3EB8A

Vira
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
334
Chain Sequence
AEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cysteine protease-like virA
publication title Structural and functional studies indicate that Shigella VirA is not a protease and does not directly destabilize microtubules.
pubmed doi rcsb
source organism Shigella flexneri
total genus 99
structure length 334
sequence length 347
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3eb8A01
3EB8A 4FMCA 3Q1CA 3PCRA 4FMAA 4FMBA 4FMDA 3PCSA 3EE1A
chains in the Genus database with same CATH superfamily
3MKIA 4XB5A 4H3UA 1W00A 3LYGA 2P05A 3S28A 1BSBA 1RSNA 2B24B 2IUJA 3NUVA 2CFLA 4HM8B 4JF8A 1BVIA 5TGNA 1ZX2A 4N6TA 2QEX3 3D5IA 1LQGC 2RSXA 3PCRA 4CCVA 1FGOA 4XBTA 2K3DA 4O8SA 1B3SA 2L4VA 1Y4KA 2CX1A 3LTAA 3MG3A 1F8NA 1IVUA 6GSPA 2H0GA 4FMAA 1DMQA 1VQ73 1RNBA 2KCDA 3EN8A 3A76A 1WTHA 2IMJA 4RZMA 1T2HA 3S29A 5KP4A 3JUQA 1GYBA 2HMNB 1O7MB 2INXA 2J8XB 2GBWB 4GSPA 2UUGC 3G8ZA 1LVNA 3VGNA 2ZL8A 3A5EA 1O7NB 3MSOA 1RLSA 1GD4A 1ASKA 1LXEA 2CG0A 2BMQB 1BOXA 1I70A 1WMPA 3CCL3 3CC43 1N8QA 1LNIA 1IDPA 2AADA 3FZWA 1HKXA 2XGLA 3TDGA 4HBRA 4K1VA 5AEUB 1PFPA 4XBYA 2KXGA 2RFRA 2F99A 3QRDA 2ZHXB 1R4YA 2CG1A 3RDEA 3EHCA 1YNVX 3OWSA 3DMCA 3MG1A 3WA2X 3MHEA 4BL3A 2BU4A 1VQN3 4FCMA 4ILFA 2W2CA 2BT3A 2WOHA 5AIIA 3PS8A 1CEWI 1M9GA 2C4BA 4ORLA 4XDVA 3X40A 3FF2A 5IG5A 1K734 3BU4A 4R4KA 3CME3 3S27A 1QJGA 1SQWA 1YGWA 2OOVC 1LOXA 3KSED 1I2GA 4STDA 3Q90A 4FMCA 1RCLA 3VF1A 4HM5B 1CH0A 1RN7A 4HYZA 3OWYA 1J2BA 1EG9B 2SARA 5IG0A 2CFKA 3JUMA 1OHSA 3D9RA 5CF1A 4N6LA 3HOHA 3S67A 1TJDA 3S5CA 3K5TA 3FKAA 1HU9A 1HZ1A 3DGLA 5I97A 2Z77A 1V58A 2LQVA 3NBBA 2KF4A 2JDIH 3ER7A 3KIIA 1WMNA 3JVCA 1WQLB 1EKMA 2CKFB 1K41A 5IEPA 1IT8A 4LGQA 2BO9B 1G02A 3NQZA 4BIRA 1UCLA 2ML6A 4RNTA 5EEOA 1I0XA 1X1XA 3EQQB 3Q3FA 3E99A 2E2VA 4R9LA 3CNMA 3F7SA 2QIYA 3D4AA 4N3VA 1RGCA 1UW1A 1K8A4 1A2VA 3DGNA 5HOHA 1YJN3 3FLJA 1FYSA 1YHQ3 1BSDA 1MWRA 3H3HA 3CD63 3SOAA 3WOEB 5D81A 3GSPA 1NDOB 2GXFA 2KF6A 2OQEC 2CWTA 3WOFB 1B2MA 1IVXA 3NM7A 4BL2A 4IIAA 1DYUA 1JJ22 3WA3A 1V74A 1JV2B 1PYLA 1QAKA 3LMLA 1TRQA 1TRPA 4HAAA 4O2HA 2CW9A 1W7CA 2L1SA 1GD3A 1D6UA 3AHSA 1T5YA 1UGHI 3D79A 1RDSA 2W9PA 5AIFA 1BRNL 3GRDA 3RGRA 1U8CB 1Q7Y4 1RHLA 1MWTA 2O3OA 4BTXA 1DVDA 4R80A 2KF3A 3URPA 4EBGA 2IYJA 1BRSA 3KE7A 1VQL3 1M1K4 3HZPA 2PZVA 1Q864 1B2UA 1KD14 2CC3A 2XFSA 3V99A 4HKVB 1IQ8A 3LH4A 1FGQA 3BNEA 4RNZA 1VQP3 1ZO2A 4FMDA 5FW5A 3FG3A 1CQSA 2JQ5A 2CWUA 2MC8A 3OXAA 1BNEA 1O7GB 2IY2A 3LTCA 1UCKA 1BSAA 4KFFA 1JNQA 1AR0A 5IERA 1VQ83 1N9EA 3IJEB 4XDWA 5ELUA 3FH1A 3LXUX 3CMA3 4RBNA 1QVG2 1BNFA 3D5GA 3EF8A 3F14A 3FG1A 1LRAA 4L8OA 1GS3A 2STDA 1TTOA 1STFI 3ZG5A 1I8VA 3U97A 4WHAA 3CPOA 1GY5A 3F40A 3N54B 1LNHA 1G96A 1FW7A 3LOYA 4WP5A 1IU7A 3OV4A 3T8UA 3DGMA 2XEPA 1IV9A 1Q42A 5BXQA 4FR9A 2YFLB 1JKGA 5AIHA 1JZOA 2F56A 2W6JH 5G1LA 4N6OB 1RCKA 1E97A 4LZIA 3FCSB 4K61A 5IW9A 2P09A 4L7KA 1EA2A 2RBIA 3SYUA 2WGQA 3GAXA 2F86B 3BIRA 1EEJA 1I0VA 3FF0A 1RGHA 3D3LA 4I4KA 4LSOA 5CLKA 4R1KA 3ROBA 1BRHA 1TIJA 3WMDA 1QMAA 1X1WA 1GOYA 3NX0A 3AGOA 3SXXA 3I563 1BNRA 1B20A 1RGKA 1JKGB 2YFIB 1B2ZA 3MG2A 1AQZA 4KT3B 4TX4A 5BVBA 4N6MA 4HM7B 3HI7A 1BRJA 2ZDJA 1OF5A 2XR8B 1YGEA 1TP6A 2UX0A 4EV5A 6RNTA 1RGLA 4J5KA 4HZ9B 5D83A 3SVAA 2CFDA 1MGWA 3K7CA 1UCIA 2SBLA 3LTDA 2R4IA 4I5QA 1Q9EA 2QGUA 3JUNA 3J7Yd 1WNHA 4XM4A 1I3FA 1SIIA 1NWWA 2W03A 3GZYB 4AKYA 4Q53A 4BTYA 1QVF2 1EUIC 4EC6A 2Z7AA 1O7HB 1N5HA 3AGNA 3HK4A 1OF5B 2OTL3 3ZFZA 4HJLB 4FMBA 2QA43 1KSIA 1TFKA 1K9M4 3K63A 1W6YA 3N8BA 1I2EA 3F8XA 3DZLA 3T8NA 5IENA 2XRXB 3CCR3 1C7HA 4HM0B 3AMOA 1FA3A 4O02B 3PCSA 2Q07A 