2J8XB

Epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title New Insights on the Role of the Gamma-Herpesvirus Uracil-DNA Glycosylase Leucine Loop Revealed by the Structure of the Epstein-Barr Virus Enzyme in Complex with an Inhibitor Protein.
pubmed doi rcsb
source organism Epstein-barr virus
molecule tags Hydrolase/inhibitor
total genus 15
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2j8xB00
1UUGB 2J8XB 2ZHXB 1EUIC 2UGIA 1UDII 1UGHI 2UUGC 1LQGC 4LYLB 1UGIA 1LQMB
chains in the Genus database with same CATH superfamily
1OHSA 3NM7A 3CPOA 4FR9A 4K90B 1I0XA 5CK6A 1W6GA 4XBYA 2CG1A 5IERA 3BU4A 3J7Yd 1RTUA 1MWRA 4HAAA 1R4CA 3MG3A 3UJMA 3CU3A 3WDGB 4WYKA 4EW5A 1UI8A 5KP4A 1B2MA 4I5QA 1IVUA 1MWSA 1O7GB 5AIFA 3S27A 3X41A 3G4S3 1YJW3 2MF7A 2IA7A 1DMMA 3TDGA 3OWUA 2ZHXB 1TUHA 2R41A 2YFJB 1OPYA 3Q1CA 1BNEA 2BMRB 2XFTA 2BU4A 3U1WA 2OTL3 3UNLA 2BT3A 1VQQA 3N9HA 3A5EA 1UGIA 4RNYA 1UCKA 1YGWA 2BIRA 3AGOA 1AVKA 2BMOB 3MSOA 4QWTA 1O7WB 3X40A 1ZX2A 2D42A 2ZDJA 3D9RA 1RN4A 1OACA 4LEHA 1BNJA 5FW5A 3WODG 3URPA 2WOFA 3JUOA 3V99A 1UUWB 2QGUA 3E99A 3OWSA 1NDOB 1VQP3 4FMDA 3LTCA 3CCQ3 1BAOA 3DM8A 3RGAA 1D6ZA 3I553 3CME3 3F9SA 1TIJA 2CFGA 1PU4A 5TGNA 3MG1A 3IMAB 4KVHA 1UDII 1N8QA 3LXUX 1PYLA 1JB4A 1JZDA 4PEJA 1NWWA 1B27A 2GBXB 2ML6A 1UI7A 3D5IA 4LGQA 4J5GA 2W56B 1W5ZA 3KIIA 3FF0A 3CCR3 4HKVB 1DE3A 2WGOA 4R1KA 3AHWA 3GZBA 2OTJ3 4GL6A 2F5MA 1BRJA 1YHQ3 2F86B 3OWYA 4HBRA 3BNEA 1FUTA 5I97A 3FG1A 2Z77A 2CX0A 2YFIB 1W4NA 2XR8B 1B2UA 1IQYA 4XB5A 1NU3A 1BNRA 2K54A 1RGAA 3PCRA 1M1K4 3PS8A 3T0UA 1ISKA 1IT8A 1TRPA 4HM7B 1DYUA 2WOHA 1NNVA 1BIRA 3DY5A 1GYBA 3ER7A 1SJWA 1Q9EA 2AADA 4N6V0 3I563 5BU4A 1SIHA 1JV2B 2HOHA 3DGYA 1GD3A 2HMKB 3LH4A 1RRHA 4CCVA 2V1LA 2H0HA 2BMQB 5DREA 2CG0A 5GSPA 1QVF2 1SIIA 1LVNA 1WMNA 3PYJA 3S5CA 3V92A 2XSHB 2C10A 1JZOA 1W7CA 1Z1SA 1JN5B 1RDSA 1G96A 4RZMA 5EVHA 4ZM8A 3EE1A 4N6LA 4MMZB 2R4IA 1B21A 3HI7A 1JJ22 2KCDA 1LXEA 3SXXA 1TFOA 1RGGA 2CIUA 1EKMA 2UUGC 3OXAA 1VZZA 3FF2A 3LT9A 3AHSA 4XDWA 3RGRA 2CKFB 2QIYA 3NV0A 2GBWB 1EUIC 4LSOA 3SX1A 3KSPA 3EQQB 2HMMB 1HU9A 3SEDA 5IG4A 4BL2A 1S723 1N9JA 1OF5B 