3EB8A

Vira
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
334
Chain Sequence
AEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease-like virA
publication title Structural and functional studies indicate that Shigella VirA is not a protease and does not directly destabilize microtubules.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
total genus 99
structure length 334
sequence length 347
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3eb8A01
3PCSA 4FMBA 4FMAA 4FMDA 3EB8A 3Q1CA 3EE1A 3PCRA 4FMCA
chains in the Genus database with same CATH superfamily
1STFI 1EQKA 3CCQ3 2YFIB 1T2HA 4ILFA 2BMRB 2J8XB 2P09A 3CPW2 1X1XA 4BTYA 4STDA 3FLJA 3HI7A 1G0TA 3EE1A 5IEOA 5AEWB 2GXFA 4L7KA 3CNMA 1LVNA 3WOEB 4EW5A 1G96A 1A2KA 1NDOB 1LQGC 2W04A 4XBYA 3DY5A 4DKIA 1SARA 1DE3A 1LOWA 1RGHA 4HVNA 3WDGB 1R4YA 4FMBA 1O7WB 1GOVA 3FG3A 5CF1A 1K9M4 5CXOA 1HZ1A 4JRFA 1M904 1Q864 3WOFB 4XDWA 2D1WA 2RSXA 1FGRA 3NV0A 3SOAA 3GSPA 5IG5A 3AMOA 5BIRA 1FUTA 1QVG2 3SLUA 2KF4A 2OWPA 2R4IA 3B7CA 3LTBA 4X2HA 1JKGA 1TRQA 3E99A 5JPUA 3EBTA 4N6V0 1YIJ3 3JUMA 4BTWA 2W0QA 3D79A 3CC43 3NBBA 3GWRA 3KE7A 1K41A 2IUKA 3K9MC 4J5GA 5AYRB 2L1SA 3WHOA 3CNXA 2ZDJA 3G16A 3JUPA 2WGQA 1E97A 3HX8A 3OWSA 3UNLA 3S29A 3I553 4R1KA 1ROAA 3AHWA 1GY5A 2XSHB 1UCLA 3X3XA 1RGFA 1I2EA 2KCDA 3PS8A 3Q1CA 5TGNA 5AYSC 1EEJA 1MWRA 2YX9A 3DH2A 5LC6A 1D6YA 4OVMA 3HIIA 1W2ZA 3A5EA 3K5TA 1ROVA 1C7HA 1ZO2A 4FMAA 2W56A 2OQEA 3H51A 1DMNA 1GS3A 1MWTA 1DETA 2HMMB 3LTCA 4BL2A 6GSPA 3HZPA 4XDVA 2W9QA 4R9KA 2KF5A 3M8CA 3MPHA 5IG0A 1BSCA 4ZM8A 2OQEC 4IIAA 1O7HB 2BU4A 3EHCA 5KP3A 1RN7A 1X1UA 3WA3A 1RKYA 1STDA 2O9UX 5AEUB 3F9SA 3GZBA 1GOUA 4HM5B 4HBRA 3LZAA 1BOXA 2IY2A 4WYKA 1B2ZA 5IERA 2BT3A 3T8NA 2QIYA 1N5PA 1W02A 2XH9A 3J7Yd 1W5ZA 4FMCA 4N6NB 2YFJB 1NB5I 1LOYA 3X3ZA 2MC8A 1ISKA 4GHOA 4L8PA 1IV9A 1NU3A 3MG3A 3PCSA 1RGLA 1QAFA 4FCMA 4U13A 1JB4A 3K7CA 3NHXA 1JBSA 2XSOB 4MMXB 5AI1A 5AIFA 4R4KA 2K3DA 3JUNA 1JBTA 1TRPA 4J8TA 4HZ9B 4N6MA 3CCM3 2W6JH 3MYTA 2RBIA 2HMJB 1O7MB 5FW5A 1IQYA 3CCR3 1QALA 1QVF2 4AKYA 3F7SA 3LMLA 8RNTA 4XB5A 3DXOA 2SBLA 1OCVA 4FMDA 3H3HA 3RGAA 5EVHA 4WWUC 3ZG5A 3DZLA 1GY7A 2XF3A 3GZXB 1OUNA 2E2UA 1FW7A 2OOVA 2ZHXB 1W2B2 1WNHA 2HMOB 1JZOA 5DREA 2QEX3 1IVVA 1BGSA 1YGEA 2D42A 1A90A 1ZGXA 1AR0A 2L4VA 3FGYA 1MNLA 2Z6BA 2OOVC 3DGNA 3IMAB 1SQWA 1B2SA 1JN5B 1WTHA 2CFGA 1WQLB 3EQQB 1W6YA 3DMCA 1EKMA 2GEXA 5CF2A 4HKVB 1VQ63 1UCIA 2CW9A 4QWTA 1VQQA 2Q07A 3ZG0A 5IG3A 5IENA 1BANA 3STDA 1IVXA 1K734 3WMDA 1B2UA 5JPPA 1UI8A 1AQZA 3NUVA 3UB1A 3RDEA 4HM1B 1X1WA 2W9PA 1Q40B 7GSPA 1GY6A 1BIRA 1M1K4 1FGOA 3MG2A 4O2HA 1N8QA 2F56A 1PYLA 1S5AA 3LOYA 1RGCA 4K1UA 3JUQA 3CCL3 1DVDA 1MWSA 1OPYA 2R41A 1IV7A 1CYVA 3BNBA 5IEPA 3CCS3 3OX9A 2HMLB 3QK9A 4N6LA 1Q9EA 1TP6A 5EQLA 2CWUA 1JB2A 2BMOB 1D6UA 3WR2A 5D83A 2CHCA 1FGMA 3Q2PA 2XGLA 1I2FA 1V57A 1W4NA 1GMRA 2CX0A 5A0OB 5M18A 1AVKA 4O8SA 1RNTA 2IMJA 1VQM3 2KF6A 1X1YA 3ECFA 3PCRA 1FZUA 3CCV3 1KQS2 1MGRA 4CCVA 1C54A 3F8HA 3N54B 3HOHA 2A15A 3T8UA 3WODG 4WFOA 4K90B 3FF0A 1HU9A 1I0VA 3OV4A 3DGYA 1RGGA 2KF3A 2CFLA 4IPBA 1LNHA 2CK3H 8CHOA 2STDA 2RCDA 2Y73A 1IYYA 3BIRA 5ELJA 4K61A 1G02A 2B1XB 4AKZA 2XGNA 3MSOA 4EV2A 3TDGA 2CWVA 3HK4A 4N3VA 1JZDA 1BVIA 2JQ5A 3L0RA 4RZMA 5IF6A 4O02B 1RRLA 2PZVA 4J9AA 2CKFB 2IA7A 1OGZA 4R80A 3AHSA 3GZRA 1Z1SA 1U8CB 2BMQB 2INXA 3OWYA 3G6E3 1IT8A 1I3IA 1RCKA 4I4KA 1DYUA 3O8YA 2SARA 1UCKA 3D4AA 3JUOA 3KIIA 1V74A 3VSYA 2F98A 5M1AA 4HM3B 1Q814 3KZTA 1GMPA 1NWWA 1O7PB 3BU4A 3LT8A 1I8VA 3NBRA 3V98A 1OHPA 1TIJA 1NNVA 2GEYA 2GU1A 4KZ1A 7RNTA 4RNZA 5G1LA 3CMA3 4N6OB 1U5OA 1LXEA 1RGEA 6RNTA 5G1KA 1ASKA 1QMAA 1UI7A 5HGRA 