3EB8A

Vira
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
334
Chain Sequence
AEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies indicate that Shigella VirA is not a protease and does not directly destabilize microtubules.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
molecule keywords Cysteine protease-like virA
total genus 99
structure length 334
sequence length 347
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3eb8A01
4FMCA 3EE1A 3EB8A 3Q1CA 4FMDA 4FMAA 3PCSA 3PCRA 4FMBA
chains in the Genus database with same CATH superfamily
1FGQA 1YNVX 1ZGXA 3DY5A 3AHWA 5EQLA 1A67A 1BNGA 1MWTA 3NHXA 3T8UA 2GU3A 5LC7A 3EQQB 4XDVA 3VGNA 1B3SA 3FSDA 4G1MB 1IQ8A 1BNIA 5M18A 1Q814 1C7HA 1CEWI 1Q40A 4ORLA 2OWPA 3X3ZA 3N9HA 3SX1A 1GD3A 3JUNA 2ZA4A 1IQYA 1I3IA 1AVKA 3G6E3 3BNEA 3PZWA 1SJWA 3KSPA 4PEJA 1UW1A 1WMPA 3V92A 2CW9A 3X42A 1OHSA 1VQP3 4EV5A 2CFWA 3WODG 2OQEC 4KT3B 2K54A 3T0UA 1E3RA 3A76A 5A0OB 2WO0A 5RNTA 1JBSA 1VQ63 3OXAA 1X1YA 4MMZB 4TX4A 2R41A 1BNJA 2GSPA 1W5ZA 4XB5A 5FW5A 1BSAA 3S67A 1JBTA 2W6JH 3OW22 1PY3A 3QRDA 1N9JA 1TJDA 1GS3A 4RNTA 3DH2A 3LTAA 5D82A 1IV9A 4N6UA 2BO9B 2W9QA 3ER7A 4HJLB 5BXQA 3CCR3 2XEPA 5IF6A 4XBTA 1VQL3 3X40A 1GY6A 1QVG2 2Y73A 4STDA 1OACA 1QMAA 2WOFA 1LQMB 4EBGA 3F7SA 2MC8A 1FUSA 2AADA 2CFGA 3OX9A 4HM8B 4HM7B 3CCQ3 2PNCA 2KF3A 4U13A 3DGMA 3ECFA 3F8HA 3KCHA 1M9GA 1MNLA 2QEX3 1EQKA 2C10A 2W56A 2XGLA 3LMLA 1AVLA 3MG3A 4MJDA 1LOWA 1KD14 2F86B 2P0XA 2CH9A 3PYJA 5AIFA 4XBXA 1RJOA 1MOLA 3LOYA 4KFDA 1F8NA 2ML6A 4I4KA 1E97A 1SARA 4EV2A 2CX0A 2Q07A 3MG1A 2W0QA 1RGHA 1N9EA 1Y4KA 3JUPA 4FCZA 3S5CA 4N6OB 1B2SA 4GHOA 1K734 2CFLA 4HVNA 1PFPA 2CIUA 3ZG0A 3IJEB 3SOYA 3DGLA 4N3VA 4L8OA 1DMMA 1STFI 1BRJA 2W03A 3EC9A 3GAXA 1LOXA 4J9AA 4JF8A 3G713 3CD63 3WA2X 3HX8A 1UUGB 4HKVB 3F40A 4AKZA 3PGBA 1QAFA 2HMJB 3N54B 1Q42A 3LZAA 1IT8A 1LVNA 3S28A 3SEDA 2MF7A 4KFEA 2C11A 5JBSA 1G0TA 3K63A 1N5HA 1VQ53 4CJNA 1E3VA 4WHAA 5IERA 3NX0A 5G2GA 1BGSA 2HMLB 4KZ1A 1T2IA 4EYCA 3GZYB 2FXTA 1B2XA 3K9MC 4FMBA 3V99A 1FGMA 1B20A 2XR8B 2IUKA 2YX9A 3NM2A 4R80A 1JB2A 1DETA 4N6V0 3DM8A 3GZBA 1GD4A 1ZX2A 3K0ZA 1BRKA 2CX1A 1UGIA 3U1WA 1OHOA 2Y74A 4LSOA 3KKGA 5KP4A 4L8PA 5D81A 3O8YA 3STDA 3K5TA 3J7Yd 1M904 3EBTA 1I2GA 1W2ZA 5AYRB 1WMOA 1RCLA 3NV0B 1IDPA 3ALAA 3OV4A 1OGXA 2IYJA 5HGRA 4K1UA 3SXXA 1K41A 1RNBA 3GZXB 3BIRA 5CLKA 7RNTA 1IYYA 1OUNA 3MWZA 1G96A 3X3XA 1V74A 2OCTA 3T8NA 2CHCA 5GSPA 1VQM3 2F99A 2W2CA 2XFSA 4FMDA 4R9KA 3SOAA 1TP6A 1VQ83 2GBXB 4HM2B 3A5EA 5ELJA 1VQ73 1OPYA 1B21A 5BIRA 3WMDA 2CWVA 5G1LA 4K90B 1NB3I 3SVAA 1T2HA 3M8CA 1N8R4 1M1K4 1BSCA 3NV0A 4FR9A 3DUKA 2D42A 2H0GA 2IMJA 3WOEB 1EEJA 1SPUA 1RN1A 3B8LA 3SYUA 1RCKA 4XDWA 3EBYA 1EG9B 5AIHA 1EKMA 5I97A 2B1XB 2IY2A 2O3OA 3D9RA 1S723 3G8ZA 3F7XA 1TIJA 3EN8A 4KFFA 1QAKA 1RGEA 2CK3H 3NUVA 1BIRA 5M1AA 1TUHA 2STDA 1A90A 2LQVA 2BU4A 2XSHB 4FCMA 4WYKB 9RNTA 4H3UA 4HYZA 2A15A 1TRQA 2XF3A 3WR2A 3CC43 2BT3A 2CFDA 4N6TA 5AEWB 4LGQA 3CPW2 1S5AA 1RHLA 2L1SA 3NQZA 1QVF2 1OGZA 1YI23 3K7CA 4LEHA 3F14A 4BL3A 1FW7A 1VQ43 3FG1A 1NU3A 1BUQA 3FG3A 2V1LA 3KSED 5CK6A 5HOHA 1W6YA 3LTDA 1W2B2 1QJGA 3EB8A 3OWYA 1OCVA 1V57A 1STDA 3D3LA 3RNTA 1AY7A 1T3BA 1NB5I 3D4AA 4J5KA 4HAAA 3URPA 3CCV3 2E2TA 1MWUA 3Q2PA 3UNLA 1BRIA 2QIYA 3B4OA 3FG4A 5TGNA 3X41A 3DXOA 5CF1A 3BLZA 3UL5A 3D79A 3JUMA 3FLJA 1JN5A 1A2KA 4XBYA 5IG3A 3TDGA 1ASKA 3CC23 1T5YA 4HM5B 2KCDA 1L5GB 1BSBA 6RNTA 1R4YA 3GRDA 1KC84 2RBIA 2F5WA 3FCSB 4GSPA 2B24B 2CWTA 4BU4A 2H0IA 3FGYA 5DRVA 1BNSA 1JNQA 3CU3A 3KIIA 3NBRA 3NXJA 1HZ1A 1KSIA 3UJMA 1BU4A 1AQZA 1Q824 2WGQA 1W6GA 4O02B 6STDA 3KE7A 4QWTA 2OOVA 3I0YA 2YFLB 4MMXB 8CHOA 