1Q7Y4 4FMAA 1RGKA 3RDEA 3BNDA 3DGMA 3WMDA 1BU4A 3I0YA 3CD63 4FMBA 2INXA 3LT8A 4HM0B 1J2BA 1I8VA 2IMJA 1AY7A 1R4YA 4HM5B 1AQZA 3EBTA 2B1XB 3LZAA 2F98A 4WWUC 1ULJB 3GZXB 3Q90A 1EQKA 1MGRA 1FGTA 1O7NB 4HM3B 1UGHI 5AIIA 1UCLA 1GS3A 4MJDA 1V57A 2RBIA 4XM4A 4HOHA 2UGIA 1RRLA 3IJEB 1FUSA 4JF8A 1BRNL 3B8LA 4I4KA 4JRFA 4CPKA 3WOFB 5STDA 3K63A 3B7CA 2M7OA 3MHEA 1LQGC 1AR0A 1TJDA 1W6CA 2D1WA 5IG5A 1YJN3 4J5KA 5IW9A 1X1XA 3LYGA 1RMSA 2E2VA 1B2ZA 3V98A 3A76A 5DRVA 1BRSA 5AYRB 1BSDA 5AI1A 1STDA 1N5PA 5IEOA 1IVWA 1UCIA 4HM1B 1EG9B 3S28A 2QEX3 3D3LA 3AMOB 3B4PA 3BNCA 4IT7A 4HJLB 1EA2A 3K9MC 1RGFA 4EBGA 5IG0A 2Z76A 1OGXA 2P0MA 3BB9A 4EV5A 4EC6A 1OGZA 1YVSA 2FNQA 1T2IA 2Z6BA 4MMYB 3X3YA 3AGNA 3ZG0A 4RNTA 1BNGA 3LMLA 4HM8B 1ZS7A 1T3BA 5M1AA 3S67A 1MWTA 1BVIA 1G02A 3KFQC 1YIJ3 1YGEA 2W56A 1A67A 1FGOA 2GU1A 4CJNA 4BL3A 4J8TA 5KP1A 5CF2A 2OOVA 2CH9A 4OVMA 4IPBA 3F7XA 3UL6A 1BNIA 1RGLA 1DVDA 1TU5A 5HOHA 1GY5A 1TP6A 1FGRA 5ELUA 5M19A 2JDIH 1ASKA 2XF3A 6GSPA 3G713 1OHOA 2ZL8A 3EN1B 1HYFA 2AAEA 1OH0A 4MEIA 2P09A 5BVBA 4LMIA 5D83A 3G0KA 3FKAA 4R80A 1PFPA 4J9AA 4L8OA 4STDA 3KSED 2PNCA 3N8BA 4HM2B 1WQLB 7STDA 4GHOA 3KKGA 1O7HB 1I3FA 7RNTA 1BNSA 5BIRA 2CWTA 1FW7A 2E2TA 2O3OA 1N5HA 1JKGB 3F8HA 5AEWB 4N6NB 1A2KA 2W04A 1IQ8A 1N9EA 1STFI 5M18A 2RGQA 2CFKA 1EEJA 1W2B2 1QALA 5LC7A 1KC84 4MMXB 3DXOA 2CFDA 1RCKA 2WO0A 1JN5A 1C54A 2FGTA 1RN1A 2Y74A 4ILFA 3WOEB 3FGYA 2W2CA 1U8CB 1BSAA 3K0ZA 5CF1A 3CMA3 3PGBA 1IT7A 1FYSA 1A90A 2CFWA 1D6UA 2K0MA 4HYZA 3QK9A 4Q53A 1NJI4 3NXJA 2F99A 2FXTA 2KF4A 4N6TA 3F8XA 1G0TA 3X42A 1WMPA 2BHMA 4G1MB 2O9UX 1W01A 1BUQA 3K7CA 1W00A 2I9WA 4N6UA 1I70A 1W6YA 5KP3A 1VQL3 2Q07A 1RGHA 3CCE3 1OF5A 1CYVA 1GY6A 1M904 2H0GA 1X1WA 2HMLB 1US1A 3WA3A 1VQ63 3SOYA 4FCZA 2W0QA 1GMPA 1RGCA 4NREA 5JPPA 1YIT3 1RJOA 3S29A 1TFKA 2CHCA 1Q42A 3NUVA 3NBBA 5G2GA 4DKIA 3DMCA 2RNTA 1D6YA 3FH1A 1OCVA 5IEPA 3STDA 2XGLA 3VF1A 1IQXA 5AIHA 3CCS3 1ZO2A 3D79A 3HIIA 4WHAA 4KT3B 2CFLA 5RNTA 4LZIA 1LQMB 5JPUA 4BTWA 1WNHA 2GU3A 2P0XA 1B3SA 1JRQA 1V74A 1ULIB 1YVBI 3KCHA 1LOWA 1GD4A 4O8SA 3UB1A 1KSIA 1IK3A 1BRHA 4AKZA 2GEXA 3JUMA 1VQM3 2W9PA 3HX8A 