1GSPA 2B24B 3AGOA 3F14A 3NM2A 1IDPA 1B27A 1MWUA 1CYUA 1OF5B 4LGQA 3BB9A 1CH0A 1B2XA 3B8LA 1JN5A 1V58A 1VQN3 5EEOA 3CCJ3 3B4PA 1BSAA 2F86B 2CFDA 1MOLA 4HJLB 4KFEA 5I97A 3G713 3ER7A 2I9WA 1JJ22 3CCE3 4EBGA 1JRQA 3KN4A 4GL6A 4WP5A 4FR9A 3PGBA 4CJNA 4HM0B 5JBSA 1YNVX 1YVSA 1W6CA 3FZWA 1RCLA 3LTDA 1BRHA 3WA2X 1RGKA 1IK3A 1Q40A 3X41A 4LMIA 3CC73 3EJVA 2CWTA 4J5KA 3URPA 2QGUA 1EG9B 1M1XB 1GMQA 1EA2A 2F99A 3MG1A 5AIHA 3PZWA 2KXGA 4HM7B 4RNTA 3X3YA 1BRNL 1I2GA 4MMYB 5BVBA 2CG0A 2XEPA 1B20A 4I5QA 4KFFA 3U1WA 5D81A 1RGAA 2GBXB 4NPBA 1PY3A 3GAXA 6STDA 1VQ43 3FG1A 3KFQC 1O7GB 3MWZA 5AIIA 3RNTA 4PEJA 1KC84 3V99A 1UDII 1D6ZA 1BUQA 1T5YA 2K54A 1L5GB 1BSDA 3PYJA 4BL3A 5LC7A 2LQVA 3EC9A 3MKIA 3CC23 4OK0A 1W01A 2OTL3 4IT7A 1UUGB 1OHSA 2Z76A 1OHOA 5STDA 3FH1A 1I0XA 4HOHA 2PNCA 4XBTA 1DMQA 2XFSA 3NM7A 1BRSA 1K8A4 1KD14 1K28A 2CIUA 1RN4A 1HKXA 3SXXA 3F40A 1VZZA 1SPUA 3NQZA 3EF8A 3DGMA 3LXUX 1RRHA 3G4S3 1NB3I 4EYCA 3BNDA 1VQ83 3DGLA 1HYFA 1TTOA 3VGNA 1ULJB 4BIRA 1VQK3 2BHMA 9RNTA 2M7OA 1AVLA 1RTUA 4EC6A 1BAOA 1GD3A 2WO0A 3N8BA 4WHAA 1QJGA 3JVCA 1VQO3 1RJOA 3Q3FA 3ZFZA 5IG4A 4XBXA 1IQXA 2W03A 3LTAA 1W6GA 3FCSB 4NHFA 2AAEA 3EB8A 4XM4A 4CPKA 1FGTA 2GBWB 2HMKB 2OCTA 4H3UA 4BU4A 3S28A 5CK6A 1UUVB 4KT3B 2P0XA 2HOHA 3NBJA 2BO9B 5GSPA 1JBRA 1QAKA 3IJEB 4HYZA 2BIRA 3ROBA 1T3BA 4H61A 2W2CA 2AADA 1RDSA 3SVAA 1CEWI 1A2VA 3D5IA 3X40A 5BU4A 3CD63 2GU3A 3S27A 3V92A 4MEIA 5M19A 3FF2A 3GZYB 4HM8B 1FUWA 1BU4A 4FCJA 1BNJA 2UUGC 1UUWB 1YJ93 1ULIB 4TX4A 1VQP3 2BNGA 3OXAA 3KKGA 1N9EA 4BTXA 1KSIA 1WMOA 4KFDA 3D5GA 2C4BA 2H0IA 2YFLB 3UL6A 3RGRA 2WOFA 1WMPA 1E3VA 4HM6B 1OF5A 3I563 1RMSA 3PXMA 4HAAA 1PFPA 1LQMB 5D82A 3MHEA 3S5CA 3X42A 1I70A 1SIHA 1B3SA 1DMMA 1DVCA 2F4YA 3HIGA 1Q7Y4 1IQ8A 2ML5A 2RFRA 2QA43 2O3OA 2IYJA 1W7CA 2FNQA 3G0KA 4RNYA 1GOYA 4O3VA 2C11A 4AEQA 1R4CA 2F5WA 5IW9A 1IU7A 3UL5A 1F8NA 3LYGA 7STDA 4K1VA 1YJN3 1JNQA 1AV4A 1Q824 1OH0A 4L8OA 2ZA4A 1N5HA 1LOXA 2Z7AA 1YIT3 3BLZA 1BUJA 4N6UA 3Q90A 3OWUA 4LZIA 3NQYA 1FYSA 1LOVA 2K0MA 1LNIA 1MGWA 1UW1A 1FUSA 1YJW3 3SOYA 4R9LA 1BNRA 2Z77A 3A76A 2ML6A 1BNSA 1BNGA 1GD4A 2H0GA 3K0ZA 4GSPA 4MJDA 4N6TA 2XRXB 1YHQ3 3BNEA 3D9RA 1A2PA 2CG1A 3IPTA 2IUJA 1VQ73 1N9JA 2XR8B 1YI23 3BNCA 3T0UA 1S723 3EN1B 3FKAA 2RGQA 1RN1A 2CFKA 2V1LA 3CU3A 3AGNA 2P38A 1Y4KA 2WGOA 3NV0B 3AMOB 2CFWA 1UGHI 5FGOA 1E3RA 1UGIA 2P05A 1JKGB 1Q42A 1YGWA 1BNEA 4LSOA 4HZBB 4LYLB 3NX0A 1BSBA 2C10A 1I3FA 3GRDA 1SJWA 2LYXA 3FSDA 1OGXA 3SX1A 2CC3A 3KCHA 1WMNA 2MF7A 2F5MA 1RHLA 1RLSA 3UJMA 2UX0A 2P0MA 4FCZA 2JDIH 3G8ZA 4GB5A 1IVWA 1VQ53 1UCJA 1PU4A 3SEDA 3DUKA 2ZL8A 4RBNA 1VQL3 1ZX2A 1AY7A 3OW22 2XFTA 3EBYA 1M9GA 2H0HA 1CQSA 3EN8A 2E2VA 1TFOA 4JF8A 4CDLA 1TJDA 2FGTA 3I0YA 4X2OA 5HOHA 3CPOA 1VQ93 5KP1A 1J2BA 3SYUA 2W56B 1TU5A 3QRDA 4ORLA 1B2MA 1BRIA 2OTJ3 1BRGA 1JV2B 1BNFA 5G2GA 4KVHA 2CX1A 2FXTA 1LRAA 3NXJA 4G1MB 5ELUA 4EV5A 3U97A 2E2TA 5RNTA 1T2IA 5AIGA 1TFKA 1BRKA 1A67A 3CXC2 2CH9A 3K63A 3CCU3 1W00A 1B21A 4MMZB 5DRVA 3DM8A 1Q7HA 1SIIA 3KSED 4NREA 4HM2B 1RSNA 1BRJA 3B4OA 3VF1A 1KWIA 1NO3A 2Y74A 3F8XA 3D3LA 4WYKB 1IVUA 4EXRA 2KAAA 1N8R4 1YVBI 5KP4A 1TUHA 3N9HA 3S67A 3EX9A 1JB5A 1GYBA 2GSPA 1FA3A 4OUQA 1US1A 1FGQA 1EUIC 5BXQA 3ALAA 3LT9A 5CLKA 4LEHA 3FG4A 3LH4A 3KSPA 1BSEA 1RNBA 1OACA 2HMNB 4Q53A 2UGIA 2WOHA 1O7NB 1ZS7A 1BNIA 1NJI4 2KRTA 3F7XA 3CME3 1IT7A 2RNTA 4HM4B 3DGOA
chains in the Genus database with same CATH topology
