2KF4A

Barnase high pressure structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 36
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf4A00
1X1XA 1B20A 1RN4A 3AHWA 4GHOA 2F56A 1B3SA 2GSPA 3DGYA 1G02A 2KF3A 1B2UA 1LOYA 2BU4A 1JBRA 3BIRA 4J5KA 1BNRA 1RGKA 1I8VA 1RSNA 2F5MA 1B21A 1BAOA 1BOXA 1UCJA 1RMSA 1BSBA 1X1UA 1TRQA 1DE3A 1RNTA 1RGHA 1AY7A 2BIRA 1PYLA 1SARA 5HOHA 1BSAA 1BRNL 1RN1A 1B27A 4BU4A 1GMPA 1HYFA 1YGWA 3Q3FA 1T2IA 5BU4A 1RCLA 1BRKA 2KF6A 1RTUA 2C4BA 1BRHA 6GSPA 2AADA 1ZGXA 1BNGA 1GOUA 3RNTA 6RNTA 1IYYA 1GOVA 1BIRA 2KF4A 1BRSA 1HZ1A 1GMQA 1I0VA 2ZA4A 3A5EA 5GSPA 1JBSA 3AGOA 1A2PA 1RCKA 7RNTA 1BVIA 3WHOA 1BNFA 1UCKA 4J5GA 1BANA 3D5IA 3D4AA 1I2GA 2AAEA 1LNIA 1I0XA 2RNTA 1BNSA 3DH2A 9RNTA 2F5WA 1RGCA 1R4YA 1LRAA 7GSPA 1YNVX 1BUJA 1I70A 1LOWA 1RLSA 1FYSA 3GSPA 1BNJA 1BNIA 3AHSA 5RNTA 1FUTA 1MGRA 1RDSA 3KCHA 1Q9EA 1PY3A 1I2EA 1B2XA 1RGFA 1RGAA 2F4YA 1BRJA 1BGSA 1I3FA 1B2SA 1UCIA 1BRIA 1FW7A 3WR2A 1BNEA 2RBIA 1UCLA 4GSPA 1LOVA 1T2HA 1TRPA 4HOHA 4RNTA 3SYUA 3BU4A 1RNBA 1BSEA 4HAAA 3URPA 1I3IA 1GMRA 1RHLA 1AQZA 1YVSA 1RGGA 1X1YA 8RNTA 1TTOA 3HOHA 1BSCA 2KF5A 1RGEA 3D5GA 1I2FA 2KAAA 3AGNA 1C54A 1FUSA 1GSPA 1B2MA 1B2ZA 1GOYA 1MGWA 1X1WA 1JBTA 1BSDA 2HOHA 1CH0A 4BIRA 5BIRA 1BRGA 1FZUA 1BU4A 2SARA 1RGLA 1DETA
chains in the Genus database with same CATH superfamily
1M1XB 3BNCA 2P0XA 1VZZA 3AHWA 1EG9B 3F9SA 1SPUA 2Z6BA 3HK4A 2P09A 1D6YA 4O8SA 2XSHB 3CMA3 1T3BA 1LOXA 3SX1A 3JUOA 1LOYA 3S27A 1JZOA 1JBRA 1UUWB 3BIRA 4O3VA 4GL6A 3OWUA 1EEJA 2F5MA 3F8XA 2KRTA 1W4NA 2ML5A 1BAOA 1UCJA 4JF8A 1RMSA 1OUNA 2K0MA 3PGBA 4XDWA 1W5ZA 1A2VA 2HMNB 1TRQA 3B8LA 4AKYA 1DE3A 3UNLA 1AY7A 4L8PA 1IVWA 2B24B 1NU3A 1UUVB 1A2KA 2E2VA 8CHOA 2C11A 1VQM3 3NX0A 5KP3A 3Q2PA 4K1VA 4BU4A 1UW1A 1JKGB 1GMPA 1HYFA 2Y73A 1Q864 1QMAA 1T2IA 1TJDA 3SVAA 2XR8B 1VQ73 5BU4A 4FMDA 1BRKA 1W6GA 1AVKA 3G8ZA 2RGQA 1W01A 3KIIA 2Z76A 3HZPA 2AADA 1FGOA 3EX9A 3FSDA 3PYJA 5AYSC 1GOUA 2OTL3 6RNTA 1S5AA 1K41A 1BRSA 1HZ1A 1EA2A 1M9GA 2QIYA 3X42A 2Y74A 5I97A 1A2PA 3EBTA 1OF5A 7STDA 1TFKA 3KKGA 3WHOA 1N5PA 1BNFA 1DMNA 1UCKA 1BANA 3F7XA 3K5TA 3KZTA 2JQ5A 4HBRA 4RBNA 1SIHA 3D4AA 5IF6A 1OF5B 1MWTA 1ZO2A 2GBXB 5DREA 3SOAA 3BLZA 1GY6A 1I0XA 