2CC3A

Structure of agrobacterium tumefaciens virb8 protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
144
structure length
144
Chain Sequence
GPHMTQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFFNYPNPTSPQVILGKHGRLEVEHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLRLTNPGGLVVTSYQTSEDTVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN VIRB8
publication title Agrobacterium Tumefaciens Virb8 Structure Reveals Potential Protein-Protein Interactions Sites.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Secretion system
total genus 39
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.230 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2cc3A00
4KZ1A 4AKYA 5JBSA 4NHFA 4O3VA 4AKZA 5I97A 4MEIA 2BHMA 2CC3A 4LSOA 4JF8A
chains in the Genus database with same CATH superfamily
4ORLA 1RN1A 2BIRA 1W2ZA 3DGYA 4OK0A 2KRTA 2CIUA 3O8YA 3V92A 1TUHA 1OF5A 3GWRA 3B8LA 2SBLA 3IMAB 1T5YA 1T3BA 2RNTA 1UGIA 4HM4B 4HKVB 4HM3B 5DREA 1BGSA 3EN8A 4R9KA 3D9RA 4HVNA 1STDA 3ECFA 1RGEA 3Q1CA 4LGQA 1DYUA 1TJDA 3D5IA 4IIAA 4AKZA 1QVF2 1X1UA 2QGUA 3AMOA 1ZX2A 1IVWA 1OGXA 5AIIA 3Q90A 1W5ZA 1B2UA 1S723 2GU1A 2XGNA 1FUWA 1O7GB 3K9MC 1NB5I 1JZOA 3SVAA 1NJI4 4HM8B 4JF8A 4HAAA 1BNEA 3G16A 3PXMA 2GEXA 4BTYA 1VQQA 3JVCA 2W56A 2ZA4A 3PYJA 4N6UA 4NHFA 5CLKA 4L8OA 1TFKA 4BL2A 5KP1A 1BAOA 1IK3A 1RKYA 3EQQB 2AADA 5M19A 2CG0A 1N9JA 1NU3A 1OH0A 2GEYA 5IG5A 4X2OA 1SQWA 1AR0A 1MGRA 4TX4A 1B2ZA 4XB5A 2M7OA 2SARA 1BSBA 1RLSA 1M9GA 2Z77A 4K1VA 4N6V0 1U5OA 3NM2A 4MEIA 1Q864 3NUVA 3MPHA 3NM7A 4FMAA 5AIHA 2WOHA 4JRFA 3CMA3 1VQN3 3OX9A 3JUOA 5CF2A 5IG4A 1G0TA 4U13A 1PU4A 4FCZA 3DY5A 1OACA 3RNTA 3X3YA 1KQS2 3URPA 3EBYA 3MG2A 1EG9B 1YVSA 1GD4A 1EQKA 4EW5A 2Q07A 1PYLA 2PZVA 5D81A 1W02A 1DE3A 1I3FA 1TU5A 3AHSA 3CCL3 3RGAA 1LOWA 2B1XB 3WR2A 5ELJA 1Z1SA 5CK6A 1VZZA 5FGOA 2ZL8A 3D3LA 1JNQA 1SIIA 1UUWB 3JUNA 3UJMA 3BNCA 3I0YA 1CQSA 1ZO2A 3LT9A 5D82A 1JBRA 1LNHA 5CF1A 3CXC2 1MOLA 1O7PB 2QIYA 3AGOA 2HMNB 1Q40B 4HZBB 3SOYA 3SXXA 3X40A 4DKIA 3G713 1LRAA 1UCIA 1I70A 2XGLA 3BNEA 1O7WB 1WTHA 1B3SA 2BHMA 3DGLA 1UGHI 5BXQA 1DVDA 2C4BA 5CXOA 2K54A 1K734 1RMSA 3H3HA 3FSDA 3QK9A 2CW9A 1V57A 2ZHXB 2K0MA 3CNXA 9RNTA 1GMQA 1I2FA 1K8A4 3RDEA 2RGQA 4EBGA 4XM4A 5IG3A 3OWUA 1O7HB 1BNSA 4RNTA 1BRIA 4J9AA 3X42A 2IY2A 1JB4A 2GSPA 2WGOA 3KZTA 2P0XA 4XBYA 4CPKA 5IERA 3VF1A 3T8NA 3NHXA 2YFJB 4AEQA 3DUKA 4NPBA 3V98A 3LH4A 5IENA 1G96A 1VQ53 1GOYA 1BANA 1BNIA 1RGCA 1BRNL 1SPUA 3S27A 2XEPA 4LMIA 4R9LA 5FW5A 1BUJA 2KF4A 2UUGC 3EHCA 4ZM8A 2W9PA 5I97A 3EB8A 4K90B 3UL6A 2P0MA 4R4KA 3F14A 3N8BA 1UUVB 3S29A 3K5TA 4GSPA 2P05A 4HOHA 2OWPA 2QA43 1NO3A 1JBSA 1RN7A 1N8QA 1Q9EA 1JN5B 1KSIA 2CFLA 3X3ZA 1T2IA 7GSPA 5GSPA 1MWTA 1CEWI 3N9HA 2W03A 3F7SA 3FG3A 2BNGA 1YGWA 2CWVA 2GBXB 3HIGA 1I0VA 4KVHA 3ZG0A 1BSAA 4GB5A 3CD63 1LQGC 2RFRA 2OTJ3 3EJVA 4O3VA 5M18A 4MMYB 1A90A 2HMLB 5D83A 3CME3 5JPPA 3GAXA 3CCS3 1YHQ3 1I2EA 1VQ73 1VQM3 2BT3A 1Q40A 4O2HA 2CFWA 3ZG5A 1OHSA 3DM8A 5AYRB 3V99A 1RSNA 3SYUA 3D79A 3F9SA 3TDGA 5AI1A 4EC6A 1GMRA 1MWSA 4LZIA 3IJEB 5M1AA 2P38A 1SARA 2Z7AA 3LZAA 1IVUA 4HM7B 1I2GA 1YNVX 3CC43 1IVVA 1TIJA 3I563 2KF5A 3VGNA 1RGHA 2R4IA 3CCV3 3Q3FA 3U1WA 4FCJA 2F86B 4BU4A 4CCVA 2BU4A 1B2SA 1Q7HA 1TP6A 3WA3A 1FGOA 1VQO3 2YFLB 3DZLA 1Q42A 4BTWA 1J2BA 3HZPA 1BSCA 3HI7A 3F7XA 3LXUX 2FXTA 2HOHA 3F8HA 3SOAA 2B24B 1BVIA 1HU9A 5EVHA 3S67A 1TRPA 5IEOA 1G02A 2O9UX 1QJGA 1BNJA 1L5GB 1JN5A 2IUJA 1B20A 1IQ8A 1C7HA 3G8ZA 2J8XB 1GY6A 3HOHA 2GU3A 2F56A 2RBIA 3FKAA 4RNYA 2AAEA 2W6JH 1IDPA 3DH2A 1FGMA 1WNHA 4OUQA 1W6CA 1STFI 3EN1B 3A5EA 3FLJA 1BOXA 1W4NA 3GZBA 5EEOA 3NBRA 4LSOA 5KP3A 4ILFA 1A2PA 6GSPA 1RGKA 3B7CA 4WFOA 