1STFI 1EQKA 3CCQ3 2YFIB 2BMRB 2P09A 3CPW2 4BTYA 4STDA 3FLJA 3HI7A 3EE1A 5IEOA 5AEWB 2GXFA 4L7KA 3CNMA 1LVNA 3WOEB 1G96A 1A2KA 1NDOB 4XBYA 2W04A 3DY5A 4HVNA 3WDGB 4FMBA 1O7WB 3FG3A 5CF1A 1K9M4 5CXOA 4JRFA 1M904 1Q864 3WOFB 4XDWA 2D1WA 2RSXA 1FGRA 3NV0A 3SOAA 5IG5A 1QVG2 3AMOA 3SLUA 2OWPA 3LTBA 2R4IA 3B7CA 4X2HA 1JKGA 3E99A 5JPUA 3EBTA 4N6V0 1YIJ3 3JUMA 4BTWA 2W0QA 3CC43 3NBBA 3GWRA 3KE7A 1K41A 2IUKA 3K9MC 5AYRB 3CNXA 2ZDJA 3G16A 3JUPA 2WGQA 1E97A 3HX8A 3OWSA 3UNLA 3S29A 3I553 4R1KA 1ROAA 1GY5A 2XSHB 3X3XA 2KCDA 3Q1CA 3PS8A 5TGNA 5AYSC 2YX9A 5LC6A 1D6YA 4OVMA 3HIIA 1W2ZA 3K5TA 1ROVA 1C7HA 1ZO2A 4FMAA 2W56A 2OQEA 3H51A 1DMNA 1GS3A 2HMMB 3LTCA 3HZPA 4XDVA 2W9QA 4R9KA 3M8CA 3MPHA 5IG0A 4ZM8A 2OQEC 4IIAA 1O7HB 3EHCA 5KP3A 1RN7A 3WA3A 1RKYA 1STDA 2O9UX 5AEUB 3F9SA 3GZBA 4HM5B 4HBRA 3LZAA 4WYKA 5IERA 2BT3A 3T8NA 2QIYA 1N5PA 1W02A 2XH9A 3J7Yd 1W5ZA 4FMCA 4N6NB 2YFJB 1NB5I 3X3ZA 2MC8A 1ISKA 4L8PA 1IV9A 1NU3A 3MG3A 3PCSA 4FCMA 1QAFA 4U13A 1L5GB 1JB4A 3K7CA 3NHXA 2XSOB 4MMXB 5AI1A 5AIFA 4R4KA 3JUNA 4J8TA 4HZ9B 4N6MA 3CCM3 2W6JH 3MYTA 2HMJB 1O7MB 5FW5A 1IQYA 3CCR3 1QALA 1QVF2 4AKYA 3F7SA 3LMLA 4XB5A 3DXOA 2SBLA 1OCVA 4FMDA 3H3HA 3RGAA 5EVHA 4WWUC 3DZLA 1GY7A 2XF3A 3GZXB 1OUNA 2E2UA 2OOVA 1W2B2 2HMOB 1WNHA 5DREA 2QEX3 1IVVA 1YGEA 2D42A 1A90A 3FGYA 1AR0A 2L4VA 1MNLA 2Z6BA 2OOVC 3DGNA 3IMAB 1SQWA 1JN5B 2CFGA 1WTHA 1WQLB 3EQQB 1W6YA 3DMCA 1EKMA 2GEXA 5CF2A 4HKVB 1VQ63 2CW9A 4QWTA 2Q07A 5IG3A 5IENA 3STDA 1IVXA 1K734 3WMDA 5JPPA 1UI8A 3NUVA 3UB1A 3RDEA 4HM1B 2W9PA 1Q40B 1GY6A 1M1K4 1FGOA 3MG2A 4O2HA 1N8QA 1S5AA 3LOYA 4K1UA 3JUQA 3CCL3 1DVDA 1OPYA 3BNBA 1IV7A 1CYVA 3CCS3 5IEPA 3OX9A 2HMLB 3QK9A 4N6LA 1TP6A 5EQLA 2CWUA 1JB2A 2BMOB 1D6UA 5D83A 2CHCA 1FGMA 3Q2PA 2XGLA 1W4NA 5A0OB 1AVKA 4O8SA 2IMJA 1VQM3 3ECFA 3PCRA 3CCV3 1KQS2 4CCVA 3F8HA 3N54B 3WODG 2A15A 3T8UA 4WFOA 4K90B 3FF0A 1HU9A 3OV4A 2CFLA 4IPBA 1LNHA 2CK3H 8CHOA 2STDA 2RCDA 2Y73A 5ELJA 4K61A 2B1XB 4AKZA 2XGNA 3MSOA 4EV2A 3TDGA 2CWVA 3HK4A 4N3VA 2JQ5A 3L0RA 5IF6A 4RZMA 4O02B 1RRLA 2PZVA 4J9AA 2CKFB 2IA7A 1OGZA 4R80A 3GZRA 1Z1SA 1U8CB 2BMQB 2INXA 3OWYA 3G6E3 1IT8A 4I4KA 1DYUA 3O8YA 3JUOA 3VSYA 3KIIA 1V74A 2F98A 4HM3B 1Q814 3KZTA 1NWWA 1O7PB 3LT8A 3NBRA 3V98A 1OHPA 1TIJA 2GEYA 2GU1A 4KZ1A 4RNZA 3CMA3 4N6OB 1U5OA 1LXEA 1ASKA 1QMAA 1UI7A 5HGRA 2B24B 3F14A 3NM2A 1IDPA 1CYUA 1OF5B 4LGQA 3BB9A 3B8LA 1JN5A 1VQN3 5EEOA 3CCJ3 3B4PA 2F86B 2CFDA 1MOLA 4HJLB 4KFEA 5I97A 3G713 3ER7A 2I9WA 1JJ22 3CCE3 4EBGA 1JRQA 3KN4A 4GL6A 4WP5A 4FR9A 3PGBA 4HM0B 5JBSA 1YHQ3 1W6CA 3FZWA 3LTDA 3WA2X 1IK3A 1Q40A 3X41A 4LMIA 3CC73 3EJVA 2CWTA 2QGUA 1EG9B 1M1XB 2F99A 1EA2A 3MG1A 5AIHA 3PZWA 2KXGA 4HM7B 3X3YA 4MMYB 5BVBA 2CG0A 2XEPA 4KFFA 3U1WA 5D81A 2GBXB 1VQ43 3GAXA 6STDA 3FG1A 3KFQC 1O7GB 3MWZA 5AIIA 4PEJA 1KC84 3V99A 1D6ZA 1BUQA 1T5YA 2K54A 3CC23 3PYJA 5LC7A 2LQVA 3EC9A 3MKIA 4OK0A 1W01A 2OTL3 4IT7A 1OHSA 2Z76A 1OHOA 5STDA 3FH1A 2PNCA 4XBTA 1DMQA 2XFSA 3NM7A 1KD14 1K8A4 1K28A 2CIUA 1HKXA 3SXXA 3F40A 1VZZA 1SPUA 3NQZA 3EF8A 3DGMA 3LXUX 1RRHA 3G4S3 1NB3I 4EYCA 3BNDA 1VQ83 3DGLA 3VGNA 1ULJB 1VQK3 2BHMA 2M7OA 1AVLA 4EC6A 1GD3A 2WO0A 3N8BA 4WHAA 1QJGA 3JVCA 1VQO3 1RJOA 5IG4A 4XBXA 1IQXA 2W03A 3LTAA 1W6GA 3FCSB 4NHFA 3EB8A 4XM4A 1FGTA 2GBWB 2HMKB 2OCTA 4H3UA 3S28A 5CK6A 1UUVB 2P0XA 3NBJA 2BO9B 1QAKA 3IJEB 4HYZA 3ROBA 4H61A 2W2CA 3SVAA 1CEWI 1A2VA 3X40A 3CD63 2GU3A 3S27A 3V92A 4MEIA 3FF2A 3GZYB 4HM8B 1FUWA 4FCJA 1UUWB 1YJ93 1ULIB 4TX4A 1VQP3 2BNGA 3OXAA 3KKGA 1N9EA 4BTXA 1KSIA 1WMOA 4KFDA 2YFLB 3UL6A 3RGRA 2WOFA 1WMPA 1E3VA 4HM6B 1OF5A 3I563 3PXMA 1PFPA 5D82A 3MHEA 3S5CA 3X42A 1SIHA 1DMMA 1DVCA 3HIGA 1Q7Y4 1IQ8A 2ML5A 2RFRA 2QA43 2O3OA 1W7CA 2FNQA 3G0KA 4RNYA 4O3VA 2C11A 4AEQA 1R4CA 5IW9A 1IU7A 3UL5A 1F8NA 3LYGA 7STDA 4K1VA 1YJN3 1JNQA 1AV4A 1Q824 1OH0A 4L8OA 1N5HA 1LOXA 2Z7AA 1YIT3 3BLZA 4N6UA 3Q90A 3OWUA 4LZIA 3NQYA 2K0MA 