1QJGA 2GEYA 3PZWA 3CC43 1DETA 1BNFA 1LNIA 3CNXA 3DH2A 2L1SA 4KFDA 1QMAA 4R9LA 4WFOA 5EEOA 3G8ZA 1Q864 3MKIA 2IUKA 3SVAA 2KRTA 3BIRA 3HIGA 2OQEA 1I2GA 2C4BA 2KAAA 5CLKA 4XDVA 2QA43 1A2PA 1BRIA 3ROBA 1LNHA 2XSOB 1TRQA 1T2HA 2P38A 2KF5A 3SYUA 1O7PB 1KWIA 1UW1A 1BANA 3GWRA 1LRAA 3AMOA 4BTXA 1K9M4 2F4YA 2XH9A 1V58A 3U97A 1BRGA 1K28A 3DGLA 1YJ93 2GXFA 1GOYA 2K3DA 1I3IA 4H61A 2C11A 2MC8A 1BOXA 3EC9A 4HZ9B 3ALAA 1UUGB 2W9QA 1RSNA 2A15A 1Q40B 1Q814 4U13A 1GMQA 1CEWI 3CNMA 1LOYA 2F56A 3EB8A 2Z7AA 4X2OA 5IF6A 1K734 1WMOA 2KF6A 2OQEC 3HOHA 2CK3H 3RNTA 3SLUA 3NQYA 4K1VA 2IYJA 2Y73A 3ZG5A 3ECFA 3HK4A 4XBXA 3NBJA 5A0OB 1RLSA 2KF3A 3FG4A 1MWUA 3FCSB 3IPTA 3KN4A 1IDPA 1T5YA 1NO3A 1SARA 5FGOA 6RNTA 1HZ1A 1KD14 6STDA 3CXC2 2E2UA 2HMNB 1E3VA 1I0VA 4K61A 3EF8A 4KZ1A 4BU4A 3KZTA 3CCM3 2F5WA 3MWZA 2XEPA 3VGNA 1NB5I 4CDLA 2OWPA 1N8R4 3FSDA 1HKXA 3D5GA 3PXMA 2B24B 4NPBA 2XFSA 2CWUA 2CX1A 3EHCA 1WTHA 1BSBA 4OUQA 2W6JH 4WYKB 3JUNA 4EXRA 1X1YA 4RNZA 2OCTA 1IU7A 3H3HA 1JKGA 3LOYA 1PY3A 2LYXA 4HVNA 4OK0A 1LOXA 3DUKA 3KE7A 4HZBB 3MG2A 3NM2A 1VQK3 1YI23 1IVVA 4ORLA 1TTOA 2PZVA 3GRDA 1OUNA 2HMOB 4HM6B 1LOVA 1VQN3 3EN8A 1E3RA 2OOVC 3DGNA 3JVCA 3DGOA 1CH0A 1ROVA 4BTYA 3N54B 1A2VA 1JBRA 4KFEA 2SARA 3G16A 3D4AA 1S5AA 5BXQA 1DMQA 1M1XB 3EJVA 1GY7A 3MYTA 1F8NA 2XRXB 1ZGXA 3T8NA 1IV7A 4FMCA 3LTBA 3X3ZA 3H51A 1YNVX 1BSEA 3FLJA 4K1UA 1U5OA 3L0RA 1QAKA 4FCJA 1BRKA 8RNTA 3CCV3 1VQ53 5LC6A 1KQS2 4X2HA 9RNTA 3T8UA 5EQLA 3UL5A 5JBSA 1I2EA 2J8XB 1ROAA 3CPW2 2IY2A 3PCSA 1NB3I 3BLZA 3EX9A 1VQ83 4R4KA 2WGQA 1B2SA 3MPHA 4H3UA 1FZUA 2GSPA 1IV9A 5ELJA 3ZFZA 2P05A 3FZWA 3B4OA 1FA3A 5D82A 1RHLA 1UCJA 4KFFA 1O7MB 3F40A 1UUVB 5CXOA 1RNTA 3CC23 2KXGA 1Q824 4TX4A 4AKYA 3GSPA 3LTDA 1QAFA 4N3VA 4O2HA 7GSPA 3NQZA 1VQ43 1MNLA 2RCDA 8CHOA 1JBSA 1FUWA 5G1KA 1E97A 4EV2A 1CYUA 2STDA 3OW22 3LTAA 1DVCA 3GZRA 1RGEA 3O8YA 3BNBA 3Q3FA 1GOUA 5HGRA 1B2XA 2ML5A 4XBTA 5IG3A 3G6E3 1GOVA 3NHXA 3EBYA 4RBNA 4FCMA 3WA2X 4L7KA 3DZLA 3GZYB 5AEUB 1BUJA 1M9GA 1L5GB 3SOAA 1W2ZA 1GMRA 4L8PA 4WP5A 2UX0A 4BIRA 3F14A 3CCU3 1MOLA 1VQ93 2CW9A 3OV4A 1IYYA 4EYCA 3WHOA 5AYSC 1GSPA 2BNGA 3HZPA 4NHFA 