2J8XB

Epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
publication title New Insights on the Role of the Gamma-Herpesvirus Uracil-DNA Glycosylase Leucine Loop Revealed by the Structure of the Epstein-Barr Virus Enzyme in Complex with an Inhibitor Protein.
pubmed doi rcsb
source organism Epstein-barr virus
total genus 15
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2j8xB00
1UDII 1EUIC 1LQMB 2UUGC 1UUGB 4LYLB 1LQGC 2ZHXB 1UGHI 2J8XB 1UGIA 2UGIA
chains in the Genus database with same CATH superfamily
3X3ZA 2F4YA 2M7OA 3NX0A 1UCKA 3CME3 4MJDA 1I0VA 2KF3A 3AHWA 2OTL3 3CC43 3NHXA 4GL6A 3BB9A 1YJN3 1G0TA 3FG1A 4NHFA 4FMBA 3V98A 4BIRA 2CFLA 3F7XA 2IY2A 3LH4A 4HVNA 1RN4A 7STDA 3B7CA 2Q07A 4K61A 5AIIA 3WA2X 3HK4A 1D6UA 1N5HA 2F56A 5ELUA 2HMOB 1IQXA 4XDWA 2BO9B 2K3DA 1GD4A 3E99A 3JVCA 4KZ1A 4Q53A 3V92A 1STFI 3MKIA 1I2GA 3URPA 3DGMA 1M9GA 3HI7A 3K63A 4JF8A 3EBYA 1QVG2 1AY7A 3F40A 3MYTA 3D79A 1B2UA 1BNEA 3CC23 2KAAA 1YVBI 1D6YA 3B8LA 3SX1A 4K1VA 4CDLA 1FGQA 3LXUX 3EX9A 1LOVA 1BAOA 4O02B 5GSPA 1YJ93 1B20A 1FYSA 4WHAA 3GSPA 1JZDA 4X2HA 3WHOA 1ULJB 1VQP3 2OQEC 1FGMA 3Q1CA 1O7PB 3J7Yd 4HM8B 1X1YA 1VQ83 1LNIA 2J8XB 3FKAA 4J5GA 1NJI4 2RFRA 1BIRA 4N6UA 2HMMB 4R1KA 1GOYA 1Q9EA 2GSPA 2CFWA 4DKIA 1IVUA 3NQZA 5AYRB 2BMOB 2CW9A 1ZS7A 2Z7AA 1GMQA 1O7WB 1BNRA 4WWUC 1I8VA 2ZA4A 3AGOA 5CF2A 1BRJA 4N6NB 1HZ1A 3CNXA 3FLJA 4RNZA 1CH0A 1ZGXA 5AIFA 1GYBA 5D82A 3EBTA 3H51A 5IG0A 3OV4A 3RGRA 4RNTA 1UDII 1RGLA 1BSEA 1K8A4 1E3VA 4BL2A 2Y73A 3X42A 3IPTA 4N6MA 1UGHI 3WOFB 1QMAA 2P05A 3KKGA 1A2VA 1YIT3 1ISKA 3FF0A 1DVCA 1PU4A 1OHOA 3SXXA 1IDPA 9RNTA 1TFKA 1G02A 3GZBA 1BUJA 1B2XA 2C10A 4LZIA 2W56A 1RCKA 4RNYA 3L0RA 4IIAA 5AI1A 4R9KA 1RGKA 1IT7A 5IF6A 3FH1A 1NU3A 1RN1A 2IYJA 3JUQA 1PFPA 1B2ZA 1JKGB 1UUVB 1JB4A 4EW5A 1GMPA 3Q2PA 4ILFA 1ASKA 2PNCA 1BUQA 1MGWA 1BRSA 1TIJA 1GY7A 4KFFA 4J9AA 8RNTA 5IERA 3EN1B 3FG3A 3X3YA 3A5EA 1BNJA 3H3HA 1Q864 1T5YA 2OWPA 3MHEA 1QAFA 5JBSA 2MC8A 3VSYA 1IV7A 3IJEB 5EQLA 1IQYA 1O7MB 2A15A 5IW9A 2F98A 4N6OB 1FUTA 4XBXA 3B4PA 1AV4A 3CPOA 1NO3A 2GEXA 1LOYA 2ZL8A 2YX9A 4X2OA 3WDGB 3S29A 3GZYB 2D42A 