1UW1A 1YJW3 3SOYA 4R9LA 2Z77A 3A76A 2ML6A 1GD4A 4MJDA 3K0ZA 4N6TA 2XRXB 3BNEA 3D9RA 2CG1A 2IUJA 3IPTA 1VQ73 1N9JA 2XR8B 1YI23 3BNCA 3T0UA 1S723 3EN1B 3FKAA 2RGQA 3CU3A 2CFKA 2V1LA 2P38A 1Y4KA 2WGOA 3NV0B 3AMOB 2CFWA 5FGOA 1E3RA 2P05A 1JKGB 1Q42A 4LSOA 4HZBB 3NX0A 2C10A 3GRDA 1SJWA 2LYXA 3FSDA 1OGXA 3SX1A 2CC3A 1WMNA 2MF7A 3UJMA 2UX0A 2P0MA 4FCZA 2JDIH 3G8ZA 4GB5A 1IVWA 1VQ53 1PU4A 3SEDA 3DUKA 2ZL8A 4RBNA 1VQL3 1ZX2A 3OW22 2XFTA 3EBYA 1M9GA 1CQSA 3EN8A 2E2VA 1TFOA 4JF8A 4CDLA 2FGTA 3I0YA 4X2OA 3CPOA 1VQ93 5KP1A 1J2BA 2W56B 1TU5A 3QRDA 4ORLA 2OTJ3 1JV2B 5G2GA 4KVHA 2FXTA 3NXJA 4G1MB 5ELUA 4EV5A 3U97A 2E2TA 5AIGA 1TFKA 1A67A 3CXC2 2CH9A 3K63A 3CCU3 1W00A 4MMZB 5DRVA 3DM8A 1SIIA 3KSED 4NREA 4HM2B 3B4OA 3VF1A 1KWIA 1NO3A 2Y74A 3F8XA 3D3LA 4WYKB 1IVUA 4EXRA 1N8R4 1YVBI 5KP4A 1TUHA 3N9HA 3S67A 3EX9A 1JB5A 1GYBA 1FA3A 4OUQA 1US1A 1FGQA 5BXQA 3ALAA 3LT9A 5CLKA 4LEHA 3FG4A 3LH4A 3KSPA 1OACA 2HMNB 4Q53A 2WOHA 1O7NB 1NJI4 2KRTA 3F7XA 3CME3 1IT7A 4HM4B 3DGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PCS A;  4FMB A;  4FMA A;  4FMD A;  3EB8 A;  3Q1C A;  3EE1 A;  3PCR A;  4FMC A; 
#chains in the Genus database with same CATH topology
 1STF I;  1EQK A;  3CCQ 3;  2YFI B;  1T2H A;  4ILF A;  2BMR B;  2J8X B;  2P09 A;  3CPW 2;  1X1X A;  4BTY A;  4STD A;  3FLJ A;  3HI7 A;  1G0T A;  3EE1 A;  5IEO A;  5AEW B;  2GXF A;  4L7K A;  3CNM A;  1LVN A;  3WOE B;  4EW5 A;  1G96 A;  1A2K A;  1NDO B;  1LQG C;  2W04 A;  4XBY A;  3DY5 A;  4DKI A;  1SAR A;  1DE3 A;  1LOW A;  1RGH A;  4HVN A;  3WDG B;  1R4Y A;  4FMB A;  1O7W B;  1GOV A;  3FG3 A;  5CF1 A;  1K9M 4;  5CXO A;  1HZ1 A;  4JRF A;  1M90 4;  1Q86 4;  3WOF B;  4XDW A;  2D1W A;  2RSX A;  1FGR A;  3NV0 A;  3SOA A;  3GSP A;  5IG5 A;  3AMO A;  5BIR A;  1FUT A;  1QVG 2;  3SLU A;  2KF4 A;  2OWP A;  2R4I A;  3B7C A;  3LTB A;  4X2H A;  1JKG A;  1TRQ A;  3E99 A;  5JPU A;  3EBT A;  4N6V 0;  1YIJ 3;  3JUM A;  4BTW A;  2W0Q A;  3D79 A;  3CC4 3;  3NBB A;  3GWR A;  3KE7 A;  1K41 A;  2IUK A;  3K9M C;  4J5G A;  5AYR B;  2L1S A;  3WHO A;  3CNX A;  2ZDJ A;  3G16 A;  3JUP A;  2WGQ A;  1E97 A;  3HX8 A;  3OWS A;  3UNL A;  3S29 A;  3I55 3;  4R1K A;  1ROA A;  3AHW A;  1GY5 A;  2XSH B;  1UCL A;  3X3X A;  1RGF A;  1I2E A;  2KCD A;  3PS8 A;  3Q1C A;  5TGN A;  5AYS C;  1EEJ A;  1MWR A;  2YX9 A;  3DH2 A;  5LC6 A;  1D6Y A;  4OVM A;  3HII A;  1W2Z A;  3A5E A;  3K5T A;  1ROV A;  1C7H A;  1ZO2 A;  4FMA A;  2W56 A;  2OQE A;  3H51 A;  1DMN A;  1GS3 A;  1MWT A;  1DET A;  2HMM B;  3LTC A;  4BL2 A;  6GSP A;  3HZP A;  4XDV A;  2W9Q A;  4R9K A;  2KF5 A;  3M8C A;  3MPH A;  5IG0 A;  1BSC A;  4ZM8 A;  2OQE C;  4IIA A;  1O7H B;  2BU4 A;  3EHC A;  5KP3 A;  1RN7 A;  1X1U A;  3WA3 A;  1RKY A;  1STD A;  2O9U X;  5AEU B;  3F9S A;  3GZB A;  1GOU A;  4HM5 B;  4HBR A;  3LZA A;  1BOX A;  2IY2 A;  4WYK A;  1B2Z A;  5IER A;  2BT3 A;  3T8N A;  2QIY A;  1N5P A;  1W02 A;  2XH9 A;  3J7Y d;  1W5Z A;  4FMC A;  4N6N B;  2YFJ B;  1NB5 I;  1LOY A;  3X3Z A;  2MC8 A;  1ISK A;  4GHO A;  4L8P A;  1IV9 A;  1NU3 A;  3MG3 A;  3PCS A;  1RGL A;  1QAF A;  4FCM A;  4U13 A;  1JB4 A;  3K7C A;  3NHX A;  1JBS A;  2XSO B;  4MMX B;  5AI1 A;  5AIF A;  4R4K A;  2K3D A;  3JUN A;  1JBT A;  1TRP A;  4J8T A;  4HZ9 B;  4N6M A;  3CCM 3;  2W6J H;  3MYT A;  2RBI A;  2HMJ B;  1O7M B;  5FW5 A;  1IQY A;  3CCR 3;  1QAL A;  1QVF 2;  4AKY A;  3F7S A;  3LML A;  8RNT A;  4XB5 A;  3DXO A;  2SBL A;  1OCV A;  4FMD A;  3H3H A;  3RGA A;  5EVH A;  4WWU C;  3ZG5 A;  3DZL A;  1GY7 A;  2XF3 A;  3GZX B;  1OUN A;  2E2U A;  1FW7 A;  2OOV A;  2ZHX B;  1W2B 2;  1WNH A;  2HMO B;  1JZO A;  5DRE