2CC3A

Structure of agrobacterium tumefaciens virb8 protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
144
structure length
144
Chain Sequence
GPHMTQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFFNYPNPTSPQVILGKHGRLEVEHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLRLTNPGGLVVTSYQTSEDTVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Secretion system
molecule keywords PROTEIN VIRB8
publication title Agrobacterium Tumefaciens Virb8 Structure Reveals Potential Protein-Protein Interactions Sites.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 39
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.230 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2cc3A00
4JF8A 4KZ1A 4MEIA 4O3VA 5I97A 4AKYA 2CC3A 5JBSA 4NHFA 4AKZA 4LSOA 2BHMA
chains in the Genus database with same CATH superfamily
1I2GA 1BIRA 1VQ73 1N5PA 2XFSA 4KFFA 3IJEB 4RBNA 3EHCA 1HYFA 3MYTA 3SX1A 2HMMB 1O7WB 1BNIA 2INXA 2OCTA 3NBJA 4O8SA 2BHMA 2R4IA 3JUOA 4HM8B 4R9LA 2RSXA 4RNYA 1QJGA 2K3DA 4BTYA 4CDLA 4CCVA 4KT3B 4N6TA 2CH9A 2XSHB 1IU7A 2J8XB 3O8YA 3WDGB 1UUGB 2ZA4A 3KZTA 1IYYA 1YIJ3 3CNMA 4I4KA 1K734 1TRPA 3KSED 2GEXA 2XR8B 3H51A 1ZO2A 2F5WA 4GB5A 4O02B 5AIFA 5G1KA 2MC8A 1S723 3BB9A 1FGMA 1N9EA 1VZZA 1WTHA 1JZOA 3PZWA 4N6LA 2WOFA 1GOVA 3FF0A 3UJMA 3D4AA 1EG9B 1V74A 2XF3A 3RDEA 1JRQA 3ZFZA 3MHEA 4JRFA 3G0KA 3E99A 4NPBA 4XBTA 3FF2A 3CCL3 1O7GB 3SYUA 8CHOA 1IQ8A 3AGNA 1RN1A 4XBXA 3WOFB 4LSOA 2P05A 1BNSA 9RNTA 5M1AA 4HZBB 3G6E3 4RNZA 4U13A 3F7XA 5AI1A 1G96A 2RFRA 3GSPA 3LTDA 4XM4A 1JN5B 1GY5A 2BNGA 2W56A 1S5AA 1IVWA 1WQLB 3FZWA 2CIUA 4WHAA 4BL3A 2F86B 2SARA 3UNLA 4PEJA 1OGXA 2UGIA 1PFPA 1DVDA 4MMXB 1U8CB 2CX0A 2GXFA 1BANA 1UCLA 4LGQA 4HM4B 3CC23 2W6JH 3ROBA 1YIT3 2Y74A 5ELJA 4MEIA 3CD63 4HM1B 5IF6A 3EJVA 3B4PA 1BRHA 3VF1A 1Q40A 1W4NA 5ELUA 4HM0B 2F5MA 1TUHA 3GZXB 3SOYA 4HM5B 4NHFA 2FXTA 2L1SA 4R9KA 2Y73A 1JNQA 2QGUA 3FG1A 1TP6A 1HZ1A 1I0XA 3F8HA 1YGEA 4IIAA 4N3VA 2KF4A 2YFJB 4Q53A 2P0XA 2KCDA 4XB5A 1SIIA 4N6V0 3D5IA 3UL6A 1W01A 3AHSA 3X3ZA 3G4S3 1QVG2 1RJOA 1YHQ3 1N5HA 1MWUA 1DMNA 1U5OA 3WA2X 3B8LA 1BNGA 2P0MA 3BLZA 1A2PA 1QALA 1M9GA 3NV0B 5FW5A 1G0TA 1BOXA 1W02A 3WMDA 4LYLB 5IG4A 1B2MA 4EV5A 2HMOB 2CFLA 2IMJA 2CKFB 1NO3A 3DGLA 3MG1A 4HOHA 4HZ9B 5AIIA 5IERA 1NWWA 2F99A 1GS3A 3NX0A 4HYZA 1RGCA 1BRKA 1MWTA 5D83A 1W2B2 1UDII 3HX8A 4EYCA 1BRGA 4G1MB 1VQ53 1TFOA 1RGLA 1B2UA 4N6UA 3VGNA 3SVAA 1EEJA 1VQN3 1EQKA 3L0RA 4WYKA 1N8R4 1RGKA 3FG3A 1UGIA 3EQQB 1RLSA 2CW9A 5D82A 5IW9A 3DY5A 1VQP3 1QMAA 1IQXA 3PCSA 2W9QA 3SOAA 2FGTA 5KP4A 4EBGA 2CFKA 1VQ63 1G02A 1OH0A 1I8VA 2BMQB 3FGYA 2W2CA 2YFIB 3DGOA 1JBRA 1FGTA 1SQWA 3GZYB 4J8TA 4O3VA 1W6YA 1W2ZA 3FH1A 4R80A 1JZDA 2ML6A 3K7CA 3DGNA 1C54A 1FZUA 3WODG 3OWSA 1RNTA 1TRQA 3M8CA 1YVBI 1EA2A 2GBWB 4XDVA 3MG3A 1FUSA 3K63A 3DZLA 3CME3 3T8UA 1CH0A 1R4CA 1VQL3 1X1UA 6GSPA 5KP1A 5DRVA 4ILFA 3LH4A 4N6MA 2RGQA 2B24B 4HM6B 4X2OA 2H0GA 3BNDA 1UCJA 3F8XA 1PY3A 1O7NB 3DMCA 3OV4A 4HM2B 2IY2A 2CFDA 1B2ZA 1B2XA 1RCKA 4K1VA 3K9MC 2C4BA 1ULIB 4L7KA 1WMOA 1GOYA 2W03A 3LT9A 3OX9A 2RCDA 2XGNA 3RGRA 1UUWB 1X1WA 2BT3A 4H3UA 4L8OA 1W7CA 3I553 5IG3A 1BSCA 3EE1A 3SEDA 4EC6A 3EB8A 1TJDA 1V57A 1RDSA 1DE3A 2C10A 7STDA 1AVLA 1IVXA 1FGOA 4LEHA 4MMZB 1MWSA 1WMNA 1JBTA 4FMDA 1B2SA 3KCHA 3GAXA 1T5YA 3J7Yd 1YJN3 1Q864 1O7HB 3ZG0A 1JBSA 5TGNA 5CK6A 5BIRA 1BRIA 1AY7A 1RRHA 3OWUA 4HM7B 1ISKA 4OK0A 2B1XB 4AEQA 1CEWI 1ASKA 5EQLA 1RTUA 1K9M4 2W56B 3CPOA 1SARA 1UI8A 1AV4A 3CNXA 1Q824 4BU4A 1US1A 1RNBA 1LNHA 3DXOA 1IV9A 2W0QA 2QA43 3TDGA 1W6CA 3BNBA 3T8NA 3AGOA 1BNEA 2KF3A 3D9RA 2CG0A 4HVNA 2AAEA 1ROVA 4X2HA 1RMSA 3LOYA 2OOVC 1N9JA 1BU4A 2P09A 2XFTA 3F7SA 3EN8A 