3FG1A 5RNTA 2IYJA 2HMOB 2V1LA 3F8XA 1W6YA 2W9QA 2F5MA 4FCMA 3FCSB 3CNMA 5AIGA 5KP4A 1NNVA 1Q814 1D6ZA 1O7MB 1ZGXA 3LOYA 4R80A 3SLUA 4NREA 3LTCA 1BNRA 1BSEA 1PY3A 3I553 1YIJ3 3CU3A 2KAAA 3CCR3 5HGRA 2CX0A 4J5KA 1B2XA 1BRKA 1VQ63 1LXEA 4IPBA 3CPOA 2FGTA 1VQK3 1M1K4 5HOHA 1N5PA 1FW7A 2C11A 5ELUA 1MNLA 3BU4A 4FMDA 2IUKA 2PNCA 3E99A 2CC3A 1OHOA 1UCJA 4WP5A 1X1YA 3ZFZA 3GZYB 1IV9A 1KC84 1M904 1FGQA 2A15A 1ZS7A 4K1UA 1OUNA 1R4CA 1E97A 2F4YA 4HJLB 1IVXA 3JUQA 1DMQA 3NV0B 2OOVC 1OPYA 1X1WA 1NB3I 2F98A 5G1KA 1UI8A 1ROAA 1ULJB 2OQEC 3L0RA 3KSPA 1QVG2 5IF6A 4OVMA 3EF8A 1I0XA 5BU4A 1BRSA 4H3UA 3NQZA 2E2VA 3ROBA 2RSXA 4MMXB 1N5HA 1YIT3 1YGEA 2CFDA 4FMCA 1W2B2 2HMKB 1DVCA 1EUIC 2JQ5A 3RGRA 8RNTA 1V58A 2F5WA 3OWSA 2WO0A 1ASKA 3PZWA 1I3IA 1UCKA 2LQVA 2Z76A 5IEPA 1ROVA 2E2UA 3FG4A 3KIIA 3CC23 1JV2B 2OTL3 3UL5A 2INXA 2KCDA 4G1MB 1BSDA 4AKYA 3WHOA 3K63A 1IT8A 2CG1A 1BRHA 3G0KA 1JRQA 1VQ93 1RJOA 2HMJB 1A2KA 2IA7A 4I5QA 3CPW2 1GMPA 3LTBA 1DETA 1BIRA 1W01A 2CFKA 2OCTA 4XBXA 1DMMA 3S5CA 3G4S3 1IV7A 4KFFA 3DGNA 3DXOA 3X41A 1JJ22 3WMDA 2OOVA 4GL6A 5LC6A 5AEUB 3LMLA 2OQEA 5AYSC 4XDWA 5IG0A 5AEWB 3HX8A 3H51A 1VQL3 1GOUA 1IYYA 4WYKA 1A2VA 2Y73A 3FZWA 1DMNA 3MSOA 1JZDA 1M1XB 3AHWA 1RTUA 1WMPA 2BO9B 1RRLA 2I9WA 3NV0A 1VQ43 1NWWA 1RNTA 4H61A 4IT7A 1LOXA 1NDOB 3DGMA 3JUPA 1GY7A 2CH9A 2XSOB 3A76A 3EE1A 3K0ZA 3OV4A 1OHPA 1WMOA 4N6OB 7STDA 3KN4A 1F8NA 3WA2X 4CJNA 4EXRA 1Q7Y4 1E3VA 1JB5A 1UI7A 1JKGB 1TTOA 3BNBA 3GRDA 3NBJA 3Q2PA 3J7Yd 1Q824 2D1WA 1BRGA 1TRQA 3HIIA 3U97A 1EEJA 1FGRA 1OCVA 3KE7A 1UUGB 3M8CA 2BMOB 1X1XA 2KF3A 5BVBA 1JBTA 1GYBA 3FH1A 1GOVA 2STDA 1HKXA 1N9EA 1A67A 1LNIA 3IPTA 3QRDA 3MG1A 6STDA 1CH0A 1IQYA 4MJDA 3SEDA 1PFPA 3S28A 3WDGB 1C54A 1N8R4 1HYFA 3HK4A 4Q53A 5JPUA 3MHEA 4K61A 3F40A 4HYZA 3BLZA 3CCQ3 2Y74A 2CWUA 1UCLA 1B2MA 2ZDJA 4BIRA 3NQYA 2MC8A 2WOFA 2L4VA 3GZXB 4X2HA 3CCU3 4L7KA 1JB2A 1CYVA 3UB1A 3BIRA 3MWZA 4KFDA 1RGGA 3FGYA 1U8CB 1FGTA 3CCM3 3LTAA 2QEX3 1AV4A 5EQLA 1UDII 1QALA 4HZ9B 1R4YA 4HM5B 1GY5A 3JUMA 2RCDA 3B4OA 1HZ1A 1TFOA 3X3XA 3NXJA 5IW9A 4R1KA 1AQZA 2ML5A 3KKGA 4O8SA 1Y4KA 1EKMA 1LQMB 1RHLA 3PCRA 1D6UA 1SIHA 2H0IA 1MWUA 3LTDA 1B21A 1KWIA 1RDSA 3LYGA 1K9M4 1BNGA 1JKGA 1IU7A 5TGNA 8CHOA 4WYKB 3G6E3 2CWTA 4RNZA 2Z6BA 3EX9A 1YVBI 1E3RA 1OGZA 4FR9A 1GD3A 1LVNA 1RCLA 2L1SA 1VQ83 3OW22 1YJW3 3CC73 1FYSA 4XDVA 6RNTA 7RNTA 4HM1B 1YI23 1ISKA 1YJ93 2F99A 2ML6A 3FF2A 4MMZB 1T2HA 1O7NB 2GBWB 2WGQA 1CYUA 4HM0B 4N6MA 3CCJ3 2K3DA 3KFQC 3GSPA 1AY7A 2KF6A 1W7CA 2H0HA 1IT7A 1RRHA 1FUTA 2LYXA 4HBRA 4I4KA 4XBTA 3EC9A 4EV5A 2XFSA 1RCKA 2YFIB 1RN4A 3FF0A 3MYTA 5AIFA 1FZUA 1K41A 2UGIA 1VQP3 3DMCA 4KFEA 1OF5B 2CX1A 1MGWA 1BNFA 2MF7A 2W0QA 5LC7A 1BRJA 3T8UA 4CDLA 3STDA 4WWUC 1RGLA 3OWYA 1UW1A 2XH9A 1S5AA 2E2TA 4KT3B 2GXFA 1US1A 1W6GA 3AMOB 1KD14 3B4PA 2C10A 3MG3A 5BIRA 1V74A 1RGAA 2XF3A 1K28A 3LT8A 3D4AA 3PS8A 4GHOA 1BUQA 3NBBA 1I8VA 1WQLB 1BU4A 4N6LA 3WOEB 2CHCA 4RZMA 4QWTA 1W00A 2R41A 5G1LA 2HMMB 2CK3H 2IMJA 2FNQA 4STDA 1LOVA 4J8TA 1D6YA 3DGOA 1GSPA 2D42A 3ALAA 1AVLA 3NX0A 4WHAA 2XRXB 3KSED 4EYCA 1WMNA 3WODG 1YJN3 2W04A 1QAKA 1FUSA 4O02B 3ER7A 4N6TA 4BTXA 4PEJA 3N54B 2W56B 3PGBA 2O3OA 2W2CA 2XSHB 2YX9A 2CKFB 5JBSA 3WOFB 2BMQB 1B27A 3BB9A 1GS3A 1ULIB 1SJWA 3MKIA 4HM2B 3T0UA 3K7CA 1EA2A 1AVKA 2BMRB 2P09A 3D5GA 3GZRA 4HM6B 1QMAA 1RGFA 2KXGA 4KZ1A 5STDA 5A0OB 3VSYA 1QAFA 3CCE3 4LYLB 3PCSA 2UX0A 3OXAA 2XR8B 4FMBA 3UNLA 4BL3A 2XFTA 5DRVA 5G2GA 1FA3A 4J5GA 2CFGA 3KCHA 2JDIH 4LEHA 3AGNA 1LOYA 4L8PA 3SX1A 3BNDA 3EBTA 4EV2A 1MWRA 2H0GA 4N3VA 4RBNA 1IQXA 4N6NB 1RNBA
chains in the Genus database with same CATH topology