5STDA 4IIAA 2QA43 3I563 1OF5A 2JDIH 1RGFA 2P0MA 3CCL3 1JV2B 2C4BA 5IW9A 1O7GB 3JVCA 3WDGB 1Q9EA 5ELUA 1X1XA 1RN4A 2P38A 3CC73 3IMAB 3RGAA 3SLUA 3PCRA 4I5QA 2ML5A 1JKGA 1VQK3 1SQWA 2W9PA 2R4IA 3Q1CA 1WMNA 2BIRA 4K1VA 4N6LA 1RGAA 3LXUX 1YHQ3 2ZDJA 1IQXA 1JZOA 1BSEA 1W00A 2BMOB 4NHFA 1DYUA 2JQ5A 1RGKA 1EUIC 3MHEA 3N8BA 4EC6A 1LRAA 1DE3A 5AEUB 3NBBA 1BAOA 3BNBA 1Q40B 1YJW3 1NNVA 1RGGA 4WWUC 3LT9A 1GMQA 1W7CA 5CXOA 4JRFA 1NDOB 1ULIB 1HYFA 1MGWA 2Z6BA 3B7CA 4OUQA 3S29A 1LNIA 1B27A 1O7PB 3DGNA 3HZPA 3ROBA 2ZHXB 3RGRA 1NWWA 1GMRA 1X1UA 1YGEA 3EF8A 4IT7A 1DMQA 2J8XB 5AI1A 5EVHA 4N6MA 1D6ZA 1JB4A 1UCLA 1A2PA 1K28A 3V98A 1BOXA 1JB5A 1TRPA 3CCS3 2E2UA 4EW5A 1IVWA 4R1KA 5IG0A 1BRHA 3Q90A 1VQQA 4FCJA 5LC6A 1YVSA 2CFKA 2OOVC 1GYBA 1BNRA 1QALA 1FUTA 4O3VA 1RSNA 4EXRA 1TFOA 1IVXA 2BMQB 1WTHA 3DGYA 1MGRA 1SIHA 1EA2A 3EHCA 3F8XA 5AYSC 1B2MA 1ISKA 1RMSA 5EEOA 3CCM3 1YJN3 3L0RA 1IK3A 3BB9A 3OWSA 3OWUA 2GXFA 5G1KA 1PU4A 3PXMA 2CWUA 2YFJB 1I8VA 1N5PA 4N6NB 5DREA 1SIIA 2XRXB 3Q3FA 3I553 1LNHA 2BHMA 3PS8A 1UDII 4WYKA 5BVBA 1IVUA 1V58A 1NO3A 3CCE3 1OHPA 3KN4A 5CF2A 2GEXA 3EX9A 1IU7A 1US1A 3AHSA 1RTUA 5D83A 3MSOA 2K0MA 4Q53A 1OH0A 3CNMA 2L4VA 1RRHA 4KVHA 1GOUA 1RGCA 1RLSA 2D1WA 2XGNA 1GOVA 1JKGB 2ZL8A 2RFRA 3AMOA 3HOHA 2OQEA 3WA3A 4AEQA 1ZO2A 2IA7A 3FF2A 3CME3 1I70A 1R4CA 1FUWA 3FF0A 2F98A 1TTOA 5FGOA 7GSPA 5KP1A 2LYXA 1OF5B 5AIIA 1AR0A 1UCKA 4HM6B 4HZ9B 2HMMB 3ZG5A 3JUOA 4LYLB 1GOYA 2FNQA 4HM0B 2CG0A 1B2ZA 2KAAA 4HM3B 4MMYB 4O8SA 2I9WA 1LXEA 1O7MB 4CPKA 1Z1SA 1IV7A 1AV4A 2BMRB 2RGQA 2W04A 4FMCA 1A2VA 1JRQA 3LT8A 1KQS2 1RGLA 1BANA 1GY7A 3MPHA 3HIGA 1TU5A 2CG1A 2QGUA 3G4S3 4X2HA 5IG5A 4GB5A 4XM4A 2HMKB 4FMAA 7STDA 3G0KA 1WQLB 3LYGA 3RDEA 1JN5B 2OTL3 1BRGA 5BU4A 1I3FA 1UUVB 4LZIA 1BUJA 4LMIA 4HM4B 4OK0A 2F5MA 2CKFB 4NPBA 2INXA 3PCSA 1ULJB 2GU1A 2HMOB 3MKIA 2BNGA 1UCIA 1FGOA 2Z76A 3AGNA 1RDSA 4CCVA 4HOHA 1YJ93 1LQGC 3DZLA 2KRTA 3BNCA 1J2BA 2SARA 4DKIA 1UGHI 3D5IA 1CH0A 1LOYA 2E2VA 4MEIA 3ZFZA 2RCDA 2KF5A 1O7NB 4R4KA 4ZM8A 1O7HB 4K61A 3CCJ3 1GY5A 1UI7A 4AKYA 1CQSA 1YGWA 3HK4A 1BNEA 1KWIA 3FH1A 1K8A4 2IUJA 2YFIB 2CC3A 2W56B 3MG2A 3QK9A 5IEPA 4RNYA 3S27A 2Z7AA 3UL6A 3VF1A 1O7WB 1JZDA 5JPUA 4IPBA 3BNDA 1RN7A 1FYSA 1BVIA 1MWRA 1W02A 3F9SA 3NQYA 4HZBB 1D6UA 1FGTA 4R9LA 1TFKA 1VQ93 3CCU3 2H0HA 4HBRA 2K3DA 4OVMA 1VQO3 4X2OA 3GSPA 3X3YA 1RKYA 2FGTA 1DVCA 3H51A 3MYTA 1RNTA 1GSPA 1BNFA 1UUWB 3GZRA 1UCJA 2GEYA 1I2FA 4J8TA 3VSYA 2HMNB 4BIRA 6GSPA 1WNHA 1DVDA 1DMNA 3KFQC 1W01A 3UB1A 3AMOB 3GWRA 1W6CA 1FZUA 1Q7HA 1ROVA 1UI8A 1C54A 3LH4A 1I0VA 1PYLA 1HU9A 3BU4A 3U97A 3LTBA 3WOFB 2P05A 3H3HA 4BTXA 5IEOA 1B2UA 4H61A 1BRSA 1RRLA 3DMCA 2F4YA 1FA3A 1JBRA 3EJVA 3WHOA 3NM7A 1LOVA 1CYVA 1I2EA 3HIIA 1K9M4 3KZTA 1M1XB 2WOHA 4NREA 1ZS7A 3EE1A 4BTWA 3CXC2 2F56A 2KXGA 2UUGC 1YVBI 3HI7A 4J5GA 4WP5A 1JJ22 1IT7A 5IG4A 2WGOA 2SBLA 1FGRA 1I0XA 2RNTA 4WFOA 4BTYA 4CDLA 2XFTA 3D5GA 8RNTA 1Q7Y4 4ILFA 1W4NA 3IPTA 4RZMA 2GBWB 1YIT3 2KF6A 1VZZA 2RSXA 3FZWA 2M7OA 1U8CB 4O2HA 1MWSA 2AAEA 4HM1B 3G16A 1VQN3 2XH9A 4GL6A 2P09A 2UX0A 2HOHA 3CPOA 3B4PA 3DGOA 3E99A 1X1WA 2UGIA 4RBNA 2OTJ3 1HKXA 1N8QA 1ROAA 4L7KA 5AIGA 1IVVA 4BL2A 1NJI4 1CYUA 1G02A 5M19A 2XSOB 3FKAA 2PZVA 5JPPA 1BRNL 1GMPA 5IENA 1BSDA 1YIJ3 5KP3A 3EN1B 1Q864 1D6YA 1U5OA 2KF4A 2O9UX 3LTCA 3NBJA 3CMA3 3CNXA 4RNZA 3JUQA 2Z77A 3AGOA
chains in the Genus database with same CATH topology