1M1K4 1DMQA 4LMIA 5M18A 1Q40B 1RGEA 2GBXB 2HMKB 3X3YA 1RSNA 2RBIA 3IMAB 1FW7A 4K90B 1RKYA 4RZMA 2Z77A 4R1KA 5HGRA 1FA3A 3CMA3 1C7HA 2OTL3 3CCJ3 1RHLA 1I3FA 2Z76A 3HIGA 3Q90A 4IT7A 1SIHA 3K5TA 2GSPA 4J9AA 1B3SA 2E2UA 2V1LA 1OCVA 2JDIH 3H3HA 1A67A 1VQ93 1J2BA 1JKGA 3S27A 1QAKA 3BNCA 4NREA 5AIGA 3NUVA 1JB2A 1IVVA 3B7CA 3GZRA 4ORLA 3HOHA 2CWVA 1KC84 3FG4A 3Q3FA 1RGHA 2K0MA 2ZL8A 1BSDA 1GY6A 4FCZA 4WFOA 2XGLA 3S5CA 3SXXA 1E3RA 4K61A 2KRTA 1BRSA 3DUKA 5DREA 1W00A 1E97A 4BTWA 1UCKA 3BIRA 3KIIA 1F8NA 2IUKA 3PYJA 3EBTA 5AIHA 3HI7A 4XBYA 4MMYB 4HM3B 3CXC2 2OQEC 5AEUB 1LOXA 3NQZA 1GOUA 2CHCA 2CWUA 1I70A 2YX9A 3F40A 4H61A 4WYKB 2A15A 3F9SA 1JV2B 3X40A 1JB4A 1B27A 1TTOA 3KN4A 4I5QA 5JPUA 1T2HA 1YJ93 4QWTA 1UCIA 1D6UA 4FMBA 1NU3A 3LZAA 5EEOA 1TU5A 1LXEA 3NBBA 2BMOB 5M19A 2Z7AA 2BU4A 1Z1SA 2D1WA 4LZIA 3STDA 2R41A 1MOLA 2IYJA 3JVCA 4IPBA 3WHOA 5BU4A 3PS8A 2QEX3 5A0OB 3OW22 1OPYA 2XEPA 1B21A 2LQVA 3DM8A 3HZPA 3LTCA 2H0IA 1K8A4 3S28A 3G713 1I2FA 2KAAA 3LT8A 1BSAA 4KFDA 1OF5A 3OWYA 5AYSC 1B20A 7GSPA 1IV7A 1FGRA 1VQ43 1GMQA 1GYBA 1PU4A 3S29A 3ALAA 2L4VA 2XRXB 1RCLA 1IK3A 1BVIA 1LVNA 1STFI 3EF8A 5I97A 2ZHXB 3ECFA 1K28A 3EN1B 3JUMA 1LQGC 3NBRA 1TFKA 3X42A 1NB5I 1FUTA 3I0YA 3FKAA 2OWPA 1OUNA 3T0UA 1YGWA 4CPKA 5D81A 1R4YA 3UL5A 1BAOA 2PNCA 4HAAA 3Q1CA 1ZGXA 1GMPA 3DGYA 1V58A 5CXOA 5IENA 1KQS2 3D5GA 1WMPA 2ZDJA 2E2VA 2PZVA 4KFEA 4ZM8A 3ZG5A 6RNTA 1D6YA 5CF1A 4J5KA 1EKMA 2BMRB 1K41A 2WO0A 3A76A 3HIIA 3U1WA 1Q9EA 3V92A 5GSPA 3OXAA 5AEWB 2WGQA 3QRDA 4K1UA 1UI7A 1DETA 2MF7A 1AQZA 1LRAA 1IVUA 1WNHA 1KD14 1M904 2CX1A 1IDPA 2K54A 4OUQA 3SLUA 1BNFA 1W6GA 4J5GA 5IG0A 3U97A 1LOWA 4L8PA 1MGRA 3DH2A 1OGZA 2WOHA 1ROAA 3WR2A 1BRNL 1QVF2 1A90A 1O7MB 1JB5A 5LC7A 3NQYA 3GRDA 3ER7A 1IT8A 3IPTA 3NM2A 4BTXA 1EUIC 1ZS7A 1OHOA 3FLJA 1N8QA 1A2VA 1BRJA 1Q814 1NJI4 1LOVA 3MSOA 1AVKA 4GSPA 3JUPA 7RNTA 3CCQ3 2M7OA 3KE7A 3LMLA 3LYGA 2XSOB 2KF6A 2CK3H 2STDA 1ZX2A 2QIYA 4AKYA 3F14A 2CC3A 1LQMB 3JUQA 2O9UX 5FGOA 1KWIA 1O7PB 4O2HA 1VQK3 8RNTA 1PYLA 2E2TA 1YJW3 1OACA 3BNEA 2W9PA 5HOHA 3CCS3 1OHSA 4BIRA 5CF2A 5IG5A 1Y4KA 1GD3A 3EX9A 1NNVA 1GD4A 3WOEB 4RNTA 1VQQA 1X1XA 4GHOA 3AMOB 3RGAA 1HU9A 4N6NB 3A5EA 1FYSA 3N9HA 2OOVA 3CPW2 3WA3A 1JJ22 3AMOA 3V98A 1VQM3 1VQ83 1CYVA 5AYRB 3AHWA 3FSDA 1I0VA 1BNRA 3G16A 3FCSB 1Q7Y4 4WP5A 2CFGA 3X41A 2IA7A 1JKGB 1DMMA 1JN5A 1Q7HA 2P38A 1YI23 3N8BA 1NDOB 1FGQA 1BNJA 3LTBA 4EXRA 3MWZA 1SJWA 4EW5A 1IT7A 3UB1A 2H0HA 1Q42A 4FCJA 1OHPA 1D6ZA 3GZBA 2SBLA 4MJDA 1SPUA 2AADA 2O3OA 1BSEA 3PGBA 4KZ1A 3I563 3EBYA 3VSYA 3CC73 5JBSA 1GSPA 2GEYA 1I2EA 2CG1A 3LXUX 2IUJA 1RN7A 4R4KA 5KP3A 1FUWA 1E3VA 1UW1A 3G8ZA 3NM7A 4HKVB 2XH9A 2HMNB 2KXGA 5BXQA 3B4OA 2UUGC 1CYUA 3PCRA 1AR0A 1QAFA 4TX4A 2OTJ3 2D42A 2ML5A 4CJNA 2KF5A 2RNTA 5IEPA 1LOYA 4HJLB 4BL2A 3RNTA 2W04A 1DVCA 2HOHA 2OQEA 1VQO3 1HKXA 3CC43 1KSIA 4FR9A 3LTAA 4GL6A 1RRLA 2Q07A 3KFQC 4DKIA 2F56A 2GU3A 1STDA 3NV0A 2HMJB 1MGWA 1NB3I 1RGAA 5STDA 5CLKA 3K0ZA 4FMAA 4WWUC 5RNTA 3PXMA 1UUVB 2CWTA 5BVBA 5EVHA 3N54B 3CCU3 1I3IA 1T3BA 1UGHI 3QK9A 3CCV3 1BUQA 2C11A 1GMRA 2HMLB 1IQYA 3NHXA 1YVSA 3DGMA 1BSBA 1A2KA 5LC6A 3V99A 5IEOA 2YFLB 3X3XA 1BGSA 4JF8A 2UX0A 4EV2A 2BIRA 5G1LA 3BU4A 1OF5B 3MPHA 3MG2A 4OVMA 5G2GA 1RGFA 1T2IA 2F98A 3JUNA 2GU1A 6STDA 2LYXA 2FNQA 3GWRA 1X1YA 1MWRA 2WGOA 3HK4A 3Q2PA 3KSPA 2BO9B 3CCM3 1W5ZA 1RGGA 2Z6BA 1L5GB 4STDA 4HBRA 3URPA 3CU3A 4KVHA 3KKGA 3D79A 4AKZA 4FMCA 3MKIA 1M1XB 1TIJA 2JQ5A 3NXJA 4N6OB 5JPPA 4FCMA 3D3LA 2CFWA 1MNLA 2I9WA 3CCE3 1ULJB 3CCR3 1BUJA 2F4YA 3EC9A 1DYUA 1LNIA 1RN4A 1CQSA 4XDWA 3S67A 1YNVX 1GY7A
chains in the Genus database with same CATH topology