3NXJA 3CPW2 1RJOA 3KZTA 1EEJA 4R4KA 1KD14 1CEWI 1VQL3 3F8HA 1NDOB 2D1WA 3EJVA 4KFDA 3BNBA 1K734 4TX4A 3OWSA 3D5IA 6STDA 1BRKA 2AAEA 3HOHA 2P09A 1L5GB 1O7HB 1VQK3 4FCMA 4HKVB 1W6YA 3ZFZA 1W6CA 2W9QA 1NB3I 2Z77A 4OK0A 1IVWA 3DGOA 4N6V0 1RTUA 3DGLA 4HM4B 4BTYA 3U97A 4O2HA 3CMA3 1D6ZA 2XH9A 2GEYA 1RNTA 1VQQA 1A90A 3GZRA 2HMJB 4GHOA 4K90B 1PYLA 3HZPA 2CWTA 3NV0B 2K54A 1W01A 4HM1B 2JQ5A 1DMNA 1T2IA 2K0MA 3CCE3 2RNTA 3PYJA 4LEHA 1YHQ3 1LXEA 1SQWA 2ML6A 1Q824 4IT7A 1QJGA 5G1KA 3AMOA 5IEOA 1LQGC 4RZMA 1OUNA 3I563 1EQKA 2SARA 4EV2A 1RLSA 1W4NA 2CK3H 3UJMA 1I3IA 2JDIH 1LVNA 3PCRA 1N9EA 3O8YA 2CX1A 2XSHB 4H3UA 1M904 5FGOA 2WOHA 4N3VA 2CFKA 1RCLA 2GU3A 1IV9A 1LOWA 3U1WA 3FCSB 2LYXA 1QALA 2Z6BA 3MPHA 4G1MB 3LTDA 4R80A 5IENA 3FGYA 3EHCA 4HOHA 2KXGA 2XGNA 1VQO3 3FG4A 1RNBA 1VQ93 1IVXA 1JZOA 3BNEA 3CCM3 1IU7A 4OUQA 1ROVA 1U8CB 1BSBA 2W04A 3IMAB 3AHSA 4FCZA 1N5PA 3F8XA 4GSPA 2OOVA 4WFOA 3PZWA 1OF5A 2PZVA 2QGUA 3D9RA 2HMNB 1GY5A 3K0ZA 3LTAA 1JBTA 2GBWB 3M8CA 3JUMA 1OGXA 2XGLA 1W02A 1YNVX 3T8UA 1OF5B 2RCDA 1KQS2 3NQYA 3S28A 1DMQA 1RGEA 1W00A 2KF4A 3G8ZA 3X40A 1C7HA 2BIRA 1WMNA 1STDA 3Q3FA 1BSCA 3CCQ3 4WYKA 5DREA 1VQ63 1DMMA 3MWZA 1JRQA 2RBIA 2WGOA 4HBRA 1DVDA 3MG3A 4H61A 3WA3A 1BSAA 3EF8A 1RSNA 3Q90A 2CKFB 1BNIA 1UCJA 3HIIA 1NB5I 1T2HA 1B27A 5AIHA 4BU4A 1DE3A 3I553 2FXTA 1BOXA 2O3OA 3NM2A 2CIUA 4J8TA 5A0OB 1SJWA 1WMPA 1U5OA 4XB5A 3UB1A 2R41A 1GSPA 2UX0A 1AQZA 4RBNA 4HAAA 5CXOA 1E97A 4HM0B 1YGWA 3SOAA 3T0UA 1TFOA 2W2CA 3FF2A 3TDGA 1B3SA 5CF1A 1JJ22 2KF6A 3NBRA 4EV5A 3G16A 2FNQA 5RNTA 1GOUA 1WNHA 2W56B 2CC3A 4MMXB 4CPKA 1K28A 3STDA 1MWRA 3N9HA 1NWWA 1BRIA 1KC84 1VQ53 1IQ8A 1KWIA 3EE1A 4HM2B 3BNCA 1EKMA 2RSXA 3K5TA 3KFQC 4MMZB 4OVMA 5HGRA 5IEPA 2IUKA 1MGRA 1M1XB 1BNSA 1TP6A 2V1LA 3K7CA 1W2ZA 2YFIB 1V58A 2LQVA 1WQLB 2E2VA 1RGGA 2E2TA 5G2GA 1RGFA 2H0GA 3NBJA 3KN4A 3F7SA 1US1A 3QRDA 3UL6A 4ZM8A 2QA43 1K9M4 1LNHA 2XEPA 2CFDA 4BL3A 1C54A 3OX9A 1JV2B 1FGOA 1OACA 1OH0A 3LMLA 3CCR3 3N54B 4BTWA 3CCU3 3DZLA 3OWUA 4FMCA 1B21A 3BIRA 1CYVA 5I97A 2ZDJA 1UUGB 1CQSA 2CH9A 1BNGA 7RNTA 1RGCA 2BMRB 2KRTA 5AEUB 3F14A 1YVSA 3QK9A 1QVF2 4AKZA 