1FGQA 3DY5A 5EQLA 1A67A 3NHXA 3T8UA 2GU3A 5LC7A 3EQQB 4XDVA 3VGNA 3FSDA 4G1MB 1IQ8A 1Q814 1C7HA 1CEWI 1Q40A 4ORLA 2OWPA 3X3ZA 3N9HA 3SX1A 1GD3A 3JUNA 1IQYA 1AVKA 3G6E3 3BNEA 3PZWA 1SJWA 3KSPA 4PEJA 1UW1A 1WMPA 3V92A 2CW9A 3X42A 1OHSA 1VQP3 4EV5A 2CFWA 3WODG 2OQEC 2K54A 3T0UA 1E3RA 3A76A 5A0OB 2WO0A 1VQ63 3OXAA 4MMZB 4TX4A 4XB5A 5FW5A 3S67A 1W5ZA 2W6JH 3QRDA 1N9JA 1GS3A 3LTAA 5D82A 1IV9A 4N6UA 2BO9B 2W9QA 3ER7A 4HJLB 5BXQA 3CCR3 2XEPA 5IF6A 4XBTA 1VQL3 3X40A 1GY6A 1QVG2 2Y73A 4STDA 1OACA 1QMAA 2WOFA 4EBGA 3F7SA 2MC8A 2CFGA 3OX9A 4HM8B 4HM7B 3CCQ3 2PNCA 4U13A 3DGMA 3ECFA 3F8HA 1M9GA 1MNLA 2QEX3 1EQKA 2C10A 2W56A 2XGLA 3LMLA 1AVLA 3MG3A 4MJDA 1KD14 2F86B 2P0XA 2CH9A 3PYJA 5AIFA 4XBXA 1RJOA 1MOLA 3LOYA 4KFDA 1F8NA 2ML6A 4I4KA 1E97A 4EV2A 2Q07A 3MG1A 2W0QA 1N9EA 1Y4KA 3JUPA 4FCZA 3S5CA 4N6OB 1K734 2CFLA 4HVNA 1PFPA 2CIUA 3IJEB 3SOYA 3DGLA 4N3VA 4L8OA 1DMMA 1STFI 2W03A 3EC9A 3GAXA 4JF8A 1LOXA 4J9AA 3CD63 3G713 3WA2X 3HX8A 4HKVB 3F40A 4AKZA 3PGBA 1QAFA 2HMJB 3N54B 1Q42A 3LZAA 1IT8A 1LVNA 3S28A 3SEDA 2MF7A 4KFEA 2C11A 5JBSA 3K63A 1N5HA 1VQ53 1E3VA 4WHAA 5IERA 3NX0A 5G2GA 2HMLB 4EYCA 3GZYB 2FXTA 3K9MC 4FMBA 3V99A 1FGMA 2XR8B 2IUKA 2YX9A 3NM2A 4R80A 1JB2A 3DM8A 3GZBA 1GD4A 1ZX2A 3K0ZA 3U1WA 1OHOA 2Y74A 4LSOA 3KKGA 5KP4A 4L8PA 5D81A 3O8YA 3STDA 3K5TA 3J7Yd 1M904 3EBTA 1W2ZA 5AYRB 1WMOA 3NV0B 1IDPA 3ALAA 3OV4A 1OGXA 5HGRA 4K1UA 3SXXA 1K41A 3GZXB 5CLKA 1OUNA 3MWZA 1G96A 3X3XA 1V74A 2OCTA 3T8NA 2CHCA 1VQM3 1VQ83 2F99A 2W2CA 2XFSA 4FMDA 4R9KA 3SOAA 1TP6A 2GBXB 4HM2B 5ELJA 1VQ73 1OPYA 3WMDA 2CWVA 4K90B 1NB3I 3SVAA 3M8CA 1N8R4 1M1K4 3NV0A 4FR9A 3DUKA 2D42A 2IMJA 3WOEB 1SPUA 3B8LA 4XDWA 3EBYA 1EG9B 5AIHA 1EKMA 5I97A 2B1XB 2O3OA 3D9RA 1S723 3G8ZA 3F7XA 1TIJA 3EN8A 4KFFA 1QAKA 2CK3H 3NUVA 1TUHA 2STDA 1A90A 2LQVA 2XSHB 4FCMA 4WYKB 4H3UA 4HYZA 2A15A 2XF3A 3CC43 2BT3A 2CFDA 4N6TA 5AEWB 4LGQA 3CPW2 1S5AA 3NQZA 1QVF2 1OGZA 1YI23 3K7CA 4LEHA 3F14A 1VQ43 3FG1A 1NU3A 1BUQA 3FG3A 2V1LA 3KSED 5CK6A 1W6YA 3LTDA 1W2B2 1QJGA 3EB8A 3OWYA 1OCVA 1STDA 3D3LA 1NB5I 3CCV3 2E2TA 3Q2PA 3UNLA 2QIYA 3B4OA 3FG4A 5TGNA 3X41A 3DXOA 5CF1A 3BLZA 3UL5A 3JUMA 3FLJA 1JN5A 1A2KA 4XBYA 5IG3A 3TDGA 1ASKA 3CC23 1T5YA 4HM5B 2KCDA 1L5GB 1KC84 3GRDA 3FCSB 2B24B 2CWTA 3FGYA 5DRVA 1JNQA 3CU3A 3KIIA 3NBRA 3NXJA 1KSIA 3UJMA 1Q824 2WGQA 1W6GA 4O02B 6STDA 3KE7A 4QWTA 2OOVA 3I0YA 2YFLB 4MMXB 8CHOA 5STDA 4IIAA 2QA43 3I563 1OF5A 2JDIH 2P0MA 3CCL3 1JV2B 5IW9A 1O7GB 3JVCA 3WDGB 5ELUA 3CC73 2P38A 3IMAB 3RGAA 3SLUA 3PCRA 2ML5A 1JKGA 1VQK3 1SQWA 2W9PA 2R4IA 3Q1CA 1WMNA 4K1VA 4N6LA 3LXUX 1YHQ3 2ZDJA 1IQXA 2BMOB 4NHFA 1W00A 1DYUA 2JQ5A 3N8BA 3MHEA 4EC6A 5AEUB 3NBBA 3BNBA 1Q40B 1YJW3 4WWUC 3LT9A 1W7CA 5CXOA 4JRFA 1NDOB 1ULIB 2Z6BA 3S29A 3B7CA 4OUQA 1O7PB 3DGNA 3HZPA 3ROBA 3RGRA 1NWWA 1YGEA 4IT7A 3EF8A 1DMQA 5AI1A 5EVHA 4N6MA 1D6ZA 1JB4A 1K28A 3V98A 1JB5A 3CCS3 2E2UA 1IVWA 4R1KA 5IG0A 3Q90A 4FCJA 5LC6A 2CFKA 2OOVC 1GYBA 1QALA 4O3VA 4EXRA 1TFOA 1IVXA 2BMQB 1WTHA 3F8XA 1SIHA 3EHCA 1EA2A 5AYSC 3OW22 1ISKA 5EEOA 3CCM3 1YJN3 3L0RA 1IK3A 3BB9A 3OWSA 3OWUA 2GXFA 1PU4A 3PXMA 2CWUA 2YFJB 4N6NB 1N5PA 5DREA 1SIIA 2XRXB 3I553 1LNHA 2BHMA 3PS8A 4WYKA 5BVBA 1IVUA 1NO3A 3CCE3 1OHPA 3KN4A 5CF2A 2GEXA 3EX9A 1IU7A 1US1A 5D83A 3MSOA 2K0MA 4Q53A 1OH0A 3CNMA 2L4VA 1RRHA 4KVHA 2D1WA 2XGNA 2ZL8A 1JKGB 3WA3A 2RFRA 3AMOA 2OQEA 3CME3 4AEQA 1ZO2A 2IA7A 3FF2A 1R4CA 1FUWA 3FF0A 2F98A 5FGOA 5KP1A 2LYXA 1OF5B 5AIIA 1AR0A 4HM6B 4HZ9B 2HMMB 3JUOA 2FNQA 4HM0B 2CG0A 4HM3B 4MMYB 4O8SA 2I9WA 1LXEA 1O7MB 1Z1SA 1IV7A 1AV4A 2BMRB 2RGQA 2W04A 4FMCA 1A2VA 1JRQA 3LT8A 1KQS2 1GY7A 3MPHA 3HIGA 1TU5A 2CG1A 2QGUA 3G4S3 4X2HA 5IG5A 4GB5A 4XM4A 2HMKB 4FMAA 7STDA 3G0KA 1WQLB 3LYGA 3RDEA 1JN5B 2OTL3 1UUVB 4LZIA 4LMIA 4HM4B 4OK0A 2CKFB 2INXA 3PCSA 1ULJB 2GU1A 2HMOB 3MKIA 2BNGA 2Z76A 1FGOA 4CCVA 1YJ93 3DZLA 1J2BA 2KRTA 3BNCA 2E2VA 4MEIA 2RCDA 1O7NB 4R4KA 4ZM8A 