4OK0A 5AIGA 1W4NA 4EYCA 1T3BA 5JPPA 2BMOB 3GWRA 3V98A 4KFDA 3BNDA 1MNLA 5CK6A 1TU5A 1RKYA 3M8CA 1FUWA 1PU4A 1JZDA 1Q7HA 1BUJA 4RNYA 1MWUA 3NV0B 1JBSA 1C54A 4OUQA 3LZAA 2C10A 2GSPA 1W5ZA 1B21A 3NHXA 1STDA 3AMOB 1RJOA 4ZM8A 4HOHA 4J8TA 2FXTA 3DM8A 1A90A 1ROVA 1LOVA 3KFQC 4K90B 1X1YA 3X3ZA 3PZWA 4CJNA 2CFGA 4FCJA 1A2PA 1X1UA 1YJ93 2ZA4A 3CCE3 4LMIA 2OWPA 7RNTA 4MMXB 5DREA 2A15A 1FGRA 1VZZA 1NJI4 1DETA 3OWUA 5EQLA 1A2KA 1ZS7A 2XSHB 3GZXB 3NBRA 1BNIA 5STDA 3UNLA 7STDA 1B27A 1JN5A 1BRKA 1B2XA 2H0HA 5AYSC 3CC23 2HMJB 1Q40B 1WMOA 5LC6A 7GSPA 3G0KA 5D82A 2HOHA 4IT7A 5KP1A 2BMRB 3X41A 2IUKA 2YFJB 1U5OA 4GHOA 3CCQ3 4J5GA 2UGIA 2HMKB 1L5GB 1BUQA 5BIRA 3MYTA 3F8HA 1S723 1W2ZA 3BNBA 3N9HA 3X3YA 1YVBI 3X42A 3CXC2 2GBXB 4NREA 9RNTA 5JPUA 1JRQA 3STDA 4EV2A 1BAOA 5M18A 2Y73A 4JRFA 3SOYA 5DRVA 1JN5B 3O8YA 2RGQA 4N6V0 1W6CA 1GY7A 1IQXA 1CYVA 3T0UA 3DGYA 2CHCA 4N6UA 3KZTA 1OHOA 1UUWB 2P0XA 5G1KA 1DVCA 1G0TA 3EX9A 1NU3A 4GL6A 1FUTA 4KVHA 1EQKA 3BLZA 1ROAA 3LTBA 3BNCA 3CCS3 1OH0A 3EC9A 1JBRA 1BNSA 3B4PA 4G1MB 1BNJA 1JBTA 1RGFA 3L0RA 1MGRA 2W56B 3LT8A 5IEOA 1RMSA 3RNTA 1Q814 2CK3H 1RGAA 2GU1A 1BANA 1YVSA 1IYYA 1OACA 4HVNA 1O7PB 2F5WA 2FGTA 2GEXA 1UUGB 2BIRA 3UL6A 1YIJ3 2F98A 2Z76A 3IPTA 3NQYA 1UUVB 4N6NB 4H61A 3EBYA 2B1XB 5AEWB 2BNGA 1VQ63 4EXRA 2I9WA 1OGXA 1QAFA 3IMAB 1SIHA 1NNVA 1B2SA 1LQMB 4HM6B 4X2HA 1FGMA 1RTUA 3ALAA 1KWIA 3EB8A 2K54A 4HM3B 5AYRB 5JBSA 1IK3A 1E3VA 1MWSA 1OCVA 3BB9A 2W9QA 1I2FA 3NXJA 2C11A 1YI23 3DY5A 5IF6A 3DUKA 1W01A 3K9MC 4L8PA 4LEHA 4LYLB 1AVLA 1K28A 3SX1A 2HMMB 2XGNA 3G16A 3UB1A 1VQK3 4WFOA 3B7CA 3EE1A 1VQM3 6STDA 1GMPA 1GSPA 3HX8A 4PEJA 1D6YA 3CU3A 2V1LA 5CXOA 2XFTA 4J9AA 1TFOA 4OVMA 1RGGA 5M1AA 3U1WA 1UI8A 4MJDA 1DMMA 3GZBA 3DH2A 1BNGA 3F7XA 4AEQA 1NB3I 3K0ZA 3MWZA 4X2OA 3GZRA 3MPHA 3SLUA 1N8R4 1GOVA 4HM4B 3KSPA 4K1UA 1UI7A 1W6GA 2O9UX 3NV0A 4WWUC 1OUNA 2XF3A 3Q1CA 1OHPA 4GB5A 1KC84 3DGOA 1KQS2 3WDGB 2WGOA 1W02A 5KP3A 3HIGA 4IPBA 3FSDA 2E2TA 5GSPA 1GMQA 1TUHA 3PYJA 3EN1B 5AI1A 4NHFA 2LYXA 1UDII 2PNCA 3V92A 3G4S3 3AHWA 1GMRA 3I0YA 3CCJ3 2M7OA 3OW22 1RGEA 2CH9A 2KAAA 2WO0A 2GEYA 1D6ZA 1AV4A 2KRTA 4HM2B 3I553 1BU4A 4NPBA 3CCU3 1RN4A 2GU3A 4U13A 1O7WB 5RNTA 1SARA 1RNTA 1MOLA 2W04A 3JUPA 1M1XB 5G2GA 2OOVA 1YJW3 2F5MA 3B4OA 4HM1B 2E2UA 2OCTA 3SEDA 3HIIA 4FCZA 2W0QA 8CHOA 5FGOA 1Q40A 4EW5A 5A0OB 3F9SA 3KN4A 1R4CA 2D1WA 1YIT3 4O3VA 2BHMA 3FGYA 1UGIA 1N5PA 2CFWA 2IA7A 3QK9A 4WYKA 1US1A 1Q824 4MEIA 3LT9A 4CDLA 1AY7A 5LC7A 1ULIB 3CCV3 3KCHA 3DXOA 3WODG 3G713 1HYFA 2P38A 1IQYA 3CNXA 1V57A 1LOYA 1LOWA 1DMNA 2FNQA 3PGBA 1BRIA 2RCDA 2Z6BA 1JB4A 3CC73 1FGTA 1RN1A 5CF2A 2CWVA 5IG3A 1BRGA 1Z1SA 2MF7A 2WOFA 3EJVA 1W2B2 2HMLB 3ECFA 2AAEA 1IV7A 2RNTA 1S5AA 3CCM3 4HZBB 4WYKB 1CYUA 4QWTA 3VSYA 1SJWA 1M904 3FG4A 4MMYB 1BGSA 3EBTA 3NBJA 3WR2A 3H51A 1FUSA 3WHOA 4AKZA 2W56A 4DKIA 1BSCA 2OQEA 3X3XA 1PY3A 5EVHA 3B8LA 1VQ53 1OPYA 2KF5A 1GOUA 1I3IA 4MMZB 1N9JA 3KKGA 1ULJB 2YX9A 1NO3A 1VQQA 1QALA 2ML5A 3JUOA 5ELJA 1FZUA 1T2IA 2XSOB 4BU4A 4CPKA 2OTJ3 3UL5A 4BTWA 2CIUA 2XH9A 3UJMA 3RGAA 1E3RA 2P0MA 5HGRA 2K0MA 1ISKA 1NB5I 1RRLA 2F4YA 1ZGXA 1AVKA 2D42A 3OX9A 1SPUA 5BU4A 1JB5A 1IT7A 4KFEA 5M19A 1GY6A 1IVVA 1JB2A 3PXMA 3Q2PA 4R9KA 3G6E3 1VQ43 1BSEA 1DE3A 2H0IA 1A67A 2Y74A 3CPW2 2HMOB 1IVWA 3ZG0A 1BIRA 8RNTA 1UCJA 2CX0A 3NM2A 1VQ93 4KZ1A 1VQO3 5IG4A 2R41A 1RRHA 1OGZA 4XBXA
chains in the Genus database with same CATH topology