1VQ73 1N5PA 2XFSA 4KFFA 3IJEB 4RBNA 3EHCA 3MYTA 3SX1A 2HMMB 1O7WB 2INXA 2OCTA 3NBJA 4O8SA 2BHMA 2R4IA 3JUOA 4HM8B 4R9LA 2RSXA 4RNYA 1QJGA 4BTYA 4CDLA 4CCVA 4N6TA 2CH9A 2XSHB 1IU7A 3O8YA 3WDGB 3KZTA 1YIJ3 3CNMA 4I4KA 1K734 3KSED 2GEXA 2XR8B 3H51A 1ZO2A 4GB5A 5AIFA 4O02B 2MC8A 1S723 3BB9A 1FGMA 1N9EA 1VZZA 1WTHA 3PZWA 4N6LA 2WOFA 3FF0A 3UJMA 1EG9B 1V74A 2XF3A 3RDEA 1JRQA 3MHEA 4JRFA 3G0KA 3E99A 4XBTA 3FF2A 3CCL3 1O7GB 8CHOA 1IQ8A 4XBXA 3WOFB 4LSOA 2P05A 4HZBB 3G6E3 4RNZA 4U13A 3F7XA 5AI1A 1G96A 2RFRA 3LTDA 4XM4A 1JN5B 1GY5A 2BNGA 2W56A 1S5AA 1IVWA 1WQLB 3FZWA 2CIUA 4WHAA 2F86B 3UNLA 4PEJA 1OGXA 1PFPA 1DVDA 4MMXB 1U8CB 2GXFA 4LGQA 4HM4B 3CC23 2W6JH 3ROBA 1YIT3 2Y74A 5ELJA 4MEIA 3CD63 4HM1B 5IF6A 3EJVA 3B4PA 3VF1A 1Q40A 1W4NA 5ELUA 4HM0B 1TUHA 3GZXB 3SOYA 4HM5B 4NHFA 2FXTA 4R9KA 2Y73A 1JNQA 2QGUA 3FG1A 1TP6A 3F8HA 1YGEA 4IIAA 4N3VA 2YFJB 4XB5A 4Q53A 2P0XA 2KCDA 1SIIA 4N6V0 3UL6A 1W01A 3X3ZA 3G4S3 1QVG2 1RJOA 1YHQ3 1N5HA 1DMNA 1U5OA 3WA2X 3B8LA 2P0MA 3BLZA 1QALA 5FW5A 1M9GA 3NV0B 1W02A 5IG4A 3WMDA 4EV5A 2HMOB 2CFLA 2IMJA 2CKFB 1NO3A 3DGLA 3MG1A 4HZ9B 5AIIA 5IERA 1NWWA 2F99A 1GS3A 3NX0A 4HYZA 5D83A 1W2B2 3HX8A 4EYCA 4G1MB 1VQ53 1TFOA 4N6UA 3VGNA 3SVAA 1VQN3 1EQKA 3L0RA 4WYKA 1N8R4 3FG3A 3EQQB 2CW9A 5D82A 3DY5A 1VQP3 1QMAA 1IQXA 3PCSA 2W9QA 3SOAA 2FGTA 5KP4A 4EBGA 2CFKA 1VQ63 1OH0A 3FGYA 2BMQB 2W2CA 2YFIB 3DGOA 1FGTA 1SQWA 3GZYB 4J8TA 4O3VA 1W6YA 1W2ZA 3FH1A 4R80A 2ML6A 3K7CA 3DGNA 3WODG 3OWSA 3M8CA 1YVBI 1EA2A 2GBWB 4XDVA 3MG3A 3K63A 3DZLA 3CME3 3T8UA 1R4CA 1VQL3 5KP1A 5DRVA 3LH4A 4N6MA 2RGQA 2B24B 4HM6B 4X2OA 3BNDA 3F8XA 1O7NB 3DMCA 3OV4A 4HM2B 2CFDA 4K1VA 3K9MC 1ULIB 4L7KA 1WMOA 2W03A 3OX9A 3LT9A 3RGRA 2RCDA 2XGNA 1UUWB 2BT3A 4H3UA 4L8OA 1W7CA 3I553 5IG3A 3EE1A 3SEDA 4EC6A 3EB8A 2C10A 7STDA 1AVLA 1IVXA 1FGOA 4LEHA 4MMZB 1WMNA 4FMDA 3GAXA 1T5YA 3J7Yd 1YJN3 1Q864 1O7HB 5TGNA 5CK6A 1RRHA 4HM7B 3OWUA 1ISKA 4OK0A 2B1XB 4AEQA 1CEWI 1ASKA 5EQLA 1K9M4 2W56B 3CPOA 1UI8A 1AV4A 3CNXA 1Q824 1US1A 1LNHA 3DXOA 1IV9A 2W0QA 2QA43 3TDGA 1W6CA 3BNBA 3T8NA 3D9RA 2CG0A 4HVNA 4X2HA 1ROVA 3LOYA 2OOVC 1N9JA 2P09A 2XFTA 3F7SA 3EN8A 1M1K4 1DMQA 4LMIA 1Q40B 2GBXB 2HMKB 3X3YA 3IMAB 4K90B 1RKYA 4RZMA 2Z77A 4R1KA 5HGRA 1FA3A 3CMA3 1C7HA 2OTL3 3CCJ3 2Z76A 3HIGA 3Q90A 4IT7A 1SIHA 3K5TA 4J9AA 2E2UA 2V1LA 1OCVA 2JDIH 3H3HA 1A67A 1VQ93 1J2BA 1JKGA 3S27A 1QAKA 3BNCA 4NREA 5AIGA 3NUVA 1JB2A 1IVVA 3B7CA 3GZRA 4ORLA 2CWVA 1KC84 3FG4A 4FCZA 3S5CA 2K0MA 2ZL8A 4WFOA 1GY6A 3SXXA 5IW9A 2XGLA 3WA3A 1E3RA 4K61A 2KRTA 3DUKA 5DREA 1W00A 1E97A 4BTWA 3KIIA 1F8NA 2IUKA 3PYJA 3EBTA 5AIHA 3HI7A 4XBYA 4MMYB 4HM3B 3CXC2 2OQEC 5AEUB 1LOXA 3NQZA 2CWUA 2CHCA 2YX9A 3F40A 4H61A 4WYKB 2A15A 3F9SA 1JV2B 3X40A 1JB4A 3KN4A 5JPUA 1YJ93 4QWTA 1D6UA 4FMBA 1NU3A 3LZAA 5EEOA 1TU5A 1LXEA 3NBBA 2BMOB 2Z7AA 1Z1SA 2D1WA 4LZIA 3STDA 1MOLA 3JVCA 4IPBA 3PS8A 2QEX3 5A0OB 3OW22 1OPYA 2XEPA 2LQVA 3DM8A 3HZPA 3LTCA 1K8A4 3S28A 3G713 3LT8A 4KFDA 1OF5A 3OWYA 5AYSC 1IV7A 1FGRA 1VQ43 1GYBA 1PU4A 3S29A 3ALAA 2L4VA 2XRXB 1IK3A 1LVNA 1STFI 3EF8A 5I97A 3ECFA 1K28A 3EN1B 3JUMA 3NBRA 1TFKA 3X42A 1NB5I 3I0YA 3FKAA 2OWPA 1OUNA 3T0UA 5D81A 3UL5A 2PNCA 3Q1CA 5CXOA 5IENA 1KQS2 1WMPA 2ZDJA 2E2VA 2PZVA 4KFEA 4ZM8A 1D6YA 5CF1A 1EKMA 2BMRB 1K41A 2WO0A 3A76A 3HIIA 3U1WA 3V92A 5AEWB 3OXAA 2WGQA 3QRDA 4K1UA 1UI7A 2MF7A 1IVUA 1WNHA 1KD14 1M904 1IDPA 2K54A 4OUQA 3SLUA 1W6GA 5IG0A 3U97A 4L8PA 1QVF2 1OGZA 2WOHA 1ROAA 1A90A 1O7MB 1JB5A 5LC7A 3NQYA 3GRDA 3ER7A 1IT8A 3IPTA 3NM2A 4BTXA 1OHOA 3FLJA 1N8QA 1A2VA 1Q814 1NJI4 3MSOA 1AVKA 3JUPA 3CCQ3 2M7OA 3KE7A 3LMLA 3LYGA 2XSOB 2CK3H 2STDA 1ZX2A 2QIYA 4AKYA 3F14A 2CC3A 3JUQA 2O9UX 5FGOA 1KWIA 1O7PB 4O2HA 1VQK3 2E2TA 1YJW3 1OACA 3BNEA 2W9PA 3CCS3 