1O7HB 4K61A 3CCJ3 1GY5A 1UI7A 4AKYA 1CQSA 3HK4A 1KWIA 3FH1A 1K8A4 2IUJA 2YFIB 2CC3A 2W56B 3MG2A 3QK9A 5IEPA 4RNYA 3S27A 2Z7AA 3UL6A 3VF1A 1O7WB 5JPUA 4IPBA 3BNDA 1RN7A 1W02A 3NQYA 3F9SA 4HZBB 1D6UA 1FGTA 4R9LA 1TFKA 1VQ93 3CCU3 4HBRA 4OVMA 1VQO3 4X2OA 3X3YA 1RKYA 2FGTA 1DVCA 3H51A 3MYTA 1UUWB 3GZRA 2GEYA 4J8TA 3VSYA 2HMNB 1WNHA 1DVDA 1DMNA 3KFQC 1W01A 3UB1A 3AMOB 3GWRA 1W6CA 1ROVA 1UI8A 3LH4A 1HU9A 3U97A 3LTBA 3WOFB 2P05A 3H3HA 4BTXA 5IEOA 4H61A 1RRLA 3DMCA 1FA3A 3EJVA 3NM7A 1CYVA 1K9M4 3HIIA 3KZTA 1M1XB 2WOHA 4NREA 3EE1A 4BTWA 3CXC2 2KXGA 4WP5A 1YVBI 3HI7A 1JJ22 1IT7A 5IG4A 2WGOA 2SBLA 1FGRA 4WFOA 4BTYA 4CDLA 2XFTA 1Q7Y4 1W4NA 3IPTA 4RZMA 2GBWB 1YIT3 1VZZA 2RSXA 3FZWA 2M7OA 1U8CB 4O2HA 4HM1B 3G16A 1VQN3 2XH9A 4GL6A 2P09A 2UX0A 3CPOA 3E99A 3B4PA 3DGOA 4N6V0 4RBNA 2OTJ3 1HKXA 1N8QA 1ROAA 4L7KA 5AIGA 1IVVA 1NJI4 1CYUA 2XSOB 3FKAA 2PZVA 5JPPA 5IENA 1YIJ3 5KP3A 3EN1B 1Q864 1D6YA 1U5OA 2O9UX 3LTCA 3NBJA 3CMA3 3CNXA 4RNZA 3JUQA 2Z77A 4KZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMC A;  3EE1 A;  3EB8 A;  3Q1C A;  4FMD A;  4FMA A;  3PCS A;  3PCR A;  4FMB A; 
#chains in the Genus database with same CATH topology
 1FGQ A;  1YNV X;  1ZGX A;  3DY5 A;  3AHW A;  5EQL A;  1A67 A;  1BNG A;  1MWT A;  3NHX A;  3T8U A;  2GU3 A;  5LC7 A;  3EQQ B;  4XDV A;  3VGN A;  1B3S A;  3FSD A;  4G1M B;  1IQ8 A;  1BNI A;  5M18 A;  1Q81 4;  1C7H A;  1CEW I;  1Q40 A;  4ORL A;  2OWP A;  3X3Z A;  3N9H A;  3SX1 A;  1GD3 A;  3JUN A;  2ZA4 A;  1IQY A;  1I3I A;  1AVK A;  3G6E 3;  3BNE A;  3PZW A;  1SJW A;  3KSP A;  4PEJ A;  1UW1 A;  1WMP A;  3V92 A;  2CW9 A;  3X42 A;  1OHS A;  1VQP 3;  4EV5 A;  2CFW A;  3WOD G;  2OQE C;  4KT3 B;  2K54 A;  3T0U A;  1E3R A;  3A76 A;  5A0O B;  2WO0 A;  5RNT A;  1JBS A;  1VQ6 3;  3OXA A;  1X1Y A;  4MMZ B;  4TX4 A;  2R41 A;  1BNJ A;  2GSP A;  1W5Z A;  4XB5 A;  5FW5 A;  1BSA A;  3S67 A;  1JBT A;  2W6J H;  3OW2 2;  1PY3 A;  3QRD A;  1N9J A;  1TJD A;  1GS3 A;  4RNT A;  3DH2 A;  3LTA A;  5D82 A;  1IV9 A;  4N6U A;  2BO9 B;  2W9Q A;  3ER7 A;  4HJL B;  5BXQ A;  3CCR 3;  2XEP A;  5IF6 A;  4XBT A;  1VQL 3;  3X40 A;  1GY6 A;  1QVG 2;  2Y73 A;  4STD A;  1OAC A;  1QMA A;  2WOF A;  1LQM B;  4EBG A;  3F7S A;  2MC8 A;  1FUS A;  2AAD A;  2CFG A;  3OX9 A;  4HM8 B;  4HM7 B;  3CCQ 3;  2PNC A;  2KF3 A;  4U13 A;  3DGM A;  3ECF A;  3F8H A;  3KCH A;  1M9G A;  1MNL A;  2QEX 3;  1EQK A;  2C10 A;  2W56 A;  2XGL A;  3LML A;  1AVL A;  3MG3 A;  4MJD A;  1LOW A;  1KD1 4;  2F86 B;  2P0X A;  2CH9 A;  3PYJ A;  5AIF A;  4XBX A;  1RJO A;  1MOL A;  3LOY A;  4KFD A;  1F8N A;  2ML6 A;  4I4K A;  1E97 A;  1SAR A;  4EV2 A;  2CX0 A;  2Q07 A;  3MG1 A;  2W0Q A;  1RGH A;  1N9E A;  1Y4K A;  3JUP A;  4FCZ A;  3S5C A;  4N6O B;  1B2S A;  4GHO A;  1K73 4;  2CFL A;  4HVN A;  1PFP A;  2CIU A;  3ZG0 A;  3IJE B;  3SOY A;  3DGL A;  4N3V A;  4L8O A;  1DMM A;  1STF I;  1BRJ A;  2W03 A;  3EC9 A;  3GAX A;  1LOX A;  4J9A A;  4JF8 A;  3G71 3;  3CD6 3;  3WA2 X;  3HX8 A;  1UUG B;  4HKV B;  3F40 A;  4AKZ A;  3PGB A;  1QAF A;  2HMJ B;  3N54 B;  1Q42 A;  3LZA A;  1IT8 A;  1LVN A;  3S28 A;  3SED A;  2MF7 A;  4KFE A;  2C11 A;  5JBS A;  1G0T A;  3K63 A;  1N5H A;  1VQ5 3;  4CJN A;  1E3V A;  4WHA A;  5IER A;  3NX0 A;  5G2G A;  1BGS A;  2HML B;  4KZ1 A;  1T2I A;  4EYC A;  3GZY B;  2FXT A;  1B2X A;  3K9M C;  4FMB A;  3V99 A;  1FGM A;  1B20 A;  2XR8 B;  2IUK A;  2YX9 A;  3NM2 A;  4R80 A;  1JB2 A;  1DET A;  4N6V 0;  3DM8 A;  3GZB A;  1GD4 A;  1ZX2 A;  3K0Z A;  1BRK A;  2CX1 A;  1UGI A;  3U1W A;  1OHO A;  2Y74 A;  4LSO A;  3KKG A;  5KP4 A;  4L8P A;  5D81 A;  3O8Y A;  3STD A;  3K5T