3MKIA 4XB5A 4H3UA 1W00A 3LYGA 2P05A 3S28A 2B24B 2IUJA 3NUVA 2CFLA 4HM8B 4JF8A 5TGNA 1ZX2A 4N6TA 2QEX3 2RSXA 3PCRA 4CCVA 1FGOA 4XBTA 4O8SA 2L4VA 1Y4KA 3LTAA 3MG3A 1F8NA 1IVUA 1VQ73 4FMAA 1DMQA 2KCDA 3EN8A 3A76A 1WTHA 2IMJA 4RZMA 3S29A 5KP4A 3JUQA 1GYBA 2HMNB 1O7MB 2INXA 2GBWB 3G8ZA 1LVNA 3VGNA 2ZL8A 1O7NB 3MSOA 1GD4A 1ASKA 1LXEA 2CG0A 2BMQB 1WMPA 3CCL3 3CC43 1N8QA 1IDPA 3FZWA 1HKXA 2XGLA 3TDGA 4HBRA 4K1VA 5AEUB 1PFPA 4XBYA 2KXGA 2RFRA 2F99A 3QRDA 2CG1A 3RDEA 3WA2X 3EHCA 3OWSA 3DMCA 3MG1A 3MHEA 1VQN3 4FCMA 2W2CA 2BT3A 2WOHA 5AIIA 3PS8A 1CEWI 1M9GA 4ORLA 4XDVA 3X40A 3FF2A 5IG5A 1K734 4R4KA 3CME3 3S27A 1QJGA 1SQWA 2OOVC 1LOXA 3KSED 4STDA 3Q90A 4FMCA 3VF1A 4HM5B 1RN7A 4HYZA 3OWYA 1J2BA 1EG9B 5IG0A 2CFKA 3JUMA 1OHSA 3D9RA 5CF1A 4N6LA 3S67A 3S5CA 3K5TA 3FKAA 1HU9A 5I97A 3DGLA 2Z77A 2LQVA 3NBBA 2JDIH 3ER7A 3KIIA 1WMNA 3JVCA 1WQLB 1EKMA 2CKFB 1K41A 5IEPA 1IT8A 4LGQA 2BO9B 3NQZA 2ML6A 5EEOA 3EQQB 3E99A 2E2VA 4R9LA 3CNMA 3F7SA 2QIYA 4N3VA 1UW1A 1K8A4 1A2VA 3DGNA 1YJN3 3FLJA 1YHQ3 3H3HA 3CD63 3SOAA 3WOEB 5D81A 1NDOB 2GXFA 2OQEC 2CWTA 3WOFB 1IVXA 3NM7A 4IIAA 1DYUA 1JJ22 3WA3A 1V74A 1JV2B 1QAKA 3LMLA 4O2HA 2CW9A 1W7CA 5AIFA 1GD3A 1D6UA 3UB1A 1T5YA 1M904 2W9PA 3GRDA 3RGRA 1U8CB 1Q7Y4 2O3OA 4BTXA 1DVDA 4R80A 4EBGA 3KE7A 1VQL3 1M1K4 3HZPA 2PZVA 1Q864 1KD14 2CC3A 2XFSA 3V99A 4HKVB 1IQ8A 3LH4A 1FGQA 3BNEA 4RNZA 1VQP3 1ZO2A 4FMDA 5FW5A 3FG3A 1CQSA 2JQ5A 2CWUA 2MC8A 3OXAA 1O7GB 3LTCA 5IERA 4KFFA 1JNQA 1AR0A 1VQ83 1N9EA 3IJEB 4XDWA 5ELUA 3FH1A 3LXUX 3CMA3 4RBNA 3EF8A 3F14A 3FG1A 4L8OA 1GS3A 2STDA 1STFI 3U97A 4WHAA 3CPOA 1GY5A 3F40A 3N54B 1LNHA 1G96A 3LOYA 4WP5A 1IU7A 3OV4A 3T8UA 3DGMA 2XEPA 1IV9A 1Q42A 5BXQA 4FR9A 2YFLB 1JKGA 5AIHA 2W6JH 4N6OB 1E97A 4LZIA 3FCSB 4K61A 5IW9A 2P09A 4L7KA 1EA2A 2WGQA 3GAXA 2F86B 3FF0A 3D3LA 4I4KA 4LSOA 5CLKA 4R1KA 3ROBA 1TIJA 3WMDA 1QMAA 3NX0A 3SXXA 3I563 2YFIB 1JKGB 3MG2A 4TX4A 5BVBA 4N6MA 4HM7B 3HI7A 2ZDJA 1OF5A 2XR8B 1YGEA 1TP6A 2UX0A 4EV5A 4HZ9B 5D83A 3SVAA 2CFDA 3K7CA 2SBLA 3LTDA 2R4IA 2QGUA 3JUNA 3J7Yd 1WNHA 4XM4A 1SIIA 1NWWA 2W03A 3GZYB 4AKYA 4Q53A 4BTYA 1QVF2 4EC6A 2Z7AA 1O7HB 1N5HA 3HK4A 1OF5B 2OTL3 4HJLB 4FMBA 2QA43 1KSIA 1TFKA 1K9M4 3K63A 1W6YA 3N8BA 3F8XA 3DZLA 3T8NA 5IENA 2XRXB 3CCR3 1C7HA 4HM0B 3AMOA 1FA3A 4O02B 3PCSA 2Q07A 4OK0A 5AIGA 1W4NA 4EYCA 5JPPA 2BMOB 3GWRA 3V98A 4KFDA 3BNDA 1MNLA 5CK6A 1TU5A 1RKYA 3M8CA 1FUWA 1PU4A 4RNYA 3NV0B 4OUQA 3LZAA 2C10A 1W5ZA 3NHXA 1STDA 3AMOB 1RJOA 4ZM8A 4J8TA 2FXTA 3DM8A 1A90A 1ROVA 3KFQC 4K90B 3X3ZA 3PZWA 2CFGA 4FCJA 1YJ93 3CCE3 4LMIA 2OWPA 4MMXB 5DREA 2A15A 1FGRA 1VZZA 1NJI4 3OWUA 5EQLA 1A2KA 2XSHB 3GZXB 3NBRA 5STDA 3UNLA 7STDA 1JN5A 3CC23 5AYSC 2HMJB 1Q40B 1WMOA 5LC6A 3G0KA 5D82A 4IT7A 5KP1A 2BMRB 3X41A 2IUKA 2YFJB 1U5OA 3CCQ3 2HMKB 1L5GB 1BUQA 3MYTA 3F8HA 1S723 1W2ZA 3BNBA 3N9HA 3X3YA 1YVBI 3X42A 3CXC2 2GBXB 4NREA 5JPUA 1JRQA 3STDA 4EV2A 2Y73A 4JRFA 3SOYA 5DRVA 1JN5B 3O8YA 2RGQA 4N6V0 1W6CA 1GY7A 1IQXA 1CYVA 3T0UA 2CHCA 4N6UA 3KZTA 1OHOA 1UUWB 2P0XA 1DVCA 4KVHA 3EX9A 1NU3A 4GL6A 1EQKA 3BLZA 1ROAA 3LTBA 3BNCA 3CCS3 1OH0A 3EC9A 3B4PA 3L0RA 2W56B 3LT8A 5IEOA 1Q814 2CK3H 2GU1A 1OACA 4HVNA 1O7PB 2FGTA 2GEXA 3UL6A 1YIJ3 2F98A 2Z76A 3IPTA 3NQYA 1UUVB 4N6NB 4H61A 3EBYA 2B1XB 5AEWB 2BNGA 1VQ63 4EXRA 2I9WA 1OGXA 1QAFA 3IMAB 1SIHA 4HM6B 4X2HA 1FGMA 3ALAA 1KWIA 3EB8A 2K54A 4HM3B 5AYRB 5JBSA 1IK3A 1E3VA 1OCVA 3BB9A 2W9QA 3NXJA 2C11A 1YI23 3DY5A 5IF6A 3DUKA 1W01A 3K9MC 4L8PA 4LEHA 1AVLA 1K28A 3SX1A 2HMMB 2XGNA 3G16A 1VQK3 4WFOA 3B7CA 3EE1A 1VQM3 6STDA 3HX8A 4PEJA 1D6YA 3CU3A 2V1LA 5CXOA 2XFTA 4J9AA 1TFOA 4OVMA 3U1WA 1UI8A 4MJDA 1DMMA 3GZBA 3F7XA 4AEQA 1NB3I 3K0ZA 3MWZA 4X2OA 3GZRA 3MPHA 3SLUA 1N8R4 4HM4B 3KSPA 4K1UA 1UI7A 1W6GA 2O9UX 3NV0A 4WWUC 1OUNA 2XF3A 3Q1CA 1OHPA 4GB5A 1KC84 3DGOA 1KQS2 3WDGB 2WGOA 1W02A 5KP3A 3HIGA 4IPBA 3FSDA 2E2TA 3PYJA 1TUHA 3EN1B 5AI1A 4NHFA 