1JB2A 3CCL3 1I2FA 1OHPA 2H0IA 2YX9A 4LYLB 3JUPA 3F7SA 4N6OB 1MGWA 4IIAA 4R9KA 3VSYA 4N6MA 4O3VA 2HMJB 5IENA 1IVXA 2CC3A 1VQO3 1SQWA 1CQSA 2L4VA 5G1LA 4GB5A 2JQ5A 3FG3A 1K8A4 3WR2A 4GSPA 1K41A 1Q40A 1AVLA 3JUQA 2LQVA 3NX0A 3K5TA 1FGQA 1QVG2 3QRDA 1FGMA 3M8CA 4HM4B 1VQ73 2BO9B 2CWVA 2RFRA 3NV0B 1JBTA 1BGSA 1BSCA 1Y4KA 1W02A 3GAXA 1JNQA 1RKYA 1RCLA 1AV4A 1SPUA 2YFLB 3OX9A 4O02B 2XGNA 3Q2PA 3NBRA 2IUJA 5D81A 3CC73 5AIGA 2SBLA 2RSXA 1DMNA 1JB5A 1C7HA 1Q7HA 1RN7A 3X3XA 2W03A 3CCJ3 4AEQA 2ZA4A 1X1UA 1RNBA 1B20A
chains in the Genus database with same CATH topology
1UUGB 2J8XB 2ZHXB 1EUIC 2UGIA 1UDII 1UGHI 2UUGC 1LQGC 4LYLB 1UGIA 1LQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUG B;  2J8X B;  2ZHX B;  1EUI C;  2UGI A;  1UDI I;  1UGH I;  2UUG C;  1LQG C;  4LYL B;  1UGI A;  1LQM B; 
#chains in the Genus database with same CATH topology
 1OHS A;  3NM7 A;  3CPO A;  4FR9 A;  4K90 B;  1I0X A;  5CK6 A;  1W6G A;  4XBY A;  2CG1 A;  5IER A;  3BU4 A;  3J7Y d;  1RTU A;  1MWR A;  4HAA A;  1R4C A;  3MG3 A;  3UJM A;  3CU3 A;  3WDG B;  4WYK A;  4EW5 A;  1UI8 A;  5KP4 A;  1B2M A;  4I5Q A;  1IVU A;  1MWS A;  1O7G B;  5AIF A;  3S27 A;  3X41 A;  3G4S 3;  1YJW 3;  2MF7 A;  2IA7 A;  1DMM A;  3TDG A;  3OWU A;  2ZHX B;  1TUH A;  2R41 A;  2YFJ B;  1OPY A;  3Q1C A;  1BNE A;  2BMR B;  2XFT A;  2BU4 A;  3U1W A;  2OTL 3;  3UNL A;  2BT3 A;  1VQQ A;  3N9H A;  3A5E A;  1UGI A;  4RNY A;  1UCK A;  1YGW A;  2BIR A;  3AGO A;  1AVK A;  2BMO B;  3MSO A;  4QWT A;  1O7W B;  3X40 A;  1ZX2 A;  2D42 A;  2ZDJ A;  3D9R A;  1RN4 A;  1OAC A;  4LEH A;  1BNJ A;  5FW5 A;  3WOD G;  3URP A;  2WOF A;  3JUO A;  3V99 A;  1UUW B;  2QGU A;  3E99 A;  3OWS A;  1NDO B;  1VQP 3;  4FMD A;  3LTC A;  3CCQ 3;  1BAO A;  3DM8 A;  3RGA A;  1D6Z A;  3I55 3;  3CME 3;  3F9S A;  1TIJ A;  2CFG A;  1PU4 A;  5TGN A;  3MG1 A;  3IMA B;  4KVH A;  1UDI I;  1N8Q A;  3LXU X;  1PYL A;  1JB4 A;  1JZD A;  4PEJ A;  1NWW A;  1B27 A;  2GBX B;  2ML6 A;  1UI7 A;  3D5I A;  4LGQ A;  4J5G A;  2W56 B;  1W5Z A;  3KII A;  3FF0 A;  3CCR 3;  4HKV B;  1DE3 A;  2WGO A;  4R1K A;  3AHW A;  3GZB A;  