2HMKB 1I0XA 5IG5A 1S723 4KFEA 2FGTA 1Q40A 1OHPA 3DMCA 3G0KA 3SVAA 1VQ73 1FUSA 1Y4KA 3PS8A 2OCTA 5CK6A 1YIJ3 1OGZA 3OXAA 1SARA 4PEJA 8CHOA 1JNQA 1UUWB 1SPUA 5STDA 5JPPA 2L1SA 1BSDA 3CXC2 3WODG 1R4CA 3BU4A 2F99A 2UUGC 3CU3A 2Z76A 4HZ9B 3K9MC 1X1WA 2XSOB 2OQEA 2IA7A 5BVBA 2F86B 3HX8A 1OPYA 2I9WA 1V57A 3UL5A 1TRQA 4EXRA 1IVVA 5IG3A 1I3FA 3ECFA 5M19A 1W6GA 4HM5B 1LQMB 2BMQB 2F5WA 1EG9B 3AMOB 3GRDA 4HM7B 1YI23 2C11A 1HU9A 1JN5A 4FMAA 5KP4A 1RHLA 2P0MA 4I4KA 1TU5A 3GAXA 2CWVA 3VGNA 1TTOA 1N8QA 3DGNA 1JN5B 2CFGA 2WO0A 5D83A 1OCVA 3KSPA 1F8NA 4EBGA 1Q7HA 1RGAA 1MOLA 1UI7A 3EQQB 3NM7A 5BXQA 1ROAA 3ZG5A 3OWYA 3G713 4QWTA 3PXMA 1EUIC 3EN8A 1WTHA 4XBYA 3FZWA 3LOYA 2BNGA 5BIRA 1VZZA 3BLZA 3F9SA 5BU4A 1CYUA 2RGQA 1FZUA 3KIIA 1MWUA 1W2B2 2W9PA 4U13A 2Y74A 4O8SA 1QAKA 1FUWA 1B2MA 5D81A 4EYCA 1J2BA 1BNFA 4KT3B 3D4AA 2OTJ3 1YGEA 5M1AA 1AVKA 4LSOA 2WGQA 6GSPA 5IG4A 1X1XA 4IPBA 3V99A 2IUJA 3ZG0A 1B2SA 4HJLB 1PY3A 2GXFA 3OW22 1ZO2A 3B4OA 3LT8A 4WYKB 3HIGA 1MWTA 5HOHA 3CCS3 2AADA 3CCV3 2L4VA 2XRXB 1Q7Y4 2ZHXB 1GD3A 2XFTA 3D3LA 4J5KA 4L7KA 5JPUA 3T8NA 2O9UX 3FSDA 3LYGA 1BRGA 2KCDA 1A67A 4R9LA 3CCJ3 4XM4A 1BGSA 1IT8A 4HM6B 1A2KA 4LMIA 1KSIA 1LRAA 3NUVA 4JRFA 5AYSC 4CJNA 2CG1A 4EC6A 3S67A 1I2FA 3AGNA 1A2PA 1JBRA 1IYYA 1G96A 1UI8A 3DM8A 3GWRA 1AVLA 1FGTA 6RNTA 3NBBA 3JUPA 1RDSA 2HMLB 1GMRA 4L8PA 1S5AA 1MNLA 1JBSA 2F5MA 4MMYB 2GBXB 1I2EA 4HM3B 1VQM3 2CG0A 2MF7A 4XBTA 3SYUA 3UNLA 1BU4A 2BT3A 5AEWB 1IK3A 4LGQA 3JUNA 4BTXA 1O7GB 1V74A 3MG1A 3ALAA 2XF3A 3DY5A 3LT9A 1ULIB 3S27A 3N8BA 4ORLA 3WR2A 4XDVA 3I0YA 2P0XA 1TJDA 5KP3A 4KVHA 2W6JH 2OOVC 4AKYA 3EC9A 2CWUA 1MWSA 2ML5A 1TUHA 3S5CA 4AEQA 5AIGA 3LTBA 2UGIA 3SLUA 1WMOA 1DYUA 1ZX2A 2C4BA 5FW5A 3RDEA 1JB5A 3SOYA 1N9JA 3X41A 3RNTA 1RRLA 1UGIA 2WOFA 1BVIA 1JKGA 3SEDA 2B1XB 2R4IA 1SIIA 1EA2A 5CLKA 5G1LA 3ROBA 4MEIA 1UW1A 2CX0A 4HYZA 1AR0A 1GY6A 3PCSA 3KCHA 1GS3A 3ER7A 3D5GA 1O7NB 2YFLB 1M1K4 1RN7A 3DGYA 5LC7A 2KF5A 1BRNL 3MG2A 5DRVA 1SIHA 4FCJA 1X1UA 1BRHA 1Q42A 2H0HA 4FMDA 3CC73 1T3BA 2W03A 3DUKA 4O3VA 1R4YA 2W0QA 1NNVA 1LOXA 2BHMA 1Q40B 1N8R4 1JB2A 5EVHA 2XFSA 3DH2A 3G4S3 1HYFA 3BNDA 