2LYXA 2PNCA 3V92A 3G4S3 3I0YA 3CCJ3 2M7OA 3OW22 2CH9A 4HM2B 2WO0A 2GEYA 1D6ZA 1AV4A 2KRTA 3I553 3CCU3 1QVG2 2GU3A 4U13A 1O7WB 1MOLA 2W04A 3JUPA 1M1XB 5G2GA 2OOVA 1YJW3 3B4OA 4HM1B 2E2UA 2OCTA 3SEDA 3HIIA 4FCZA 2W0QA 8CHOA 5FGOA 1Q40A 5A0OB 3F9SA 3KN4A 1R4CA 2D1WA 1YIT3 4O3VA 2BHMA 3FGYA 1N5PA 2CFWA 2IA7A 3QK9A 4WYKA 1US1A 1Q824 4MEIA 3LT9A 4CDLA 5LC7A 1ULIB 3CCV3 3DXOA 3WODG 3G713 2P38A 1IQYA 3CNXA 2FNQA 1DMNA 3PGBA 2RCDA 2Z6BA 1JB4A 3CC73 1FGTA 5CF2A 2CWVA 5IG3A 2WOFA 1Z1SA 2MF7A 3EJVA 1W2B2 2HMLB 3ECFA 1IV7A 1S5AA 3CCM3 4HZBB 4WYKB 1CYUA 4QWTA 3VSYA 1SJWA 3FG4A 4MMYB 3EBTA 3NBJA 3H51A 4AKZA 2W56A 2OQEA 3X3XA 5EVHA 3B8LA 1VQ53 1OPYA 4MMZB 1N9JA 3KKGA 1ULJB 2YX9A 1NO3A 1QALA 2ML5A 3JUOA 5ELJA 2XSOB 2OTJ3 3UL5A 4BTWA 2CIUA 2XH9A 3UJMA 3RGAA 1E3RA 2P0MA 5HGRA 2K0MA 1ISKA 1NB5I 1RRLA 1AVKA 2D42A 3OX9A 1SPUA 1JB5A 1IT7A 4KFEA 1GY6A 1IVVA 1JB2A 3PXMA 3Q2PA 4R9KA 3G6E3 1VQ43 1A67A 2Y74A 3CPW2 2HMOB 1IVWA 3NM2A 1VQ93 4KZ1A 1VQO3 5IG4A 4G1MB 1RRHA 1OGZA 4XBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EB8 A;  4FMC A;  3Q1C A;  3PCR A;  4FMA A;  4FMB A;  4FMD A;  3PCS A;  3EE1 A; 
#chains in the Genus database with same CATH topology
 3MKI A;  4XB5 A;  4H3U A;  1W00 A;  3LYG A;  2P05 A;  3S28 A;  1BSB A;  1RSN A;  2B24 B;  2IUJ A;  3NUV A;  2CFL A;  4HM8 B;  4JF8 A;  1BVI A;  5TGN A;  1ZX2 A;  4N6T A;  2QEX 3;  3D5I A;  1LQG C;  2RSX A;  3PCR A;  4CCV A;  1FGO A;  4XBT A;  2K3D A;  4O8S A;  1B3S A;  2L4V A;  1Y4K A;  2CX1 A;  3LTA A;  3MG3 A;  1F8N A;  1IVU A;  6GSP A;  2H0G A;  4FMA A;  1DMQ A;  1VQ7 3;  1RNB A;  2KCD A;  3EN8 A;  3A76 A;  1WTH A;  2IMJ A;  4RZM A;  1T2H A;  3S29 A;  5KP4 A;  3JUQ A;  1GYB A;  2HMN B;  1O7M B;  2INX A;  2J8X B;  2GBW B;  4GSP A;  2UUG C;  3G8Z A;  1LVN A;  3VGN A;  2ZL8 A;  3A5E A;  1O7N B;  3MSO A;  1RLS A;  1GD4 A;  1ASK A;  1LXE A;  2CG0 A;  2BMQ B;  1BOX A;  1I70 A;  1WMP A;  3CCL 3;  3CC4 3;  1N8Q A;  1LNI A;  1IDP A;  2AAD A;  3FZW A;  1HKX A;  2XGL A;  3TDG A;  4HBR A;  4K1V A;  5AEU B;  1PFP A;  4XBY A;  2KXG A;  2RFR A;  2F99 A;  3QRD A;  2ZHX B;  1R4Y A;  2CG1 A;  3RDE A;  3EHC A;  1YNV X;  3OWS A;  3DMC A;  3MG1 A;  3WA2 X;  3MHE A;  4BL3 A;  2BU4 A;  1VQN 3;  4FCM A;  4ILF A;  2W2C A;  2BT3 A;  2WOH A;  5AII A;  3PS8 A;  1CEW I;  1M9G A;  2C4B A;  4ORL A;  4XDV A;  3X40 A;  3FF2 A;  5IG5 A;  1K73 4;  3BU4 A;  4R4K A;  3CME 3;  3S27 A;  1QJG A;  1SQW A;  1YGW A;  2OOV C;  1LOX A;  3KSE D;  1I2G A;  4STD A;  3Q90 A;  4FMC A;  1RCL A;  3VF1 A;  4HM5 B;  1CH0 A;  1RN7 A;  4HYZ A;  3OWY A;  1J2B A;  1EG9 B;  2SAR A;  5IG0 A;  2CFK A;  3JUM A;  1OHS A;  3D9R A;  5CF1 A;  4N6L A;  3HOH A;  3S67 A;  1TJD A;  3S5C A;  3K5T A;  3FKA A;  1HU9 A;  1HZ1 A;  3DGL A;  5I97 A;  2Z77 A;  1V58 A;  2LQV A;  3NBB A;  2KF4 A;  2JDI H;  3ER7 A;  3KII A;  1WMN A;  3JVC A;  1WQL B;  1EKM A;  2CKF B;  1K41 A;  5IEP A;  1IT8 A;  4LGQ A;  2BO9 B;  1G02 A;  3NQZ A;  4BIR A;  1UCL A;  2ML6 A;  4RNT A;  5EEO A;  1I0X A;  1X1X A;  3EQQ B;  3Q3F A;  3E99 A;  2E2V A;  4R9L A;  3CNM A;  3F7S A;  2QIY A;  3D4A A;  4N3V A;  1RGC A;  1UW1 A;  1K8A 4;  1A2V A;  3DGN A;  5HOH A;  1YJN 3;  3FLJ A;  1FYS A;  1YHQ 3;  1BSD A;  1MWR A;  3H3H A;  3CD6 3;  3SOA A;  3WOE B;  5D81 A;  3GSP A;  1NDO B;  2GXF A;  2KF6 A;  2OQE C;  2CWT A;  3WOF B;  1B2M A;  1IVX A;  3NM7 A;  4BL2 A;  4IIA A;  1DYU A;  1JJ2 2;  3WA3 A;  1V74 A;  1JV2 B;  1PYL A;  1QAK A;  3LML A;  1TRQ A;  1TRP A;  4HAA A;  4O2H A;  2CW9 A;  1W7C A;  2L1S A;  1GD3 A;  1D6U A;  3AHS A;  1T5Y A;  1UGH I;  3D79 A;  1RDS A;  2W9P A;  5AIF A;  1BRN