2J8XB

Epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights on the Role of the Gamma-Herpesvirus Uracil-DNA Glycosylase Leucine Loop Revealed by the Structure of the Epstein-Barr Virus Enzyme in Complex with an Inhibitor Protein.
pubmed doi rcsb
source organism Epstein-barr virus
molecule tags Hydrolase/inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 15
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2j8xB00
1LQGC 1UGIA 1UUGB 2ZHXB 4LYLB 1EUIC 1UGHI 1UDII 1LQMB 2UGIA 2UUGC 2J8XB
chains in the Genus database with same CATH superfamily
2XSHB 2YX9A 1AV4A 3FGYA 1KD14 2ZA4A 2SARA 1UI7A 2CFLA 2WGQA 3K63A 2Y73A 3KIIA 1I0VA 1JBRA 5M19A 4NPBA 1LOXA 1BSDA 4EW5A 1BNIA 3CME3 6GSPA 1FGMA 2QGUA 4J5GA 4MMYB 1WNHA 1X1UA 1YVSA 3DH2A 1UI8A 3WHOA 4FMDA 4FMBA 8CHOA 2O9UX 3SYUA 4XDVA 4CPKA 2UX0A 3URPA 3T0UA 3B7CA 4LMIA 3MKIA 5CK6A 2W0QA 3CU3A 1WMPA 1JB2A 3D9RA 3JUMA 1KSIA 1K28A 3RGAA 4BTWA 1OPYA 3U97A 1BRHA 3BNCA 3DGNA 1OHPA 5D82A 2FXTA 1GYBA 4FCJA 3CCJ3 3KCHA 3LTCA 3E99A 5BU4A 1JKGB 3LTAA 2GBXB 3OV4A 3CXC2 1RDSA 1BSEA 3N9HA 2ML5A 3HI7A 1DVDA 3CMA3 1Q40B 1BVIA 1IV7A 1BRJA 2YFJB 4H3UA 4LYLB 4RBNA 2BHMA 4GL6A 1N5HA 3S29A 2RNTA 5STDA 3J7Yd 2XEPA 2IA7A 2KXGA 1JJ22 1NWWA 4X2OA 1VQ93 3OX9A 4GHOA 1BGSA 1O7HB 3JVCA 4XDWA 2OOVC 5HGRA 1M9GA 3X42A 5KP4A 1O7PB 1GMPA 2K3DA 1IT7A 4Q53A 4EXRA 3CCQ3 1BSBA 2SBLA 3FF2A 1VZZA 2AADA 3DGYA 2XGNA 3VGNA 3UNLA 1UW1A 3X3YA 4WWUC 3O8YA 3X3XA 3MSOA 4X2HA 3CC43 1UCLA 3G8ZA 3OWYA 1YIT3 1K41A 3EQQB 1LVNA 4WYKA 3CPW2 1N5PA 1V58A 3JUNA 1LNHA 1GY6A 4WP5A 3V92A 1BANA 2GEYA 3LH4A 4LGQA 3G713 1JBSA 1BNFA 4K1UA 4I4KA 4HBRA 3S5CA 1K8A4 2L1SA 1DETA 3B4PA 1LOVA 3KE7A 5DRVA 5CF1A 1FUTA 2K54A 1T3BA 4IT7A 2GU3A 1RN7A 2BMQB 5CXOA 4N6MA 1CH0A 2KF4A 1YGEA 1DMNA 1PU4A 1IU7A 1STDA 1T2HA 1VQQA 3DGLA 1QALA 1YJN3 3SLUA 3GZYB 4HM7B 2F86B 1O7MB 3DMCA 1JZDA 3EHCA 4MMZB 1O7WB 4HM1B 3CPOA 1BRSA 1VQK3 1BRNL 5FW5A 2H0GA 4HZ9B 1ULIB 3OW22 1NNVA 1TTOA 3N54B 1OUNA 3CCR3 1RGEA 4R9KA 2OOVA 1TJDA 4BTYA 1LQGC 4WYKB 5EEOA 5TGNA 4ZM8A 3DY5A 1T2IA 2HMMB 3K0ZA 3CCU3 1FUWA 1GD3A 3CCM3 1JB4A 2Y74A 5LC6A 2CWUA 5IG4A 1N9JA 