4ORLA 1W2ZA 4OK0A 2KRTA 2CIUA 3O8YA 3V92A 1TUHA 1OF5A 3GWRA 3B8LA 2SBLA 3IMAB 1T5YA 4HM4B 4HKVB 4HM3B 5DREA 3EN8A 4R9KA 3D9RA 4HVNA 1STDA 3ECFA 3Q1CA 4LGQA 1DYUA 4IIAA 4AKZA 1QVF2 2QGUA 3AMOA 1ZX2A 1IVWA 1OGXA 5AIIA 3Q90A 1W5ZA 1S723 2GU1A 2XGNA 1FUWA 1O7GB 3K9MC 1NB5I 3SVAA 1NJI4 4HM8B 4JF8A 3G16A 3PXMA 2GEXA 4BTYA 3JVCA 2W56A 3PYJA 4N6UA 5CLKA 4NHFA 5KP1A 4L8OA 1TFKA 1RKYA 1IK3A 3EQQB 2CG0A 1N9JA 1NU3A 1OH0A 2GEYA 5IG5A 4X2OA 1SQWA 1AR0A 4TX4A 4XB5A 2M7OA 1M9GA 2Z77A 4K1VA 4N6V0 1U5OA 3NM2A 4MEIA 1Q864 3NUVA 3MPHA 3NM7A 4FMAA 5AIHA 2WOHA 4JRFA 3CMA3 1VQN3 3OX9A 3JUOA 5CF2A 5IG4A 4U13A 1PU4A 4FCZA 3DY5A 1OACA 3X3YA 1KQS2 3EBYA 3MG2A 1EG9B 1GD4A 1EQKA 2Q07A 2PZVA 5D81A 1W02A 3CCL3 1TU5A 3RGAA 2B1XB 5ELJA 1Z1SA 5CK6A 1VZZA 5FGOA 2ZL8A 3D3LA 1JNQA 1SIIA 1UUWB 3JUNA 3UJMA 3BNCA 3I0YA 1CQSA 1ZO2A 3LT9A 5D82A 1LNHA 5CF1A 3CXC2 1MOLA 2QIYA 1O7PB 2HMNB 1Q40B 4HZBB 3SOYA 3SXXA 3X40A 3G713 2XGLA 3BNEA 1O7WB 1WTHA 2BHMA 5BXQA 3DGLA 1K734 5CXOA 2K54A 3H3HA 3FSDA 3QK9A 2CW9A 2K0MA 3CNXA 1K8A4 3RDEA 2RGQA 4EBGA 4XM4A 5IG3A 3OWUA 1O7HB 4J9AA 3X42A 4XBYA 1JB4A 2WGOA 3KZTA 2P0XA 5IERA 3VF1A 3T8NA 3NHXA 2YFJB 4AEQA 3DUKA 3V98A 3LH4A 5IENA 1G96A 1VQ53 1SPUA 3S27A 2XEPA 4LMIA 4R9LA 5FW5A 3EHCA 4ZM8A 2W9PA 5I97A 3EB8A 4K90B 3UL6A 2P0MA 4R4KA 3F14A 3N8BA 1UUVB 3S29A 3K5TA 2P05A 2QA43 2OWPA 1NO3A 1RN7A 1N8QA 1JN5B 1KSIA 2CFLA 3X3ZA 1CEWI 3N9HA 2W03A 3F7SA 3FG3A 2BNGA 2CWVA 2GBXB 3HIGA 4KVHA 4GB5A 3CD63 2RFRA 2OTJ3 3EJVA 4O3VA 4MMYB 1A90A 2HMLB 5D83A 3CME3 5JPPA 3GAXA 3CCS3 1YHQ3 1VQ73 1VQM3 2BT3A 1Q40A 4O2HA 2CFWA 1OHSA 3DM8A 5AYRB 3V99A 3F9SA 3TDGA 5AI1A 4EC6A 4LZIA 3IJEB 2P38A 2Z7AA 3LZAA 4HM7B 1IVUA 3CC43 1IVVA 1TIJA 3I563 3VGNA 2R4IA 3CCV3 3U1WA 4FCJA 2F86B 4CCVA 1TP6A 3WA3A 1FGOA 1VQO3 2YFLB 3DZLA 1Q42A 4BTWA 1J2BA 3HZPA 3HI7A 3F7XA 3LXUX 2FXTA 3F8HA 3SOAA 2B24B 1HU9A 5EVHA 3S67A 5IEOA 2O9UX 1QJGA 1L5GB 1JN5A 2IUJA 1IQ8A 1C7HA 3G8ZA 1GY6A 2GU3A 3FKAA 4RNYA 2W6JH 1IDPA 1FGMA 1WNHA 4OUQA 1W6CA 1STFI 3EN1B 3FLJA 1W4NA 3GZBA 5EEOA 3NBRA 4LSOA 5KP3A 3B7CA 4WFOA 3FG1A 2HMOB 2V1LA 3F8XA 1W6YA 2W9QA 4FCMA 3FCSB 3CNMA 5AIGA 5KP4A 1Q814 1D6ZA 1O7MB 3LOYA 4R80A 3SLUA 4NREA 3LTCA 3I553 1YIJ3 3CU3A 3CCR3 5HGRA 1VQ63 1LXEA 4IPBA 3CPOA 2FGTA 1VQK3 1M1K4 1N5PA 2C11A 5ELUA 1MNLA 4FMDA 2IUKA 2PNCA 3E99A 2CC3A 1OHOA 4WP5A 3GZYB 1IV9A 1KC84 1M904 1FGQA 2A15A 4K1UA 1OUNA 1R4CA 1E97A 4HJLB 1IVXA 3JUQA 1DMQA 3NV0B 2OOVC 1OPYA 1NB3I 2F98A 1UI8A 1ROAA 1ULJB 2OQEC 3L0RA 3KSPA 1QVG2 5IF6A 4OVMA 3EF8A 4H3UA 3NQZA 2E2VA 3ROBA 2RSXA 4MMXB 1N5HA 1YIT3 1YGEA 2CFDA 4FMCA 1W2B2 2HMKB 1DVCA 2JQ5A 3RGRA 3OWSA 2WO0A 1ASKA 3PZWA 5IEPA 2LQVA 2Z76A 1ROVA 2E2UA 3FG4A 3KIIA 3CC23 1JV2B 2OTL3 3UL5A 2INXA 2KCDA 4G1MB 4AKYA 3K63A 1IT8A 2CG1A 3G0KA 1JRQA 1VQ93 1RJOA 2HMJB 1A2KA 2IA7A 3CPW2 3LTBA 1W01A 2CFKA 2OCTA 4XBXA 1DMMA 3S5CA 3G4S3 1IV7A 4KFFA 3DGNA 3DXOA 3X41A 1JJ22 3WMDA 2OOVA 4GL6A 5LC6A 5AEUB 3LMLA 2OQEA 5AYSC 4XDWA 5IG0A 5AEWB 3HX8A 3H51A 1VQL3 4WYKA 1A2VA 2Y73A 3FZWA 1DMNA 3MSOA 1M1XB 1WMPA 2BO9B 1RRLA 2I9WA 3NV0A 1VQ43 1NWWA 4H61A 4IT7A 1LOXA 1NDOB 3DGMA 3JUPA 1GY7A 3A76A 2CH9A 2XSOB 3EE1A 3K0ZA 3OV4A 1OHPA 1WMOA 4N6OB 7STDA 3KN4A 1F8NA 3WA2X 4EXRA 1Q7Y4 1E3VA 1JB5A 1UI7A 1JKGB 3BNBA 3GRDA 3NBJA 3Q2PA 3J7Yd 1Q824 2D1WA 3HIIA 3U97A 1FGRA 1OCVA 3KE7A 3M8CA 2BMOB 5BVBA 1GYBA 3FH1A 2STDA 1HKXA 1N9EA 1A67A 3QRDA 3IPTA 3MG1A 6STDA 1IQYA 4MJDA 3SEDA 1PFPA 3S28A 3WDGB 1N8R4 3HK4A 4Q53A 5JPUA 3MHEA 4K61A 3F40A 4HYZA 3BLZA 3CCQ3 2Y74A 2CWUA 2ZDJA 3NQYA 2MC8A 2WOFA 2L4VA 3GZXB 4X2HA 3CCU3 4L7KA 1JB2A 1CYVA 3UB1A 3MWZA 4KFDA 3FGYA 1U8CB 1FGTA 3CCM3 3LTAA 2QEX3 1AV4A 5EQLA 1QALA 4HZ9B 4HM5B 1GY5A 3JUMA 2RCDA 3B4OA 1TFOA 3X3XA 3NXJA 5IW9A 4R1KA 2ML5A 3KKGA 