2INXA 3KSED 5EEOA 1VQ43 4STDA 2P38A 3RGAA 2STDA 2YFJB 4N6TA 2HOHA 1Q814 5M18A 1VQN3 4WP5A 4NPBA 3X3XA 2IMJA 2SBLA 1W7CA 3WOEB 4K1UA 4I5QA 5TGNA 4FR9A 2QEX3 2BU4A 3JUOA 4L8OA 1FW7A 2GU1A 1RRHA 1RMSA 7GSPA 1E3RA 3CNMA 3DXOA 1TRPA 4GB5A 1W5ZA 1K41A 2QIYA 1YJW3 1UCLA 4CCVA 1RKYA 1FA3A 1RGHA 3LZAA 3EB8A 1GOVA 1BANA 3WMDA 1OHSA 3NV0A 3GZXB 3PGBA 1HKXA 1Z1SA 5LC6A 4LYLB 2H0IA 3CD63 4NREA 3LTCA 5KP1A 4N6LA 3G6E3 1DETA 3A76A 1I70A 5ELJA 2XR8B 1UCIA 3MSOA 3CCL3 4HZBB 3VF1A 2B24B 3KE7A 2CHCA 1FGRA 2E2UA
chains in the Genus database with same CATH topology
1UDII 1EUIC 1LQMB 2UUGC 1UUGB 4LYLB 1LQGC 2ZHXB 1UGHI 2J8XB 1UGIA 2UGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDI I;  1EUI C;  1LQM B;  2UUG C;  1UUG B;  4LYL B;  1LQG C;  2ZHX B;  1UGH I;  2J8X B;  1UGI A;  2UGI A; 
#chains in the Genus database with same CATH topology
 3X3Z A;  2F4Y A;  2M7O A;  3NX0 A;  1UCK A;  3CME 3;  4MJD A;  1I0V A;  2KF3 A;  3AHW A;  2OTL 3;  3CC4 3;  3NHX A;  4GL6 A;  3BB9 A;  1YJN 3;  1G0T A;  3FG1 A;  4NHF A;  4FMB A;  3V98 A;  4BIR A;  2CFL A;  3F7X A;  2IY2 A;  3LH4 A;  4HVN A;  1RN4 A;  7STD A;  3B7C A;  2Q07 A;  4K61 A;  5AII A;  3WA2 X;  3HK4 A;  1D6U A;  1N5H A;  2F56 A;  5ELU A;  2HMO B;  1IQX A;  4XDW A;  2BO9 B;  2K3D A;  1GD4 A;  3E99 A;  3JVC A;  4KZ1 A;  4Q53 A;  3V92 A;  1STF I;  3MKI A;  1I2G A;  3URP A;  3DGM A;  1M9G A;  3HI7 A;  3K63 A;  4JF8 A;  3EBY A;  1QVG 2;  1AY7 A;  3F40 A;  3MYT A;  3D79 A;  1B2U A;  1BNE A;  3CC2 3;  2KAA A;  1YVB I;  1D6Y A;  3B8L A;  3SX1 A;  4K1V A;  4CDL A;  1FGQ A;  3LXU X;  3EX9 A;  1LOV A;  1BAO A;  4O02 B;  5GSP A;  1YJ9 3;  1B20 A;  1FYS A;  4WHA A;  3GSP A;  1JZD A;  4X2H A;  3WHO A;  1ULJ B;  1VQP 3;  2OQE C;  1FGM A;  3Q1C A;  1O7P B;  3J7Y d;  4HM8 B;  1X1Y A;  1VQ8 3;  1LNI A;  2J8X B;  3FKA A;  4J5G A;  1NJI 4;  2RFR A;  1BIR A;  4N6U A;  2HMM B;  4R1K A;  1GOY A;  1Q9E A;  2GSP A;  2CFW A;  4DKI A;  1IVU A;  3NQZ A;  5AYR B;  2BMO B;  2CW9 A;  1ZS7 A;  2Z7A A;  1GMQ A;  1O7W B;  1BNR A;  4WWU C;  1I8V A;  2ZA4 A;  3AGO A;  5CF2 A;  1BRJ A;  4N6N B;  1HZ1 A;  