A;  2QEX 3;  1IVV A;  1BGS A;  1YGE A;  2D42 A;  1A90 A;  1ZGX A;  1AR0 A;  2L4V A;  3FGY A;  1MNL A;  2Z6B A;  2OOV C;  3DGN A;  3IMA B;  1SQW A;  1B2S A;  1JN5 B;  1WTH A;  2CFG A;  1WQL B;  3EQQ B;  1W6Y A;  3DMC A;  1EKM A;  2GEX A;  5CF2 A;  4HKV B;  1VQ6 3;  1UCI A;  2CW9 A;  4QWT A;  1VQQ A;  2Q07 A;  3ZG0 A;  5IG3 A;  5IEN A;  1BAN A;  3STD A;  1IVX A;  1K73 4;  3WMD A;  1B2U A;  5JPP A;  1UI8 A;  1AQZ A;  3NUV A;  3UB1 A;  3RDE A;  4HM1 B;  1X1W A;  2W9P A;  1Q40 B;  7GSP A;  1GY6 A;  1BIR A;  1M1K 4;  1FGO A;  3MG2 A;  4O2H A;  1N8Q A;  2F56 A;  1PYL A;  1S5A A;  3LOY A;  1RGC A;  4K1U A;  3JUQ A;  3CCL 3;  1DVD A;  1MWS A;  1OPY A;  2R41 A;  1IV7 A;  1CYV A;  3BNB A;  5IEP A;  3CCS 3;  3OX9 A;  2HML B;  3QK9 A;  4N6L A;  1Q9E A;  1TP6 A;  5EQL A;  2CWU A;  1JB2 A;  2BMO B;  1D6U A;  3WR2 A;  5D83 A;  2CHC A;  1FGM A;  3Q2P A;  2XGL A;  1I2F A;  1V57 A;  1W4N A;  1GMR A;  2CX0 A;  5A0O B;  5M18 A;  1AVK A;  4O8S A;  1RNT A;  2IMJ A;  1VQM 3;  2KF6 A;  1X1Y A;  3ECF A;  3PCR A;  1FZU A;  3CCV 3;  1KQS 2;  1MGR A;  4CCV A;  1C54 A;  3F8H A;  3N54 B;  3HOH A;  2A15 A;  3T8U A;  3WOD G;  4WFO A;  4K90 B;  3FF0 A;  1HU9 A;  1I0V A;  3OV4 A;  3DGY A;  1RGG A;  2KF3 A;  2CFL A;  4IPB A;  1LNH A;  2CK3 H;  8CHO A;  2STD A;  2RCD A;  2Y73 A;  1IYY A;  3BIR A;  5ELJ A;  4K61 A;  1G02 A;  2B1X B;  4AKZ A;  2XGN A;  3MSO A;  4EV2 A;  3TDG A;  2CWV A;  3HK4 A;  4N3V A;  1JZD A;  1BVI A;  2JQ5 A;  3L0R A;  4RZM A;  5IF6 A;  4O02 B;  1RRL A;  2PZV A;  4J9A A;  2CKF B;  2IA7 A;  1OGZ A;  4R80 A;  3AHS A;  3GZR A;  1Z1S A;  1U8C B;  2BMQ B;  2INX A;  3OWY A;  3G6E 3;  1IT8 A;  1I3I A;  1RCK A;  4I4K A;  1DYU A;  3O8Y A;  2SAR A;  1UCK A;  3D4A A;  3JUO A;  3KII A;  1V74 A;  3VSY A;  2F98 A;  5M1A A;  4HM3 B;  1Q81 4;  3KZT A;  1GMP A;  1NWW A;  1O7P B;  3BU4 A;  3LT8 A;  1I8V A;  3NBR A;  3V98 A;  1OHP A;  1TIJ A;  1NNV A;  2GEY A;  2GU1 A;  4KZ1 A;  7RNT A;  4RNZ A;  5G1L A;  3CMA 3;  4N6O B;  1U5O A;  1LXE A;  1RGE A;  6RNT A;  5G1K A;  1ASK A;  1QMA A;  1UI7 A;  5HGR A;  1GSP A;  2B24 B;  3AGO A;  3F14 A;  3NM2 A;  1IDP A;  1B27 A;  1MWU A;  1CYU A;  1OF5 B;  4LGQ A;  3BB9 A;  1CH0 A;  1B2X A;  3B8L A;  1JN5 A;  1V58 A;  1VQN 3;  5EEO A;  3CCJ 3;  3B4P A;  1BSA A;  2F86 B;  2CFD A;  1MOL A;  4HJL B;  4KFE A;  5I97 A;  3G71 3;  3ER7 A;  2I9W A;  1JJ2 2;  3CCE 3;  4EBG A;  1JRQ A;  3KN4 A;  4GL6 A;  4WP5 A;  4FR9 A;  3PGB A;  4CJN A;  4HM0 B;  5JBS A;  1YNV X;  1YVS A;  1W6C A;  3FZW A;  1RCL A;  3LTD A;  1BRH A;  3WA2 X;  1RGK A;  1IK3 A;  1Q40 A;  3X41 A;  4LMI A;  3CC7 3;  3EJV A;  2CWT A;  4J5K A;  3URP A;  2QGU A;  1EG9 B;  1M1X B;  1GMQ A;  1EA2 A;  2F99 A;  3MG1 A;  5AIH A;  3PZW A;  2KXG A;  4HM7 B;  4RNT A;  3X3Y A;  1BRN L;  1I2G A;  4MMY B;  5BVB A;  2CG0 A;  2XEP A;  1B20 A;  4I5Q A;  4KFF A;  3U1W A;  5D81 A;  1RGA A;  2GBX B;  4NPB A;  1PY3 A;  3GAX A;  6STD A;  1VQ4 3;  3FG1 A;  3KFQ C;  1O7G B;  3MWZ A;  5AII A;  3RNT A;  4PEJ A;  1KC8 4;  3V99 A;  1UDI I;  1D6Z A;  1BUQ A;  1T5Y A;  2K54 A;  1L5G B;  1BSD A;  3PYJ A;  4BL3 A;  5LC7 A;  2LQV A;  3EC9 A;  3MKI A;  3CC2 3;  4OK0 A;  1W01 A;  2OTL 3;  4IT7 A;  1UUG B;  1OHS A;  2Z76 A;  1OHO A;  5STD A;  3FH1 A;  1I0X A;  4HOH A;  2PNC A;  4XBT A;  1DMQ A;  2XFS A;  3NM7 A;  1BRS A;  1K8A 4;  1KD1 4;  1K28 A;  2CIU A;  1RN4 A;  1HKX A;  3SXX A;  3F40 A;  1VZZ A;  1SPU A;  3NQZ A;  3EF8 A;  3DGM A;  3LXU X;  1RRH A;  3G4S 3;  1NB3 I;  4EYC A;  3BND A;  1VQ8 3;  3DGL A;  1HYF A;  1TTO A;  3VGN A;  1ULJ B;  4BIR A;  1VQK 3;  2BHM A;  9RNT A;  2M7O