2J8XB

Epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights on the Role of the Gamma-Herpesvirus Uracil-DNA Glycosylase Leucine Loop Revealed by the Structure of the Epstein-Barr Virus Enzyme in Complex with an Inhibitor Protein.
pubmed doi rcsb
source organism Epstein-barr virus
molecule tags Hydrolase/inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 15
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2j8xB00
2UUGC 1UDII 1UUGB 1LQMB 2UGIA 2J8XB 1UGHI 1EUIC 1UGIA 1LQGC 4LYLB 2ZHXB
chains in the Genus database with same CATH superfamily
1YNVX 3KE7A 1AVKA 1VZZA 1C54A 4HM8B 5ELUA 1BNEA 3BNBA 3NUVA 3JUOA 1I0VA 1ZS7A 3CCJ3 3V98A 1RGCA 2LQVA 5FGOA 5D83A 1O7NB 2OQEA 1SARA 3MG2A 9RNTA 1DYUA 3B8LA 3NBJA 4N3VA 4N6OB 3CXC2 1I3FA 1QVF2 2R41A 1GY7A 1W6YA 3E99A 1R4YA 1VQ73 1N5PA 4IIAA 2BU4A 1IVVA 1YVBI 3NBRA 3AHWA 3ZG0A 1OCVA 4LZIA 1PYLA 4AEQA 1GY6A 1RMSA 3FF2A 6GSPA 4R9KA 1LOXA 1RN1A 2BIRA 5RNTA 1M9GA 3SYUA 3CCM3 3LZAA 1JJ22 1BRIA 2OOVC 3CNXA 3Q90A 1BNGA 2KF3A 4N6LA 1DVDA 2ML5A 1VQK3 3MHEA 3DGLA 5IEOA 4STDA 2GSPA 4EV5A 1TTOA 3KCHA 3KFQC 4HM2B 1O7WB 4Q53A 1BOXA 4LSOA 1OUNA 1T5YA 1W5ZA 1IVWA 1TRQA 4EW5A 5AYSC 1UDII 2WO0A 1YGEA 3AGNA 3NM2A 2IUKA 5EEOA 3SOAA 1MWTA 1A90A 1YVSA 2XSOB 1ROAA 3F7SA 4ORLA 1CH0A 2MF7A 2RBIA 3URPA 2INXA 3LTDA 1TFOA 3ROBA 3EJVA 1GMRA 3JUPA 1BNIA 3BB9A 3KIIA 1OGZA 3CPOA 2LYXA 3H3HA 3S5CA 3EHCA 3EE1A 1UCJA 3HOHA 1I70A 3FZWA 4HKVB 4XDVA 1QVG2 1O7PB 3CCQ3 1HYFA 1IQYA 1OPYA 4GB5A 4N6NB 1N8R4 1EA2A 2F5MA 2KF4A 2JQ5A 5D81A 4HM1B 1BAOA 5AIHA 3GSPA 1E97A 1DMNA 1BNJA 3GAXA 3PYJA 1ASKA 4RZMA 2WGOA 4O02B 5ELJA 3LTCA 4JF8A 1FUSA 1RGKA 1W01A 1ZX2A 3DGMA 1BVIA 3VGNA 4EBGA 4EV2A 3G4S3 4ZM8A 3D9RA 3DGOA 3ECFA 2HMOB 3F8HA 1IQXA 3NV0A 2UGIA 2BHMA 5AIIA 1IQ8A 2Z76A 3SX1A 4LMIA 3GRDA 1IDPA 1YHQ3 1VQL3 2PNCA 5IENA 3J7Yd 1V57A 3CCL3 3G16A 2XGLA 2CFLA 2KCDA 1IT7A 3N8BA 2GEXA 3PGBA 2L4VA 1STDA 1BRSA 3EQQB 3HZPA 3WOEB 1SJWA 4RNZA 3F7XA 3O8YA 1ZO2A 1GOUA 1US1A 1STFI 1LNHA 1YJ93 4FCJA 1NNVA 1G02A 1NU3A 1BIRA 2AAEA 2R4IA 3NQYA 3Q3FA 2BT3A 1PU4A 3CCR3 4J9AA 2CHCA 1VQ43 1JB5A 3HIGA 4HVNA 4BTXA 1CQSA 4L7KA 