3CNX A;  3FLJ A;  4RNZ A;  1CH0 A;  1ZGX A;  5AIF A;  1GYB A;  5D82 A;  3EBT A;  3H51 A;  5IG0 A;  3OV4 A;  3RGR A;  4RNT A;  1UDI I;  1RGL A;  1BSE A;  1K8A 4;  1E3V A;  4BL2 A;  2Y73 A;  3X42 A;  3IPT A;  4N6M A;  1UGH I;  3WOF B;  1QMA A;  2P05 A;  3KKG A;  1A2V A;  1YIT 3;  1ISK A;  3FF0 A;  1DVC A;  1PU4 A;  1OHO A;  3SXX A;  1IDP A;  9RNT A;  1TFK A;  1G02 A;  3GZB A;  1BUJ A;  1B2X A;  2C10 A;  4LZI A;  2W56 A;  1RCK A;  4RNY A;  3L0R A;  4IIA A;  5AI1 A;  4R9K A;  1RGK A;  1IT7 A;  5IF6 A;  3FH1 A;  1NU3 A;  1RN1 A;  2IYJ A;  3JUQ A;  1PFP A;  1B2Z A;  1JKG B;  1UUV B;  1JB4 A;  4EW5 A;  1GMP A;  3Q2P A;  4ILF A;  1ASK A;  2PNC A;  1BUQ A;  1MGW A;  1BRS A;  1TIJ A;  1GY7 A;  4KFF A;  4J9A A;  8RNT A;  5IER A;  3EN1 B;  3FG3 A;  3X3Y A;  3A5E A;  1BNJ A;  3H3H A;  1Q86 4;  1T5Y A;  2OWP A;  3MHE A;  1QAF A;  5JBS A;  2MC8 A;  3VSY A;  1IV7 A;  3IJE B;  5EQL A;  1IQY A;  1O7M B;  2A15 A;  5IW9 A;  2F98 A;  4N6O B;  1FUT A;  4XBX A;  3B4P A;  1AV4 A;  3CPO A;  1NO3 A;  2GEX A;  1LOY A;  2ZL8 A;  2YX9 A;  4X2O A;  3WDG B;  3S29 A;  3GZY B;  2D42 A;  3NXJ A;  3CPW 2;  1RJO A;  3KZT A;  1EEJ A;  4R4K A;  1KD1 4;  1CEW I;  1VQL 3;  3F8H A;  1NDO B;  2D1W A;  3EJV A;  4KFD A;  3BNB A;  1K73 4;  4TX4 A;  3OWS A;  3D5I A;  6STD A;  1BRK A;  2AAE A;  3HOH A;  2P09 A;  1L5G B;  1O7H B;  1VQK 3;  4FCM A;  4HKV B;  1W6Y A;  3ZFZ A;  1W6C A;  2W9Q A;  1NB3 I;  2Z77 A;  4OK0 A;  1IVW A;  3DGO A;  4N6V 0;  1RTU A;  3DGL A;  4HM4 B;  4BTY A;  3U97 A;  4O2H A;  3CMA 3;  1D6Z A;  2XH9 A;  2GEY A;  1RNT A;  1VQQ A;  1A90 A;  3GZR A;  2HMJ B;  4GHO A;  4K90 B;  1PYL A;  3HZP A;  2CWT A;  3NV0 B;  2K54 A;  1W01 A;  4HM1 B;  2JQ5 A;  1DMN A;  1T2I A;  2K0M A;  3CCE 3;  2RNT A;  3PYJ A;  4LEH A;  1YHQ 3;  1LXE A;  1SQW A;  2ML6 A;  1Q82 4;  4IT7 A;  1QJG A;  5G1K A;  3AMO A;  5IEO A;  1LQG C;  4RZM A;  1OUN A;  3I56 3;  1EQK A;  2SAR A;  4EV2 A;  1RLS A;  1W4N A;  2CK3 H;  3UJM A;  1I3I A;  2JDI H;  1LVN A;  3PCR A;  1N9E A;  3O8Y A;  2CX1 A;  2XSH B;  4H3U A;  1M90 4;  5FGO A;  2WOH A;  4N3V A;  2CFK A;  1RCL A;  