A;  1AVL A;  1RTU A;  4EC6 A;  1BAO A;  1GD3 A;  2WO0 A;  3N8B A;  4WHA A;  1QJG A;  3JVC A;  1VQO 3;  1RJO A;  3Q3F A;  3ZFZ A;  5IG4 A;  4XBX A;  1IQX A;  2W03 A;  3LTA A;  1W6G A;  3FCS B;  4NHF A;  2AAE A;  3EB8 A;  4XM4 A;  4CPK A;  1FGT A;  2GBW B;  2HMK B;  2OCT A;  4H3U A;  4BU4 A;  3S28 A;  5CK6 A;  1UUV B;  4KT3 B;  2P0X A;  2HOH A;  3NBJ A;  2BO9 B;  5GSP A;  1JBR A;  1QAK A;  3IJE B;  4HYZ A;  2BIR A;  3ROB A;  1T3B A;  4H61 A;  2W2C A;  2AAD A;  1RDS A;  3SVA A;  1CEW I;  1A2V A;  3D5I A;  3X40 A;  5BU4 A;  3CD6 3;  2GU3 A;  3S27 A;  3V92 A;  4MEI A;  5M19 A;  3FF2 A;  3GZY B;  4HM8 B;  1FUW A;  1BU4 A;  4FCJ A;  1BNJ A;  2UUG C;  1UUW B;  1YJ9 3;  1ULI B;  4TX4 A;  1VQP 3;  2BNG A;  3OXA A;  3KKG A;  1N9E A;  4BTX A;  1KSI A;  1WMO A;  4KFD A;  3D5G A;  2C4B A;  2H0I A;  2YFL B;  3UL6 A;  3RGR A;  2WOF A;  1WMP A;  1E3V A;  4HM6 B;  1OF5 A;  3I56 3;  1RMS A;  3PXM A;  4HAA A;  1PFP A;  1LQM B;  5D82 A;  3MHE A;  3S5C A;  3X42 A;  1I70 A;  1SIH A;  1B3S A;  1DMM A;  1DVC A;  2F4Y A;  3HIG A;  1Q7Y 4;  1IQ8 A;  2ML5 A;  2RFR A;  2QA4 3;  2O3O A;  2IYJ A;  1W7C A;  2FNQ A;  3G0K A;  4RNY A;  1GOY A;  4O3V A;  2C11 A;  4AEQ A;  1R4C A;  2F5W A;  5IW9 A;  1IU7 A;  3UL5 A;  1F8N A;  3LYG A;  7STD A;  4K1V A;  1YJN 3;  1JNQ A;  1AV4 A;  1Q82 4;  1OH0 A;  4L8O A;  2ZA4 A;  1N5H A;  1LOX A;  2Z7A A;  1YIT 3;  3BLZ A;  1BUJ A;  4N6U A;  3Q90 A;  3OWU A;  4LZI A;  3NQY A;  1FYS A;  1LOV A;  2K0M A;  1LNI A;  1MGW A;  1UW1 A;  1FUS A;  1YJW 3;  3SOY A;  4R9L A;  1BNR A;  2Z77 A;  3A76 A;  2ML6 A;  1BNS A;  1BNG A;  1GD4 A;  2H0G A;  3K0Z A;  4GSP A;  4MJD A;  4N6T A;  2XRX B;  1YHQ 3;  3BNE A;  3D9R A;  1A2P A;  2CG1 A;  3IPT A;  2IUJ A;  1VQ7 3;  1N9J A;  2XR8 B;  1YI2 3;  3BNC A;  3T0U A;  1S72 3;  3EN1 B;  3FKA A;  2RGQ A;  1RN1 A;  2CFK A;  2V1L A;  3CU3 A;  3AGN A;  2P38 A;  1Y4K A;  2WGO A;  3NV0 B;  3AMO B;  2CFW A;  1UGH I;  5FGO A;  1E3R A;  1UGI A;  2P05 A;  1JKG B;  1Q42 A;  1YGW A;  1BNE A;  4LSO A;  4HZB B;  4LYL B;  3NX0 A;  1BSB A;  2C10 A;  1I3F A;  3GRD A;  1SJW A;  2LYX A;  3FSD A;  1OGX A;  3SX1 A;  2CC3 A;  3KCH A;  1WMN A;  2MF7 A;  2F5M A;  1RHL A;  1RLS A;  3UJM A;  2UX0 A;  2P0M A;  4FCZ A;  2JDI H;  3G8Z A;  4GB5 A;  1IVW A;  1VQ5 3;  1UCJ A;  1PU4 A;  3SED A;  3DUK A;  2ZL8 A;  4RBN A;  1VQL 3;  1ZX2 A;  1AY7 A;  3OW2 2;  2XFT A;  3EBY A;  1M9G A;  2H0H A;  1CQS A;  3EN8 A;  2E2V A;  1TFO A;  4JF8 A;  4CDL A;  1TJD A;  2FGT A;  3I0Y A;  4X2O A;  5HOH A;  3CPO A;  1VQ9 3;  5KP1 A;  1J2B A;  3SYU A;  2W56 B;  1TU5 A;  3QRD A;  4ORL A;  1B2M A;  1BRI A;  2OTJ 3;  1BRG A;  1JV2 B;  1BNF A;  5G2G A;  4KVH A;  2CX1 A;  2FXT A;  1LRA A;  3NXJ A;  4G1M B;  5ELU A;  4EV5 A;  3U97 A;  2E2T A;  5RNT A;  1T2I A;  5AIG A;  1TFK A;  1BRK A;  1A67 A;  3CXC 2;  2CH9 A;  3K63 A;  3CCU 3;  1W00 A;  1B21 A;  4MMZ B;  5DRV A;  3DM8 A;  1Q7H A;  1SII A;  3KSE D;  4NRE A;  4HM2 B;  1RSN A;  1BRJ A;  3B4O A;  3VF1 A;  1KWI A;  1NO3 A;  2Y74 A;  3F8X A;  3D3L A;  4WYK B;  1IVU A;  4EXR A;  2KAA A;  1N8R 4;  1YVB I;  5KP4 A;  1TUH A;  3N9H A;  3S67 A;  3EX9 A;  1JB5 A;  1GYB A;  2GSP A;  1FA3 A;  4OUQ A;  1US1 A;  1FGQ A;  1EUI C;  5BXQ A;  3ALA A;  3LT9 A;  5CLK A;  4LEH A;  3FG4 A;  3LH4 A;  3KSP A;  1BSE A;  1RNB A;  1OAC A;  2HMN B;  4Q53 A;  2UGI A;  2WOH A;  1O7N B;  1ZS7 A;  1BNI A;  1NJI 4;  2KRT A;  3F7X A;  3CME 3;  1IT7 A;  2RNT A;  4HM4 B;  3DGO A; 
#chains in the Genus database with same CATH homology