1RGGA 1K41A 3CU3A 2W9QA 2P0MA 1UGHI 2F99A 3NV0B 2XSHB 3BNDA 5AIGA 5M19A 1AVLA 3I0YA 2OTJ3 5IERA 1BUJA 1UUGB 3GZYB 1VQM3 1BRNL 1TRPA 1RGHA 1WMPA 1D6ZA 2E2UA 1ULIB 2RGQA 3X40A 1RGFA 4L8PA 2BMQB 2GU1A 1BNSA 2CG1A 5CF1A 3CME3 2KF5A 1CYVA 4I5QA 1YIT3 3D5IA 1TU5A 2OWPA 4OUQA 5AIFA 5IG5A 4XBXA 4CPKA 2AADA 2GXFA 1Q7Y4 1G0TA 2IA7A 4KFFA 3V92A 1LOYA 2CG0A 1S5AA 4GL6A 4FR9A 2ZL8A 3K63A 5BU4A 1FYSA 2CK3H 1KSIA 1I2GA 1RLSA 2W9PA 3QRDA 5IG3A 3D4AA 1JZOA 3U1WA 3CCS3 3EBYA 4HBRA 2HOHA 3A76A 2HMNB 3LMLA 5STDA 3STDA 2SARA 3UL6A 3G6E3 5LC6A 1BUQA 2IYJA 4N6MA 3PXMA 3NXJA 4FCMA 1HKXA 3OWSA 1B2UA 2Y74A 3CCV3 1DE3A 1I2EA 1BRJA 2C11A 1IV9A 1UUVB 2CW9A 4BL3A 1FZUA 1UW1A 5GSPA 3WHOA 2HMLB 2K0MA 4HZ9B 3HI7A 2P38A 3DUKA 3PZWA 1EKMA 5CLKA 1JKGA 4HM0B 5HOHA 1G96A 2BMOB 3GZXB 3I563 1QAKA 2IMJA 1L5GB 8CHOA 3WR2A 2Q07A 2JDIH 3ALAA 2L1SA 3BIRA 1FUTA 1QALA 4FMAA 4EC6A 1OHSA 3IJEB 3SLUA 1BU4A 1N5HA 4BL2A 1Q40B 1W7CA 1Z1SA 2F4YA 3F8XA 3CC23 1R4CA 3OX9A 1RNTA 2Y73A 1FGRA 1TJDA 4O2HA 4BTWA 1UCLA 2D42A 1MWRA 2M7OA 2W03A 3MG1A 2HMMB 4HM6B 2KXGA 4R4KA 1HZ1A 4RNTA 4BU4A 2XFTA 1O7MB 3MWZA 3PS8A 5FW5A 7GSPA 3WOFB 3H51A 3IPTA 2IY2A 1FGMA 2XR8B 1YGWA 1Q9EA 1JB4A 3LH4A 2K3DA 4G1MB 3EC9A 3AMOB 3EN1B 3RNTA 3FCSB 3MPHA 5JBSA 1TIJA 1RTUA 1VQN3 1WNHA 1A67A 2J8XB 1SPUA 1SIHA 1GS3A 1LNIA 4KFEA 1MWSA 4JRFA 3S67A 3X41A 4AKZA 1ROVA 5KP1A 1K8A4 1BSEA 4XM4A 1WMNA 1OH0A 1SIIA 3B4PA 3JUNA 4NREA 4XBYA 8RNTA 2BNGA 1EUIC 1UUWB 2W6JH 5IW9A 2CWTA 3G8ZA 2RNTA 4HZBB 1Q814 1LOVA 3DH2A 1N9EA 4ILFA 1AQZA 1LQGC 4LYLB 4NPBA 1KD14 1JZDA 1GD4A 1QMAA 1X1UA 2GU3A 1VQQA 5BIRA 1JNQA 3S28A 1BNRA 3F9SA 3CMA3 5AEWB 3FSDA 1BRKA 1CEWI 1K28A 2B1XB 1JV2B 3JUQA 1GY5A 5I97A 3G713 1VQP3 1TFKA 1BSDA 1BRGA 3IMAB 1U5OA 3UNLA 5JPPA 3S27A 1T2HA 1VQ63 5CXOA 1MGRA 1MWUA 3EF8A 4WP5A 1T2IA 2O3OA 2CH9A 2CFDA 3CC43 1FUWA 2WOFA 5IG4A 1JBSA 4MMZB 1FGOA 1JBRA 3D5GA 1B3SA 1W02A 3FG4A 1W2B2 2P09A 4R1KA 4NHFA 1M1K4 4MMYB 1V58A 4CCVA 3WODG 1NWWA 1MGWA 3WMDA 1B2SA 4FMDA 1E3RA 1FGTA 2YFIB 3FH1A 4KVHA 3GWRA 1LVNA 3BLZA 3CNMA 2W2CA 1O7HB 3MYTA 2BO9B 5EQLA 1AV4A 4R80A 1OHPA 2H0IA 1JKGB 1LRAA 2F56A 4N6TA 5TGNA 4I4KA 