1OHSA 5CF2A 5IG5A 1Y4KA 1GD3A 3EX9A 3WOEB 1GD4A 3AMOB 3RGAA 1HU9A 4N6NB 2OOVA 3N9HA 3CPW2 1JJ22 3AMOA 3V98A 1VQM3 1VQ83 1CYVA 5AYRB 3FSDA 3G16A 3FCSB 1Q7Y4 4WP5A 2CFGA 3X41A 2IA7A 1JKGB 1DMMA 1JN5A 2P38A 1YI23 3N8BA 1NDOB 1FGQA 3LTBA 4EXRA 3MWZA 1SJWA 1IT7A 3UB1A 1Q42A 4FCJA 1OHPA 1D6ZA 3GZBA 2SBLA 4MJDA 1SPUA 3PGBA 2O3OA 3I563 4KZ1A 3EBYA 3VSYA 3CC73 5JBSA 2GEYA 2CG1A 2IUJA 3LXUX 1RN7A 4R4KA 5KP3A 1FUWA 1E3VA 1UW1A 3G8ZA 3NM7A 4HKVB 2XH9A 2HMNB 2KXGA 5BXQA 3B4OA 1CYUA 3PCRA 1AR0A 1QAFA 4TX4A 2OTJ3 2D42A 2ML5A 5IEPA 4HJLB 2W04A 1DVCA 2OQEA 1VQO3 1HKXA 3CC43 1KSIA 4FR9A 3LTAA 4GL6A 1RRLA 2Q07A 3KFQC 2GU3A 1STDA 3NV0A 2HMJB 1NB3I 5STDA 5CLKA 3K0ZA 4FMAA 4WWUC 3PXMA 1UUVB 2CWTA 5BVBA 5EVHA 3N54B 3CCU3 3QK9A 1BUQA 3CCV3 2C11A 2HMLB 3NHXA 1IQYA 3DGMA 1A2KA 5LC6A 3V99A 5IEOA 2YFLB 3X3XA 4JF8A 4EV2A 2UX0A 1OF5B 3MPHA 3MG2A 4OVMA 5G2GA 3JUNA 2F98A 2GU1A 6STDA 2LYXA 2FNQA 3GWRA 2WGOA 3Q2PA 3HK4A 3KSPA 2BO9B 3CCM3 1W5ZA 2Z6BA 1L5GB 4STDA 4HBRA 3CU3A 4KVHA 3KKGA 4AKZA 4FMCA 3MKIA 1M1XB 1TIJA 2JQ5A 3NXJA 4N6OB 5JPPA 4FCMA 3D3LA 2CFWA 1MNLA 2I9WA 3CCE3 1ULJB 3CCR3 3EC9A 1DYUA 4XDWA 1CQSA 3S67A 1GY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF8 A;  4KZ1 A;  4MEI A;  4O3V A;  5I97 A;  4AKY A;  2CC3 A;  5JBS A;  4NHF A;  4AKZ A;  4LSO A;  2BHM A; 
#chains in the Genus database with same CATH topology
 1I2G A;  1BIR A;  1VQ7 3;  1N5P A;  2XFS A;  4KFF A;  3IJE B;  4RBN A;  3EHC A;  1HYF A;  3MYT A;  3SX1 A;  2HMM B;  1O7W B;  1BNI A;  2INX A;  2OCT A;  3NBJ A;  4O8S A;  2BHM A;  2R4I A;  3JUO A;  4HM8 B;  4R9L A;  2RSX A;  4RNY A;  1QJG A;  2K3D A;  4BTY A;  4CDL A;  4CCV A;  4KT3 B;  4N6T A;  2CH9 A;  2XSH B;  1IU7 A;  2J8X B;  3O8Y A;  3WDG B;  1UUG B;  2ZA4 A;  3KZT A;  1IYY A;  1YIJ 3;  3CNM A;  4I4K A;  1K73 4;  1TRP A;  3KSE D;  2GEX A;  2XR8 B;  3H51 A;  1ZO2 A;  2F5W A;  4GB5 A;  4O02 B;  5AIF A;  5G1K A;  2MC8 A;  1S72 3;  3BB9 A;  1FGM A;  1N9E A;  1VZZ A;  1WTH A;  1JZO A;  3PZW A;  4N6L A;  2WOF A;  1GOV A;  3FF0 A;  3UJM A;  3D4A A;  1EG9 B;  1V74 A;  2XF3 A;  3RDE A;  1JRQ A;  3ZFZ A;  3MHE A;  4JRF A;  3G0K A;  3E99 A;  4NPB A;  4XBT A;  3FF2 A;  3CCL 3;  1O7G B;  3SYU A;  8CHO A;  1IQ8 A;  3AGN A;  1RN1 A;  4XBX A;  3WOF B;  4LSO A;  2P05 A;  1BNS A;  9RNT A;  5M1A A;  4HZB B;  3G6E 3;  4RNZ A;  4U13 A;  3F7X A;  5AI1 A;  1G96 A;  2RFR A;  3GSP A;  3LTD A;  4XM4 A;  1JN5 B;  1GY5 A;  2BNG A;  2W56 A;  1S5A A;  1IVW A;  1WQL B;  3FZW A;  2CIU A;  4WHA A;  4BL3 A;  2F86 B;  2SAR A;  3UNL A;  4PEJ A;  1OGX A;  2UGI A;  1PFP A;  1DVD A;  4MMX B;  1U8C B;  2CX0 A;  2GXF A;  1BAN A;  1UCL A;  4LGQ A;  4HM4 B;  3CC2 3;  2W6J H;  3ROB A;  1YIT 3;  2Y74 A;  5ELJ A;  4MEI A;  3CD6 3;  4HM1 B;  5IF6 A;  3EJV A;  3B4P A;  1BRH A;  3VF1 A;  1Q40 A;  1W4N A;  5ELU A;  4HM0 B;  2F5M A;  1TUH A;  3GZX B;  3SOY A;  4HM5 B;  4NHF A;  2FXT A;  2L1S A;  4R9K A;  2Y73 A;  1JNQ A;  2QGU A;  3FG1 A;  1TP6 A;  1HZ1 A;  1I0X A;  3F8H A;  1YGE A;  4IIA A;  4N3V A;  2KF4 A;  2YFJ B;  4Q53 A;  2P0X A;  2KCD A;  4XB5 A;  1SII A;  4N6V 0;  3D5I A;  3UL6 A;  1W01 A;  3AHS A;  3X3Z A;  3G4S 3;  1QVG 2;  1RJO A;  1YHQ 3;  1N5H A;  1MWU A;  1DMN A;  1U5O A;  3WA2 X;  3B8L A;  1BNG A;  2P0M A;  3BLZ A;  1A2P A;  1QAL A;  1M9G A;  3NV0 B;  5FW5 A;  1G0T A;  1BOX A;  1W02 A;  3WMD A;  4LYL B;  5IG4 A;  1B2M A;  4EV5 A;  2HMO B;  2CFL A;  2IMJ A;  2CKF B;  1NO3 A;  3DGL A;  3MG1 A;  4HOH A;  4HZ9 B;  5AII A;  5IER A;  1NWW A;  2F99 A;  1GS3 A;  3NX0 A;  4HYZ A;  1RGC A;  1BRK A;  1MWT A;  5D83 A;  1W2B 2;  1UDI I;  3HX8 A;  4EYC A;  1BRG A;  4G1M B;  1VQ5 3;  1TFO A;  