A;  3J7Y d;  1M90 4;  3EBT A;  1I2G A;  1W2Z A;  5AYR B;  1WMO A;  1RCL A;  3NV0 B;  1IDP A;  3ALA A;  3OV4 A;  1OGX A;  2IYJ A;  5HGR A;  4K1U A;  3SXX A;  1K41 A;  1RNB A;  3GZX B;  3BIR A;  5CLK A;  7RNT A;  1IYY A;  1OUN A;  3MWZ A;  1G96 A;  3X3X A;  1V74 A;  2OCT A;  3T8N A;  2CHC A;  5GSP A;  1VQM 3;  2F99 A;  2W2C A;  2XFS A;  4FMD A;  4R9K A;  3SOA A;  1TP6 A;  1VQ8 3;  2GBX B;  4HM2 B;  3A5E A;  5ELJ A;  1VQ7 3;  1OPY A;  1B21 A;  5BIR A;  3WMD A;  2CWV A;  5G1L A;  4K90 B;  1NB3 I;  3SVA A;  1T2H A;  3M8C A;  1N8R 4;  1M1K 4;  1BSC A;  3NV0 A;  4FR9 A;  3DUK A;  2D42 A;  2H0G A;  2IMJ A;  3WOE B;  1EEJ A;  1SPU A;  1RN1 A;  3B8L A;  3SYU A;  1RCK A;  4XDW A;  3EBY A;  1EG9 B;  5AIH A;  1EKM A;  5I97 A;  2B1X B;  2IY2 A;  2O3O A;  3D9R A;  1S72 3;  3G8Z A;  3F7X A;  1TIJ A;  3EN8 A;  4KFF A;  1QAK A;  1RGE A;  2CK3 H;  3NUV A;  1BIR A;  5M1A A;  1TUH A;  2STD A;  1A90 A;  2LQV A;  2BU4 A;  2XSH B;  4FCM A;  4WYK B;  9RNT A;  4H3U A;  4HYZ A;  2A15 A;  1TRQ A;  2XF3 A;  3WR2 A;  3CC4 3;  2BT3 A;  2CFD A;  4N6T A;  5AEW B;  4LGQ A;  3CPW 2;  1S5A A;  1RHL A;  2L1S A;  3NQZ A;  1QVF 2;  1OGZ A;  1YI2 3;  3K7C A;  4LEH A;  3F14 A;  4BL3 A;  1FW7 A;  1VQ4 3;  3FG1 A;  1NU3 A;  1BUQ A;  3FG3 A;  2V1L A;  3KSE D;  5CK6 A;  5HOH A;  1W6Y A;  3LTD A;  1W2B 2;  1QJG A;  3EB8 A;  3OWY A;  1OCV A;  1V57 A;  1STD A;  3D3L A;  3RNT A;  1AY7 A;  1T3B A;  1NB5 I;  3D4A A;  4J5K A;  4HAA A;  3URP A;  3CCV 3;  2E2T A;  1MWU A;  3Q2P A;  3UNL A;  1BRI A;  2QIY A;  3B4O A;  3FG4 A;  5TGN A;  3X41 A;  3DXO A;  5CF1 A;  3BLZ A;  3UL5 A;  3D79 A;  3JUM A;  3FLJ A;  1JN5 A;  1A2K A;  4XBY A;  5IG3 A;  3TDG A;  1ASK A;  3CC2 3;  1T5Y A;  4HM5 B;  2KCD A;  1L5G B;  1BSB A;  6RNT A;  1R4Y A;  3GRD A;  1KC8 4;  2RBI A;  2F5W A;  3FCS B;  4GSP A;  2B24 B;  2CWT A;  4BU4 A;  2H0I A;  3FGY A;  5DRV A;  1BNS A;  1JNQ A;  3CU3 A;  3KII A;  3NBR A;  3NXJ A;  1HZ1 A;  1KSI A;  3UJM A;  1BU4 A;  1AQZ A;  1Q82 4;  2WGQ A;  1W6G A;  4O02 B;  6STD A;  3KE7 A;  4QWT A;  2OOV A;  3I0Y A;  2YFL B;  4MMX B;  8CHO A;  5STD A;  4IIA A;  2QA4 3;  3I56 3;  1OF5 A;  2JDI H;  1RGF A;  2P0M A;  3CCL 3;  1JV2 B;  2C4B A;  5IW9 A;  1O7G B;  3JVC A;  3WDG B;  1Q9E A;  5ELU A;  1X1X A;  1RN4 A;  2P38 A;  3CC7 3;  3IMA B;  3RGA A;  3SLU A;  3PCR A;  4I5Q A;  2ML5 A;  1JKG A;  1VQK 3;  1SQW A;  2W9P A;  2R4I A;  3Q1C A;  1WMN A;  2BIR A;  4K1V A;  4N6L A;  1RGA A;  3LXU X;  1YHQ 3;  2ZDJ A;  1IQX A;  1JZO A;  1BSE A;  1W00 A;  2BMO B;  4NHF A;  1DYU A;  2JQ5 A;  1RGK A;  1EUI C;  3MHE A;  3N8B A;  4EC6 A;  1LRA A;  1DE3 A;  5AEU B;  3NBB A;  1BAO A;  3BNB A;  1Q40 B;  1YJW 3;  1NNV A;  1RGG A;  4WWU C;  3LT9 A;  1GMQ A;  1W7C A;  5CXO A;  4JRF A;  1NDO B;  1ULI B;  1HYF A;  1MGW A;  2Z6B A;  3B7C A;  4OUQ A;  3S29 A;  1LNI A;  1B27 A;  1O7P B;  3DGN A;  3HZP A;  3ROB A;  2ZHX B;  3RGR A;  1NWW A;  1GMR A;  1X1U A;  1YGE A;  3EF8 A;  4IT7 A;  1DMQ A;  2J8X B;  5AI1 A;  5EVH A;  4N6M A;  1D6Z A;  1JB4 A;  1UCL A;  1A2P A;  1K28 A;  3V98 A;  1BOX A;  1JB5 A;  1TRP A;  3CCS 3;  2E2U A;  4EW5 A;  1IVW A;  4R1K A;  5IG0 A;  1BRH A;  3Q90 A;  1VQQ A;  4FCJ A;  5LC6 A;  1YVS A;  2CFK A;  2OOV C;  1GYB A;  1BNR A;  1QAL A;  1FUT A;  4O3V A;  1RSN A;  4EXR A;  1TFO A;  1IVX A;  2BMQ B;  1WTH A;  3DGY A;  1MGR A;  1SIH A;  1EA2 A;  3EHC A;  3F8X A;  5AYS C;  1B2M A;  1ISK A;  1RMS A;  5EEO A;  3CCM 3;  1YJN 3;  3L0R A;  1IK3 A;  3BB9 A;  3OWS A;  3OWU A;  2GXF A;  5G1K A;  1PU4 A;  3PXM A;  2CWU A;  2YFJ B;  1I8V A;  1N5P A;  4N6N B;  5DRE A;  1SII A;  2XRX