L;  3GRD A;  3RGR A;  1U8C B;  1Q7Y 4;  1RHL A;  1MWT A;  2O3O A;  4BTX A;  1DVD A;  4R80 A;  2KF3 A;  3URP A;  4EBG A;  2IYJ A;  1BRS A;  3KE7 A;  1VQL 3;  1M1K 4;  3HZP A;  2PZV A;  1Q86 4;  1B2U A;  1KD1 4;  2CC3 A;  2XFS A;  3V99 A;  4HKV B;  1IQ8 A;  3LH4 A;  1FGQ A;  3BNE A;  4RNZ A;  1VQP 3;  1ZO2 A;  4FMD A;  5FW5 A;  3FG3 A;  1CQS A;  2JQ5 A;  2CWU A;  2MC8 A;  3OXA A;  1BNE A;  1O7G B;  2IY2 A;  3LTC A;  1UCK A;  1BSA A;  4KFF A;  1JNQ A;  1AR0 A;  5IER A;  1VQ8 3;  1N9E A;  3IJE B;  4XDW A;  5ELU A;  3FH1 A;  3LXU X;  3CMA 3;  4RBN A;  1QVG 2;  1BNF A;  3D5G A;  3EF8 A;  3F14 A;  3FG1 A;  1LRA A;  4L8O A;  1GS3 A;  2STD A;  1TTO A;  1STF I;  3ZG5 A;  1I8V A;  3U97 A;  4WHA A;  3CPO A;  1GY5 A;  3F40 A;  3N54 B;  1LNH A;  1G96 A;  1FW7 A;  3LOY A;  4WP5 A;  1IU7 A;  3OV4 A;  3T8U A;  3DGM A;  2XEP A;  1IV9 A;  1Q42 A;  5BXQ A;  4FR9 A;  2YFL B;  1JKG A;  5AIH A;  1JZO A;  2F56 A;  2W6J H;  5G1L A;  4N6O B;  1RCK A;  1E97 A;  4LZI A;  3FCS B;  4K61 A;  5IW9 A;  2P09 A;  4L7K A;  1EA2 A;  2RBI A;  3SYU A;  2WGQ A;  3GAX A;  2F86 B;  3BIR A;  1EEJ A;  1I0V A;  3FF0 A;  1RGH A;  3D3L A;  4I4K A;  4LSO A;  5CLK A;  4R1K A;  3ROB A;  1BRH A;  1TIJ A;  3WMD A;  1QMA A;  1X1W A;  1GOY A;  3NX0 A;  3AGO A;  3SXX A;  3I56 3;  1BNR A;  1B20 A;  1RGK A;  1JKG B;  2YFI B;  1B2Z A;  3MG2 A;  1AQZ A;  4KT3 B;  4TX4 A;  5BVB A;  4N6M A;  4HM7 B;  3HI7 A;  1BRJ A;  2ZDJ A;  1OF5 A;  2XR8 B;  1YGE A;  1TP6 A;  2UX0 A;  4EV5 A;  6RNT A;  1RGL A;  4J5K A;  4HZ9 B;  5D83 A;  3SVA A;  2CFD A;  1MGW A;  3K7C A;  1UCI A;  2SBL A;  3LTD A;  2R4I A;  4I5Q A;  1Q9E A;  2QGU A;  3JUN A;  3J7Y d;  1WNH A;  4XM4 A;  1I3F A;  1SII A;  1NWW A;  2W03 A;  3GZY B;  4AKY A;  4Q53 A;  4BTY A;  1QVF 2;  1EUI C;  4EC6 A;  2Z7A A;  1O7H B;  1N5H A;  3AGN A;  3HK4 A;  1OF5 B;  2OTL 3;  3ZFZ A;  4HJL B;  4FMB A;  2QA4 3;  1KSI A;  1TFK A;  1K9M 4;  3K63 A;  1W6Y A;  3N8B A;  1I2E A;  3F8X A;  3DZL A;  3T8N A;  5IEN A;  2XRX B;  3CCR 3;  1C7H A;  4HM0 B;  3AMO A;  1FA3 A;  4O02 B;  3PCS A;  2Q07 A;  4OK0 A;  5AIG A;  1W4N A;  4EYC A;  1T3B A;  5JPP A;  2BMO B;  3GWR A;  3V98 A;  4KFD A;  3BND A;  1MNL A;  5CK6 A;  1TU5 A;  1RKY A;  3M8C A;  1FUW A;  1PU4 A;  1JZD A;  1Q7H A;  1BUJ A;  4RNY A;  1MWU A;  3NV0 B;  1JBS A;  1C54 A;  4OUQ A;  3LZA A;  2C10 A;  2GSP A;  1W5Z A;  1B21 A;  3NHX A;  1STD A;  3AMO B;  1RJO A;  4ZM8 A;  4HOH A;  4J8T A;  2FXT A;  3DM8 A;  1A90 A;  1ROV A;  1LOV A;  3KFQ C;  4K90 B;  1X1Y A;  3X3Z A;  3PZW A;  4CJN A;  2CFG A;  4FCJ A;  1A2P A;  1X1U A;  1YJ9 3;  2ZA4 A;  3CCE 3;  4LMI A;  2OWP A;  7RNT A;  4MMX B;  5DRE A;  2A15 A;  1FGR A;  1VZZ A;  1NJI 4;  1DET A;  3OWU A;  5EQL A;  1A2K A;  1ZS7 A;  2XSH B;  3GZX B;  3NBR A;  1BNI A;  5STD A;  3UNL A;  7STD A;  1B27 A;  1JN5 A;  1BRK A;  1B2X A;  2H0H A;  5AYS C;  3CC2 3;  2HMJ B;  1Q40 B;  1WMO A;  5LC6 A;  7GSP A;  3G0K A;  5D82 A;  2HOH A;  4IT7 A;  5KP1 A;  2BMR B;  3X41 A;  2IUK A;  2YFJ B;  1U5O A;  4GHO A;  3CCQ 3;  4J5G A;  2UGI A;  2HMK B;  1L5G B;  1BUQ A;  5BIR A;  3MYT A;  3F8H A;  1S72 3;  1W2Z A;  3BNB A;  3N9H A;  3X3Y A;  1YVB I;  3X42 A;  3CXC 2;  2GBX B;  4NRE A;  9RNT A;  5JPU A;  1JRQ A;  3STD A;  4EV2 A;  1BAO A;  5M18 A;  2Y73 A;  4JRF A;  3SOY A;  5DRV A;  1JN5 B;  3O8Y A;  2RGQ A;  4N6V 0;  1W6C A;  1GY7 A;  1IQX A;  1CYV A;  3T0U A;  3DGY A;  2CHC A;  4N6U A;  3KZT A;  1OHO A;  1UUW B;  2P0X A;  5G1K A;  1DVC A;  1G0T A;  3EX9 A;  1NU3 A;  4GL6 A;  1FUT A;  4KVH A;  1EQK A;  3BLZ A;  1ROA A;  3LTB A;  3BNC A;  3CCS 3;  1OH0 A;  3EC9 A;  