1RGL A;  1B2U A;  4N6U A;  3VGN A;  3SVA A;  1EEJ A;  1VQN 3;  1EQK A;  3L0R A;  4WYK A;  1N8R 4;  1RGK A;  3FG3 A;  1UGI A;  3EQQ B;  1RLS A;  2CW9 A;  5D82 A;  5IW9 A;  3DY5 A;  1VQP 3;  1QMA A;  1IQX A;  3PCS A;  2W9Q A;  3SOA A;  2FGT A;  5KP4 A;  4EBG A;  2CFK A;  1VQ6 3;  1G02 A;  1OH0 A;  1I8V A;  2BMQ B;  3FGY A;  2W2C A;  2YFI B;  3DGO A;  1JBR A;  1FGT A;  1SQW A;  3GZY B;  4J8T A;  4O3V A;  1W6Y A;  1W2Z A;  3FH1 A;  4R80 A;  1JZD A;  2ML6 A;  3K7C A;  3DGN A;  1C54 A;  1FZU A;  3WOD G;  3OWS A;  1RNT A;  1TRQ A;  3M8C A;  1YVB I;  1EA2 A;  2GBW B;  4XDV A;  3MG3 A;  1FUS A;  3K63 A;  3DZL A;  3CME 3;  3T8U A;  1CH0 A;  1R4C A;  1VQL 3;  1X1U A;  6GSP A;  5KP1 A;  5DRV A;  4ILF A;  3LH4 A;  4N6M A;  2RGQ A;  2B24 B;  4HM6 B;  4X2O A;  2H0G A;  3BND A;  1UCJ A;  3F8X A;  1PY3 A;  1O7N B;  3DMC A;  3OV4 A;  4HM2 B;  2IY2 A;  2CFD A;  1B2Z A;  1B2X A;  1RCK A;  4K1V A;  3K9M C;  2C4B A;  1ULI B;  4L7K A;  1WMO A;  1GOY A;  2W03 A;  3LT9 A;  3OX9 A;  2RCD A;  2XGN A;  3RGR A;  1UUW B;  1X1W A;  2BT3 A;  4H3U A;  4L8O A;  1W7C A;  3I55 3;  5IG3 A;  1BSC A;  3EE1 A;  3SED A;  4EC6 A;  3EB8 A;  1TJD A;  1V57 A;  1RDS A;  1DE3 A;  2C10 A;  7STD A;  1AVL A;  1IVX A;  1FGO A;  4LEH A;  4MMZ B;  1MWS A;  1WMN A;  1JBT A;  4FMD A;  1B2S A;  3KCH A;  3GAX A;  1T5Y A;  3J7Y d;  1YJN 3;  1Q86 4;  1O7H B;  3ZG0 A;  1JBS A;  5TGN A;  5CK6 A;  5BIR A;  1BRI A;  1AY7 A;  1RRH A;  3OWU A;  4HM7 B;  1ISK A;  4OK0 A;  2B1X B;  4AEQ A;  1CEW I;  1ASK A;  5EQL A;  1RTU A;  1K9M 4;  2W56 B;  3CPO A;  1SAR A;  1UI8 A;  1AV4 A;  3CNX A;  1Q82 4;  4BU4 A;  1US1 A;  1RNB A;  1LNH A;  3DXO A;  1IV9 A;  2W0Q A;  2QA4 3;  3TDG A;  1W6C A;  3BNB A;  3T8N A;  3AGO A;  1BNE A;  2KF3 A;  3D9R A;  2CG0 A;  4HVN A;  2AAE A;  1ROV A;  4X2H A;  1RMS A;  3LOY A;  2OOV C;  1N9J A;  1BU4 A;  2P09 A;  2XFT A;  3F7S A;  3EN8 A;  1M1K 4;  1DMQ A;  4LMI A;  5M18 A;  1Q40 B;  1RGE A;  2GBX B;  2HMK B;  3X3Y A;  1RSN A;  2RBI A;  3IMA B;  1FW7 A;  4K90 B;  1RKY A;  4RZM A;  2Z77 A;  4R1K A;  5HGR A;  1FA3 A;  3CMA 3;  1C7H A;  2OTL 3;  3CCJ 3;  1RHL A;  1I3F A;  2Z76 A;  3HIG A;  3Q90 A;  4IT7 A;  1SIH A;  3K5T A;  2GSP A;  4J9A A;  1B3S A;  2E2U A;  2V1L A;  1OCV A;  2JDI H;  3H3H A;  1A67 A;  1VQ9 3;  1J2B A;  1JKG A;  3S27 A;  1QAK A;  3BNC A;  4NRE A;  5AIG A;  3NUV A;  1JB2 A;  1IVV A;  3B7C A;  3GZR A;  4ORL A;  3HOH A;  2CWV A;  1KC8 4;  3FG4 A;  3Q3F A;  1RGH A;  2K0M A;  2ZL8 A;  1BSD A;  1GY6 A;  4FCZ A;  4WFO A;  2XGL A;  3S5C A;  3SXX A;  1E3R A;  4K61 A;  2KRT A;  1BRS A;  3DUK A;  5DRE A;  1W00 A;  1E97 A;  4BTW A;  1UCK A;  3BIR A;  3KII A;  1F8N A;  2IUK A;  3PYJ A;  3EBT A;  5AIH A;  3HI7 A;  4XBY A;  4MMY B;  4HM3 B;  3CXC 2;  2OQE C;  5AEU B;  1LOX A;  3NQZ A;  1GOU A;  2CHC A;  2CWU A;  1I70 A;  2YX9 A;  3F40 A;  4H61 A;  4WYK B;  2A15 A;  3F9S A;  1JV2 B;  3X40 A;  1JB4 A;  1B27 A;  1TTO A;  3KN4 A;  4I5Q A;  5JPU A;  1T2H A;  1YJ9 3;  4QWT A;  1UCI A;  1D6U A;  4FMB A;  1NU3 A;  3LZA A;  5EEO A;  1TU5 A;  1LXE A;  3NBB A;  2BMO B;  5M19 A;  2Z7A A;  2BU4 A;  1Z1S A;  2D1W A;  4LZI A;  3STD A;  2R41 A;  1MOL A;  2IYJ A;  3JVC A;  4IPB A;  3WHO A;  5BU4 A;  3PS8 A;  2QEX 3;  5A0O B;  3OW2 2;  1OPY A;  2XEP A;  1B21 A;  2LQV A;  3DM8 A;  3HZP A;  3LTC A;  2H0I A;  1K8A 4;  3S28 A;  3G71 3;  1I2F A;  2KAA A;  3LT8 A;  1BSA A;  4KFD A;  1OF5 A;  3OWY A;  5AYS C;  1B20 A;  7GSP A;  1IV7 A;  1FGR A;  1VQ4 3;  1GMQ A;  1GYB A;  1PU4 A;  3S29 A;  3ALA A;  2L4V A;  2XRX B;  1RCL A;  1IK3 A;  1BVI A;  1LVN A;  1STF I;  3EF8 A;  5I97 A;  2ZHX B;  3ECF A;  1K28 A;  3EN1 