B;  3Q3F A;  3I55 3;  1LNH A;  2BHM A;  3PS8 A;  1UDI I;  4WYK A;  5BVB A;  1IVU A;  1V58 A;  1NO3 A;  3CCE 3;  1OHP A;  3KN4 A;  5CF2 A;  2GEX A;  3EX9 A;  1IU7 A;  1US1 A;  3AHS A;  1RTU A;  5D83 A;  3MSO A;  2K0M A;  4Q53 A;  1OH0 A;  3CNM A;  2L4V A;  1RRH A;  4KVH A;  1GOU A;  1RGC A;  1RLS A;  2D1W A;  2XGN A;  1GOV A;  1JKG B;  2ZL8 A;  2RFR A;  3AMO A;  3HOH A;  2OQE A;  3WA3 A;  4AEQ A;  1ZO2 A;  2IA7 A;  3FF2 A;  3CME 3;  1I70 A;  1R4C A;  1FUW A;  3FF0 A;  2F98 A;  1TTO A;  5FGO A;  7GSP A;  5KP1 A;  2LYX A;  1OF5 B;  5AII A;  1AR0 A;  1UCK A;  4HM6 B;  4HZ9 B;  2HMM B;  3ZG5 A;  3JUO A;  4LYL B;  1GOY A;  2FNQ A;  4HM0 B;  2CG0 A;  1B2Z A;  2KAA A;  4HM3 B;  4MMY B;  4O8S A;  2I9W A;  1LXE A;  1O7M B;  4CPK A;  1Z1S A;  1IV7 A;  1AV4 A;  2BMR B;  2RGQ A;  2W04 A;  4FMC A;  1A2V A;  1JRQ A;  3LT8 A;  1KQS 2;  1RGL A;  1BAN A;  1GY7 A;  3MPH A;  3HIG A;  1TU5 A;  2CG1 A;  2QGU A;  3G4S 3;  4X2H A;  5IG5 A;  4GB5 A;  4XM4 A;  2HMK B;  4FMA A;  7STD A;  3G0K A;  1WQL B;  3LYG A;  3RDE A;  1JN5 B;  2OTL 3;  1BRG A;  5BU4 A;  1I3F A;  1UUV B;  4LZI A;  1BUJ A;  4LMI A;  4HM4 B;  4OK0 A;  2F5M A;  2CKF B;  4NPB A;  2INX A;  3PCS A;  1ULJ B;  2GU1 A;  2HMO B;  3MKI A;  2BNG A;  1UCI A;  1FGO A;  2Z76 A;  3AGN A;  1RDS A;  4CCV A;  4HOH A;  1YJ9 3;  1LQG C;  3DZL A;  2KRT A;  3BNC A;  1J2B A;  2SAR A;  4DKI A;  1UGH I;  3D5I A;  1CH0 A;  1LOY A;  2E2V A;  4MEI A;  3ZFZ A;  2RCD A;  2KF5 A;  1O7N B;  4R4K A;  4ZM8 A;  1O7H B;  4K61 A;  3CCJ 3;  1GY5 A;  1UI7 A;  4AKY A;  1CQS A;  1YGW A;  3HK4 A;  1BNE A;  1KWI A;  3FH1 A;  1K8A 4;  2IUJ A;  2YFI B;  2CC3 A;  2W56 B;  3MG2 A;  3QK9 A;  5IEP A;  4RNY A;  3S27 A;  2Z7A A;  3UL6 A;  3VF1 A;  1O7W B;  1JZD A;  5JPU A;  4IPB A;  3BND A;  1RN7 A;  1FYS A;  1BVI A;  1MWR A;  1W02 A;  3F9S A;  3NQY A;  4HZB B;  1D6U A;  1FGT A;  4R9L A;  1TFK A;  1VQ9 3;  3CCU 3;  2H0H A;  4HBR A;  2K3D A;  4OVM A;  1VQO 3;  4X2O A;  3GSP A;  3X3Y A;  1RKY A;  2FGT A;  1DVC A;  3H51 A;  3MYT A;  1RNT A;  1GSP A;  1BNF A;  1UUW B;  3GZR A;  1UCJ A;  2GEY A;  1I2F A;  4J8T A;  3VSY A;  2HMN B;  4BIR A;  6GSP A;  1WNH A;  1DVD A;  1DMN A;  3KFQ C;  1W01 A;  3UB1 A;  3AMO B;  3GWR A;  1W6C A;  1FZU A;  1Q7H A;  1ROV A;  1UI8 A;  1C54 A;  3LH4 A;  1I0V A;  1PYL A;  1HU9 A;  3BU4 A;  3U97 A;  3LTB A;  3WOF B;  2P05 A;  3H3H A;  4BTX A;  5IEO A;  1B2U A;  4H61 A;  1BRS A;  1RRL A;  3DMC A;  2F4Y A;  1FA3 A;  1JBR A;  3EJV A;  3WHO A;  3NM7 A;  1LOV A;  1CYV A;  1I2E A;  3HII A;  1K9M 4;  3KZT A;  1M1X B;  2WOH A;  4NRE A;  1ZS7 A;  3EE1 A;  4BTW A;  3CXC 2;  2F56 A;  2KXG A;  2UUG C;  1YVB I;  3HI7 A;  4J5G A;  4WP5 A;  1JJ2 2;  1IT7 A;  5IG4 A;  2WGO A;  2SBL A;  1FGR A;  1I0X A;  2RNT A;  4WFO A;  4BTY A;  4CDL A;  2XFT A;  3D5G A;  8RNT A;  1Q7Y 4;  4ILF A;  1W4N A;  3IPT A;  4RZM A;  2GBW B;  1YIT 3;  2KF6 A;  1VZZ A;  2RSX A;  3FZW A;  2M7O A;  1U8C B;  4O2H A;  1MWS A;  2AAE A;  4HM1 B;  3G16 A;  1VQN 3;  2XH9 A;  4GL6 A;  2P09 A;  2UX0 A;  2HOH A;  3CPO A;  3B4P A;  3DGO A;  3E99 A;  1X1W A;  2UGI A;  4RBN A;  2OTJ 3;  1HKX A;  1N8Q A;  1ROA A;  4L7K A;  5AIG A;  1IVV A;  4BL2 A;  1NJI 4;  1CYU A;  1G02 A;  5M19 A;  2XSO B;  3FKA A;  2PZV A;  5JPP A;  1BRN L;  1GMP A;  5IEN A;  1BSD A;  1YIJ 3;  5KP3 A;  3EN1 B;  1Q86 4;  1D6Y A;  1U5O A;  2KF4 A;  2O9U X;  3LTC A;  3NBJ A;  3CMA 3;  3CNX A;  4RNZ A;  3JUQ A;  2Z77 A;  3AGO A; 
#chains in the Genus database with same CATH homology