 1STF I;  1EQK A;  3CCQ 3;  2YFI B;  2BMR B;  2P09 A;  3CPW 2;  4BTY A;  4STD A;  3FLJ A;  3HI7 A;  3EE1 A;  5IEO A;  5AEW B;  2GXF A;  4L7K A;  3CNM A;  1LVN A;  3WOE B;  1G96 A;  1A2K A;  1NDO B;  4XBY A;  2W04 A;  3DY5 A;  4HVN A;  3WDG B;  4FMB A;  1O7W B;  3FG3 A;  5CF1 A;  1K9M 4;  5CXO A;  4JRF A;  1M90 4;  1Q86 4;  3WOF B;  4XDW A;  2D1W A;  2RSX A;  1FGR A;  3NV0 A;  3SOA A;  5IG5 A;  1QVG 2;  3AMO A;  3SLU A;  2OWP A;  3LTB A;  2R4I A;  3B7C A;  4X2H A;  1JKG A;  3E99 A;  5JPU A;  3EBT A;  4N6V 0;  1YIJ 3;  3JUM A;  4BTW A;  2W0Q A;  3CC4 3;  3NBB A;  3GWR A;  3KE7 A;  1K41 A;  2IUK A;  3K9M C;  5AYR B;  3CNX A;  2ZDJ A;  3G16 A;  3JUP A;  2WGQ A;  1E97 A;  3HX8 A;  3OWS A;  3UNL A;  3S29 A;  3I55 3;  4R1K A;  1ROA A;  1GY5 A;  2XSH B;  3X3X A;  2KCD A;  3Q1C A;  3PS8 A;  5TGN A;  5AYS C;  2YX9 A;  5LC6 A;  1D6Y A;  4OVM A;  3HII A;  1W2Z A;  3K5T A;  1ROV A;  1C7H A;  1ZO2 A;  4FMA A;  2W56 A;  2OQE A;  3H51 A;  1DMN A;  1GS3 A;  2HMM B;  3LTC A;  3HZP A;  4XDV A;  2W9Q A;  4R9K A;  3M8C A;  3MPH A;  5IG0 A;  4ZM8 A;  2OQE C;  4IIA A;  1O7H B;  3EHC A;  5KP3 A;  1RN7 A;  3WA3 A;  1RKY A;  1STD A;  2O9U X;  5AEU B;  3F9S A;  3GZB A;  4HM5 B;  4HBR A;  3LZA A;  4WYK A;  5IER A;  2BT3 A;  3T8N A;  2QIY A;  1N5P A;  1W02 A;  2XH9 A;  3J7Y d;  1W5Z A;  4FMC A;  4N6N B;  2YFJ B;  1NB5 I;  3X3Z A;  2MC8 A;  1ISK A;  4L8P A;  1IV9 A;  1NU3 A;  3MG3 A;  3PCS A;  4FCM A;  1QAF A;  4U13 A;  1L5G B;  1JB4 A;  3K7C A;  3NHX A;  2XSO B;  4MMX B;  5AI1 A;  5AIF A;  4R4K A;  3JUN A;  4J8T A;  4HZ9 B;  4N6M A;  3CCM 3;  2W6J H;  3MYT A;  2HMJ B;  1O7M B;  5FW5 A;  1IQY A;  3CCR 3;  1QAL A;  1QVF 2;  4AKY A;  3F7S A;  3LML A;  4XB5 A;  3DXO A;  2SBL A;  1OCV A;  4FMD A;  3H3H A;  3RGA A;  5EVH A;  4WWU C;  3DZL A;  1GY7 A;  2XF3 A;  3GZX B;  1OUN A;  2E2U A;  2OOV A;  1W2B 2;  2HMO B;  1WNH A;  5DRE A;  2QEX 3;  1IVV A;  1YGE A;  2D42 A;  1A90 A;  3FGY A;  1AR0 A;  2L4V A;  1MNL A;  2Z6B A;  2OOV C;  3DGN A;  3IMA B;  1SQW A;  1JN5 B;  2CFG A;  1WTH A;  1WQL B;  3EQQ B;  1W6Y A;  3DMC A;  1EKM A;  2GEX A;  5CF2 A;  4HKV B;  1VQ6 3;  2CW9 A;  4QWT A;  2Q07 A;  5IG3 A;  5IEN A;  3STD A;  1IVX A;  1K73 4;  3WMD A;  5JPP A;  1UI8 A;  3NUV A;  3UB1 A;  3RDE A;  4HM1 B;  2W9P A;  1Q40 B;  1GY6 A;  1M1K 4;  1FGO A;  3MG2 A;  4O2H A;  1N8Q A;  1S5A A;  3LOY A;  4K1U A;  3JUQ A;  3CCL 3;  1DVD A;  1OPY A;  3BNB A;  1IV7 A;  1CYV A;  3CCS 3;  5IEP A;  3OX9 A;  2HML B;  3QK9 A;  4N6L A;  1TP6 A;  5EQL A;  2CWU A;  1JB2 A;  2BMO B;  1D6U A;  5D83 A;  2CHC A;  1FGM A;  3Q2P A;  2XGL A;  1W4N A;  5A0O B;  1AVK A;  4O8S A;  2IMJ A;  1VQM 3;  3ECF A;  3PCR A;  3CCV 3;  1KQS 2;  4CCV A;  3F8H A;  3N54 B;  3WOD G;  2A15 A;  3T8U A;  4WFO A;  4K90 B;  3FF0 A;  1HU9 A;  3OV4 A;  2CFL A;  4IPB A;  1LNH A;  2CK3 H;  8CHO A;  2STD A;  2RCD A;  2Y73 A;  5ELJ A;  4K61 A;  2B1X B;  4AKZ A;  2XGN A;  3MSO A;  4EV2 A;  3TDG A;  2CWV A;  3HK4 A;  4N3V A;  2JQ5 A;  3L0R A;  5IF6 A;  4RZM A;  4O02 B;  1RRL A;  2PZV A;  4J9A A;  2CKF B;  2IA7 A;  1OGZ A;  4R80 A;  3GZR A;  1Z1S A;  1U8C B;  2BMQ B;  2INX A;  3OWY A;  3G6E 3;  1IT8 A;  4I4K A;  1DYU A;  3O8Y A;  3JUO A;  3VSY A;  3KII A;  1V74 A;  2F98 A;  4HM3 B;  1Q81 4;  3KZT A;  1NWW A;  1O7P B;  3LT8 A;  3NBR A;  3V98 A;  1OHP A;  1TIJ A;  2GEY A;  2GU1 A;  4KZ1 A;  4RNZ A;  3CMA 3;  4N6O B;  1U5O A;  1LXE A;  1ASK A;  1QMA A;  1UI7 A;  5HGR A;  2B24 B;  3F14 A;  3NM2 A;  1IDP A;  1CYU A;  1OF5 B;  4LGQ A;  3BB9 A;  3B8L A;  1JN5 A;  1VQN 3;  5EEO A;  3CCJ 3;  3B4P A;  2F86 B;  2CFD A;  1MOL A;  4HJL B;  4KFE A;  5I97 A;  3G71 3;  3ER7 A;  2I9W A;  1JJ2 2;  3CCE 3;  4EBG A;  