B;  3JUM A;  1LQG C;  3NBR A;  1TFK A;  3X42 A;  1NB5 I;  1FUT A;  3I0Y A;  3FKA A;  2OWP A;  1OUN A;  3T0U A;  1YGW A;  4CPK A;  5D81 A;  1R4Y A;  3UL5 A;  1BAO A;  2PNC A;  4HAA A;  3Q1C A;  1ZGX A;  1GMP A;  3DGY A;  1V58 A;  5CXO A;  5IEN A;  1KQS 2;  3D5G A;  1WMP A;  2ZDJ A;  2E2V A;  2PZV A;  4KFE A;  4ZM8 A;  3ZG5 A;  6RNT A;  1D6Y A;  5CF1 A;  4J5K A;  1EKM A;  2BMR B;  1K41 A;  2WO0 A;  3A76 A;  3HII A;  3U1W A;  1Q9E A;  3V92 A;  5GSP A;  3OXA A;  5AEW B;  2WGQ A;  3QRD A;  4K1U A;  1UI7 A;  1DET A;  2MF7 A;  1AQZ A;  1LRA A;  1IVU A;  1WNH A;  1KD1 4;  1M90 4;  2CX1 A;  1IDP A;  2K54 A;  4OUQ A;  3SLU A;  1BNF A;  1W6G A;  4J5G A;  5IG0 A;  3U97 A;  1LOW A;  4L8P A;  1MGR A;  3DH2 A;  1OGZ A;  2WOH A;  1ROA A;  3WR2 A;  1BRN L;  1QVF 2;  1A90 A;  1O7M B;  1JB5 A;  5LC7 A;  3NQY A;  3GRD A;  3ER7 A;  1IT8 A;  3IPT A;  3NM2 A;  4BTX A;  1EUI C;  1ZS7 A;  1OHO A;  3FLJ A;  1N8Q A;  1A2V A;  1BRJ A;  1Q81 4;  1NJI 4;  1LOV A;  3MSO A;  1AVK A;  4GSP A;  3JUP A;  7RNT A;  3CCQ 3;  2M7O A;  3KE7 A;  3LML A;  3LYG A;  2XSO B;  2KF6 A;  2CK3 H;  2STD A;  1ZX2 A;  2QIY A;  4AKY A;  3F14 A;  2CC3 A;  1LQM B;  3JUQ A;  2O9U X;  5FGO A;  1KWI A;  1O7P B;  4O2H A;  1VQK 3;  8RNT A;  1PYL A;  2E2T A;  1YJW 3;  1OAC A;  3BNE A;  2W9P A;  5HOH A;  3CCS 3;  1OHS A;  4BIR A;  5CF2 A;  5IG5 A;  1Y4K A;  1GD3 A;  3EX9 A;  1NNV A;  1GD4 A;  3WOE B;  4RNT A;  1VQQ A;  1X1X A;  4GHO A;  3AMO B;  3RGA A;  1HU9 A;  4N6N B;  3A5E A;  1FYS A;  3N9H A;  2OOV A;  3CPW 2;  3WA3 A;  1JJ2 2;  3AMO A;  3V98 A;  1VQM 3;  1VQ8 3;  1CYV A;  5AYR B;  3AHW A;  3FSD A;  1I0V A;  1BNR A;  3G16 A;  3FCS B;  1Q7Y 4;  4WP5 A;  2CFG A;  3X41 A;  2IA7 A;  1JKG B;  1DMM A;  1JN5 A;  1Q7H A;  2P38 A;  1YI2 3;  3N8B A;  1NDO B;  1FGQ A;  1BNJ A;  3LTB A;  4EXR A;  3MWZ A;  1SJW A;  4EW5 A;  1IT7 A;  3UB1 A;  2H0H A;  1Q42 A;  4FCJ A;  1OHP A;  1D6Z A;  3GZB A;  2SBL A;  4MJD A;  1SPU A;  2AAD A;  2O3O A;  1BSE A;  3PGB A;  4KZ1 A;  3I56 3;  3EBY A;  3VSY A;  3CC7 3;  5JBS A;  1GSP A;  2GEY A;  1I2E A;  2CG1 A;  3LXU X;  2IUJ A;  1RN7 A;  4R4K A;  5KP3 A;  1FUW A;  1E3V A;  1UW1 A;  3G8Z A;  3NM7 A;  4HKV B;  2XH9 A;  2HMN B;  2KXG A;  5BXQ A;  3B4O A;  2UUG C;  1CYU A;  3PCR A;  1AR0 A;  1QAF A;  4TX4 A;  2OTJ 3;  2D42 A;  2ML5 A;  4CJN A;  2KF5 A;  2RNT A;  5IEP A;  1LOY A;  4HJL B;  4BL2 A;  3RNT A;  2W04 A;  1DVC A;  2HOH A;  2OQE A;  1VQO 3;  1HKX A;  3CC4 3;  1KSI A;  4FR9 A;  3LTA A;  4GL6 A;  1RRL A;  2Q07 A;  3KFQ C;  4DKI A;  2F56 A;  2GU3 A;  1STD A;  3NV0 A;  2HMJ B;  1MGW A;  1NB3 I;  1RGA A;  5STD A;  5CLK A;  3K0Z A;  4FMA A;  4WWU C;  5RNT A;  3PXM A;  1UUV B;  2CWT A;  5BVB A;  5EVH A;  3N54 B;  3CCU 3;  1I3I A;  1T3B A;  1UGH I;  3QK9 A;  3CCV 3;  1BUQ A;  2C11 A;  1GMR A;  2HML B;  1IQY A;  3NHX A;  1YVS A;  3DGM A;  1BSB A;  1A2K A;  5LC6 A;  3V99 A;  5IEO A;  2YFL B;  3X3X A;  1BGS A;  4JF8 A;  2UX0 A;  4EV2 A;  2BIR A;  5G1L A;  3BU4 A;  1OF5 B;  3MPH A;  3MG2 A;  4OVM A;  5G2G A;  1RGF A;  1T2I A;  2F98 A;  3JUN A;  2GU1 A;  6STD A;  2LYX A;  2FNQ A;  3GWR A;  1X1Y A;  1MWR A;  2WGO A;  3HK4 A;  3Q2P A;  3KSP A;  2BO9 B;  3CCM 3;  1W5Z A;  1RGG A;  2Z6B A;  1L5G B;  4STD A;  4HBR A;  3URP A;  3CU3 A;  4KVH A;  3KKG A;  3D79 A;  4AKZ A;  4FMC A;  3MKI A;  1M1X B;  1TIJ A;  2JQ5 A;  3NXJ A;  4N6O B;  5JPP A;  4FCM A;  3D3L A;  2CFW A;  1MNL A;  2I9W A;  3CCE 3;  1ULJ B;  3CCR 3;  1BUJ A;  2F4Y A;  3EC9 A;  1DYU A;  1LNI A;  1RN4 A;  1CQS A;  4XDW A;  3S67 A;  1YNV X;  1GY7 A; 
#chains in the Genus database with same CATH homology