1KWIA 4H61A 4KZ1A 3X3XA 5AYRB 1GMQA 2Z77A 1YI23 1N8QA 2KRTA 3I553 3AHSA 1GOYA 4CDLA 4DKIA 3FLJA 2XRXB 1GOVA 3DGNA 1B2XA 4J5GA 1Q40A 3NM7A 3NQZA 4HM7B 1QAFA 2XH9A 3KKGA 2QIYA 1EG9B 1GSPA 2HMJB 2Z6BA 3B4OA 3FKAA 3UB1A 5IG0A 3RGAA 3OV4A 1DMMA 2H0HA 5D82A 1A2KA 1GMPA 1JRQA 1OHOA 2E2TA 5BVBA 6STDA 3K5TA 3KN4A 4LEHA 5AEUB 1VQO3 2CX0A 4HYZA 2FNQA 1W6CA 4HOHA 3UJMA 1RNBA 3DMCA 3PCSA 2E2VA 3FGYA 1I3IA 4K61A 1WMOA 3SVAA 1QJGA 3LT9A 2CFKA 1IVUA 2RFRA 3LOYA 4PEJA 2QA43 2UUGC 3EN8A 3HK4A 1KQS2 3JUMA 4GHOA 2K54A 4OVMA 1IV7A 3KSED 1RRLA 1AY7A 4IPBA 5HGRA 1U8CB 1Y4KA 3T8UA 1FA3A 1UI8A 1K734 4HM3B 2UX0A 4WYKB 3CD63 1B27A 1C7HA 1BANA 3FG1A 3LT8A 3ZFZA 2A15A 3SXXA 3KSPA 3DGYA 3F14A 1W00A 4FMCA 1UI7A 2SBLA 4QWTA 4MMXB 1ISKA 1RGLA 4GSPA 1OACA 2PZVA 1RGEA 1RJOA 2XFSA 3CCU3 2RCDA 4O3VA 5AI1A 4K90B 1YJN3 1WTHA 3GZBA 2YFLB 5BXQA 4MJDA 1X1YA 1JB2A 2O9UX 3K7CA 3VSYA 2XEPA 1A2PA 5G2GA 2C10A 2GBWB 3X3YA 4BTYA 1I0XA 1NB3I 1RN4A 4N6V0 3SEDA 3RGRA 2IUJA 2KF6A 3HX8A 1TP6A 1YJW3 2F98A 3OXAA 4RBNA 7STDA 2CFWA 1RDSA 5DRVA 1EQKA 3JVCA 1B20A 1W2ZA 1TUHA 3U97A 4XBTA 3CCE3 2WGQA 3T0UA 1FGQA 4EYCA 1K9M4 1W4NA 4TX4A 4U13A 3ER7A 5A0OB 1HU9A 4J8TA 1S723 1JBTA 3DY5A 1M1XB 1J2BA 5G1LA 1T3BA 1ULJB 1BSAA 2OOVA 7RNTA 5LC7A 3RDEA 1X1XA 1DMQA 1D6UA 4IT7A 1RSNA 1RHLA 4BIRA 1IVXA 4HAAA 3V99A 1PFPA 3AGOA 3M8CA 1JN5A 2CKFB 2W04A 4OK0A 2F5WA 1BNFA 2OCTA 3D79A 3Q2PA 1B2ZA 1OF5A 1MNLA 2P0XA 4HM4B 2B24B 3MKIA 3T8NA 1RRHA 5CK6A 3B7CA 1B2MA 3HIIA 1BGSA 3Q1CA 1BRHA 4WHAA 3MG3A 2C4BA 4X2HA 2CFGA 1Q42A 3DM8A 3EX9A 1KC84 4FMBA 1I8VA 3EB8A 1UCKA 3BU4A 4J5KA 4XB5A 4H3UA 1O7GB 2OTL3 3NX0A 1RN7A 3QK9A 4RNYA 2W56A 3GZRA 3OWYA 1GYBA 1NB5I 3WDGB 6RNTA 1I2FA 2GBXB 2OQEC 3F40A 5KP3A 5CF2A 3NHXA 3PCRA 4LGQA 1UCIA 5M18A 3SOYA 2HMKB 4WYKA 3WA2X 1AR0A 1EEJA 1IK3A 1MOLA 2YX9A 2CIUA 1N9JA 4KFDA 3N9HA 4FCZA 3X3ZA 3DZLA 2QGUA 1Q7HA 1UGIA 3LXUX 1LXEA 5IF6A 2RSXA 2FXTA 3AMOA 2CWVA 4AKYA 1RKYA 3FF0A 1LQMB 4KT3B 1X1WA 2I9WA 1IU7A 2W56B 4K1UA 4O8SA 2D1WA 2ZHXB 4HJLB 1W6GA 1ZGXA 2FGTA 2F86B 3A5EA 3G0KA 1SQWA 1Q864 2ZA4A 3LYGA 3EBTA 1A2VA 3OWUA 4EXRA 3LTBA 3N54B 3VF1A 1NDOB 2MC8A 1B21A 4CJNA 