1JRQA 2BIRA 3CNXA 3UL6A 3EX9A 4EYCA 1RN1A 3FH1A 1E97A 3NXJA 1BSCA 2J8XB 3IPTA 1RKYA 2IY2A 2FGTA 3MG2A 1IK3A 1W6YA 3KFQC 1EUIC 1I8VA 2MF7A 1OF5A 4U13A 4BL3A 1B21A 4AKYA 1BUJA 1N9EA 1RRHA 1U8CB 3F14A 2IMJA 2W9PA 3RDEA 1R4CA 1JNQA 2O3OA 1EQKA 3AGNA 2CWTA 1FA3A 1KWIA 3X3ZA 1SQWA 2B24B 2MC8A 2UUGC 1RCKA 1RTUA 2W56B 2KF3A 1BRIA 2JDIH 1ISKA 1UDII 3BNBA 1IV9A 1I2EA 3DXOA 3WA3A 4LZIA 1B3SA 4ILFA 4BIRA 1OACA 2E2TA 1GOVA 1RN4A 1UUVB 1RGCA 2F99A 2GBWB 3EC9A 3LT9A 3M8CA 1IVVA 3HIIA 5BXQA 3AMOB 1STFI 2W56A 4H61A 3VSYA 5JBSA 3NQZA 1KC84 4O2HA 5G1KA 1BIRA 3PYJA 1BU4A 1JB5A 1TRPA 2XRXB 1RGFA 2YFIB 3WODG 4HM6B 2BNGA 3F9SA 3MG1A 3OWUA 3FCSB 3PXMA 1A2PA 2HMOB 3Q1CA 1Q7Y4 1UGIA 2PZVA 1OF5B 1E3VA 1X1YA 3Q3FA 3LTBA 1B2UA 4AEQA 1UUGB 1W5ZA 1YVBI 3BNEA 4FMCA 3FF0A 2Z6BA 3X40A 1MOLA 1YNVX 3MG3A 8RNTA 1D6YA 2GU1A 1RGAA 1W2B2 2M7OA 1YGWA 2RCDA 4BL2A 3AMOA 4HAAA 1VQ43 1UUWB 5LC7A 2STDA 2Z77A 1TRQA 3F8XA 3OWSA 3ZG5A 3EE1A 1YJW3 2A15A 2CIUA 2HMNB 5A0OB 2LYXA 4HM5B 4G1MB 2B1XB 3F8HA 3TDGA 1FW7A 1QAKA 3EB8A 3FG4A 2WOHA 3VF1A 3CNMA 1A90A 4RNZA 1MNLA 2R41A 1KQS2 1U5OA 4K1VA 1GY7A 4CJNA 1CQSA 1HZ1A 3PCSA 2P09A 1IQ8A 3B8LA 1FGRA 4J5KA 4LEHA 4N6UA 3GZBA 3I553 2CFWA 2XSOB 2CX0A 1A2VA 2GEXA 3LTDA 4TX4A 5EQLA 3G4S3 2WOFA 1BSAA 1BNRA 3CCL3 2Z7AA 4L7KA 4OVMA 1I2GA 2E2UA 1RGHA 1MWUA 2XR8B 3B4OA 1C54A 2P0XA 3ALAA 1ROVA 3ZG0A 1MGWA 3SX1A 1FUSA 1AR0A 1BNJA 2OTL3 5IF6A 2XFTA 1D6ZA 1OCVA 1W2ZA 1ZS7A 2CWVA 3K7CA 1I70A 1LOWA 2UGIA 3QK9A 4N6NB 2RGQA 4CCVA 1OHSA 1YHQ3 4MEIA 4FR9A 1M904 2XF3A 1J2BA 2D42A 3FKAA 1TP6A 4RNTA 5AIHA 5AEUB 5IEPA 1HYFA 1C7HA 3EBYA 3GAXA 4JF8A 1S723 1IQYA 3SEDA 3T8NA 1Q824 5CF2A 2QIYA 4RNYA 4AKZA 2QEX3 2F5MA 3A5EA 4KVHA 1QJGA 2CHCA 3PCRA 4MJDA 2OCTA 3FLJA 3Q2PA 2ML6A 1PYLA 5IW9A 2OTJ3 1G02A 1S5AA 2P0MA 2F5WA 3GSPA 1SIHA 1G0TA 2OQEC 5DREA 5D81A 3T8UA 3ER7A 5JPPA 3DGOA 3F7SA 4I5QA 5CLKA 1EKMA 5AIFA 1PY3A 4HKVB 1RNTA 1JV2B 3MHEA 1BNEA 1Y4KA 3K9MC 3HX8A 1B2SA 3JUOA 2OQEA 1O7GB 3CC73 1GS3A 4R9LA 5IG3A 4RZMA 1GMRA 9RNTA 1I0XA 1W7CA 3NX0A 1UGHI 3UL5A 5AYRB 2RFRA 2F4YA 2C4BA 2W03A 3LXUX 1NB3I 2CH9A 1SJWA 1RSNA 3EN1B 2KCDA 4GSPA 1DVCA 1Q864 