2OTJ 3;  4GL6 A;  2F5M A;  1BRJ A;  1YHQ 3;  2F86 B;  3OWY A;  4HBR A;  3BNE A;  1FUT A;  5I97 A;  3FG1 A;  2Z77 A;  2CX0 A;  2YFI B;  1W4N A;  2XR8 B;  1B2U A;  1IQY A;  4XB5 A;  1NU3 A;  1BNR A;  2K54 A;  1RGA A;  3PCR A;  1M1K 4;  3PS8 A;  3T0U A;  1ISK A;  1IT8 A;  1TRP A;  4HM7 B;  1DYU A;  2WOH A;  1NNV A;  1BIR A;  3DY5 A;  1GYB A;  3ER7 A;  1SJW A;  1Q9E A;  2AAD A;  4N6V 0;  3I56 3;  5BU4 A;  1SIH A;  1JV2 B;  2HOH A;  3DGY A;  1GD3 A;  2HMK B;  3LH4 A;  1RRH A;  4CCV A;  2V1L A;  2H0H A;  2BMQ B;  5DRE A;  2CG0 A;  5GSP A;  1QVF 2;  1SII A;  1LVN A;  1WMN A;  3PYJ A;  3S5C A;  3V92 A;  2XSH B;  2C10 A;  1JZO A;  1W7C A;  1Z1S A;  1JN5 B;  1RDS A;  1G96 A;  4RZM A;  5EVH A;  4ZM8 A;  3EE1 A;  4N6L A;  4MMZ B;  2R4I A;  1B21 A;  3HI7 A;  1JJ2 2;  2KCD A;  1LXE A;  3SXX A;  1TFO A;  1RGG A;  2CIU A;  1EKM A;  2UUG C;  3OXA A;  1VZZ A;  3FF2 A;  3LT9 A;  3AHS A;  4XDW A;  3RGR A;  2CKF B;  2QIY A;  3NV0 A;  2GBW B;  1EUI C;  4LSO A;  3SX1 A;  3KSP A;  3EQQ B;  2HMM B;  1HU9 A;  3SED A;  5IG4 A;  4BL2 A;  1S72 3;  1N9J A;  1OF5 B;  1Q7Y 4;  4FMA A;  1RGK A;  3RDE A;  3BND A;  3DGM A;  3WMD A;  1BU4 A;  3I0Y A;  3CD6 3;  4FMB A;  2INX A;  3LT8 A;  4HM0 B;  1J2B A;  1I8V A;  2IMJ A;  1AY7 A;  1R4Y A;  4HM5 B;  1AQZ A;  3EBT A;  2B1X B;  3LZA A;  2F98 A;  4WWU C;  1ULJ B;  3GZX B;  3Q90 A;  1EQK A;  1MGR A;  1FGT A;  1O7N B;  4HM3 B;  1UGH I;  5AII A;  1UCL A;  1GS3 A;  4MJD A;  1V57 A;  2RBI A;  4XM4 A;  4HOH A;  2UGI A;  1RRL A;  3IJE B;  1FUS A;  4JF8 A;  1BRN L;  3B8L A;  4I4K A;  4JRF A;  4CPK A;  3WOF B;  5STD A;  3K63 A;  3B7C A;  2M7O A;  3MHE A;  1LQG C;  1AR0 A;  1TJD A;  1W6C A;  2D1W A;  5IG5 A;  1YJN 3;  4J5K A;  5IW9 A;  1X1X A;  3LYG A;  1RMS A;  2E2V A;  1B2Z A;  3V98 A;  3A76 A;  5DRV A;  1BRS A;  5AYR B;  1BSD A;  5AI1 A;  1STD A;  1N5P A;  5IEO A;  1IVW A;  1UCI A;  4HM1 B;  1EG9 B;  3S28 A;  2QEX 3;  3D3L A;  3AMO B;  3B4P A;  3BNC A;  4IT7 A;  4HJL B;  1EA2 A;  3K9M C;  1RGF A;  4EBG A;  5IG0 A;  2Z76 A;  1OGX A;  2P0M A;  3BB9 A;  4EV5 A;  4EC6 A;  1OGZ A;  1YVS A;  2FNQ A;  