1RCKA 3OW22 3BNCA 4HM5B 3X42A 1D6YA 1PY3A 5IEPA 1DETA 3K9MC 1Q824 1NJI4 2STDA 3D3LA 3WA3A 3S29A 3L0RA 1OGXA 1CYUA 3FG3A 3KZTA 4MEIA 3BNEA 2QEX3 4K1VA 3MSOA 1NO3A 2YFJB 3CPW2 4WFOA 1M904 5JPUA 1RCLA 3UL5A 2CWUA 1LOWA 1GD3A 1F8NA 3ZG5A 2KAAA 2W0QA 2WOHA 1VQ83 1IYYA 1BSCA 5EVHA 2GEYA 2P05A 2XGNA 4X2OA 5DREA 2CX1A 4L8OA 3NBBA 1FW7A 2ZDJA 1VQ93 5M1AA 1E3VA 1JN5B 1RGAA 4N6UA 2XF3A 5KP4A 4XDWA 2CC3A 1OF5B 4R9LA 1V74A 2H0GA 3DXOA 1IT8A 3LTAA 3CC73 1DVCA 3K0ZA 2V1LA 2Z7AA 1VQ53 1BSBA 2BMRB 1YIJ3 1WQLB 4WWUC 3TDGA 2ML6A 5G1KA
chains in the Genus database with same CATH topology
2UUGC 1UDII 1UUGB 1LQMB 2UGIA 2J8XB 1UGHI 1EUIC 1UGIA 1LQGC 4LYLB 2ZHXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUG C;  1UDI I;  1UUG B;  1LQM B;  2UGI A;  2J8X B;  1UGH I;  1EUI C;  1UGI A;  1LQG C;  4LYL B;  2ZHX B; 
#chains in the Genus database with same CATH topology
 1YNV X;  3KE7 A;  1AVK A;  1VZZ A;  1C54 A;  4HM8 B;  5ELU A;  1BNE A;  3BNB A;  3NUV A;  3JUO A;  1I0V A;  1ZS7 A;  3CCJ 3;  3V98 A;  1RGC A;  2LQV A;  5FGO A;  5D83 A;  1O7N B;  2OQE A;  1SAR A;  3MG2 A;  9RNT A;  1DYU A;  3B8L A;  3NBJ A;  4N3V A;  4N6O B;  3CXC 2;  1I3F A;  1QVF 2;  2R41 A;  1GY7 A;  1W6Y A;  3E99 A;  1R4Y A;  1VQ7 3;  1N5P A;  4IIA A;  2BU4 A;  1IVV A;  1YVB I;  3NBR A;  3AHW A;  3ZG0 A;  1OCV A;  4LZI A;  1PYL A;  4AEQ A;  1GY6 A;  1RMS A;  3FF2 A;  6GSP A;  4R9K A;  1LOX A;  1RN1 A;  2BIR A;  5RNT A;  1M9G A;  3SYU A;  3CCM 3;  3LZA A;  1JJ2 2;  1BRI A;  2OOV C;  3CNX A;  3Q90 A;  1BNG A;  2KF3 A;  4N6L A;  1DVD A;  2ML5 A;  1VQK 3;  3MHE A;  3DGL A;  5IEO A;  4STD A;  2GSP A;  4EV5 A;  1TTO A;  3KCH A;  3KFQ C;  4HM2 B;  1O7W B;  4Q53 A;  1BOX A;  4LSO A;  1OUN A;  1T5Y A;  1W5Z A;  1IVW A;  1TRQ A;  4EW5 A;  5AYS C;  1UDI I;  2WO0 A;  1YGE A;  3AGN A;  3NM2 A;  2IUK A;  5EEO A;  3SOA A;  1MWT A;  1A90 A;  1YVS A;  2XSO B;  1ROA A;  3F7S A;  4ORL A;  1CH0 A;  2MF7 A;  2RBI A;  3URP A;  2INX A;  3LTD A;  1TFO A;  3ROB A;  3EJV A;  1GMR A;  3JUP A;  1BNI A;  3BB9 A;  3KII A;  1OGZ A;  3CPO A;  2LYX A;  3H3H A;  3S5C A;  3EHC A;  3EE1 A;  