 1FGQ A;  3DY5 A;  5EQL A;  1A67 A;  3NHX A;  3T8U A;  2GU3 A;  5LC7 A;  3EQQ B;  4XDV A;  3VGN A;  3FSD A;  4G1M B;  1IQ8 A;  1Q81 4;  1C7H A;  1CEW I;  1Q40 A;  4ORL A;  2OWP A;  3X3Z A;  3N9H A;  3SX1 A;  1GD3 A;  3JUN A;  1IQY A;  1AVK A;  3G6E 3;  3BNE A;  3PZW A;  1SJW A;  3KSP A;  4PEJ A;  1UW1 A;  1WMP A;  3V92 A;  2CW9 A;  3X42 A;  1OHS A;  1VQP 3;  4EV5 A;  2CFW A;  3WOD G;  2OQE C;  2K54 A;  3T0U A;  1E3R A;  3A76 A;  5A0O B;  2WO0 A;  1VQ6 3;  3OXA A;  4MMZ B;  4TX4 A;  4XB5 A;  5FW5 A;  3S67 A;  1W5Z A;  2W6J H;  3QRD A;  1N9J A;  1GS3 A;  3LTA A;  5D82 A;  1IV9 A;  4N6U A;  2BO9 B;  2W9Q A;  3ER7 A;  4HJL B;  5BXQ A;  3CCR 3;  2XEP A;  5IF6 A;  4XBT A;  1VQL 3;  3X40 A;  1GY6 A;  1QVG 2;  2Y73 A;  4STD A;  1OAC A;  1QMA A;  2WOF A;  4EBG A;  3F7S A;  2MC8 A;  2CFG A;  3OX9 A;  4HM8 B;  4HM7 B;  3CCQ 3;  2PNC A;  4U13 A;  3DGM A;  3ECF A;  3F8H A;  1M9G A;  1MNL A;  2QEX 3;  1EQK A;  2C10 A;  2W56 A;  2XGL A;  3LML A;  1AVL A;  3MG3 A;  4MJD A;  1KD1 4;  2F86 B;  2P0X A;  2CH9 A;  3PYJ A;  5AIF A;  4XBX A;  1RJO A;  1MOL A;  3LOY A;  4KFD A;  1F8N A;  2ML6 A;  4I4K A;  1E97 A;  4EV2 A;  2Q07 A;  3MG1 A;  2W0Q A;  1N9E A;  1Y4K A;  3JUP A;  4FCZ A;  3S5C A;  4N6O B;  1K73 4;  2CFL A;  4HVN A;  1PFP A;  2CIU A;  3IJE B;  3SOY A;  3DGL A;  4N3V A;  4L8O A;  1DMM A;  1STF I;  2W03 A;  3EC9 A;  3GAX A;  4JF8 A;  1LOX A;  4J9A A;  3CD6 3;  3G71 3;  3WA2 X;  3HX8 A;  4HKV B;  3F40 A;  4AKZ A;  3PGB A;  1QAF A;  2HMJ B;  3N54 B;  1Q42 A;  3LZA A;  1IT8 A;  1LVN A;  3S28 A;  3SED A;  2MF7 A;  4KFE A;  2C11 A;  5JBS A;  3K63 A;  1N5H A;  1VQ5 3;  1E3V A;  4WHA A;  5IER A;  3NX0 A;  5G2G A;  2HML B;  4EYC A;  3GZY B;  2FXT A;  3K9M C;  4FMB A;  3V99 A;  1FGM A;  2XR8 B;  2IUK A;  2YX9 A;  3NM2 A;  4R80 A;  1JB2 A;  3DM8 A;  3GZB A;  1GD4 A;  1ZX2 A;  3K0Z A;  3U1W A;  1OHO A;  2Y74 A;  4LSO A;  3KKG A;  5KP4 A;  4L8P A;  5D81 A;  3O8Y A;  3STD A;  3K5T A;  3J7Y d;  1M90 4;  3EBT A;  1W2Z A;  5AYR B;  1WMO A;  3NV0 B;  1IDP A;  3ALA A;  3OV4 A;  1OGX A;  5HGR A;  4K1U A;  3SXX A;  1K41 A;  3GZX B;  5CLK A;  1OUN A;  3MWZ A;  1G96 A;  3X3X A;  1V74 A;  2OCT A;  3T8N A;  2CHC A;  1VQM 3;  1VQ8 3;  2F99 A;  2W2C A;  2XFS A;  4FMD A;  4R9K A;  3SOA A;  1TP6 A;  2GBX B;  4HM2 B;  5ELJ A;  1VQ7 3;  1OPY A;  3WMD A;  2CWV A;  4K90 B;  1NB3 I;  3SVA A;  3M8C A;  1N8R 4;  1M1K 4;  3NV0 A;  4FR9 A;  3DUK A;  2D42 A;  2IMJ A;  3WOE B;  1SPU A;  3B8L A;  4XDW A;  3EBY A;  1EG9 B;  5AIH A;  1EKM A;  5I97 A;  2B1X B;  2O3O A;  3D9R A;  1S72 3;  3G8Z A;  3F7X A;  1TIJ A;  3EN8 A;  4KFF A;  1QAK A;  2CK3 H;  3NUV A;  1TUH A;  2STD A;  1A90 A;  2LQV A;  2XSH B;  4FCM A;  4WYK B;  4H3U A;  4HYZ A;  2A15 A;  2XF3 A;  3CC4 3;  2BT3 A;  2CFD A;  4N6T A;  5AEW B;  4LGQ A;  3CPW 2;  1S5A A;  3NQZ A;  1QVF 2;  1OGZ A;  1YI2 3;  3K7C A;  4LEH A;  3F14 A;  1VQ4 3;  3FG1 A;  1NU3 A;  1BUQ A;  3FG3 A;  2V1L A;  3KSE D;  5CK6 A;  1W6Y A;  3LTD A;  1W2B 2;  1QJG A;  3EB8 A;  3OWY A;  1OCV A;  1STD A;  3D3L A;  1NB5 I;  3CCV 3;  2E2T A;  3Q2P A;  3UNL A;  2QIY A;  3B4O A;  3FG4 A;  5TGN A;  3X41 A;  3DXO A;  5CF1 A;  3BLZ A;  3UL5 A;  3JUM A;  3FLJ A;  1JN5 A;  1A2K A;  4XBY A;  5IG3 A;  3TDG A;  1ASK A;  3CC2 3;  1T5Y A;  4HM5 B;  2KCD A;  1L5G B;  1KC8 4;  3GRD A;  3FCS B;  2B24 B;  2CWT A;  3FGY A;  5DRV A;  1JNQ A;  3CU3 A;  3KII A;  3NBR A;  3NXJ A;  1KSI A;  3UJM A;  1Q82 4;  2WGQ A;  1W6G A;  4O02 B;  6STD A;  3KE7 A;  4QWT A;  2OOV A;  3I0Y A;  2YFL B;  4MMX B;  8CHO A;  5STD A;  4IIA A;  2QA4 3;  3I56 3;  1OF5 A;  2JDI H;  2P0M A;  3CCL 3;  1JV2 B;  5IW9 A;  1O7G B;  3JVC A;  3WDG B;  5ELU A;  3CC7 3;  2P38 A;  3IMA