2GU3 A;  1IV9 A;  1LOW A;  3U1W A;  3FCS B;  2LYX A;  1QAL A;  2Z6B A;  3MPH A;  4G1M B;  3LTD A;  4R80 A;  5IEN A;  3FGY A;  3EHC A;  4HOH A;  2KXG A;  2XGN A;  1VQO 3;  3FG4 A;  1RNB A;  1VQ9 3;  1IVX A;  1JZO A;  3BNE A;  3CCM 3;  1IU7 A;  4OUQ A;  1ROV A;  1U8C B;  1BSB A;  2W04 A;  3IMA B;  3AHS A;  4FCZ A;  1N5P A;  3F8X A;  4GSP A;  2OOV A;  4WFO A;  3PZW A;  1OF5 A;  2PZV A;  2QGU A;  3D9R A;  2HMN B;  1GY5 A;  3K0Z A;  3LTA A;  1JBT A;  2GBW B;  3M8C A;  3JUM A;  1OGX A;  2XGL A;  1W02 A;  1YNV X;  3T8U A;  1OF5 B;  2RCD A;  1KQS 2;  3NQY A;  3S28 A;  1DMQ A;  1RGE A;  1W00 A;  2KF4 A;  3G8Z A;  3X40 A;  1C7H A;  2BIR A;  1WMN A;  1STD A;  3Q3F A;  1BSC A;  3CCQ 3;  4WYK A;  5DRE A;  1VQ6 3;  1DMM A;  3MWZ A;  1JRQ A;  2RBI A;  2WGO A;  4HBR A;  1DVD A;  3MG3 A;  4H61 A;  3WA3 A;  1BSA A;  3EF8 A;  1RSN A;  3Q90 A;  2CKF B;  1BNI A;  1UCJ A;  3HII A;  1NB5 I;  1T2H A;  1B27 A;  5AIH A;  4BU4 A;  1DE3 A;  3I55 3;  2FXT A;  1BOX A;  2O3O A;  3NM2 A;  2CIU A;  4J8T A;  5A0O B;  1SJW A;  1WMP A;  1U5O A;  4XB5 A;  3UB1 A;  2R41 A;  1GSP A;  2UX0 A;  1AQZ A;  4RBN A;  4HAA A;  5CXO A;  1E97 A;  4HM0 B;  1YGW A;  3SOA A;  3T0U A;  1TFO A;  2W2C A;  3FF2 A;  3TDG A;  1B3S A;  5CF1 A;  1JJ2 2;  2KF6 A;  3NBR A;  4EV5 A;  3G16 A;  2FNQ A;  5RNT A;  1GOU A;  1WNH A;  2W56 B;  2CC3 A;  4MMX B;  4CPK A;  1K28 A;  3STD A;  1MWR A;  3N9H A;  1NWW A;  1BRI A;  1KC8 4;  1VQ5 3;  1IQ8 A;  1KWI A;  3EE1 A;  4HM2 B;  3BNC A;  1EKM A;  2RSX A;  3K5T A;  3KFQ C;  4MMZ B;  4OVM A;  5HGR A;  5IEP A;  2IUK A;  1MGR A;  1M1X B;  1BNS A;  1TP6 A;  2V1L A;  3K7C A;  1W2Z A;  2YFI B;  1V58 A;  2LQV A;  1WQL B;  2E2V A;  1RGG A;  2E2T A;  5G2G A;  1RGF A;  2H0G A;  3NBJ A;  3KN4 A;  3F7S A;  1US1 A;  3QRD A;  3UL6 A;  4ZM8 A;  2QA4 3;  1K9M 4;  1LNH A;  2XEP A;  2CFD A;  4BL3 A;  1C54 A;  3OX9 A;  1JV2 B;  1FGO A;  1OAC A;  1OH0 A;  3LML A;  3CCR 3;  3N54 B;  4BTW A;  3CCU 3;  3DZL A;  3OWU A;  4FMC A;  1B21 A;  3BIR A;  1CYV A;  5I97 A;  2ZDJ A;  1UUG B;  1CQS A;  2CH9 A;  1BNG A;  7RNT A;  1RGC A;  2BMR B;  2KRT A;  