3ECFA 3QRDA 1US1A 1IYYA 1BNSA 3DUKA 3IMAB 3FG1A 5AEWB 4XM4A 4ORLA 3BB9A 2W2CA 3DM8A 5JPUA 5IERA 1A2KA 1JKGA 1CYVA 2W6JH 1L5GB 3NM7A 1EEJA 1AVLA 3V99A 2KF6A 1GOUA 3F7XA 1QAFA 3GZXB 2I9WA 3EBTA 4HM4B 4KZ1A 4NREA 4XBYA 4WFOA 3FG3A 1NJI4 1Q40A 3NBJA 3PZWA 3U1WA 3NV0B 2BMOB 3OXAA 4HZBB 7RNTA 1VQL3 1FGOA 1BRGA 1TFOA 3CCV3 1IQXA 3JUQA 1SIIA 1BRKA 4CDLA 1JBTA 1IT8A 2W9QA 3I0YA 1R4YA 1Q7HA 1FYSA 2LQVA 5RNTA 2KAAA 5FGOA 4HM2B 3WMDA 3WA2X 1I3FA 3NBRA 1RJOA 2C10A 1O7NB 2CX1A 1B2ZA 3PS8A 4FCMA 3MWZA 4MMXB 4XB5A 4L8PA 1BAOA 1ULJB 1YIJ3 3CCE3 3N8BA 3X41A 1VQ53 2PNCA 1ROAA 2HMJB 4O8SA 5GSPA 1NU3A 1OH0A 3LOYA 1DMMA 3HZPA 1RCLA 1MWSA 3SOAA 3CCS3 2H0IA 3S27A 3G6E3 1B27A 2IYJA 2OWPA 4QWTA 1RNBA 1GSPA 2CG0A 1I3IA 3KKGA 1JN5A 1VQ83 2BMRB 1MWTA 1RGLA 4R80A 2CG1A 1QVF2 1W01A 2WO0A 2XH9A 3KSED 4HJLB 1DE3A 4N6V0 3KZTA 3WDGB 1UCJA 1TU5A 2ZL8A 1G96A 1VQO3 2RBIA 1AY7A 1B2MA 1TIJA 5ELJA 3SOYA 3UB1A 4KFEA 3LMLA 1ZX2A 2H0HA 5AYSC 2P38A 3A76A 1Q42A 2CFDA 5BVBA 1FGTA 2JQ5A 3BIRA 3D3LA 1IDPA 3GZRA 4OUQA 5D83A 3IJEB 4HM3B 4N3VA 1LXEA 4KT3B 4N6OB 3FZWA 1MGRA 4IPBA 2AAEA 1W00A 3H3HA 1VQN3 1K9M4 3SVAA 1TFKA 2CK3H 1BOXA 5M1AA 1CYUA 3S67A 1WTHA 3FSDA 1SARA 3H51A 5M18A 5I97A 3D5IA 1X1XA 4L8OA 1IVWA 1E3RA 1WMOA 1IVUA 1Z1SA 1QVG2 4HYZA 3HK4A 4XBXA 3RGRA 2CC3A 4EBGA 1A67A 5IENA 2CFKA 2Z76A 4R1KA 3JUPA 3AHSA 3Q90A 2WGOA 5AIGA 1PFPA 1ASKA 1GMQA 1Q9EA 3NV0A 4HM0B 7GSPA 2R4IA 1LNIA 1HU9A 1RMSA 2HMLB 2IUJA 2KF5A 2F98A 4K61A 1RLSA 3G0KA 4EV2A 2XFSA 1NDOB 3AGOA 1OGZA 4R4KA 1Q814 3MPHA 2BU4A 1N8R4 2XGLA 1CEWI 4HM8B 1WMNA 5AI1A 1YI23 1BUQA 1UCKA 1VQP3 2INXA 4J9AA 3UJMA 4PEJA 2D1WA 4FMAA 1NB5I 4FCZA 1ZO2A 3WOEB 2GXFA 1MWRA 4XBTA 3D5GA 1YJ93 1F8NA 1B20A 3LT8A 4STDA 1BNGA 1W02A 3NHXA 4K90B 2IUKA 2W04A 2Q07A 4DKIA 5KP3A 1W6GA 2ZDJA 4O3VA 1FGQA 3K5TA 6STDA 3HIGA 3DGMA 3D79A 3NM2A 1FZUA 2GSPA 1RGGA 1EA2A 4HVNA 3NBBA 1DMQA 1IVXA 2CKFB 3MYTA 4NHFA 1RGKA 4BTXA 5KP1A 1W6CA 3HOHA 5G2GA 4HOHA 3PGBA 1N8QA 3EF8A 3GRDA 3LYGA 3NQYA 3NUVA 1VQ73 1VQ63 1M1K4 3V98A 2ZHXB 2RSXA 1HKXA 2QA43 2FNQA 2L4VA 3CC23 5IEOA 1V57A 3BLZA 3BNDA 1JZOA 3D4AA 5AIIA 3WR2A 5G1LA 1LOYA 5IG5A 1JN5B 