1T2I A;  2Z6B A;  4MMY B;  3X3Y A;  3AGN A;  3ZG0 A;  4RNT A;  1BNG A;  3LML A;  4HM8 B;  1ZS7 A;  1T3B A;  5M1A A;  3S67 A;  1MWT A;  1BVI A;  1G02 A;  3KFQ C;  1YIJ 3;  1YGE A;  2W56 A;  1A67 A;  1FGO A;  2GU1 A;  4CJN A;  4BL3 A;  4J8T A;  5KP1 A;  5CF2 A;  2OOV A;  2CH9 A;  4OVM A;  4IPB A;  3F7X A;  3UL6 A;  1BNI A;  1RGL A;  1DVD A;  1TU5 A;  5HOH A;  1GY5 A;  1TP6 A;  1FGR A;  5ELU A;  5M19 A;  2JDI H;  1ASK A;  2XF3 A;  6GSP A;  3G71 3;  1OHO A;  2ZL8 A;  3EN1 B;  1HYF A;  2AAE A;  1OH0 A;  4MEI A;  2P09 A;  5BVB A;  4LMI A;  5D83 A;  3G0K A;  3FKA A;  4R80 A;  1PFP A;  4J9A A;  4L8O A;  4STD A;  3KSE D;  2PNC A;  3N8B A;  4HM2 B;  1WQL B;  7STD A;  4GHO A;  3KKG A;  1O7H B;  1I3F A;  7RNT A;  1BNS A;  5BIR A;  2CWT A;  1FW7 A;  2E2T A;  2O3O A;  1N5H A;  1JKG B;  3F8H A;  5AEW B;  4N6N B;  1A2K A;  2W04 A;  1IQ8 A;  1N9E A;  1STF I;  5M18 A;  2RGQ A;  2CFK A;  1EEJ A;  1W2B 2;  1QAL A;  5LC7 A;  1KC8 4;  4MMX B;  3DXO A;  2CFD A;  1RCK A;  2WO0 A;  1JN5 A;  1C54 A;  2FGT A;  1RN1 A;  2Y74 A;  4ILF A;  3WOE B;  3FGY A;  2W2C A;  1U8C B;  1BSA A;  3K0Z A;  5CF1 A;  3CMA 3;  3PGB A;  1IT7 A;  1FYS A;  1A90 A;  2CFW A;  1D6U A;  2K0M A;  4HYZ A;  3QK9 A;  4Q53 A;  1NJI 4;  3NXJ A;  2F99 A;  2FXT A;  2KF4 A;  4N6T A;  3F8X A;  1G0T A;  3X42 A;  1WMP A;  2BHM A;  4G1M B;  2O9U X;  1W01 A;  1BUQ A;  3K7C A;  1W00 A;  2I9W A;  4N6U A;  1I70 A;  1W6Y A;  5KP3 A;  1VQL 3;  2Q07 A;  1RGH A;  3CCE 3;  1OF5 A;  1CYV A;  1GY6 A;  1M90 4;  2H0G A;  1X1W A;  2HML B;  1US1 A;  3WA3 A;  1VQ6 3;  3SOY A;  4FCZ A;  2W0Q A;  1GMP A;  1RGC A;  4NRE A;  5JPP A;  1YIT 3;  1RJO A;  3S29 A;  1TFK A;  2CHC A;  1Q42 A;  3NUV A;  3NBB A;  5G2G A;  4DKI A;  3DMC A;  2RNT A;  1D6Y A;  3FH1 A;  1OCV A;  5IEP A;  3STD A;  2XGL A;  3VF1 A;  1IQX A;  5AIH A;  3CCS 3;  1ZO2 A;  3D79 A;  3HII A;  4WHA A;  4KT3 B;  2CFL A;  5RNT A;  4LZI A;  1LQM B;  5JPU A;  4BTW A;  1WNH A;  2GU3 A;  2P0X A;  1B3S A;  1JRQ A;  1V74 A;  1ULI B;  1YVB I;  3KCH A;  1LOW A;  1GD4 A;  4O8S A;  3UB1 A;  1KSI A;  1IK3 A;  1BRH A;  4AKZ A;  2GEX A;  3JUM