4O8SA 1Y4KA 1EKMA 3PCRA 1D6UA 1SIHA 3LTDA 1K9M4 3LYGA 1KWIA 1JKGA 1IU7A 5TGNA 8CHOA 4WYKB 3G6E3 2CWTA 4RNZA 2Z6BA 3EX9A 1YVBI 1E3RA 1OGZA 4FR9A 1GD3A 1LVNA 1VQ83 3OW22 1YJW3 3CC73 4XDVA 1YI23 4HM1B 1ISKA 1YJ93 2F99A 2ML6A 3FF2A 4MMZB 1CYUA 1O7NB 2GBWB 2WGQA 4HM0B 4N6MA 3CCJ3 3KFQC 1W7CA 1IT7A 1RRHA 4HBRA 2LYXA 4I4KA 4XBTA 3EC9A 4EV5A 2XFSA 3FF0A 2YFIB 3MYTA 5AIFA 1K41A 1VQP3 3DMCA 4KFEA 1OF5B 2MF7A 2W0QA 5LC7A 3T8UA 4CDLA 3STDA 4WWUC 3OWYA 1UW1A 2XH9A 1S5AA 2E2TA 2GXFA 1US1A 1W6GA 3AMOB 1KD14 3B4PA 2C10A 3MG3A 1V74A 2XF3A 3LT8A 1K28A 3PS8A 1BUQA 3NBBA 1WQLB 4N6LA 3WOEB 2CHCA 4RZMA 4QWTA 1W00A 2HMMB 2CK3H 2IMJA 2FNQA 4STDA 4J8TA 1D6YA 3DGOA 2D42A 3ALAA 1AVLA 3NX0A 4WHAA 2XRXB 3KSED 4EYCA 1WMNA 3WODG 1YJN3 2W04A 1QAKA 4O02B 3ER7A 4N6TA 4BTXA 4PEJA 3N54B 2W56B 3PGBA 2O3OA 2W2CA 2XSHB 2YX9A 2CKFB 5JBSA 3WOFB 2BMQB 3BB9A 1GS3A 1ULIB 1SJWA 3MKIA 4HM2B 3T0UA 3K7CA 1EA2A 1AVKA 2BMRB 2P09A 3GZRA 4HM6B 1DVDA 1QMAA 2KXGA 5A0OB 4KZ1A 5STDA 3CCE3 3VSYA 1QAFA 3PCSA 2UX0A 3OXAA 2XR8B 4FMBA 3UNLA 1FA3A 2XFTA 5DRVA 5G2GA 2CFGA 2JDIH 4LEHA 4L8PA 3SX1A 3BNDA 3EBTA 4EV2A 4N3VA 4RBNA 1IQXA 4N6NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ1 A;  4AKY A;  5JBS A;  4NHF A;  4O3V A;  4AKZ A;  5I97 A;  4MEI A;  2BHM A;  2CC3 A;  4LSO A;  4JF8 A; 
#chains in the Genus database with same CATH topology
 4ORL A;  1RN1 A;  2BIR A;  1W2Z A;  3DGY A;  4OK0 A;  2KRT A;  2CIU A;  3O8Y A;  3V92 A;  1TUH A;  1OF5 A;  3GWR A;  3B8L A;  2SBL A;  3IMA B;  1T5Y A;  1T3B A;  2RNT A;  1UGI A;  4HM4 B;  4HKV B;  4HM3 B;  5DRE A;  1BGS A;  3EN8 A;  4R9K A;  3D9R A;  4HVN A;  1STD A;  3ECF A;  1RGE A;  3Q1C A;  4LGQ A;  1DYU A;  1TJD A;  3D5I A;  4IIA A;  4AKZ A;  1QVF 2;  1X1U A;  2QGU A;  3AMO A;  1ZX2 A;  1IVW A;  1OGX A;  5AII A;  3Q90 A;  1W5Z A;  1B2U A;  1S72 3;  2GU1 A;  2XGN A;  1FUW A;  1O7G B;  3K9M C;  1NB5 I;  1JZO A;  3SVA A;  1NJI 4;  4HM8 B;  4JF8 A;  4HAA A;  1BNE A;  3G16 A;  3PXM A;  2GEX A;  4BTY A;  1VQQ A;  3JVC A;  2W56 A;  2ZA4 A;  3PYJ A;  4N6U A;  4NHF A;  5CLK A;  4L8O A;  1TFK A;  4BL2 A;  5KP1 A;  1BAO A;  1IK3 A;  1RKY A;  3EQQ B;  2AAD A;  5M19 A;  2CG0 A;  1N9J A;  1NU3 A;  1OH0 A;  2GEY A;  5IG5 A;  4X2O A;  1SQW A;  1AR0 A;  1MGR A;  4TX4 A;  1B2Z A;  4XB5 A;  2M7O A;  2SAR A;  1BSB A;  1RLS A;  1M9G A;  2Z77 A;  4K1V A;  4N6V 0;  1U5O A;  3NM2 A;  4MEI A;  1Q86 4;  3NUV A;  3MPH A;  3NM7 A;  4FMA A;  5AIH A;  2WOH A;  4JRF A;  3CMA 3;  1VQN 3;  3OX9 A;  3JUO A;  5CF2 A;  5IG4 A;  1G0T A;  4U13 A;  1PU4 A;  4FCZ A;  3DY5 A;  1OAC A;  3RNT A;  3X3Y A;  1KQS 2;  3URP A;  3EBY A;  3MG2 A;  1EG9 B;  1YVS A;  1GD4 A;  1EQK A;  4EW5 A;  2Q07 A;  1PYL A;  2PZV A;  5D81 A;  1W02 A;  1DE3 A;  1I3F A;  1TU5 A;  3AHS A;  3CCL 3;  3RGA A;  1LOW A;  2B1X B;  3WR2 A;  5ELJ A;  1Z1S A;  5CK6 A;  1VZZ A;  5FGO A;  2ZL8 A;  3D3L A;  1JNQ A;  1SII A;  1UUW B;  3JUN A;  3UJM A;  3BNC A;  3I0Y A;  1CQS A;  1ZO2 A;  3LT9 A;  5D82 A;  1JBR A;  1LNH A;  5CF1 A;  3CXC 2;  1MOL A;  1O7P B;  2QIY A;  3AGO A;  2HMN B;  1Q40 B;  4HZB B;  3SOY A;  3SXX A;  3X40 A;  4DKI A;  3G71 3;  1LRA A;  1UCI A;  1I70 A;  2XGL A;  3BNE A;  1O7W B;  1WTH A;  1B3S A;  2BHM A;  3DGL A;  1UGH I;  5BXQ A;  1DVD A;  2C4B A;  5CXO A;  2K54 A;  1K73 4;  1RMS A;  3H3H A;  3FSD A;  3QK9 A;  2CW9 A;  1V57 A;  2ZHX B;  2K0M A;  3CNX A;  9RNT A;  1GMQ A;  1I2F A;  1K8A 4;  3RDE A;  2RGQ A;  4EBG A;  4XM4 A;  5IG3 A;  3OWU A;  1O7H B;  1BNS A;  4RNT A;  1BRI A;  4J9A A;  3X42 A;  2IY2 A;  1JB4 A;  2GSP A;  2WGO A;  3KZT A;  2P0X A;  4XBY A;  4CPK A;  5IER A;  3VF1 A;  3T8N A;  3NHX A;  2YFJ B;  