1NO3A 4OK0A 5EVHA 3WOFB 4EC6A 1W4NA 3STDA 3AHWA 4LSOA 2F56A 1DYUA 2C11A 1RRLA 3CD63 1AQZA 3ROBA 2BO9B 1K734 1LRAA 1GY5A 4IIAA 2KRTA 2BT3A 1AVKA 1T5YA 4KFFA 1GD4A 4BU4A 2CW9A 2YFLB 5HOHA 3SXXA 1GOYA 3I563 3G16A 3KN4A 1M1XB 2K0MA 2HOHA 1X1WA 1D6UA 1UCIA 3EN8A 3L0RA 4GB5A 3RNTA 3F40A 6RNTA 4O02B 1OGXA 2V1LA 3GWRA 2E2VA 5ELUA 1OHOA 4J8TA 4KFDA 3S28A 2HMKB 3EJVA 4N6LA 5BIRA 1ZGXA 1EG9B 2CFGA 3LZAA 7STDA 5IG0A 1LQMB 4EV5A 4N6TA 1QMAA 2P05A 3ZFZA 3BU4A 3DZLA 1VQM3 1I2FA 3KSPA 1V74A 1B2XA 4JRFA 1RHLA 4WHAA 1SPUA 1TUHA 1WQLB
chains in the Genus database with same CATH topology
1LQGC 1UGIA 1UUGB 2ZHXB 4LYLB 1EUIC 1UGHI 1UDII 1LQMB 2UGIA 2UUGC 2J8XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQG C;  1UGI A;  1UUG B;  2ZHX B;  4LYL B;  1EUI C;  1UGH I;  1UDI I;  1LQM B;  2UGI A;  2UUG C;  2J8X B; 
#chains in the Genus database with same CATH topology
 2XSH B;  2YX9 A;  1AV4 A;  3FGY A;  1KD1 4;  2ZA4 A;  2SAR A;  1UI7 A;  2CFL A;  2WGQ A;  3K63 A;  2Y73 A;  3KII A;  1I0V A;  1JBR A;  5M19 A;  4NPB A;  1LOX A;  1BSD A;  4EW5 A;  1BNI A;  3CME 3;  6GSP A;  1FGM A;  2QGU A;  4J5G A;  4MMY B;  1WNH A;  1X1U A;  1YVS A;  3DH2 A;  1UI8 A;  3WHO A;  4FMD A;  4FMB A;  8CHO A;  2O9U X;  3SYU A;  4XDV A;  4CPK A;  2UX0 A;  3URP A;  3T0U A;  3B7C A;  4LMI A;  3MKI A;  5CK6 A;  2W0Q A;  3CU3 A;  1WMP A;  1JB2 A;  3D9R A;  3JUM A;  1KSI A;  1K28 A;  3RGA A;  4BTW A;  1OPY A;  3U97 A;  1BRH A;  3BNC A;  3DGN A;  1OHP A;  5D82 A;  2FXT A;  1GYB A;  4FCJ A;  3CCJ 3;  3KCH A;  3LTC A;  3E99 A;  5BU4 A;  1JKG B;  3LTA A;  2GBX B;  3OV4 A;  3CXC 2;  1RDS A;  1BSE A;  3N9H A;  2ML5 A;  3HI7 A;  1DVD A;  3CMA 3;  1Q40 B;  1BVI A;  1IV7 A;  1BRJ A;  2YFJ B;  4H3U A;  4LYL B;  4RBN A;  2BHM A;  4GL6 A;  1N5H A;  3S29 A;  2RNT A;  5STD A;  3J7Y d;  2XEP A;  2IA7 A;  2KXG A;  1JJ2 2;  1NWW A;  4X2O A;  1VQ9 3;  3OX9 A;  4GHO A;  1BGS A;  1O7H B;  3JVC A;  4XDW A;  2OOV C;  5HGR A;  1M9G A;  3X42 A;  5KP4 A;  1O7P B;  1GMP A;  2K3D A;  1IT7 A;  4Q53 A;  4EXR A;  3CCQ 3;  1BSB A;  2SBL A;  3FF2 A;  1VZZ A;  2AAD A;  3DGY A;  2XGN A;  3VGN A;  3UNL A;  1UW1 A;  3X3Y A;  4WWU C;  3O8Y A;  3X3X A;  3MSO A;  4X2H A;  3CC4 3;  1UCL A;  3G8Z A;  3OWY A;  1YIT 3;  1K41 A;  3EQQ B;  1LVN A;  4WYK A;  3CPW 2;  1N5P A;  1V58 A;  3JUN A;  1LNH A;  1GY6 A;  4WP5 A;  3V92 A;  1BAN A;  2GEY A;  3LH4 A;  4LGQ A;  3G71 3;  1JBS A;  1BNF A;  4K1U A;  4I4K A;  4HBR A;  3S5C A;  1K8A 4;  2L1S A;  1DET A;  3B4P A;  1LOV A;  3KE7 A;  5DRV A;  5CF1 A;  1FUT A;  2K54 A;  1T3B A;  4IT7 A;  2GU3 A;  1RN7 A;  2BMQ B;  5CXO A;  4N6M A;  1CH0 A;  2KF4 A;  1YGE A;  1DMN A;  1PU4 A;  1IU7 A;  1STD A;  1T2H A;  1VQQ A;  3DGL A;  1QAL A;  1YJN 3;  3SLU A;  3GZY B;  4HM7 B;  2F86 B;  1O7M B;  3DMC A;  1JZD A;  3EHC A;  4MMZ B;  1O7W B;  4HM1 B;  3CPO A;  1BRS A;  1VQK 3;  1BRN L;  5FW5 A;  2H0G A;  4HZ9 B;  1ULI B;  3OW2 2;  1NNV A;  1TTO A;  3N54 B;  1OUN A;  3CCR 3;  1RGE A;  4R9K A;  2OOV A;  1TJD A;  4BTY A;  1LQG C;  4WYK B;  5EEO A;  5TGN A;  4ZM8 A;  3DY5 A;  1T2I A;  2HMM B;  3K0Z A;  3CCU 3;  1FUW A;  1GD3 A;  3CCM 3;  1JB4 A;  2Y74 A;  5LC6 A;  2CWU A;  5IG4 A;  1N9J A;  1JRQ A;  2BIR A;  3CNX A;  3UL6 A;  3EX9 A;  4EYC A;  1RN1 A;  3FH1 A;  1E97 A;  3NXJ A;  1BSC A;  2J8X B;  3IPT A;  1RKY A;  2IY2 A;  2FGT A;  3MG2 A;  1IK3 A;  1W6Y A;  3KFQ C;  1EUI C;  1I8V A;  2MF7 A;  1OF5 A;  4U13 A;  4BL3 A;  1B21 A;  4AKY A;  1BUJ A;  1N9E A;  1RRH A;  1U8C B;  3F14 A;  2IMJ A;  2W9P A;  3RDE A;  1R4C A;  1JNQ A;  2O3O A;  1EQK A;  3AGN A;  2CWT A;  1FA3 A;  1KWI A;  3X3Z A;  1SQW A;  2B24 B;  2MC8 A;  2UUG C;  1RCK A;  1RTU A;  2W56 B;  2KF3 A;  1BRI A;  2JDI H;  1ISK A;  1UDI I;  3BNB A;  1IV9 A;  1I2E A;  3DXO A;  3WA3 A;  4LZI A;  1B3S A;  4ILF A;  4BIR A;  1OAC A;  2E2T A;  1GOV A;  1RN4 A;  1UUV B;  1RGC A;  2F99 A;  2GBW B;  3EC9 A;  3LT9 A;  3M8C A;  1IVV A;  3HII A;  5BXQ A;  3AMO B;  1STF I;  2W56 A;  4H61 A;  3VSY A;  5JBS A;  3NQZ A;  1KC8 4;  4O2H A;  5G1K A;  1BIR A;  3PYJ A;  1BU4 A;  1JB5 A;  1TRP A;  2XRX B;  1RGF A;  2YFI B;  3WOD G;  4HM6 B;  2BNG A;  3F9S A;  3MG1 A;  3OWU A;  3FCS B;  3PXM A;  1A2P A;  2HMO B;  3Q1C A;  1Q7Y 4;  1UGI A;  2PZV