1UCJ A;  3HOH A;  1I70 A;  3FZW A;  4HKV B;  4XDV A;  1QVG 2;  1O7P B;  3CCQ 3;  1HYF A;  1IQY A;  1OPY A;  4GB5 A;  4N6N B;  1N8R 4;  1EA2 A;  2F5M A;  2KF4 A;  2JQ5 A;  5D81 A;  4HM1 B;  1BAO A;  5AIH A;  3GSP A;  1E97 A;  1DMN A;  1BNJ A;  3GAX A;  3PYJ A;  1ASK A;  4RZM A;  2WGO A;  4O02 B;  5ELJ A;  3LTC A;  4JF8 A;  1FUS A;  1RGK A;  1W01 A;  1ZX2 A;  3DGM A;  1BVI A;  3VGN A;  4EBG A;  4EV2 A;  3G4S 3;  4ZM8 A;  3D9R A;  3DGO A;  3ECF A;  2HMO B;  3F8H A;  1IQX A;  3NV0 A;  2UGI A;  2BHM A;  5AII A;  1IQ8 A;  2Z76 A;  3SX1 A;  4LMI A;  3GRD A;  1IDP A;  1YHQ 3;  1VQL 3;  2PNC A;  5IEN A;  3J7Y d;  1V57 A;  3CCL 3;  3G16 A;  2XGL A;  2CFL A;  2KCD A;  1IT7 A;  3N8B A;  2GEX A;  3PGB A;  2L4V A;  1STD A;  1BRS A;  3EQQ B;  3HZP A;  3WOE B;  1SJW A;  4RNZ A;  3F7X A;  3O8Y A;  1ZO2 A;  1GOU A;  1US1 A;  1STF I;  1LNH A;  1YJ9 3;  4FCJ A;  1NNV A;  1G02 A;  1NU3 A;  1BIR A;  2AAE A;  2R4I A;  3NQY A;  3Q3F A;  2BT3 A;  1PU4 A;  3CCR 3;  4J9A A;  2CHC A;  1VQ4 3;  1JB5 A;  3HIG A;  4HVN A;  4BTX A;  1CQS A;  4L7K A;  1RGG A;  1K41 A;  3CU3 A;  2W9Q A;  2P0M A;  1UGH I;  2F99 A;  3NV0 B;  2XSH B;  3BND A;  5AIG A;  5M19 A;  1AVL A;  3I0Y A;  2OTJ 3;  5IER A;  1BUJ A;  1UUG B;  3GZY B;  1VQM 3;  1BRN L;  1TRP A;  1RGH A;  1WMP A;  1D6Z A;  2E2U A;  1ULI B;  2RGQ A;  3X40 A;  1RGF A;  4L8P A;  2BMQ B;  2GU1 A;  1BNS A;  2CG1 A;  5CF1 A;  3CME 3;  2KF5 A;  1CYV A;  4I5Q A;  1YIT 3;  3D5I A;  1TU5 A;  2OWP A;  4OUQ A;  5AIF A;  5IG5 A;  4XBX A;  4CPK A;  2AAD A;  2GXF A;  1Q7Y 4;  1G0T A;  2IA7 A;  4KFF A;  3V92 A;  1LOY A;  2CG0 A;  1S5A A;  4GL6 A;  4FR9 A;  2ZL8 A;  3K63 A;  5BU4 A;  1FYS A;  2CK3 H;  1KSI A;  1I2G A;  1RLS A;  2W9P A;  3QRD A;  5IG3 A;  3D4A A;  1JZO A;  3U1W A;  3CCS 3;  3EBY A;  4HBR A;  2HOH A;  3A76 A;  2HMN B;  3LML A;  5STD A;  3STD A;  2SAR A;  3UL6 A;  3G6E 3;  5LC6 A;  1BUQ A;  2IYJ A;  4N6M A;  3PXM A;  3NXJ A;  4FCM A;  1HKX A;  3OWS A;  1B2U A;  2Y74 A;  3CCV 3;  1DE3 A;  1I2E A;  1BRJ A;  2C11 A;  1IV9 A;  1UUV B;  2CW9 A;  4BL3 A;  1FZU A;  1UW1 A;  5GSP A;  3WHO A;  2HML