5AEU B;  3F14 A;  1YVS A;  3QK9 A;  1QVF 2;  4AKZ A;  2HMK B;  1I0X A;  5IG5 A;  1S72 3;  4KFE A;  2FGT A;  1Q40 A;  1OHP A;  3DMC A;  3G0K A;  3SVA A;  1VQ7 3;  1FUS A;  1Y4K A;  3PS8 A;  2OCT A;  5CK6 A;  1YIJ 3;  1OGZ A;  3OXA A;  1SAR A;  4PEJ A;  8CHO A;  1JNQ A;  1UUW B;  1SPU A;  5STD A;  5JPP A;  2L1S A;  1BSD A;  3CXC 2;  3WOD G;  1R4C A;  3BU4 A;  2F99 A;  2UUG C;  3CU3 A;  2Z76 A;  4HZ9 B;  3K9M C;  1X1W A;  2XSO B;  2OQE A;  2IA7 A;  5BVB A;  2F86 B;  3HX8 A;  1OPY A;  2I9W A;  1V57 A;  3UL5 A;  1TRQ A;  4EXR A;  1IVV A;  5IG3 A;  1I3F A;  3ECF A;  5M19 A;  1W6G A;  4HM5 B;  1LQM B;  2BMQ B;  2F5W A;  1EG9 B;  3AMO B;  3GRD A;  4HM7 B;  1YI2 3;  2C11 A;  1HU9 A;  1JN5 A;  4FMA A;  5KP4 A;  1RHL A;  2P0M A;  4I4K A;  1TU5 A;  3GAX A;  2CWV A;  3VGN A;  1TTO A;  1N8Q A;  3DGN A;  1JN5 B;  2CFG A;  2WO0 A;  5D83 A;  1OCV A;  3KSP A;  1F8N A;  4EBG A;  1Q7H A;  1RGA A;  1MOL A;  1UI7 A;  3EQQ B;  3NM7 A;  5BXQ A;  1ROA A;  3ZG5 A;  3OWY A;  3G71 3;  4QWT A;  3PXM A;  1EUI C;  3EN8 A;  1WTH A;  4XBY A;  3FZW A;  3LOY A;  2BNG A;  5BIR A;  1VZZ A;  3BLZ A;  3F9S A;  5BU4 A;  1CYU A;  2RGQ A;  1FZU A;  3KII A;  1MWU A;  1W2B 2;  2W9P A;  4U13 A;  2Y74 A;  4O8S A;  1QAK A;  1FUW A;  1B2M A;  5D81 A;  4EYC A;  1J2B A;  1BNF A;  4KT3 B;  3D4A A;  2OTJ 3;  1YGE A;  5M1A A;  1AVK A;  4LSO A;  2WGQ A;  6GSP A;  5IG4 A;  1X1X A;  4IPB A;  3V99 A;  2IUJ A;  3ZG0 A;  1B2S A;  4HJL B;  1PY3 A;  2GXF A;  3OW2 2;  1ZO2 A;  3B4O A;  3LT8 A;  4WYK B;  3HIG A;  1MWT A;  5HOH A;  3CCS 3;  2AAD A;  3CCV 3;  2L4V A;  2XRX B;  1Q7Y 4;  2ZHX B;  1GD3 A;  2XFT A;  3D3L A;  4J5K A;  4L7K A;  5JPU A;  3T8N A;  2O9U X;  3FSD A;  3LYG A;  1BRG A;  2KCD A;  1A67 A;  4R9L A;  3CCJ 3;  4XM4 A;  1BGS A;  1IT8 A;  4HM6 B;  1A2K A;  4LMI A;  1KSI A;  1LRA A;  3NUV A;  4JRF A;  5AYS C;  4CJN A;  2CG1 A;  4EC6 A;  3S67 A;  1I2F A;  3AGN A;  1A2P A;  1JBR A;  1IYY A;  1G96 A;  1UI8 A;  3DM8 A;  3GWR A;  1AVL A;  1FGT A;  6RNT A;  3NBB A;  3JUP A;  1RDS A;  2HML B;  1GMR A;  4L8P A;  1S5A A;  1MNL A;  1JBS A;  2F5M A;  4MMY B;  