 1VQ7 3;  1N5P A;  2XFS A;  4KFF A;  3IJE B;  4RBN A;  3EHC A;  3MYT A;  3SX1 A;  2HMM B;  1O7W B;  2INX A;  2OCT A;  3NBJ A;  4O8S A;  2BHM A;  2R4I A;  3JUO A;  4HM8 B;  4R9L A;  2RSX A;  4RNY A;  1QJG A;  4BTY A;  4CDL A;  4CCV A;  4N6T A;  2CH9 A;  2XSH B;  1IU7 A;  3O8Y A;  3WDG B;  3KZT A;  1YIJ 3;  3CNM A;  4I4K A;  1K73 4;  3KSE D;  2GEX A;  2XR8 B;  3H51 A;  1ZO2 A;  4GB5 A;  5AIF A;  4O02 B;  2MC8 A;  1S72 3;  3BB9 A;  1FGM A;  1N9E A;  1VZZ A;  1WTH A;  3PZW A;  4N6L A;  2WOF A;  3FF0 A;  3UJM A;  1EG9 B;  1V74 A;  2XF3 A;  3RDE A;  1JRQ A;  3MHE A;  4JRF A;  3G0K A;  3E99 A;  4XBT A;  3FF2 A;  3CCL 3;  1O7G B;  8CHO A;  1IQ8 A;  4XBX A;  3WOF B;  4LSO A;  2P05 A;  4HZB B;  3G6E 3;  4RNZ A;  4U13 A;  3F7X A;  5AI1 A;  1G96 A;  2RFR A;  3LTD A;  4XM4 A;  1JN5 B;  1GY5 A;  2BNG A;  2W56 A;  1S5A A;  1IVW A;  1WQL B;  3FZW A;  2CIU A;  4WHA A;  2F86 B;  3UNL A;  4PEJ A;  1OGX A;  1PFP A;  1DVD A;  4MMX B;  1U8C B;  2GXF A;  4LGQ A;  4HM4 B;  3CC2 3;  2W6J H;  3ROB A;  1YIT 3;  2Y74 A;  5ELJ A;  4MEI A;  3CD6 3;  4HM1 B;  5IF6 A;  3EJV A;  3B4P A;  3VF1 A;  1Q40 A;  1W4N A;  5ELU A;  4HM0 B;  1TUH A;  3GZX B;  3SOY A;  4HM5 B;  4NHF A;  2FXT A;  4R9K A;  2Y73 A;  1JNQ A;  2QGU A;  3FG1 A;  1TP6 A;  3F8H A;  1YGE A;  4IIA A;  4N3V A;  2YFJ B;  4XB5 A;  4Q53 A;  2P0X A;  2KCD A;  1SII A;  4N6V 0;  3UL6 A;  1W01 A;  3X3Z A;  3G4S 3;  1QVG 2;  1RJO A;  1YHQ 3;  1N5H A;  1DMN A;  1U5O A;  3WA2 X;  3B8L A;  2P0M A;  3BLZ A;  1QAL A;  5FW5 A;  1M9G A;  3NV0 B;  1W02 A;  5IG4 A;  3WMD A;  4EV5 A;  2HMO B;  2CFL A;  2IMJ A;  2CKF B;  1NO3 A;  3DGL A;  3MG1 A;  4HZ9 B;  5AII A;  5IER A;  1NWW A;  2F99 A;  1GS3 A;  3NX0 A;  4HYZ A;  5D83 A;  1W2B 2;  3HX8 A;  4EYC A;  4G1M B;  1VQ5 3;  1TFO A;  4N6U A;  3VGN A;  3SVA A;  1VQN 3;  1EQK A;  3L0R A;  4WYK A;  1N8R 4;  3FG3 A;  3EQQ B;  2CW9 A;  5D82 A;  3DY5 A;  1VQP 3;  1QMA A;  1IQX A;  3PCS A;  2W9Q A;  3SOA A;  2FGT A;  5KP4 A;  4EBG A;  2CFK A;  1VQ6 3;  1OH0 A;  3FGY A;  2BMQ B;  2W2C A;  2YFI B;  3DGO A;  1FGT A;  1SQW A;  3GZY B;  4J8T A;  4O3V A;  1W6Y A;  1W2Z A;  3FH1 A;  4R80 A;  2ML6 A;  3K7C A;  3DGN A;  3WOD G;  3OWS A;  3M8C A;  1YVB I;  1EA2 A;  2GBW B;  4XDV A;  3MG3 A;  3K63 A;  3DZL A;  3CME 3;  3T8U A;  1R4C A;  1VQL 3;  5KP1 A;  5DRV A;  3LH4 A;  4N6M A;  2RGQ A;  2B24 B;  4HM6 B;  4X2O A;  3BND A;  3F8X A;  1O7N B;  3DMC A;  3OV4 A;  4HM2 B;  2CFD A;  4K1V A;  3K9M C;  1ULI B;  4L7K A;  1WMO A;  2W03 A;  3OX9 A;  3LT9 A;  3RGR A;  2RCD A;  2XGN A;  1UUW B;  2BT3 A;  4H3U A;  4L8O A;  1W7C A;  3I55 3;  5IG3 A;  3EE1 A;  3SED A;  4EC6 A;  3EB8 A;  2C10 A;  7STD A;  1AVL A;  1IVX A;  1FGO A;  4LEH A;  4MMZ B;  1WMN A;  4FMD A;  3GAX A;  1T5Y A;  3J7Y d;  1YJN 3;  1Q86 4;  1O7H B;  5TGN A;  5CK6 A;  1RRH A;  4HM7 B;  3OWU A;  1ISK A;  4OK0 A;  2B1X B;  4AEQ A;  1CEW I;  1ASK A;  5EQL A;  1K9M 4;  2W56 B;  3CPO A;  1UI8 A;  1AV4 A;  3CNX A;  1Q82 4;  1US1 A;  1LNH A;  3DXO A;  1IV9 A;  2W0Q A;  2QA4 3;  3TDG A;  1W6C A;  3BNB A;  3T8N A;  3D9R A;  2CG0 A;  4HVN A;  4X2H A;  1ROV A;  3LOY A;  2OOV C;  1N9J A;  2P09 A;  2XFT A;  3F7S A;  3EN8 A;  1M1K 4;  1DMQ A;  4LMI A;  1Q40 B;  2GBX B;  2HMK B;  3X3Y A;  3IMA B;  4K90 B;  1RKY A;  4RZM A;  2Z77 A;  4R1K A;  5HGR A;  1FA3 A;  3CMA 3;  1C7H A;  2OTL 3;  3CCJ 3;  2Z76 A;  3HIG A;  3Q90 A;  4IT7 A;  1SIH A;  3K5T A;  4J9A A;  2E2U A;  2V1L A;  1OCV A;  2JDI H;  3H3H A;  1A67 A;  1VQ9 3;  1J2B A;  1JKG A;  3S27 A;  1QAK A;  3BNC A;  4NRE A;  5AIG A;  3NUV A;  1JB2 A;  1IVV A;  3B7C A;  3GZR A;  4ORL A;  2CWV A;  1KC8 4;  3FG4 A;  4FCZ A;  3S5C A;  2K0M