1JBR A;  1BNS A;  3B4P A;  4G1M B;  1BNJ A;  1JBT A;  1RGF A;  3L0R A;  1MGR A;  2W56 B;  3LT8 A;  5IEO A;  1RMS A;  3RNT A;  1Q81 4;  2CK3 H;  1RGA A;  2GU1 A;  1BAN A;  1YVS A;  1IYY A;  1OAC A;  4HVN A;  1O7P B;  2F5W A;  2FGT A;  2GEX A;  1UUG B;  2BIR A;  3UL6 A;  1YIJ 3;  2F98 A;  2Z76 A;  3IPT A;  3NQY A;  1UUV B;  4N6N B;  4H61 A;  3EBY A;  2B1X B;  5AEW B;  2BNG A;  1VQ6 3;  4EXR A;  2I9W A;  1OGX A;  1QAF A;  3IMA B;  1SIH A;  1NNV A;  1B2S A;  1LQM B;  4HM6 B;  4X2H A;  1FGM A;  1RTU A;  3ALA A;  1KWI A;  3EB8 A;  2K54 A;  4HM3 B;  5AYR B;  5JBS A;  1IK3 A;  1E3V A;  1MWS A;  1OCV A;  3BB9 A;  2W9Q A;  1I2F A;  3NXJ A;  2C11 A;  1YI2 3;  3DY5 A;  5IF6 A;  3DUK A;  1W01 A;  3K9M C;  4L8P A;  4LEH A;  4LYL B;  1AVL A;  1K28 A;  3SX1 A;  2HMM B;  2XGN A;  3G16 A;  3UB1 A;  1VQK 3;  4WFO A;  3B7C A;  3EE1 A;  1VQM 3;  6STD A;  1GMP A;  1GSP A;  3HX8 A;  4PEJ A;  1D6Y A;  3CU3 A;  2V1L A;  5CXO A;  2XFT A;  4J9A A;  1TFO A;  4OVM A;  1RGG A;  5M1A A;  3U1W A;  1UI8 A;  4MJD A;  1DMM A;  3GZB A;  3DH2 A;  1BNG A;  3F7X A;  4AEQ A;  1NB3 I;  3K0Z A;  3MWZ A;  4X2O A;  3GZR A;  3MPH A;  3SLU A;  1N8R 4;  1GOV A;  4HM4 B;  3KSP A;  4K1U A;  1UI7 A;  1W6G A;  2O9U X;  3NV0 A;  4WWU C;  1OUN A;  2XF3 A;  3Q1C A;  1OHP A;  4GB5 A;  1KC8 4;  3DGO A;  1KQS 2;  3WDG B;  2WGO A;  1W02 A;  5KP3 A;  3HIG A;  4IPB A;  3FSD A;  2E2T A;  5GSP A;  1GMQ A;  1TUH A;  3PYJ A;  3EN1 B;  5AI1 A;  4NHF A;  2LYX A;  1UDI I;  2PNC A;  3V92 A;  3G4S 3;  3AHW A;  1GMR A;  3I0Y A;  3CCJ 3;  2M7O A;  3OW2 2;  1RGE A;  2CH9 A;  2KAA A;  2WO0 A;  2GEY A;  1D6Z A;  1AV4 A;  2KRT A;  4HM2 B;  3I55 3;  1BU4 A;  4NPB A;  3CCU 3;  1RN4 A;  2GU3 A;  4U13 A;  1O7W B;  5RNT A;  1SAR A;  1RNT A;  1MOL A;  2W04 A;  3JUP A;  1M1X B;  5G2G A;  2OOV A;  1YJW 3;  2F5M A;  3B4O A;  4HM1 B;  2E2U A;  2OCT A;  3SED A;  3HII A;  4FCZ A;  2W0Q A;  8CHO A;  5FGO A;  1Q40 A;  4EW5 A;  5A0O B;  3F9S A;  3KN4 A;  1R4C A;  2D1W A;  1YIT 3;  4O3V A;  2BHM A;  3FGY A;  1UGI A;  1N5P A;  2CFW A;  2IA7 A;  3QK9 A;  4WYK A;  1US1 A;  1Q82 4;  4MEI A;  3LT9 A;  4CDL A;  1AY7 A;  5LC7 A;  1ULI B;  3CCV 3;  3KCH A;  3DXO A;  3WOD G;  3G71 3;  1HYF A;  2P38 A;  1IQY A;  3CNX A;  1V57 A;  1LOY A;  1LOW A;  1DMN A;  2FNQ A;  3PGB A;  1BRI A;  2RCD A;  2Z6B A;  1JB4 A;  3CC7 3;  1FGT A;  1RN1 A;  5CF2 A;  2CWV A;  5IG3 A;  1BRG A;  1Z1S A;  2MF7 A;  2WOF A;  3EJV A;  1W2B 2;  2HML B;  3ECF A;  2AAE A;  1IV7 A;  2RNT A;  1S5A A;  3CCM 3;  4HZB B;  4WYK B;  1CYU A;  4QWT A;  3VSY A;  1SJW A;  1M90 4;  3FG4 A;  4MMY B;  1BGS A;  3EBT A;  3NBJ A;  3WR2 A;  3H51 A;  1FUS A;  3WHO A;  4AKZ A;  2W56 A;  4DKI A;  1BSC A;  2OQE A;  3X3X A;  1PY3 A;  5EVH A;  3B8L A;  1VQ5 3;  1OPY A;  2KF5 A;  1GOU A;  1I3I A;  4MMZ B;  1N9J A;  3KKG A;  1ULJ B;  2YX9 A;  1NO3 A;  1VQQ A;  1QAL A;  2ML5 A;  3JUO A;  5ELJ A;  1FZU A;  1T2I A;  2XSO B;  4BU4 A;  4CPK A;  2OTJ 3;  3UL5 A;  4BTW A;  2CIU A;  2XH9 A;  3UJM A;  3RGA A;  1E3R A;  2P0M A;  5HGR A;  2K0M A;  1ISK A;  1NB5 I;  1RRL A;  2F4Y A;  1ZGX A;  1AVK A;  2D42 A;  3OX9 A;  1SPU A;  5BU4 A;  1JB5 A;  1IT7 A;  4KFE A;  5M19 A;  1GY6 A;  1IVV A;  1JB2 A;  3PXM A;  3Q2P A;  4R9K A;  3G6E 3;  1VQ4 3;  1BSE A;  1DE3 A;  2H0I A;  1A67 A;  2Y74 A;  3CPW 2;  2HMO B;  1IVW A;  3ZG0 A;  1BIR A;  8RNT A;  1UCJ A;  2CX0 A;  3NM2 A;  1VQ9 3;  4KZ1 A;  1VQO 3;  5IG4 A;  2R41 A;  1RRH A;  1OGZ A;  4XBX A; 
#chains in the Genus database with same CATH homology