B;  2K0M A;  4HZ9 B;  3HI7 A;  2P38 A;  3DUK A;  3PZW A;  1EKM A;  5CLK A;  1JKG A;  4HM0 B;  5HOH A;  1G96 A;  2BMO B;  3GZX B;  3I56 3;  1QAK A;  2IMJ A;  1L5G B;  8CHO A;  3WR2 A;  2Q07 A;  2JDI H;  3ALA A;  2L1S A;  3BIR A;  1FUT A;  1QAL A;  4FMA A;  4EC6 A;  1OHS A;  3IJE B;  3SLU A;  1BU4 A;  1N5H A;  4BL2 A;  1Q40 B;  1W7C A;  1Z1S A;  2F4Y A;  3F8X A;  3CC2 3;  1R4C A;  3OX9 A;  1RNT A;  2Y73 A;  1FGR A;  1TJD A;  4O2H A;  4BTW A;  1UCL A;  2D42 A;  1MWR A;  2M7O A;  2W03 A;  3MG1 A;  2HMM B;  4HM6 B;  2KXG A;  4R4K A;  1HZ1 A;  4RNT A;  4BU4 A;  2XFT A;  1O7M B;  3MWZ A;  3PS8 A;  5FW5 A;  7GSP A;  3WOF B;  3H51 A;  3IPT A;  2IY2 A;  1FGM A;  2XR8 B;  1YGW A;  1Q9E A;  1JB4 A;  3LH4 A;  2K3D A;  4G1M B;  3EC9 A;  3AMO B;  3EN1 B;  3RNT A;  3FCS B;  3MPH A;  5JBS A;  1TIJ A;  1RTU A;  1VQN 3;  1WNH A;  1A67 A;  2J8X B;  1SPU A;  1SIH A;  1GS3 A;  1LNI A;  4KFE A;  1MWS A;  4JRF A;  3S67 A;  3X41 A;  4AKZ A;  1ROV A;  5KP1 A;  1K8A 4;  1BSE A;  4XM4 A;  1WMN A;  1OH0 A;  1SII A;  3B4P A;  3JUN A;  4NRE A;  4XBY A;  8RNT A;  2BNG A;  1EUI C;  1UUW B;  2W6J H;  5IW9 A;  2CWT A;  3G8Z A;  2RNT A;  4HZB B;  1Q81 4;  1LOV A;  3DH2 A;  1N9E A;  4ILF A;  1AQZ A;  1LQG C;  4LYL B;  4NPB A;  1KD1 4;  1JZD A;  1GD4 A;  1QMA A;  1X1U A;  2GU3 A;  1VQQ A;  5BIR A;  1JNQ A;  3S28 A;  1BNR A;  3F9S A;  3CMA 3;  5AEW B;  3FSD A;  1BRK A;  1CEW I;  1K28 A;  2B1X B;  1JV2 B;  3JUQ A;  1GY5 A;  5I97 A;  3G71 3;  1VQP 3;  1TFK A;  1BSD A;  1BRG A;  3IMA B;  1U5O A;  3UNL A;  5JPP A;  3S27 A;  1T2H A;  1VQ6 3;  5CXO A;  1MGR A;  1MWU A;  3EF8 A;  4WP5 A;  1T2I A;  2O3O A;  2CH9 A;  2CFD A;  3CC4 3;  1FUW A;  2WOF A;  5IG4 A;  1JBS A;  4MMZ B;  1FGO A;  1JBR A;  3D5G A;  1B3S A;  1W02 A;  3FG4 A;  1W2B 2;  2P09 A;  4R1K A;  4NHF A;  1M1K 4;  4MMY B;  1V58 A;  4CCV A;  3WOD G;  1NWW A;  1MGW A;  3WMD A;  1B2S A;  4FMD A;  1E3R A;  1FGT A;  2YFI B;  3FH1 A;  4KVH A;  3GWR A;  1LVN A;  3BLZ A;  3CNM A;  2W2C A;  1O7H B;  3MYT A;  2BO9 B;  5EQL A;  1AV4 A;  4R80 A;  1OHP A;  2H0I A;  1JKG B;  1LRA A;  2F56 A;  4N6T A;  