4AEQ A;  3DUK A;  4NPB A;  3V98 A;  3LH4 A;  5IEN A;  1G96 A;  1VQ5 3;  1GOY A;  1BAN A;  1BNI A;  1RGC A;  1BRN L;  1SPU A;  3S27 A;  2XEP A;  4LMI A;  4R9L A;  5FW5 A;  1BUJ A;  2KF4 A;  2UUG C;  3EHC A;  4ZM8 A;  2W9P A;  5I97 A;  3EB8 A;  4K90 B;  3UL6 A;  2P0M A;  4R4K A;  3F14 A;  3N8B A;  1UUV B;  3S29 A;  3K5T A;  4GSP A;  2P05 A;  4HOH A;  2OWP A;  2QA4 3;  1NO3 A;  1JBS A;  1RN7 A;  1N8Q A;  1Q9E A;  1JN5 B;  1KSI A;  2CFL A;  3X3Z A;  1T2I A;  7GSP A;  5GSP A;  1MWT A;  1CEW I;  3N9H A;  2W03 A;  3F7S A;  3FG3 A;  2BNG A;  1YGW A;  2CWV A;  2GBX B;  3HIG A;  1I0V A;  4KVH A;  3ZG0 A;  1BSA A;  4GB5 A;  3CD6 3;  1LQG C;  2RFR A;  2OTJ 3;  3EJV A;  4O3V A;  5M18 A;  4MMY B;  1A90 A;  2HML B;  5D83 A;  3CME 3;  5JPP A;  3GAX A;  3CCS 3;  1YHQ 3;  1I2E A;  1VQ7 3;  1VQM 3;  2BT3 A;  1Q40 A;  4O2H A;  2CFW A;  3ZG5 A;  1OHS A;  3DM8 A;  5AYR B;  3V99 A;  1RSN A;  3SYU A;  3D79 A;  3F9S A;  3TDG A;  5AI1 A;  4EC6 A;  1GMR A;  1MWS A;  4LZI A;  3IJE B;  5M1A A;  2P38 A;  1SAR A;  2Z7A A;  3LZA A;  1IVU A;  4HM7 B;  1I2G A;  1YNV X;  3CC4 3;  1IVV A;  1TIJ A;  3I56 3;  2KF5 A;  3VGN A;  1RGH A;  2R4I A;  3CCV 3;  3Q3F A;  3U1W A;  4FCJ A;  2F86 B;  4BU4 A;  4CCV A;  2BU4 A;  1B2S A;  1Q7H A;  1TP6 A;  3WA3 A;  1FGO A;  1VQO 3;  2YFL B;  3DZL A;  1Q42 A;  4BTW A;  1J2B A;  3HZP A;  1BSC A;  3HI7 A;  3F7X A;  3LXU X;  2FXT A;  2HOH A;  3F8H A;  3SOA A;  2B24 B;  1BVI A;  1HU9 A;  5EVH A;  3S67 A;  1TRP A;  5IEO A;  1G02 A;  2O9U X;  1QJG A;  1BNJ A;  1L5G B;  1JN5 A;  2IUJ A;  1B20 A;  1IQ8 A;  1C7H A;  3G8Z A;  2J8X B;  1GY6 A;  3HOH A;  2GU3 A;  2F56 A;  2RBI A;  3FKA A;  4RNY A;  2AAE A;  2W6J H;  1IDP A;  3DH2 A;  1FGM A;  1WNH A;  4OUQ A;  1W6C A;  1STF I;  3EN1 B;  3A5E A;  3FLJ A;  1BOX A;  1W4N A;  3GZB A;  5EEO A;  3NBR A;  4LSO A;  5KP3 A;  4ILF A;  1A2P A;  6GSP A;  1RGK A;  3B7C A;  4WFO A;  3FG1 A;  5RNT A;  2IYJ A;  2HMO B;  2V1L A;  3F8X A;  1W6Y A;  2W9Q A;  2F5M A;  4FCM A;  3FCS B;  3CNM A;  5AIG A;  5KP4 A;  1NNV A;  1Q81 4;  1D6Z A;  1O7M B;  1ZGX A;  3LOY A;  4R80 A;  3SLU A;  4NRE A;  3LTC A;  1BNR A;  1BSE A;  1PY3 A;  3I55 3;  1YIJ 3;  3CU3 A;  2KAA A;  3CCR 3;  5HGR A;  2CX0 A;  4J5K A;  1B2X A;  1BRK A;  1VQ6 3;  1LXE A;  4IPB A;  3CPO A;  2FGT A;  1VQK 3;  1M1K 4;  5HOH A;  1N5P A;  1FW7 A;  2C11 A;  5ELU A;  1MNL A;  3BU4 A;  4FMD A;  2IUK A;  2PNC A;  3E99 A;  2CC3 A;  1OHO A;  1UCJ A;  4WP5 A;  1X1Y A;  3ZFZ A;  3GZY B;  1IV9 A;  1KC8 4;  1M90 4;  1FGQ A;  2A15 A;  1ZS7 A;  4K1U A;  1OUN A;  1R4C A;  1E97 A;  2F4Y A;  4HJL B;  1IVX A;  3JUQ A;  1DMQ A;  3NV0 B;  2OOV C;  1OPY A;  1X1W A;  1NB3 I;  2F98 A;  5G1K A;  1UI8 A;  1ROA A;  1ULJ B;  2OQE C;  3L0R A;  3KSP A;  1QVG 2;  5IF6 A;  4OVM A;  3EF8 A;  1I0X A;  5BU4 A;  1BRS A;  4H3U A;  3NQZ A;  2E2V A;  3ROB A;  2RSX A;  4MMX B;  1N5H A;  1YIT 3;  1YGE A;  2CFD A;  4FMC A;  1W2B 2;  2HMK B;  1DVC A;  1EUI C;  2JQ5 A;  3RGR A;  8RNT A;  1V58 A;  2F5W A;  3OWS A;  2WO0 A;  1ASK A;  3PZW A;  1I3I A;  1UCK A;  2LQV A;  2Z76 A;  5IEP A;  1ROV A;  2E2U A;  3FG4 A;  3KII A;  3CC2 3;  1JV2 B;  2OTL 3;  3UL5 A;  2INX A;  2KCD A;  4G1M B;  1BSD A;  4AKY A;  3WHO A;  3K63 A;  1IT8 A;  2CG1 A;  1BRH A;  3G0K A;  1JRQ A;  1VQ9 3;  1RJO A;  2HMJ B;  1A2K A;  2IA7 A;  4I5Q A;  3CPW 2;  1GMP A;  3LTB A;  1DET A;  1BIR A;  1W01 A;  2CFK A;  2OCT A;  4XBX A;  1DMM A;  3S5C A;  3G4S 3;  1IV7 A;  4KFF A;  3DGN A;  3DXO A;  3X41 A;  1JJ2 2;  3WMD A;  2OOV A;  4GL6 A;  5LC6 A;  5AEU B;  3LML A;  2OQE A;  5AYS C;  4XDW A;  5IG0 A;  5AEW B;  3HX8 A;  3H51 A;  1VQL 3;  1GOU A;  