A;  1OF5 B;  1E3V A;  1X1Y A;  3Q3F A;  3LTB A;  1B2U A;  4AEQ A;  1UUG B;  1W5Z A;  1YVB I;  3BNE A;  4FMC A;  3FF0 A;  2Z6B A;  3X40 A;  1MOL A;  1YNV X;  3MG3 A;  8RNT A;  1D6Y A;  2GU1 A;  1RGA A;  1W2B 2;  2M7O A;  1YGW A;  2RCD A;  4BL2 A;  3AMO A;  4HAA A;  1VQ4 3;  1UUW B;  5LC7 A;  2STD A;  2Z77 A;  1TRQ A;  3F8X A;  3OWS A;  3ZG5 A;  3EE1 A;  1YJW 3;  2A15 A;  2CIU A;  2HMN B;  5A0O B;  2LYX A;  4HM5 B;  4G1M B;  2B1X B;  3F8H A;  3TDG A;  1FW7 A;  1QAK A;  3EB8 A;  3FG4 A;  2WOH A;  3VF1 A;  3CNM A;  1A90 A;  4RNZ A;  1MNL A;  2R41 A;  1KQS 2;  1U5O A;  4K1V A;  1GY7 A;  4CJN A;  1CQS A;  1HZ1 A;  3PCS A;  2P09 A;  1IQ8 A;  3B8L A;  1FGR A;  4J5K A;  4LEH A;  4N6U A;  3GZB A;  3I55 3;  2CFW A;  2XSO B;  2CX0 A;  1A2V A;  2GEX A;  3LTD A;  4TX4 A;  5EQL A;  3G4S 3;  2WOF A;  1BSA A;  1BNR A;  3CCL 3;  2Z7A A;  4L7K A;  4OVM A;  1I2G A;  2E2U A;  1RGH A;  1MWU A;  2XR8 B;  3B4O A;  1C54 A;  2P0X A;  3ALA A;  1ROV A;  3ZG0 A;  1MGW A;  3SX1 A;  1FUS A;  1AR0 A;  1BNJ A;  2OTL 3;  5IF6 A;  2XFT A;  1D6Z A;  1OCV A;  1W2Z A;  1ZS7 A;  2CWV A;  3K7C A;  1I70 A;  1LOW A;  2UGI A;  3QK9 A;  4N6N B;  2RGQ A;  4CCV A;  1OHS A;  1YHQ 3;  4MEI A;  4FR9 A;  1M90 4;  2XF3 A;  1J2B A;  2D42 A;  3FKA A;  1TP6 A;  4RNT A;  5AIH A;  5AEU B;  5IEP A;  1HYF A;  1C7H A;  3EBY A;  3GAX A;  4JF8 A;  1S72 3;  1IQY A;  3SED A;  3T8N A;  1Q82 4;  5CF2 A;  2QIY A;  4RNY A;  4AKZ A;  2QEX 3;  2F5M A;  3A5E A;  4KVH A;  1QJG A;  2CHC A;  3PCR A;  4MJD A;  2OCT A;  3FLJ A;  3Q2P A;  2ML6 A;  1PYL A;  5IW9 A;  2OTJ 3;  1G02 A;  1S5A A;  2P0M A;  2F5W A;  3GSP A;  1SIH A;  1G0T A;  2OQE C;  5DRE A;  5D81 A;  3T8U A;  3ER7 A;  5JPP A;  3DGO A;  3F7S A;  4I5Q A;  5CLK A;  1EKM A;  5AIF A;  1PY3 A;  4HKV B;  1RNT A;  1JV2 B;  3MHE A;  1BNE A;  1Y4K A;  3K9M C;  3HX8 A;  1B2S A;  3JUO A;  2OQE A;  1O7G B;  3CC7 3;  1GS3 A;  4R9L A;  5IG3 A;  4RZM A;  1GMR A;  9RNT A;  1I0X A;  1W7C A;  3NX0 A;  1UGH I;  3UL5 A;  5AYR B;  2RFR A;  2F4Y A;  2C4B A;  2W03 A;  3LXU X;  1NB3 I;  2CH9 A;  1SJW A;  1RSN A;  3EN1 B;  2KCD A;  4GSP A;  