3B4O A;  3N8B A;  5CF2 A;  5D83 A;  4R9L A;  1OGZ A;  3CCU 3;  4CCV A;  4EBG A;  1QMA A;  2WGO A;  5EVH A;  3N9H A;  2HMJ B;  1W5Z A;  3D3L A;  2C11 A;  3KZT A;  3MPH A;  3CPW 2;  4OVM A;  1VQ9 3;  1ROA A;  1JB2 A;  4WHA A;  3CCV 3;  2F99 A;  1OHP A;  2W9Q A;  1OUN A;  1IVV A;  4HKV B;  2CKF B;  1GS3 A;  2ZDJ A;  2CFD A;  3CCE 3;  1Y4K A;  1IV9 A;  4HM4 B;  3FKA A;  3NBB A;  4FCM A;  1W02 A;  3G8Z A;  3O8Y A;  4JRF A;  1OGX A;  1GY6 A;  1L5G B;  1PU4 A;  4EV2 A;  1U5O A;  4N3V A;  1N9E A;  1VQP 3;  1JRQ A;  3JUO A;  1M9G A;  1RKY A;  1OH0 A;  2W6J H;  2XFS A;  3X42 A;  1VQ4 3;  1F8N A;  1K9M 4;  2YFL B;  2JQ5 A;  5AYS C;  3F8X A;  1VQM 3;  1O7G B;  1FGO A;  1YIJ 3;  1FGQ A;  3MWZ A;  1OHO A;  3CCM 3;  2WOF A;  1A2K A;  2CFK A;  1UI7 A;  2P09 A;  1SIH A;  4RBN A;  4HVN A;  1WMP A;  2INX A;  2ML5 A;  3GZY B;  3S29 A;  4IT7 A;  2Z76 A;  1LNH A;  2A15 A;  2RGQ A;  3F7S A;  1A90 A;  3DMC A;  3ECF A;  3K63 A;  3PZW A;  5ELJ A;  2YFI B;  4AKZ A;  1TP6 A;  5KP1 A;  1RRH A;  4QWT A;  2E2V A;  2CG0 A;  2W03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...