1IYY A;  4WYK A;  1A2V A;  2Y73 A;  3FZW A;  1DMN A;  3MSO A;  1JZD A;  1M1X B;  3AHW A;  1RTU A;  1WMP A;  2BO9 B;  1RRL A;  2I9W A;  3NV0 A;  1VQ4 3;  1NWW A;  1RNT A;  4H61 A;  4IT7 A;  1LOX A;  1NDO B;  3DGM A;  3JUP A;  1GY7 A;  2CH9 A;  2XSO B;  3A76 A;  3EE1 A;  3K0Z A;  3OV4 A;  1OHP A;  1WMO A;  4N6O B;  7STD A;  3KN4 A;  1F8N A;  3WA2 X;  4CJN A;  4EXR A;  1Q7Y 4;  1E3V A;  1JB5 A;  1UI7 A;  1JKG B;  1TTO A;  3BNB A;  3GRD A;  3NBJ A;  3Q2P A;  3J7Y d;  1Q82 4;  2D1W A;  1BRG A;  1TRQ A;  3HII A;  3U97 A;  1EEJ A;  1FGR A;  1OCV A;  3KE7 A;  1UUG B;  3M8C A;  2BMO B;  1X1X A;  2KF3 A;  5BVB A;  1JBT A;  1GYB A;  3FH1 A;  1GOV A;  2STD A;  1HKX A;  1N9E A;  1A67 A;  1LNI A;  3IPT A;  3QRD A;  3MG1 A;  6STD A;  1CH0 A;  1IQY A;  4MJD A;  3SED A;  1PFP A;  3S28 A;  3WDG B;  1C54 A;  1N8R 4;  1HYF A;  3HK4 A;  4Q53 A;  5JPU A;  3MHE A;  4K61 A;  3F40 A;  4HYZ A;  3BLZ A;  3CCQ 3;  2Y74 A;  2CWU A;  1UCL A;  1B2M A;  2ZDJ A;  4BIR A;  3NQY A;  2MC8 A;  2WOF A;  2L4V A;  3GZX B;  4X2H A;  3CCU 3;  4L7K A;  1JB2 A;  1CYV A;  3UB1 A;  3BIR A;  3MWZ A;  4KFD A;  1RGG A;  3FGY A;  1U8C B;  1FGT A;  3CCM 3;  3LTA A;  2QEX 3;  1AV4 A;  5EQL A;  1UDI I;  1QAL A;  4HZ9 B;  1R4Y A;  4HM5 B;  1GY5 A;  3JUM A;  2RCD A;  3B4O A;  1HZ1 A;  1TFO A;  3X3X A;  3NXJ A;  5IW9 A;  4R1K A;  1AQZ A;  2ML5 A;  3KKG A;  4O8S A;  1Y4K A;  1EKM A;  1LQM B;  1RHL A;  3PCR A;  1D6U A;  1SIH A;  2H0I A;  1MWU A;  3LTD A;  1B21 A;  1KWI A;  1RDS A;  3LYG A;  1K9M 4;  1BNG A;  1JKG A;  1IU7 A;  5TGN A;  8CHO A;  4WYK B;  3G6E 3;  2CWT A;  4RNZ A;  2Z6B A;  3EX9 A;  1YVB I;  1E3R A;  1OGZ A;  4FR9 A;  1GD3 A;  1LVN A;  1RCL A;  2L1S A;  1VQ8 3;  3OW2 2;  1YJW 3;  3CC7 3;  1FYS A;  4XDV A;  6RNT A;  7RNT A;  4HM1 B;  1YI2 3;  1ISK A;  1YJ9 3;  2F99 A;  2ML6 A;  3FF2 A;  4MMZ B;  1T2H A;  1O7N B;  2GBW B;  2WGQ A;  1CYU A;  4HM0 B;  4N6M A;  3CCJ 3;  2K3D A;  3KFQ C;  3GSP A;  1AY7 A;  2KF6 A;  1W7C A;  2H0H A;  1IT7 A;  1RRH A;  1FUT A;  2LYX A;  4HBR A;  4I4K A;  4XBT A;  3EC9 A;  4EV5 A;  2XFS A;  1RCK A;  2YFI B;  1RN4 A;  3FF0 A;  3MYT A;  5AIF A;  1FZU A;  1K41 A;  2UGI A;  1VQP 3;  3DMC A;  4KFE A;  1OF5 B;  2CX1 A;  1MGW A;  1BNF A;  2MF7 A;  2W0Q A;  5LC7 A;  1BRJ A;  3T8U A;  4CDL A;  3STD A;  4WWU C;  1RGL A;  3OWY A;  1UW1 A;  2XH9 A;  1S5A A;  2E2T A;  4KT3 B;  2GXF A;  1US1 A;  1W6G A;  3AMO B;  1KD1 4;  3B4P A;  2C10 A;  3MG3 A;  5BIR A;  1V74 A;  1RGA A;  2XF3 A;  1K28 A;  3LT8 A;  3D4A A;  3PS8 A;  4GHO A;  1BUQ A;  3NBB A;  1I8V A;  1WQL B;  1BU4 A;  4N6L A;  3WOE B;  2CHC A;  4RZM A;  4QWT A;  1W00 A;  2R41 A;  5G1L A;  2HMM B;  2CK3 H;  2IMJ A;  2FNQ A;  4STD A;  1LOV A;  4J8T A;  1D6Y A;  3DGO A;  1GSP A;  2D42 A;  3ALA A;  1AVL A;  3NX0 A;  4WHA A;  2XRX B;  3KSE D;  4EYC A;  1WMN A;  3WOD G;  1YJN 3;  2W04 A;  1QAK A;  1FUS A;  4O02 B;  3ER7 A;  4N6T A;  4BTX A;  4PEJ A;  3N54 B;  2W56 B;  3PGB A;  2O3O A;  2W2C A;  2XSH B;  2YX9 A;  2CKF B;  5JBS A;  3WOF B;  2BMQ B;  1B27 A;  3BB9 A;  1GS3 A;  1ULI B;  1SJW A;  3MKI A;  4HM2 B;  3T0U A;  3K7C A;  1EA2 A;  1AVK A;  2BMR B;  2P09 A;  3D5G A;  3GZR A;  4HM6 B;  1QMA A;  1RGF A;  2KXG A;  4KZ1 A;  5STD A;  5A0O B;  3VSY A;  1QAF A;  3CCE 3;  4LYL B;  3PCS A;  2UX0 A;  3OXA A;  2XR8 B;  4FMB A;  3UNL A;  4BL3 A;  2XFT A;  5DRV A;  5G2G A;  1FA3 A;  4J5G A;  2CFG A;  3KCH A;  2JDI H;  4LEH A;  3AGN A;  1LOY A;  4L8P A;  3SX1 A;  3BND A;  3EBT A;  4EV2 A;  1MWR A;  2H0G A;  4N3V A;  4RBN A;  1IQX A;  4N6N B;  1RNB A; 
#chains in the Genus database with same CATH homology