B;  3RGA A;  3SLU A;  3PCR A;  2ML5 A;  1JKG A;  1VQK 3;  1SQW A;  2W9P A;  2R4I A;  3Q1C A;  1WMN A;  4K1V A;  4N6L A;  3LXU X;  1YHQ 3;  2ZDJ A;  1IQX A;  2BMO B;  4NHF A;  1W00 A;  1DYU A;  2JQ5 A;  3N8B A;  3MHE A;  4EC6 A;  5AEU B;  3NBB A;  3BNB A;  1Q40 B;  1YJW 3;  4WWU C;  3LT9 A;  1W7C A;  5CXO A;  4JRF A;  1NDO B;  1ULI B;  2Z6B A;  3S29 A;  3B7C A;  4OUQ A;  1O7P B;  3DGN A;  3HZP A;  3ROB A;  3RGR A;  1NWW A;  1YGE A;  4IT7 A;  3EF8 A;  1DMQ A;  5AI1 A;  5EVH A;  4N6M A;  1D6Z A;  1JB4 A;  1K28 A;  3V98 A;  1JB5 A;  3CCS 3;  2E2U A;  1IVW A;  4R1K A;  5IG0 A;  3Q90 A;  4FCJ A;  5LC6 A;  2CFK A;  2OOV C;  1GYB A;  1QAL A;  4O3V A;  4EXR A;  1TFO A;  1IVX A;  2BMQ B;  1WTH A;  3F8X A;  1SIH A;  3EHC A;  1EA2 A;  5AYS C;  3OW2 2;  1ISK A;  5EEO A;  3CCM 3;  1YJN 3;  3L0R A;  1IK3 A;  3BB9 A;  3OWS A;  3OWU A;  2GXF A;  1PU4 A;  3PXM A;  2CWU A;  2YFJ B;  4N6N B;  1N5P A;  5DRE A;  1SII A;  2XRX B;  3I55 3;  1LNH A;  2BHM A;  3PS8 A;  4WYK A;  5BVB A;  1IVU A;  1NO3 A;  3CCE 3;  1OHP A;  3KN4 A;  5CF2 A;  2GEX A;  3EX9 A;  1IU7 A;  1US1 A;  5D83 A;  3MSO A;  2K0M A;  4Q53 A;  1OH0 A;  3CNM A;  2L4V A;  1RRH A;  4KVH A;  2D1W A;  2XGN A;  2ZL8 A;  1JKG B;  3WA3 A;  2RFR A;  3AMO A;  2OQE A;  3CME 3;  4AEQ A;  1ZO2 A;  2IA7 A;  3FF2 A;  1R4C A;  1FUW A;  3FF0 A;  2F98 A;  5FGO A;  5KP1 A;  2LYX A;  1OF5 B;  5AII A;  1AR0 A;  4HM6 B;  4HZ9 B;  2HMM B;  3JUO A;  2FNQ A;  4HM0 B;  2CG0 A;  4HM3 B;  4MMY B;  4O8S A;  2I9W A;  1LXE A;  1O7M B;  1Z1S A;  1IV7 A;  1AV4 A;  2BMR B;  2RGQ A;  2W04 A;  4FMC A;  1A2V A;  1JRQ A;  3LT8 A;  1KQS 2;  1GY7 A;  3MPH A;  3HIG A;  1TU5 A;  2CG1 A;  2QGU A;  3G4S 3;  4X2H A;  5IG5 A;  4GB5 A;  4XM4 A;  2HMK B;  4FMA A;  7STD A;  3G0K A;  1WQL B;  3LYG A;  3RDE A;  1JN5 B;  2OTL 3;  1UUV B;  4LZI A;  4LMI A;  4HM4 B;  4OK0 A;  2CKF B;  2INX A;  3PCS A;  1ULJ B;  2GU1 A;  2HMO B;  3MKI A;  2BNG A;  2Z76 A;  1FGO A;  4CCV A;  1YJ9 3;  3DZL A;  1J2B A;  2KRT A;  3BNC A;  2E2V A;  4MEI A;  2RCD A;  1O7N B;  4R4K A;  4ZM8 A;  1O7H B;  4K61 A;  3CCJ 3;  1GY5 A;  1UI7 A;  4AKY A;  1CQS A;  3HK4 A;  1KWI A;  3FH1 A;  1K8A 4;  2IUJ A;  2YFI B;  2CC3 A;  2W56 B;  3MG2 A;  3QK9 A;  5IEP A;  4RNY A;  3S27 A;  2Z7A A;  3UL6 A;  3VF1 A;  1O7W B;  5JPU A;  4IPB A;  3BND A;  1RN7 A;  1W02 A;  3NQY A;  3F9S A;  4HZB B;  1D6U A;  1FGT A;  4R9L A;  1TFK A;  1VQ9 3;  3CCU 3;  4HBR A;  4OVM A;  1VQO 3;  4X2O A;  3X3Y A;  1RKY A;  2FGT A;  1DVC A;  3H51 A;  3MYT A;  1UUW B;  3GZR A;  2GEY A;  4J8T A;  3VSY A;  2HMN B;  1WNH A;  1DVD A;  1DMN A;  3KFQ C;  1W01 A;  3UB1 A;  3AMO B;  3GWR A;  1W6C A;  1ROV A;  1UI8 A;  3LH4 A;  1HU9 A;  3U97 A;  3LTB A;  3WOF B;  2P05 A;  3H3H A;  4BTX A;  5IEO A;  4H61 A;  1RRL A;  3DMC A;  1FA3 A;  3EJV A;  3NM7 A;  1CYV A;  1K9M 4;  3HII A;  3KZT A;  1M1X B;  2WOH A;  4NRE A;  3EE1 A;  4BTW A;  3CXC 2;  2KXG A;  4WP5 A;  1YVB I;  3HI7 A;  1JJ2 2;  1IT7 A;  5IG4 A;  2WGO A;  2SBL A;  1FGR A;  4WFO A;  4BTY A;  4CDL A;  2XFT A;  1Q7Y 4;  1W4N A;  3IPT A;  4RZM A;  2GBW B;  1YIT 3;  1VZZ A;  2RSX A;  3FZW A;  2M7O A;  1U8C B;  4O2H A;  4HM1 B;  3G16 A;  1VQN 3;  2XH9 A;  4GL6 A;  2P09 A;  2UX0 A;  3CPO A;  3E99 A;  3B4P A;  3DGO A;  4N6V 0;  4RBN A;  2OTJ 3;  1HKX A;  1N8Q A;  1ROA A;  4L7K A;  5AIG A;  1IVV A;  1NJI 4;  1CYU A;  2XSO B;  3FKA A;  2PZV A;  5JPP A;  5IEN A;  1YIJ 3;  5KP3 A;  3EN1 B;  1Q86 4;  1D6Y A;  1U5O A;  2O9U X;  3LTC A;  3NBJ A;  3CMA 3;  3CNX A;  4RNZ A;  3JUQ A;  2Z77 A;  4KZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...