2GBX B;  1I2E A;  4HM3 B;  1VQM 3;  2CG0 A;  2MF7 A;  4XBT A;  3SYU A;  3UNL A;  1BU4 A;  2BT3 A;  5AEW B;  1IK3 A;  4LGQ A;  3JUN A;  4BTX A;  1O7G B;  1V74 A;  3MG1 A;  3ALA A;  2XF3 A;  3DY5 A;  3LT9 A;  1ULI B;  3S27 A;  3N8B A;  4ORL A;  3WR2 A;  4XDV A;  3I0Y A;  2P0X A;  1TJD A;  5KP3 A;  4KVH A;  2W6J H;  2OOV C;  4AKY A;  3EC9 A;  2CWU A;  1MWS A;  2ML5 A;  1TUH A;  3S5C A;  4AEQ A;  5AIG A;  3LTB A;  2UGI A;  3SLU A;  1WMO A;  1DYU A;  1ZX2 A;  2C4B A;  5FW5 A;  3RDE A;  1JB5 A;  3SOY A;  1N9J A;  3X41 A;  3RNT A;  1RRL A;  1UGI A;  2WOF A;  1BVI A;  1JKG A;  3SED A;  2B1X B;  2R4I A;  1SII A;  1EA2 A;  5CLK A;  5G1L A;  3ROB A;  4MEI A;  1UW1 A;  2CX0 A;  4HYZ A;  1AR0 A;  1GY6 A;  3PCS A;  3KCH A;  1GS3 A;  3ER7 A;  3D5G A;  1O7N B;  2YFL B;  1M1K 4;  1RN7 A;  3DGY A;  5LC7 A;  2KF5 A;  1BRN L;  3MG2 A;  5DRV A;  1SIH A;  4FCJ A;  1X1U A;  1BRH A;  1Q42 A;  2H0H A;  4FMD A;  3CC7 3;  1T3B A;  2W03 A;  3DUK A;  4O3V A;  1R4Y A;  2W0Q A;  1NNV A;  1LOX A;  2BHM A;  1Q40 B;  1N8R 4;  1JB2 A;  5EVH A;  2XFS A;  3DH2 A;  3G4S 3;  1HYF A;  3BND A;  2INX A;  3KSE D;  5EEO A;  1VQ4 3;  4STD A;  2P38 A;  3RGA A;  2STD A;  2YFJ B;  4N6T A;  2HOH A;  1Q81 4;  5M18 A;  1VQN 3;  4WP5 A;  4NPB A;  3X3X A;  2IMJ A;  2SBL A;  1W7C A;  3WOE B;  4K1U A;  4I5Q A;  5TGN A;  4FR9 A;  2QEX 3;  2BU4 A;  3JUO A;  4L8O A;  1FW7 A;  2GU1 A;  1RRH A;  1RMS A;  7GSP A;  1E3R A;  3CNM A;  3DXO A;  1TRP A;  4GB5 A;  1W5Z A;  1K41 A;  2QIY A;  1YJW 3;  1UCL A;  4CCV A;  1RKY A;  1FA3 A;  1RGH A;  3LZA A;  3EB8 A;  1GOV A;  1BAN A;  3WMD A;  1OHS A;  3NV0 A;  3GZX B;  3PGB A;  1HKX A;  1Z1S A;  5LC6 A;  4LYL B;  2H0I A;  3CD6 3;  4NRE A;  3LTC A;  5KP1 A;  4N6L A;  3G6E 3;  1DET A;  3A76 A;  1I70 A;  5ELJ A;  2XR8 B;  1UCI A;  3MSO A;  3CCL 3;  4HZB B;  3VF1 A;  2B24 B;  3KE7 A;  2CHC A;  1FGR A;  2E2U A; 
#chains in the Genus database with same CATH homology
 1UDI I;  1EUI C;  1LQM B;  2UUG C;  1UUG B;  4LYL B;  1LQG C;  2ZHX B;  1UGH I;  2J8X B;  1UGI A;  2UGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...