 4ORL A;  1W2Z A;  4OK0 A;  2KRT A;  2CIU A;  3O8Y A;  3V92 A;  1TUH A;  1OF5 A;  3GWR A;  3B8L A;  2SBL A;  3IMA B;  1T5Y A;  4HM4 B;  4HKV B;  4HM3 B;  5DRE A;  3EN8 A;  4R9K A;  3D9R A;  4HVN A;  1STD A;  3ECF A;  3Q1C A;  4LGQ A;  1DYU A;  4IIA A;  4AKZ A;  1QVF 2;  2QGU A;  3AMO A;  1ZX2 A;  1IVW A;  1OGX A;  5AII A;  3Q90 A;  1W5Z A;  1S72 3;  2GU1 A;  2XGN A;  1FUW A;  1O7G B;  3K9M C;  1NB5 I;  3SVA A;  1NJI 4;  4HM8 B;  4JF8 A;  3G16 A;  3PXM A;  2GEX A;  4BTY A;  3JVC A;  2W56 A;  3PYJ A;  4N6U A;  5CLK A;  4NHF A;  5KP1 A;  4L8O A;  1TFK A;  1RKY A;  1IK3 A;  3EQQ B;  2CG0 A;  1N9J A;  1NU3 A;  1OH0 A;  2GEY A;  5IG5 A;  4X2O A;  1SQW A;  1AR0 A;  4TX4 A;  4XB5 A;  2M7O A;  1M9G A;  2Z77 A;  4K1V A;  4N6V 0;  1U5O A;  3NM2 A;  4MEI A;  1Q86 4;  3NUV A;  3MPH A;  3NM7 A;  4FMA A;  5AIH A;  2WOH A;  4JRF A;  3CMA 3;  1VQN 3;  3OX9 A;  3JUO A;  5CF2 A;  5IG4 A;  4U13 A;  1PU4 A;  4FCZ A;  3DY5 A;  1OAC A;  3X3Y A;  1KQS 2;  3EBY A;  3MG2 A;  1EG9 B;  1GD4 A;  1EQK A;  2Q07 A;  2PZV A;  5D81 A;  1W02 A;  3CCL 3;  1TU5 A;  3RGA A;  2B1X B;  5ELJ A;  1Z1S A;  5CK6 A;  1VZZ A;  5FGO A;  2ZL8 A;  3D3L A;  1JNQ A;  1SII A;  1UUW B;  3JUN A;  3UJM A;  3BNC A;  3I0Y A;  1CQS A;  1ZO2 A;  3LT9 A;  5D82 A;  1LNH A;  5CF1 A;  3CXC 2;  1MOL A;  2QIY A;  1O7P B;  2HMN B;  1Q40 B;  4HZB B;  3SOY A;  3SXX A;  3X40 A;  3G71 3;  2XGL A;  3BNE A;  1O7W B;  1WTH A;  2BHM A;  5BXQ A;  3DGL A;  1K73 4;  5CXO A;  2K54 A;  3H3H A;  3FSD A;  3QK9 A;  2CW9 A;  2K0M A;  3CNX A;  1K8A 4;  3RDE A;  2RGQ A;  4EBG A;  4XM4 A;  5IG3 A;  3OWU A;  1O7H B;  4J9A A;  3X42 A;  4XBY A;  1JB4 A;  2WGO A;  3KZT A;  2P0X A;  5IER A;  3VF1 A;  3T8N A;  3NHX A;  2YFJ B;  4AEQ A;  3DUK A;  3V98 A;  3LH4 A;  5IEN A;  1G96 A;  1VQ5 3;  1SPU A;  3S27 A;  2XEP A;  4LMI A;  4R9L A;  5FW5 A;  3EHC A;  4ZM8 A;  2W9P A;  5I97 A;  3EB8 A;  4K90 B;  3UL6 A;  2P0M A;  4R4K A;  3F14 A;  3N8B A;  1UUV B;  3S29 A;  3K5T A;  2P05 A;  2QA4 3;  2OWP A;  1NO3 A;  1RN7 A;  1N8Q A;  1JN5 B;  1KSI A;  2CFL A;  3X3Z A;  1CEW I;  3N9H A;  2W03 A;  3F7S A;  3FG3 A;  2BNG A;  2CWV A;  2GBX B;  3HIG A;  4KVH A;  4GB5 A;  3CD6 3;  2RFR A;  2OTJ 3;  3EJV A;  4O3V A;  4MMY B;  1A90 A;  2HML B;  5D83 A;  3CME 3;  5JPP A;  3GAX A;  3CCS 3;  1YHQ 3;  1VQ7 3;  1VQM 3;  2BT3 A;  1Q40 A;  4O2H A;  2CFW A;  1OHS A;  3DM8 A;  5AYR B;  3V99 A;  3F9S A;  3TDG A;  5AI1 A;  4EC6 A;  4LZI A;  3IJE B;  2P38 A;  2Z7A A;  3LZA A;  4HM7 B;  1IVU A;  3CC4 3;  1IVV A;  1TIJ A;  3I56 3;  3VGN A;  2R4I A;  3CCV 3;  3U1W A;  4FCJ A;  2F86 B;  4CCV A;  1TP6 A;  3WA3 A;  1FGO A;  1VQO 3;  2YFL B;  3DZL A;  1Q42 A;  4BTW A;  1J2B A;  3HZP A;  3HI7 A;  3F7X A;  3LXU X;  2FXT A;  3F8H A;  3SOA A;  2B24 B;  1HU9 A;  5EVH A;  3S67 A;  5IEO A;  2O9U X;  1QJG A;  1L5G B;  1JN5 A;  2IUJ A;  1IQ8 A;  1C7H A;  3G8Z A;  1GY6 A;  2GU3 A;  3FKA A;  4RNY A;  2W6J H;  1IDP A;  1FGM A;  1WNH A;  4OUQ A;  1W6C A;  1STF I;  3EN1 B;  3FLJ A;  1W4N A;  3GZB A;  5EEO A;  3NBR A;  4LSO A;  5KP3 A;  3B7C A;  4WFO A;  3FG1 A;  2HMO B;  2V1L A;  3F8X A;  1W6Y A;  2W9Q A;  4FCM A;  3FCS B;  3CNM A;  5AIG A;  5KP4 A;  1Q81 4;  1D6Z A;  1O7M B;  3LOY A;  4R80 A;  3SLU A;  4NRE A;  3LTC A;  3I55 3;  1YIJ 3;  3CU3 A;  3CCR 3;  5HGR A;  1VQ6 3;  1LXE A;  4IPB A;  3CPO A;  2FGT A;  1VQK 3;  1M1K 4;  1N5P A;  2C11 A;  5ELU A;  1MNL A;  4FMD A;  2IUK A;  2PNC A;  3E99 A;  2CC3 A;  1OHO A;  4WP5 A;  3GZY B;  1IV9 A;  1KC8 4;  1M90 4;  1FGQ A;  2A15 A;  4K1U A;  1OUN A;  1R4C A;  1E97 A;  4HJL B;  1IVX A;  3JUQ A;  1DMQ A;  3NV0 B;  2OOV C;  1OPY A;  1NB3 I;  2F98 A;  1UI8 A;  1ROA