A;  2ZL8 A;  4WFO A;  1GY6 A;  3SXX A;  5IW9 A;  2XGL A;  3WA3 A;  1E3R A;  4K61 A;  2KRT A;  3DUK A;  5DRE A;  1W00 A;  1E97 A;  4BTW A;  3KII A;  1F8N A;  2IUK A;  3PYJ A;  3EBT A;  5AIH A;  3HI7 A;  4XBY A;  4MMY B;  4HM3 B;  3CXC 2;  2OQE C;  5AEU B;  1LOX A;  3NQZ A;  2CWU A;  2CHC A;  2YX9 A;  3F40 A;  4H61 A;  4WYK B;  2A15 A;  3F9S A;  1JV2 B;  3X40 A;  1JB4 A;  3KN4 A;  5JPU A;  1YJ9 3;  4QWT A;  1D6U A;  4FMB A;  1NU3 A;  3LZA A;  5EEO A;  1TU5 A;  1LXE A;  3NBB A;  2BMO B;  2Z7A A;  1Z1S A;  2D1W A;  4LZI A;  3STD A;  1MOL A;  3JVC A;  4IPB A;  3PS8 A;  2QEX 3;  5A0O B;  3OW2 2;  1OPY A;  2XEP A;  2LQV A;  3DM8 A;  3HZP A;  3LTC A;  1K8A 4;  3S28 A;  3G71 3;  3LT8 A;  4KFD A;  1OF5 A;  3OWY A;  5AYS C;  1IV7 A;  1FGR A;  1VQ4 3;  1GYB A;  1PU4 A;  3S29 A;  3ALA A;  2L4V A;  2XRX B;  1IK3 A;  1LVN A;  1STF I;  3EF8 A;  5I97 A;  3ECF A;  1K28 A;  3EN1 B;  3JUM A;  3NBR A;  1TFK A;  3X42 A;  1NB5 I;  3I0Y A;  3FKA A;  2OWP A;  1OUN A;  3T0U A;  5D81 A;  3UL5 A;  2PNC A;  3Q1C A;  5CXO A;  5IEN A;  1KQS 2;  1WMP A;  2ZDJ A;  2E2V A;  2PZV A;  4KFE A;  4ZM8 A;  1D6Y A;  5CF1 A;  1EKM A;  2BMR B;  1K41 A;  2WO0 A;  3A76 A;  3HII A;  3U1W A;  3V92 A;  5AEW B;  3OXA A;  2WGQ A;  3QRD A;  4K1U A;  1UI7 A;  2MF7 A;  1IVU A;  1WNH A;  1KD1 4;  1M90 4;  1IDP A;  2K54 A;  4OUQ A;  3SLU A;  1W6G A;  5IG0 A;  3U97 A;  4L8P A;  1QVF 2;  1OGZ A;  2WOH A;  1ROA A;  1A90 A;  1O7M B;  1JB5 A;  5LC7 A;  3NQY A;  3GRD A;  3ER7 A;  1IT8 A;  3IPT A;  3NM2 A;  4BTX A;  1OHO A;  3FLJ A;  1N8Q A;  1A2V A;  1Q81 4;  1NJI 4;  3MSO A;  1AVK A;  3JUP A;  3CCQ 3;  2M7O A;  3KE7 A;  3LML A;  3LYG A;  2XSO B;  2CK3 H;  2STD A;  1ZX2 A;  2QIY A;  4AKY A;  3F14 A;  2CC3 A;  3JUQ A;  2O9U X;  5FGO A;  1KWI A;  1O7P B;  4O2H A;  1VQK 3;  2E2T A;  1YJW 3;  1OAC A;  3BNE A;  2W9P A;  3CCS 3;  1OHS A;  5CF2 A;  5IG5 A;  1Y4K A;  1GD3 A;  3EX9 A;  3WOE B;  1GD4 A;  3AMO B;  3RGA A;  1HU9 A;  4N6N B;  2OOV A;  3N9H A;  3CPW 2;  1JJ2 2;  3AMO A;  3V98 A;  1VQM 3;  1VQ8 3;  1CYV A;  5AYR B;  3FSD A;  3G16 A;  3FCS B;  1Q7Y 4;  4WP5 A;  2CFG A;  3X41 A;  2IA7 A;  1JKG B;  1DMM A;  1JN5 A;  2P38 A;  1YI2 3;  3N8B A;  1NDO B;  1FGQ A;  3LTB A;  4EXR A;  3MWZ A;  1SJW A;  1IT7 A;  3UB1 A;  1Q42 A;  4FCJ A;  1OHP A;  1D6Z A;  3GZB A;  2SBL A;  4MJD A;  1SPU A;  3PGB A;  2O3O A;  3I56 3;  4KZ1 A;  3EBY A;  3VSY A;  3CC7 3;  5JBS A;  2GEY A;  2CG1 A;  2IUJ A;  3LXU X;  1RN7 A;  4R4K A;  5KP3 A;  1FUW A;  1E3V A;  1UW1 A;  3G8Z A;  3NM7 A;  4HKV B;  2XH9 A;  2HMN B;  2KXG A;  5BXQ A;  3B4O A;  1CYU A;  3PCR A;  1AR0 A;  1QAF A;  4TX4 A;  2OTJ 3;  2D42 A;  2ML5 A;  5IEP A;  4HJL B;  2W04 A;  1DVC A;  2OQE A;  1VQO 3;  1HKX A;  3CC4 3;  1KSI A;  4FR9 A;  3LTA A;  4GL6 A;  1RRL A;  2Q07 A;  3KFQ C;  2GU3 A;  1STD A;  3NV0 A;  2HMJ B;  1NB3 I;  5STD A;  5CLK A;  3K0Z A;  4FMA A;  4WWU C;  3PXM A;  1UUV B;  2CWT A;  5BVB A;  5EVH A;  3N54 B;  3CCU 3;  3QK9 A;  1BUQ A;  3CCV 3;  2C11 A;  2HML B;  3NHX A;  1IQY A;  3DGM A;  1A2K A;  5LC6 A;  3V99 A;  5IEO A;  2YFL B;  3X3X A;  4JF8 A;  4EV2 A;  2UX0 A;  1OF5 B;  3MPH A;  3MG2 A;  4OVM A;  5G2G A;  3JUN A;  2F98 A;  2GU1 A;  6STD A;  2LYX A;  2FNQ A;  3GWR A;  2WGO A;  3Q2P A;  3HK4 A;  3KSP A;  2BO9 B;  3CCM 3;  1W5Z A;  2Z6B A;  1L5G B;  4STD A;  4HBR A;  3CU3 A;  4KVH A;  3KKG A;  4AKZ A;  4FMC A;  3MKI A;  1M1X B;  1TIJ A;  2JQ5 A;  3NXJ A;  4N6O B;  5JPP A;  4FCM A;  3D3L A;  2CFW A;  1MNL A;  2I9W A;  3CCE 3;  1ULJ B;  3CCR 3;  3EC9 A;  1DYU A;  4XDW A;  1CQS A;  3S67 A;  1GY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...