5TGN A;  4I4K A;  1KWI A;  4H61 A;  4KZ1 A;  3X3X A;  5AYR B;  1GMQ A;  2Z77 A;  1YI2 3;  1N8Q A;  2KRT A;  3I55 3;  3AHS A;  1GOY A;  4CDL A;  4DKI A;  3FLJ A;  2XRX B;  1GOV A;  3DGN A;  1B2X A;  4J5G A;  1Q40 A;  3NM7 A;  3NQZ A;  4HM7 B;  1QAF A;  2XH9 A;  3KKG A;  2QIY A;  1EG9 B;  1GSP A;  2HMJ B;  2Z6B A;  3B4O A;  3FKA A;  3UB1 A;  5IG0 A;  3RGA A;  3OV4 A;  1DMM A;  2H0H A;  5D82 A;  1A2K A;  1GMP A;  1JRQ A;  1OHO A;  2E2T A;  5BVB A;  6STD A;  3K5T A;  3KN4 A;  4LEH A;  5AEU B;  1VQO 3;  2CX0 A;  4HYZ A;  2FNQ A;  1W6C A;  4HOH A;  3UJM A;  1RNB A;  3DMC A;  3PCS A;  2E2V A;  3FGY A;  1I3I A;  4K61 A;  1WMO A;  3SVA A;  1QJG A;  3LT9 A;  2CFK A;  1IVU A;  2RFR A;  3LOY A;  4PEJ A;  2QA4 3;  2UUG C;  3EN8 A;  3HK4 A;  1KQS 2;  3JUM A;  4GHO A;  2K54 A;  4OVM A;  1IV7 A;  3KSE D;  1RRL A;  1AY7 A;  4IPB A;  5HGR A;  1U8C B;  1Y4K A;  3T8U A;  1FA3 A;  1UI8 A;  1K73 4;  4HM3 B;  2UX0 A;  4WYK B;  3CD6 3;  1B27 A;  1C7H A;  1BAN A;  3FG1 A;  3LT8 A;  3ZFZ A;  2A15 A;  3SXX A;  3KSP A;  3DGY A;  3F14 A;  1W00 A;  4FMC A;  1UI7 A;  2SBL A;  4QWT A;  4MMX B;  1ISK A;  1RGL A;  4GSP A;  1OAC A;  2PZV A;  1RGE A;  1RJO A;  2XFS A;  3CCU 3;  2RCD A;  4O3V A;  5AI1 A;  4K90 B;  1YJN 3;  1WTH A;  3GZB A;  2YFL B;  5BXQ A;  4MJD A;  1X1Y A;  1JB2 A;  2O9U X;  3K7C A;  3VSY A;  2XEP A;  1A2P A;  5G2G A;  2C10 A;  2GBW B;  3X3Y A;  4BTY A;  1I0X A;  1NB3 I;  1RN4 A;  4N6V 0;  3SED A;  3RGR A;  2IUJ A;  2KF6 A;  3HX8 A;  1TP6 A;  1YJW 3;  2F98 A;  3OXA A;  4RBN A;  7STD A;  2CFW A;  1RDS A;  5DRV A;  1EQK A;  3JVC A;  1B20 A;  1W2Z A;  1TUH A;  3U97 A;  4XBT A;  3CCE 3;  2WGQ A;  3T0U A;  1FGQ A;  4EYC A;  1K9M 4;  1W4N A;  4TX4 A;  4U13 A;  3ER7 A;  5A0O B;  1HU9 A;  4J8T A;  1S72 3;  1JBT A;  3DY5 A;  1M1X B;  1J2B A;  5G1L A;  1T3B A;  1ULJ B;  1BSA A;  2OOV A;  7RNT A;  5LC7 A;  3RDE A;  1X1X A;  1DMQ A;  1D6U A;  4IT7 A;  1RSN A;  1RHL A;  4BIR A;  1IVX A;  4HAA A;  3V99 A;  1PFP A;  3AGO A;  3M8C A;  1JN5 A;  2CKF B;  2W04 A;  4OK0 A;  2F5W A;  1BNF A;  2OCT A;  3D79 A;  3Q2P A;  1B2Z A;  1OF5 A;  1MNL