A;  1ULJ B;  2OQE C;  3L0R A;  3KSP A;  1QVG 2;  5IF6 A;  4OVM A;  3EF8 A;  4H3U A;  3NQZ A;  2E2V A;  3ROB A;  2RSX A;  4MMX B;  1N5H A;  1YIT 3;  1YGE A;  2CFD A;  4FMC A;  1W2B 2;  2HMK B;  1DVC A;  2JQ5 A;  3RGR A;  3OWS A;  2WO0 A;  1ASK A;  3PZW A;  5IEP A;  2LQV A;  2Z76 A;  1ROV A;  2E2U A;  3FG4 A;  3KII A;  3CC2 3;  1JV2 B;  2OTL 3;  3UL5 A;  2INX A;  2KCD A;  4G1M B;  4AKY A;  3K63 A;  1IT8 A;  2CG1 A;  3G0K A;  1JRQ A;  1VQ9 3;  1RJO A;  2HMJ B;  1A2K A;  2IA7 A;  3CPW 2;  3LTB A;  1W01 A;  2CFK A;  2OCT A;  4XBX A;  1DMM A;  3S5C A;  3G4S 3;  1IV7 A;  4KFF A;  3DGN A;  3DXO A;  3X41 A;  1JJ2 2;  3WMD A;  2OOV A;  4GL6 A;  5LC6 A;  5AEU B;  3LML A;  2OQE A;  5AYS C;  4XDW A;  5IG0 A;  5AEW B;  3HX8 A;  3H51 A;  1VQL 3;  4WYK A;  1A2V A;  2Y73 A;  3FZW A;  1DMN A;  3MSO A;  1M1X B;  1WMP A;  2BO9 B;  1RRL A;  2I9W A;  3NV0 A;  1VQ4 3;  1NWW A;  4H61 A;  4IT7 A;  1LOX A;  1NDO B;  3DGM A;  3JUP A;  1GY7 A;  3A76 A;  2CH9 A;  2XSO B;  3EE1 A;  3K0Z A;  3OV4 A;  1OHP A;  1WMO A;  4N6O B;  7STD A;  3KN4 A;  1F8N A;  3WA2 X;  4EXR A;  1Q7Y 4;  1E3V A;  1JB5 A;  1UI7 A;  1JKG B;  3BNB A;  3GRD A;  3NBJ A;  3Q2P A;  3J7Y d;  1Q82 4;  2D1W A;  3HII A;  3U97 A;  1FGR A;  1OCV A;  3KE7 A;  3M8C A;  2BMO B;  5BVB A;  1GYB A;  3FH1 A;  2STD A;  1HKX A;  1N9E A;  1A67 A;  3QRD A;  3IPT A;  3MG1 A;  6STD A;  1IQY A;  4MJD A;  3SED A;  1PFP A;  3S28 A;  3WDG B;  1N8R 4;  3HK4 A;  4Q53 A;  5JPU A;  3MHE A;  4K61 A;  3F40 A;  4HYZ A;  3BLZ A;  3CCQ 3;  2Y74 A;  2CWU A;  2ZDJ A;  3NQY A;  2MC8 A;  2WOF A;  2L4V A;  3GZX B;  4X2H A;  3CCU 3;  4L7K A;  1JB2 A;  1CYV A;  3UB1 A;  3MWZ A;  4KFD A;  3FGY A;  1U8C B;  1FGT A;  3CCM 3;  3LTA A;  2QEX 3;  1AV4 A;  5EQL A;  1QAL A;  4HZ9 B;  4HM5 B;  1GY5 A;  3JUM A;  2RCD A;  3B4O A;  1TFO A;  3X3X A;  3NXJ A;  5IW9 A;  4R1K A;  2ML5 A;  3KKG A;  4O8S A;  1Y4K A;  1EKM A;  3PCR A;  1D6U A;  1SIH A;  3LTD A;  1K9M 4;  3LYG A;  1KWI A;  1JKG A;  1IU7 A;  5TGN A;  8CHO A;  4WYK B;  3G6E 3;  2CWT A;  4RNZ A;  2Z6B A;  3EX9 A;  1YVB I;  1E3R A;  1OGZ A;  4FR9 A;  1GD3 A;  1LVN A;  1VQ8 3;  3OW2 2;  1YJW 3;  3CC7 3;  4XDV A;  1YI2 3;  4HM1 B;  1ISK A;  1YJ9 3;  2F99 A;  2ML6 A;  3FF2 A;  4MMZ B;  1CYU A;  1O7N B;  2GBW B;  2WGQ A;  4HM0 B;  4N6M A;  3CCJ 3;  3KFQ C;  1W7C A;  1IT7 A;  1RRH A;  4HBR A;  2LYX A;  4I4K A;  4XBT A;  3EC9 A;  4EV5 A;  2XFS A;  3FF0 A;  2YFI B;  3MYT A;  5AIF A;  1K41 A;  1VQP 3;  3DMC A;  4KFE A;  1OF5 B;  2MF7 A;  2W0Q A;  5LC7 A;  3T8U A;  4CDL A;  3STD A;  4WWU C;  3OWY A;  1UW1 A;  2XH9 A;  1S5A A;  2E2T A;  2GXF A;  1US1 A;  1W6G A;  3AMO B;  1KD1 4;  3B4P A;  2C10 A;  3MG3 A;  1V74 A;  2XF3 A;  3LT8 A;  1K28 A;  3PS8 A;  1BUQ A;  3NBB A;  1WQL B;  4N6L A;  3WOE B;  2CHC A;  4RZM A;  4QWT A;  1W00 A;  2HMM B;  2CK3 H;  2IMJ A;  2FNQ A;  4STD A;  4J8T A;  1D6Y A;  3DGO A;  2D42 A;  3ALA A;  1AVL A;  3NX0 A;  4WHA A;  2XRX B;  3KSE D;  4EYC A;  1WMN A;  3WOD G;  1YJN 3;  2W04 A;  1QAK A;  4O02 B;  3ER7 A;  4N6T A;  4BTX A;  4PEJ A;  3N54 B;  2W56 B;  3PGB A;  2O3O A;  2W2C A;  2XSH B;  2YX9 A;  2CKF B;  5JBS A;  3WOF B;  2BMQ B;  3BB9 A;  1GS3 A;  1ULI B;  1SJW A;  3MKI A;  4HM2 B;  3T0U A;  3K7C A;  1EA2 A;  1AVK A;  2BMR B;  2P09 A;  3GZR A;  4HM6 B;  1DVD A;  1QMA A;  2KXG A;  5A0O B;  4KZ1 A;  5STD A;  3CCE 3;  3VSY A;  1QAF A;  3PCS A;  2UX0 A;  3OXA A;  2XR8 B;  4FMB A;  3UNL A;  1FA3 A;  2XFT A;  5DRV A;  5G2G A;  2CFG A;  2JDI H;  4LEH A;  4L8P A;  3SX1 A;  3BND A;  3EBT A;  4EV2 A;  4N3V A;  4RBN A;  1IQX A;  4N6N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...