1DVC A;  1Q86 4;  3ECF A;  3QRD A;  1US1 A;  1IYY A;  1BNS A;  3DUK A;  3IMA B;  3FG1 A;  5AEW B;  4XM4 A;  4ORL A;  3BB9 A;  2W2C A;  3DM8 A;  5JPU A;  5IER A;  1A2K A;  1JKG A;  1CYV A;  2W6J H;  1L5G B;  3NM7 A;  1EEJ A;  1AVL A;  3V99 A;  2KF6 A;  1GOU A;  3F7X A;  1QAF A;  3GZX B;  2I9W A;  3EBT A;  4HM4 B;  4KZ1 A;  4NRE A;  4XBY A;  4WFO A;  3FG3 A;  1NJI 4;  1Q40 A;  3NBJ A;  3PZW A;  3U1W A;  3NV0 B;  2BMO B;  3OXA A;  4HZB B;  7RNT A;  1VQL 3;  1FGO A;  1BRG A;  1TFO A;  3CCV 3;  1IQX A;  3JUQ A;  1SII A;  1BRK A;  4CDL A;  1JBT A;  1IT8 A;  2W9Q A;  3I0Y A;  1R4Y A;  1Q7H A;  1FYS A;  2LQV A;  5RNT A;  2KAA A;  5FGO A;  4HM2 B;  3WMD A;  3WA2 X;  1I3F A;  3NBR A;  1RJO A;  2C10 A;  1O7N B;  2CX1 A;  1B2Z A;  3PS8 A;  4FCM A;  3MWZ A;  4MMX B;  4XB5 A;  4L8P A;  1BAO A;  1ULJ B;  1YIJ 3;  3CCE 3;  3N8B A;  3X41 A;  1VQ5 3;  2PNC A;  1ROA A;  2HMJ B;  4O8S A;  5GSP A;  1NU3 A;  1OH0 A;  3LOY A;  1DMM A;  3HZP A;  1RCL A;  1MWS A;  3SOA A;  3CCS 3;  2H0I A;  3S27 A;  3G6E 3;  1B27 A;  2IYJ A;  2OWP A;  4QWT A;  1RNB A;  1GSP A;  2CG0 A;  1I3I A;  3KKG A;  1JN5 A;  1VQ8 3;  2BMR B;  1MWT A;  1RGL A;  4R80 A;  2CG1 A;  1QVF 2;  1W01 A;  2WO0 A;  2XH9 A;  3KSE D;  4HJL B;  1DE3 A;  4N6V 0;  3KZT A;  3WDG B;  1UCJ A;  1TU5 A;  2ZL8 A;  1G96 A;  1VQO 3;  2RBI A;  1AY7 A;  1B2M A;  1TIJ A;  5ELJ A;  3SOY A;  3UB1 A;  4KFE A;  3LML A;  1ZX2 A;  2H0H A;  5AYS C;  2P38 A;  3A76 A;  1Q42 A;  2CFD A;  5BVB A;  1FGT A;  2JQ5 A;  3BIR A;  3D3L A;  1IDP A;  3GZR A;  4OUQ A;  5D83 A;  3IJE B;  4HM3 B;  4N3V A;  1LXE A;  4KT3 B;  4N6O B;  3FZW A;  1MGR A;  4IPB A;  2AAE A;  1W00 A;  3H3H A;  1VQN 3;  1K9M 4;  3SVA A;  1TFK A;  2CK3 H;  1BOX A;  5M1A A;  1CYU A;  3S67 A;  1WTH A;  3FSD A;  1SAR A;  3H51 A;  5M18 A;  5I97 A;  3D5I A;  1X1X A;  4L8O A;  1IVW A;  1E3R A;  1WMO A;  1IVU A;  1Z1S A;  1QVG 2;  4HYZ A;  3HK4 A;  4XBX A;  3RGR A;  2CC3 A;  4EBG A;  1A67 A;  5IEN A;  2CFK A;  2Z76 A;  4R1K A;  3JUP A;  3AHS A;  3Q90 A;  2WGO A;  5AIG A;  1PFP A;  1ASK A;  1GMQ A;  1Q9E A;  3NV0 A;  4HM0 B;  7GSP A;  2R4I