 3MKI A;  4XB5 A;  4H3U A;  1W00 A;  3LYG A;  2P05 A;  3S28 A;  2B24 B;  2IUJ A;  3NUV A;  2CFL A;  4HM8 B;  4JF8 A;  5TGN A;  1ZX2 A;  4N6T A;  2QEX 3;  2RSX A;  3PCR A;  4CCV A;  1FGO A;  4XBT A;  4O8S A;  2L4V A;  1Y4K A;  3LTA A;  3MG3 A;  1F8N A;  1IVU A;  1VQ7 3;  4FMA A;  1DMQ A;  2KCD A;  3EN8 A;  3A76 A;  1WTH A;  2IMJ A;  4RZM A;  3S29 A;  5KP4 A;  3JUQ A;  1GYB A;  2HMN B;  1O7M B;  2INX A;  2GBW B;  3G8Z A;  1LVN A;  3VGN A;  2ZL8 A;  1O7N B;  3MSO A;  1GD4 A;  1ASK A;  1LXE A;  2CG0 A;  2BMQ B;  1WMP A;  3CCL 3;  3CC4 3;  1N8Q A;  1IDP A;  3FZW A;  1HKX A;  2XGL A;  3TDG A;  4HBR A;  4K1V A;  5AEU B;  1PFP A;  4XBY A;  2KXG A;  2RFR A;  2F99 A;  3QRD A;  2CG1 A;  3RDE A;  3WA2 X;  3EHC A;  3OWS A;  3DMC A;  3MG1 A;  3MHE A;  1VQN 3;  4FCM A;  2W2C A;  2BT3 A;  2WOH A;  5AII A;  3PS8 A;  1CEW I;  1M9G A;  4ORL A;  4XDV A;  3X40 A;  3FF2 A;  5IG5 A;  1K73 4;  4R4K A;  3CME 3;  3S27 A;  1QJG A;  1SQW A;  2OOV C;  1LOX A;  3KSE D;  4STD A;  3Q90 A;  4FMC A;  3VF1 A;  4HM5 B;  1RN7 A;  4HYZ A;  3OWY A;  1J2B A;  1EG9 B;  5IG0 A;  2CFK A;  3JUM A;  1OHS A;  3D9R A;  5CF1 A;  4N6L A;  3S67 A;  3S5C A;  3K5T A;  3FKA A;  1HU9 A;  5I97 A;  3DGL A;  2Z77 A;  2LQV A;  3NBB A;  2JDI H;  3ER7 A;  3KII A;  1WMN A;  3JVC A;  1WQL B;  1EKM A;  2CKF B;  1K41 A;  5IEP A;  1IT8 A;  4LGQ A;  2BO9 B;  3NQZ A;  2ML6 A;  5EEO A;  3EQQ B;  3E99 A;  2E2V A;  4R9L A;  3CNM A;  3F7S A;  2QIY A;  4N3V A;  1UW1 A;  1K8A 4;  1A2V A;  3DGN A;  1YJN 3;  3FLJ A;  1YHQ 3;  3H3H A;  3CD6 3;  3SOA A;  3WOE B;  5D81 A;  1NDO B;  2GXF A;  2OQE C;  2CWT A;  3WOF B;  1IVX A;  3NM7 A;  4IIA A;  1DYU A;  1JJ2 2;  3WA3 A;  1V74 A;  1JV2 B;  1QAK A;  3LML A;  4O2H A;  2CW9 A;  1W7C A;  5AIF A;  1GD3 A;  1D6U A;  3UB1 A;  1T5Y A;  1M90 4;  2W9P A;  3GRD A;  3RGR A;  1U8C B;  1Q7Y 4;  2O3O A;  4BTX A;  1DVD A;  4R80 A;  4EBG A;  3KE7 A;  1VQL 3;  1M1K 4;  3HZP A;  2PZV A;  1Q86 4;  1KD1 4;  2CC3 A;  2XFS A;  3V99 A;  4HKV B;  1IQ8 A;  3LH4 A;  1FGQ A;  3BNE A;  4RNZ A;  1VQP 3;  1ZO2 A;  4FMD A;  5FW5 A;  3FG3 A;  1CQS A;  2JQ5 A;  2CWU A;  2MC8 A;  3OXA A;  1O7G B;  3LTC A;  5IER A;  4KFF A;  1JNQ A;  1AR0 A;  1VQ8 3;  1N9E A;  3IJE B;  4XDW A;  5ELU A;  3FH1 A;  3LXU X;  3CMA 3;  4RBN A;  3EF8 A;  3F14 A;  3FG1 A;  4L8O A;  1GS3 A;  2STD A;  1STF I;  3U97 A;  4WHA A;  3CPO A;  1GY5 A;  3F40 A;  3N54 B;  1LNH A;  1G96 A;  3LOY A;  4WP5 A;  1IU7 A;  3OV4 A;  3T8U A;  3DGM A;  2XEP A;  1IV9 A;  1Q42 A;  5BXQ A;  4FR9 A;  2YFL B;  1JKG A;  5AIH A;  2W6J H;  4N6O B;  1E97 A;  4LZI A;  3FCS B;  4K61 A;  5IW9 A;  2P09 A;  4L7K A;  1EA2 A;  2WGQ A;  3GAX A;  2F86 B;  3FF0 A;  3D3L A;  4I4K A;  4LSO A;  5CLK A;  4R1K A;  3ROB A;  1TIJ A;  3WMD A;  1QMA A;  3NX0 A;  3SXX A;  3I56 3;  2YFI B;  1JKG B;  3MG2 A;  4TX4 A;  5BVB A;  4N6M A;  4HM7 B;  3HI7 A;  2ZDJ A;  1OF5 A;  2XR8 B;  1YGE A;  1TP6 A;  2UX0 A;  4EV5 A;  4HZ9 B;  5D83 A;  3SVA A;  2CFD A;  3K7C A;  2SBL A;  3LTD A;  2R4I A;  2QGU A;  3JUN A;  3J7Y d;  1WNH A;  4XM4 A;  1SII A;  1NWW A;  2W03 A;  3GZY B;  4AKY A;  4Q53 A;  4BTY A;  1QVF 2;  4EC6 A;  2Z7A A;  1O7H B;  1N5H A;  3HK4 A;  1OF5 B;  2OTL 3;  4HJL B;  4FMB A;  2QA4 3;  1KSI A;  1TFK A;  1K9M 4;  3K63 A;  1W6Y A;  3N8B A;  3F8X A;  3DZL A;  3T8N A;  5IEN A;  2XRX B;  3CCR 3;  1C7H A;  4HM0 B;  3AMO A;  1FA3 A;  4O02 B;  3PCS A;  2Q07 A;  4OK0 A;  5AIG A;  1W4N A;  4EYC A;  5JPP A;  2BMO B;  3GWR A;  3V98 A;  4KFD A;  3BND A;  1MNL A;  5CK6 A;  1TU5 A;  1RKY A;  3M8C A;  1FUW A;  1PU4 A;  4RNY A;  3NV0 B;  4OUQ A;  3LZA A;  2C10 A;  1W5Z A;  3NHX A;  1STD A;  3AMO B;  1RJO A;  4ZM8 A;  4J8T A;  2FXT A;  3DM8 A;  