A;  1VQM 3;  2W9P A;  3HX8 A;  1QJG A;  2GEY A;  3PZW A;  3CC4 3;  1DET A;  1BNF A;  1LNI A;  3CNX A;  3DH2 A;  2L1S A;  4KFD A;  1QMA A;  4R9L A;  4WFO A;  5EEO A;  3G8Z A;  1Q86 4;  3MKI A;  2IUK A;  3SVA A;  2KRT A;  3BIR A;  3HIG A;  2OQE A;  1I2G A;  2C4B A;  2KAA A;  5CLK A;  4XDV A;  2QA4 3;  1A2P A;  1BRI A;  3ROB A;  1LNH A;  2XSO B;  1TRQ A;  1T2H A;  2P38 A;  2KF5 A;  3SYU A;  1O7P B;  1KWI A;  1UW1 A;  1BAN A;  3GWR A;  1LRA A;  3AMO A;  4BTX A;  1K9M 4;  2F4Y A;  2XH9 A;  1V58 A;  3U97 A;  1BRG A;  1K28 A;  3DGL A;  1YJ9 3;  2GXF A;  1GOY A;  2K3D A;  1I3I A;  4H61 A;  2C11 A;  2MC8 A;  1BOX A;  3EC9 A;  4HZ9 B;  3ALA A;  1UUG B;  2W9Q A;  1RSN A;  2A15 A;  1Q40 B;  1Q81 4;  4U13 A;  1GMQ A;  1CEW I;  3CNM A;  1LOY A;  2F56 A;  3EB8 A;  2Z7A A;  4X2O A;  5IF6 A;  1K73 4;  1WMO A;  2KF6 A;  2OQE C;  3HOH A;  2CK3 H;  3RNT A;  3SLU A;  3NQY A;  4K1V A;  2IYJ A;  2Y73 A;  3ZG5 A;  3ECF A;  3HK4 A;  4XBX A;  3NBJ A;  5A0O B;  1RLS A;  2KF3 A;  3FG4 A;  1MWU A;  3FCS B;  3IPT A;  3KN4 A;  1IDP A;  1T5Y A;  1NO3 A;  1SAR A;  5FGO A;  6RNT A;  1HZ1 A;  1KD1 4;  6STD A;  3CXC 2;  2E2U A;  2HMN B;  1E3V A;  1I0V A;  4K61 A;  3EF8 A;  4KZ1 A;  4BU4 A;  3KZT A;  3CCM 3;  2F5W A;  3MWZ A;  2XEP A;  3VGN A;  1NB5 I;  4CDL A;  2OWP A;  1N8R 4;  3FSD A;  1HKX A;  3D5G A;  3PXM A;  2B24 B;  4NPB A;  2XFS A;  2CWU A;  2CX1 A;  3EHC A;  1WTH A;  1BSB A;  4OUQ A;  2W6J H;  4WYK B;  3JUN A;  4EXR A;  1X1Y A;  4RNZ A;  2OCT A;  1IU7 A;  3H3H A;  1JKG A;  3LOY A;  1PY3 A;  2LYX A;  4HVN A;  4OK0 A;  1LOX A;  3DUK A;  3KE7 A;  4HZB B;  3MG2 A;  3NM2 A;  1VQK 3;  1YI2 3;  1IVV A;  4ORL A;  1TTO A;  2PZV A;  3GRD A;  1OUN A;  2HMO B;  4HM6 B;  1LOV A;  1VQN 3;  3EN8 A;  1E3R A;  2OOV C;  3DGN A;  3JVC A;  3DGO A;  1CH0 A;  1ROV A;  4BTY A;  3N54 B;  1A2V A;  1JBR A;  4KFE A;  2SAR A;  3G16 A;  3D4A A;  1S5A A;  5BXQ A;  1DMQ A;  1M1X B;  3EJV A;  1GY7 A;  3MYT A;  1F8N A;  2XRX B;  1ZGX A;  3T8N A;  1IV7 A;  4FMC A;  3LTB A;  3X3Z A;  3H51 A;  1YNV X;  1BSE A;  3FLJ A;  4K1U A;  1U5O A;  3L0R A;  1QAK A;  4FCJ A;  1BRK A;  8RNT A;  3CCV 3;  1VQ5 3;  5LC6 A;  1KQS 2;  4X2H A;  9RNT A;  3T8U A;  5EQL A;  3UL5 A;  5JBS A;  1I2E A;  2J8X B;  1ROA A;  3CPW 2;  2IY2 A;  3PCS A;  1NB3 I;  3BLZ A;  3EX9 A;  1VQ8 3;  4R4K A;  2WGQ A;  1B2S A;  3MPH A;  4H3U A;  1FZU A;  2GSP A;  1IV9 A;  5ELJ A;  3ZFZ A;  2P05 A;  3FZW A;  3B4O A;  1FA3 A;  5D82 A;  1RHL A;  1UCJ A;  4KFF A;  1O7M B;  3F40 A;  1UUV B;  5CXO A;  1RNT A;  3CC2 3;  2KXG A;  1Q82 4;  4TX4 A;  4AKY A;  3GSP A;  3LTD A;  1QAF A;  4N3V A;  4O2H A;  7GSP A;  3NQZ A;  1VQ4 3;  1MNL A;  2RCD A;  8CHO A;  1JBS A;  1FUW A;  5G1K A;  1E97 A;  4EV2 A;  1CYU A;  2STD A;  3OW2 2;  3LTA A;  1DVC A;  3GZR A;  1RGE A;  3O8Y A;  3BNB A;  3Q3F A;  1GOU A;  5HGR A;  1B2X A;  2ML5 A;  4XBT A;  5IG3 A;  3G6E 3;  1GOV A;  3NHX A;  3EBY A;  4RBN A;  4FCM A;  3WA2 X;  4L7K A;  3DZL A;  3GZY B;  5AEU B;  1BUJ A;  1M9G A;  1L5G B;  3SOA A;  1W2Z A;  1GMR A;  4L8P A;  4WP5 A;  2UX0 A;  4BIR A;  3F14 A;  3CCU 3;  1MOL A;  1VQ9 3;  2CW9 A;  3OV4 A;  1IYY A;  4EYC A;  3WHO A;  5AYS C;  1GSP A;  2BNG A;  3HZP A;  4NHF A;  1JB2 A;  3CCL 3;  1I2F A;  1OHP A;  2H0I A;  2YX9 A;  4LYL B;  3JUP A;  3F7S A;  4N6O B;  1MGW A;  4IIA A;  4R9K A;  3VSY A;  4N6M A;  4O3V A;  2HMJ B;  5IEN A;  1IVX A;  2CC3 A;  1VQO 3;  1SQW A;  1CQS A;  2L4V A;  5G1L A;  4GB5 A;  2JQ5 A;  3FG3 A;  1K8A 4;  3WR2 A;  4GSP A;  1K41 A;  1Q40 A;  1AVL A;  3JUQ A;  2LQV A;  3NX0 A;  3K5T A;  1FGQ A;  1QVG 2;  3QRD A;  1FGM A;  3M8C A;  4HM4 B;  1VQ7 3;  2BO9 B;  2CWV A;  2RFR A;  3NV0 B;  1JBT A;  1BGS A;  1BSC A;  1Y4K A;  1W02 A;  3GAX A;  1JNQ A;  1RKY A;  1RCL A;  1AV4 A;  1SPU A;  2YFL B;  3OX9 A;  4O02 B;  2XGN A;  3Q2P A;  3NBR A;  2IUJ A;  5D81 A;  3CC7 3;  5AIG A;  2SBL A;  2RSX A;  1DMN A;  1JB5 A;  1C7H A;  1Q7H A;  1RN7 A;  3X3X A;  2W03 A;  3CCJ 3;  4AEQ A;  2ZA4 A;  1X1U A;  1RNB A;  1B20 A; 
#chains in the Genus database with same CATH homology
 1UUG B;  2J8X B;  2ZHX B;  1EUI C;  2UGI A;  1UDI I;  1UGH I;  2UUG C;  1LQG C;  4LYL B;  1UGI A;  1LQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...