A;  2P0X A;  4HM4 B;  2B24 B;  3MKI A;  3T8N A;  1RRH A;  5CK6 A;  3B7C A;  1B2M A;  3HII A;  1BGS A;  3Q1C A;  1BRH A;  4WHA A;  3MG3 A;  2C4B A;  4X2H A;  2CFG A;  1Q42 A;  3DM8 A;  3EX9 A;  1KC8 4;  4FMB A;  1I8V A;  3EB8 A;  1UCK A;  3BU4 A;  4J5K A;  4XB5 A;  4H3U A;  1O7G B;  2OTL 3;  3NX0 A;  1RN7 A;  3QK9 A;  4RNY A;  2W56 A;  3GZR A;  3OWY A;  1GYB A;  1NB5 I;  3WDG B;  6RNT A;  1I2F A;  2GBX B;  2OQE C;  3F40 A;  5KP3 A;  5CF2 A;  3NHX A;  3PCR A;  4LGQ A;  1UCI A;  5M18 A;  3SOY A;  2HMK B;  4WYK A;  3WA2 X;  1AR0 A;  1EEJ A;  1IK3 A;  1MOL A;  2YX9 A;  2CIU A;  1N9J A;  4KFD A;  3N9H A;  4FCZ A;  3X3Z A;  3DZL A;  2QGU A;  1Q7H A;  1UGI A;  3LXU X;  1LXE A;  5IF6 A;  2RSX A;  2FXT A;  3AMO A;  2CWV A;  4AKY A;  1RKY A;  3FF0 A;  1LQM B;  4KT3 B;  1X1W A;  2I9W A;  1IU7 A;  2W56 B;  4K1U A;  4O8S A;  2D1W A;  2ZHX B;  4HJL B;  1W6G A;  1ZGX A;  2FGT A;  2F86 B;  3A5E A;  3G0K A;  1SQW A;  1Q86 4;  2ZA4 A;  3LYG A;  3EBT A;  1A2V A;  3OWU A;  4EXR A;  3LTB A;  3N54 B;  3VF1 A;  1NDO B;  2MC8 A;  1B21 A;  4CJN A;  1RCK A;  3OW2 2;  3BNC A;  4HM5 B;  3X42 A;  1D6Y A;  1PY3 A;  5IEP A;  1DET A;  3K9M C;  1Q82 4;  1NJI 4;  2STD A;  3D3L A;  3WA3 A;  3S29 A;  3L0R A;  1OGX A;  1CYU A;  3FG3 A;  3KZT A;  4MEI A;  3BNE A;  2QEX 3;  4K1V A;  3MSO A;  1NO3 A;  2YFJ B;  3CPW 2;  4WFO A;  1M90 4;  5JPU A;  1RCL A;  3UL5 A;  2CWU A;  1LOW A;  1GD3 A;  1F8N A;  3ZG5 A;  2KAA A;  2W0Q A;  2WOH A;  1VQ8 3;  1IYY A;  1BSC A;  5EVH A;  2GEY A;  2P05 A;  2XGN A;  4X2O A;  5DRE A;  2CX1 A;  4L8O A;  3NBB A;  1FW7 A;  2ZDJ A;  1VQ9 3;  5M1A A;  1E3V A;  1JN5 B;  1RGA A;  4N6U A;  2XF3 A;  5KP4 A;  4XDW A;  2CC3 A;  1OF5 B;  4R9L A;  1V74 A;  2H0G A;  3DXO A;  1IT8 A;  3LTA A;  3CC7 3;  1DVC A;  3K0Z A;  2V1L A;  2Z7A A;  1VQ5 3;  1BSB A;  2BMR B;  1YIJ 3;  1WQL B;  4WWU C;  3TDG A;  2ML6 A;  5G1K A; 
#chains in the Genus database with same CATH homology
 2UUG C;  1UDI I;  1UUG B;  1LQM B;  2UGI A;  2J8X B;  1UGH I;  1EUI C;  1UGI A;  1LQG C;  4LYL B;  2ZHX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...