A;  1LNI A;  1HU9 A;  1RMS A;  2HML B;  2IUJ A;  2KF5 A;  2F98 A;  4K61 A;  1RLS A;  3G0K A;  4EV2 A;  2XFS A;  1NDO B;  3AGO A;  1OGZ A;  4R4K A;  1Q81 4;  3MPH A;  2BU4 A;  1N8R 4;  2XGL A;  1CEW I;  4HM8 B;  1WMN A;  5AI1 A;  1YI2 3;  1BUQ A;  1UCK A;  1VQP 3;  2INX A;  4J9A A;  3UJM A;  4PEJ A;  2D1W A;  4FMA A;  1NB5 I;  4FCZ A;  1ZO2 A;  3WOE B;  2GXF A;  1MWR A;  4XBT A;  3D5G A;  1YJ9 3;  1F8N A;  1B20 A;  3LT8 A;  4STD A;  1BNG A;  1W02 A;  3NHX A;  4K90 B;  2IUK A;  2W04 A;  2Q07 A;  4DKI A;  5KP3 A;  1W6G A;  2ZDJ A;  4O3V A;  1FGQ A;  3K5T A;  6STD A;  3HIG A;  3DGM A;  3D79 A;  3NM2 A;  1FZU A;  2GSP A;  1RGG A;  1EA2 A;  4HVN A;  3NBB A;  1DMQ A;  1IVX A;  2CKF B;  3MYT A;  4NHF A;  1RGK A;  4BTX A;  5KP1 A;  1W6C A;  3HOH A;  5G2G A;  4HOH A;  3PGB A;  1N8Q A;  3EF8 A;  3GRD A;  3LYG A;  3NQY A;  3NUV A;  1VQ7 3;  1VQ6 3;  1M1K 4;  3V98 A;  2ZHX B;  2RSX A;  1HKX A;  2QA4 3;  2FNQ A;  2L4V A;  3CC2 3;  5IEO A;  1V57 A;  3BLZ A;  3BND A;  1JZO A;  3D4A A;  5AII A;  3WR2 A;  5G1L A;  1LOY A;  5IG5 A;  1JN5 B;  1NO3 A;  4OK0 A;  5EVH A;  3WOF B;  4EC6 A;  1W4N A;  3STD A;  3AHW A;  4LSO A;  2F56 A;  1DYU A;  2C11 A;  1RRL A;  3CD6 3;  1AQZ A;  3ROB A;  2BO9 B;  1K73 4;  1LRA A;  1GY5 A;  4IIA A;  2KRT A;  2BT3 A;  1AVK A;  1T5Y A;  4KFF A;  1GD4 A;  4BU4 A;  2CW9 A;  2YFL B;  5HOH A;  3SXX A;  1GOY A;  3I56 3;  3G16 A;  3KN4 A;  1M1X B;  2K0M A;  2HOH A;  1X1W A;  1D6U A;  1UCI A;  3EN8 A;  3L0R A;  4GB5 A;  3RNT A;  3F40 A;  6RNT A;  4O02 B;  1OGX A;  2V1L A;  3GWR A;  2E2V A;  5ELU A;  1OHO A;  4J8T A;  4KFD A;  3S28 A;  2HMK B;  3EJV A;  4N6L A;  5BIR A;  1ZGX A;  1EG9 B;  2CFG A;  3LZA A;  7STD A;  5IG0 A;  1LQM B;  4EV5 A;  4N6T A;  1QMA A;  2P05 A;  3ZFZ A;  3BU4 A;  3DZL A;  1VQM 3;  1I2F A;  3KSP A;  1V74 A;  1B2X A;  4JRF A;  1RHL A;  4WHA A;  1SPU A;  1TUH A;  1WQL B; 
#chains in the Genus database with same CATH homology
 1LQG C;  1UGI A;  1UUG B;  2ZHX B;  4LYL B;  1EUI C;  1UGH I;  1UDI I;  1LQM B;  2UGI A;  2UUG C;  2J8X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...