1A90 A;  1ROV A;  3KFQ C;  4K90 B;  3X3Z A;  3PZW A;  2CFG A;  4FCJ A;  1YJ9 3;  3CCE 3;  4LMI A;  2OWP A;  4MMX B;  5DRE A;  2A15 A;  1FGR A;  1VZZ A;  1NJI 4;  3OWU A;  5EQL A;  1A2K A;  2XSH B;  3GZX B;  3NBR A;  5STD A;  3UNL A;  7STD A;  1JN5 A;  3CC2 3;  5AYS C;  2HMJ B;  1Q40 B;  1WMO A;  5LC6 A;  3G0K A;  5D82 A;  4IT7 A;  5KP1 A;  2BMR B;  3X41 A;  2IUK A;  2YFJ B;  1U5O A;  3CCQ 3;  2HMK B;  1L5G B;  1BUQ A;  3MYT A;  3F8H A;  1S72 3;  1W2Z A;  3BNB A;  3N9H A;  3X3Y A;  1YVB I;  3X42 A;  3CXC 2;  2GBX B;  4NRE A;  5JPU A;  1JRQ A;  3STD A;  4EV2 A;  2Y73 A;  4JRF A;  3SOY A;  5DRV A;  1JN5 B;  3O8Y A;  2RGQ A;  4N6V 0;  1W6C A;  1GY7 A;  1IQX A;  1CYV A;  3T0U A;  2CHC A;  4N6U A;  3KZT A;  1OHO A;  1UUW B;  2P0X A;  1DVC A;  4KVH A;  3EX9 A;  1NU3 A;  4GL6 A;  1EQK A;  3BLZ A;  1ROA A;  3LTB A;  3BNC A;  3CCS 3;  1OH0 A;  3EC9 A;  3B4P A;  3L0R A;  2W56 B;  3LT8 A;  5IEO A;  1Q81 4;  2CK3 H;  2GU1 A;  1OAC A;  4HVN A;  1O7P B;  2FGT A;  2GEX A;  3UL6 A;  1YIJ 3;  2F98 A;  2Z76 A;  3IPT A;  3NQY A;  1UUV B;  4N6N B;  4H61 A;  3EBY A;  2B1X B;  5AEW B;  2BNG A;  1VQ6 3;  4EXR A;  2I9W A;  1OGX A;  1QAF A;  3IMA B;  1SIH A;  4HM6 B;  4X2H A;  1FGM A;  3ALA A;  1KWI A;  3EB8 A;  2K54 A;  4HM3 B;  5AYR B;  5JBS A;  1IK3 A;  1E3V A;  1OCV A;  3BB9 A;  2W9Q A;  3NXJ A;  2C11 A;  1YI2 3;  3DY5 A;  5IF6 A;  3DUK A;  1W01 A;  3K9M C;  4L8P A;  4LEH A;  1AVL A;  1K28 A;  3SX1 A;  2HMM B;  2XGN A;  3G16 A;  1VQK 3;  4WFO A;  3B7C A;  3EE1 A;  1VQM 3;  6STD A;  3HX8 A;  4PEJ A;  1D6Y A;  3CU3 A;  2V1L A;  5CXO A;  2XFT A;  4J9A A;  1TFO A;  4OVM A;  3U1W A;  1UI8 A;  4MJD A;  1DMM A;  3GZB A;  3F7X A;  4AEQ A;  1NB3 I;  3K0Z A;  3MWZ A;  4X2O A;  3GZR A;  3MPH A;  3SLU A;  1N8R 4;  4HM4 B;  3KSP A;  4K1U A;  1UI7 A;  1W6G A;  2O9U X;  3NV0 A;  4WWU C;  1OUN A;  2XF3 A;  3Q1C A;  1OHP A;  4GB5 A;  1KC8 4;  3DGO A;  1KQS 2;  3WDG B;  2WGO A;  1W02 A;  5KP3 A;  3HIG A;  4IPB A;  3FSD A;  2E2T A;  3PYJ A;  1TUH A;  3EN1 B;  5AI1 A;  4NHF A;  2LYX A;  2PNC A;  3V92 A;  3G4S 3;  3I0Y A;  3CCJ 3;  2M7O A;  3OW2 2;  2CH9 A;  4HM2 B;  2WO0 A;  2GEY A;  1D6Z A;  1AV4 A;  2KRT A;  3I55 3;  3CCU 3;  1QVG 2;  2GU3 A;  4U13 A;  1O7W B;  1MOL A;  2W04 A;  3JUP A;  1M1X B;  5G2G A;  2OOV A;  1YJW 3;  3B4O A;  4HM1 B;  2E2U A;  2OCT A;  3SED A;  3HII A;  4FCZ A;  2W0Q A;  8CHO A;  5FGO A;  1Q40 A;  5A0O B;  3F9S A;  3KN4 A;  1R4C A;  2D1W A;  1YIT 3;  4O3V A;  2BHM A;  3FGY A;  1N5P A;  2CFW A;  2IA7 A;  3QK9 A;  4WYK A;  1US1 A;  1Q82 4;  4MEI A;  3LT9 A;  4CDL A;  5LC7 A;  1ULI B;  3CCV 3;  3DXO A;  3WOD G;  3G71 3;  2P38 A;  1IQY A;  3CNX A;  2FNQ A;  1DMN A;  3PGB A;  2RCD A;  2Z6B A;  1JB4 A;  3CC7 3;  1FGT A;  5CF2 A;  2CWV A;  5IG3 A;  2WOF A;  1Z1S A;  2MF7 A;  3EJV A;  1W2B 2;  2HML B;  3ECF A;  1IV7 A;  1S5A A;  3CCM 3;  4HZB B;  4WYK B;  1CYU A;  4QWT A;  3VSY A;  1SJW A;  3FG4 A;  4MMY B;  3EBT A;  3NBJ A;  3H51 A;  4AKZ A;  2W56 A;  2OQE A;  3X3X A;  5EVH A;  3B8L A;  1VQ5 3;  1OPY A;  4MMZ B;  1N9J A;  3KKG A;  1ULJ B;  2YX9 A;  1NO3 A;  1QAL A;  2ML5 A;  3JUO A;  5ELJ A;  2XSO B;  2OTJ 3;  3UL5 A;  4BTW A;  2CIU A;  2XH9 A;  3UJM A;  3RGA A;  1E3R A;  2P0M A;  5HGR A;  2K0M A;  1ISK A;  1NB5 I;  1RRL A;  1AVK A;  2D42 A;  3OX9 A;  1SPU A;  1JB5 A;  1IT7 A;  4KFE A;  1GY6 A;  1IVV A;  1JB2 A;  3PXM A;  3Q2P A;  4R9K A;  3G6E 3;  1VQ4 3;  1A67 A;  2Y74 A;  3CPW 2;  2HMO B;  1IVW A;  3NM2 A;  1VQ9 3;  4KZ1 A;  1VQO 3;  5IG4 A;  4G1M B;  1RRH A;  1OGZ A;  4XBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...