1JRQ A;  3KN4 A;  4GL6 A;  4WP5 A;  4FR9 A;  3PGB A;  4HM0 B;  5JBS A;  1YHQ 3;  1W6C A;  3FZW A;  3LTD A;  3WA2 X;  1IK3 A;  1Q40 A;  3X41 A;  4LMI A;  3CC7 3;  3EJV A;  2CWT A;  2QGU A;  1EG9 B;  1M1X B;  2F99 A;  1EA2 A;  3MG1 A;  5AIH A;  3PZW A;  2KXG A;  4HM7 B;  3X3Y A;  4MMY B;  5BVB A;  2CG0 A;  2XEP A;  4KFF A;  3U1W A;  5D81 A;  2GBX B;  1VQ4 3;  3GAX A;  6STD A;  3FG1 A;  3KFQ C;  1O7G B;  3MWZ A;  5AII A;  4PEJ A;  1KC8 4;  3V99 A;  1D6Z A;  1BUQ A;  1T5Y A;  2K54 A;  3CC2 3;  3PYJ A;  5LC7 A;  2LQV A;  3EC9 A;  3MKI A;  4OK0 A;  1W01 A;  2OTL 3;  4IT7 A;  1OHS A;  2Z76 A;  1OHO A;  5STD A;  3FH1 A;  2PNC A;  4XBT A;  1DMQ A;  2XFS A;  3NM7 A;  1KD1 4;  1K8A 4;  1K28 A;  2CIU A;  1HKX A;  3SXX A;  3F40 A;  1VZZ A;  1SPU A;  3NQZ A;  3EF8 A;  3DGM A;  3LXU X;  1RRH A;  3G4S 3;  1NB3 I;  4EYC A;  3BND A;  1VQ8 3;  3DGL A;  3VGN A;  1ULJ B;  1VQK 3;  2BHM A;  2M7O A;  1AVL A;  4EC6 A;  1GD3 A;  2WO0 A;  3N8B A;  4WHA A;  1QJG A;  3JVC A;  1VQO 3;  1RJO A;  5IG4 A;  4XBX A;  1IQX A;  2W03 A;  3LTA A;  1W6G A;  3FCS B;  4NHF A;  3EB8 A;  4XM4 A;  1FGT A;  2GBW B;  2HMK B;  2OCT A;  4H3U A;  3S28 A;  5CK6 A;  1UUV B;  2P0X A;  3NBJ A;  2BO9 B;  1QAK A;  3IJE B;  4HYZ A;  3ROB A;  4H61 A;  2W2C A;  3SVA A;  1CEW I;  1A2V A;  3X40 A;  3CD6 3;  2GU3 A;  3S27 A;  3V92 A;  4MEI A;  3FF2 A;  3GZY B;  4HM8 B;  1FUW A;  4FCJ A;  1UUW B;  1YJ9 3;  1ULI B;  4TX4 A;  1VQP 3;  2BNG A;  3OXA A;  3KKG A;  1N9E A;  4BTX A;  1KSI A;  1WMO A;  4KFD A;  2YFL B;  3UL6 A;  3RGR A;  2WOF A;  1WMP A;  1E3V A;  4HM6 B;  1OF5 A;  3I56 3;  3PXM A;  1PFP A;  5D82 A;  3MHE A;  3S5C A;  3X42 A;  1SIH A;  1DMM A;  1DVC A;  3HIG A;  1Q7Y 4;  1IQ8 A;  2ML5 A;  2RFR A;  2QA4 3;  2O3O A;  1W7C A;  2FNQ A;  3G0K A;  4RNY A;  4O3V A;  2C11 A;  4AEQ A;  1R4C A;  5IW9 A;  1IU7 A;  3UL5 A;  1F8N A;  3LYG A;  7STD A;  4K1V A;  1YJN 3;  1JNQ A;  1AV4 A;  1Q82 4;  1OH0 A;  4L8O A;  1N5H A;  1LOX A;  2Z7A A;  1YIT 3;  3BLZ A;  4N6U A;  3Q90 A;  3OWU A;  4LZI A;  3NQY A;  2K0M A;  1UW1 A;  1YJW 3;  3SOY A;  4R9L A;  2Z77 A;  3A76 A;  2ML6 A;  1GD4 A;  4MJD A;  3K0Z A;  4N6T A;  2XRX B;  3BNE A;  3D9R A;  2CG1 A;  2IUJ A;  3IPT A;  1VQ7 3;  1N9J A;  2XR8 B;  1YI2 3;  3BNC A;  3T0U A;  1S72 3;  3EN1 B;  3FKA A;  2RGQ A;  3CU3 A;  2CFK A;  2V1L A;  2P38 A;  1Y4K A;  2WGO A;  3NV0 B;  3AMO B;  2CFW A;  5FGO A;  1E3R A;  2P05 A;  1JKG B;  1Q42 A;  4LSO A;  4HZB B;  3NX0 A;  2C10 A;  3GRD A;  1SJW A;  2LYX A;  3FSD A;  1OGX A;  3SX1 A;  2CC3 A;  1WMN A;  2MF7 A;  3UJM A;  2UX0 A;  2P0M A;  4FCZ A;  2JDI H;  3G8Z A;  4GB5 A;  1IVW A;  1VQ5 3;  1PU4 A;  3SED A;  3DUK A;  2ZL8 A;  4RBN A;  1VQL 3;  1ZX2 A;  3OW2 2;  2XFT A;  3EBY A;  1M9G A;  1CQS A;  3EN8 A;  2E2V A;  1TFO A;  4JF8 A;  4CDL A;  2FGT A;  3I0Y A;  4X2O A;  3CPO A;  1VQ9 3;  5KP1 A;  1J2B A;  2W56 B;  1TU5 A;  3QRD A;  4ORL A;  2OTJ 3;  1JV2 B;  5G2G A;  4KVH A;  2FXT A;  3NXJ A;  4G1M B;  5ELU A;  4EV5 A;  3U97 A;  2E2T A;  5AIG A;  1TFK A;  1A67 A;  3CXC 2;  2CH9 A;  3K63 A;  3CCU 3;  1W00 A;  4MMZ B;  5DRV A;  3DM8 A;  1SII A;  3KSE D;  4NRE A;  4HM2 B;  3B4O A;  3VF1 A;  1KWI A;  1NO3 A;  2Y74 A;  3F8X A;  3D3L A;  4WYK B;  1IVU A;  4EXR A;  1N8R 4;  1YVB I;  5KP4 A;  1TUH A;  3N9H A;  3S67 A;  3EX9 A;  1JB5 A;  1GYB A;  1FA3 A;  4OUQ A;  1US1 A;  1FGQ A;  5BXQ A;  3ALA A;  3LT9 A;  5CLK A;  4LEH A;  3FG4 A;  3LH4 A;  3KSP A;  1OAC A;  2HMN B;  4Q53 A;  2WOH A;  1O7N B;  1NJI 4;  2KRT A;  3F7X A;  3CME 3;  1IT7 A;  4HM4 B;  3DGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...