2HMLB 3CCR3 4KFEA 1HU9A 2GBWB 3CCU3 3PCRA 4XBYA 1PU4A 3JUQA 4X2HA 4HM8B 1E3RA 2R4IA 1YNVX 1OHOA 2XF3A 1UDII 2IYJA 4FCMA 1RLSA 4LEHA 4HYZA 5DRVA 2STDA 2XEPA 3RGRA 1WMPA 1O7HB 2HMJB 3CU3A 3RDEA 1MGRA 5A0OB 3CC43 2CFDA 3FKAA 4R9LA 1B2XA 1RGFA 3QRDA 4CPKA 4FR9A 1OH0A 2F4YA 1AR0A 3CNXA 1I3FA 3X3XA 4XM4A 3EE1A 1OACA 5CLKA 5BVBA 3LTBA 1IVVA 3WOFB 2CKFB 1LOVA 4R9KA 4HM0B 4RNTA 1RNBA 2WGOA 4HM5B 3CD63 2C10A 3URPA 3FZWA 2YFJB 1RHLA 3GRDA 5KP4A 3B4OA 1WMNA 2OTJ3 3DGOA 3K9MC 4LMIA 1DYUA 3MWZA 5D83A 5EVHA 3MG2A 3EHCA 3D5GA 4OVMA 2CWVA 2GU1A 1VQO3 3EN8A 2XSOB 2FGTA 2KAAA 1C54A 1G0TA 1B2ZA 3S29A 3ECFA 5ELJA 3MPHA 3F7SA 5CF1A 1X1WA 3HX8A 3ROBA 1CH0A 4BIRA 3NV0A 1VQ93 5BIRA 1QVF2 1FZUA 1IK3A 3OXAA 2SARA 3NV0B 3RGAA 4XB5A 1DETA 4BL2A 2BMQB 1B20A 3FH1A 4HM3B 4HZ9B 4GHOA 2D42A 4RZMA 5G1LA 2F56A 2WGQA 1UUGB 1C7HA 1YHQ3 4G1MB 5CXOA 1B3SA 1YI23 5JPUA 1K734 1W00A 3ZG0A 5AIHA 2CFLA 2KF3A 1L5GB 2BU4A 2BT3A 1JZDA 2IY2A 1FGMA 2W56A 1IQ8A 4WP5A 2OCTA 2W04A 1TFOA 4NREA 1G96A 1I8VA 1RSNA 4HM4B 2W56B 1STFI 5LC6A 2WO0A 2QGUA 1X1UA 2WOFA 4EV5A 2L4VA 1RNTA 3Q1CA 4WYKA 3VSYA 1Q42A 2BMOB 2RSXA 1R4CA 4FMBA 2Z7AA 1GS3A 2GXFA 3JUPA 3STDA 4STDA 4FCJA 1BSAA 3MSOA 2KCDA 2SBLA 3SOYA 1W6YA 5AEWB 3IJEB 3WA3A 1ROVA 1YGWA 4WWUC 3CPW2 1KD14 1DMQA 4EBGA 2KF6A 3PCSA 3PS8A 1IT8A 6GSPA 4AEQA 3UL6A 5M18A 1BNGA 2JDIH 3RNTA 3CCL3 1IYYA 1GOVA 1BIRA 3EN1B 2ZA4A 3IPTA 4KFFA 3T0UA 3KE7A 2XFTA 5AI1A 4DKIA 3OWYA 3AGOA 1RJOA 3G6E3 1BVIA 1NB3I 2L1SA 2M7OA 4MMXB 3A76A 4J5GA 3CCS3 3SEDA 3NM7A 1N8R4 1JB2A 4RNZA 1ZX2A 1LQMB 1I2GA 2W0QA 2AAEA 5JBSA 1LNIA 3OX9A 1UGHI 1WNHA 1JKGA 2RNTA 3DMCA 4HZBB 2HMMB 3TDGA 1IVUA 3HIGA 5AEUB 4N6OB 1ULJB 1N9EA 3PZWA 1GY5A 3EF8A 1BUJA 3J7Yd 4K61A 3PXMA 1FGQA 5STDA 4BL3A 1NO3A 1O7GB 3S28A 3CCV3 1QAFA 4KZ1A 2UX0A 1FYSA 1BNJA 1BNIA 1JN5B 1K28A 2V1LA 3UL5A 4HM7B 1JJ22 2BO9B 1MWSA 1RDSA 3KCHA 1Q7HA 1Q9EA 1PY3A 5AIGA 1F8NA 3WMDA 4FMCA 6STDA 3LTCA 1BRJA 1ROAA 1JV2B 1UI7A 5M1AA 2W6JH 3S67A 5IG3A 1UCIA 5FW5A 1OGXA 1IV9A 3MHEA 3WODG 3X40A 2PNCA 4GSPA 1TRPA 1T2HA 4U13A 5IW9A 4K90B 4H61A 4EW5A 1GMRA 1RRLA 1IV7A 2B1XB 1AQZA 2CK3H 2ZL8A 2CX1A 1MNLA 4CDLA 2LYXA 3JUMA 3HOHA 2XH9A 1BSCA 1NNVA 5AYRB 3JVCA 4XDVA 1O7PB 1FUWA 3DY5A 3N54B 3V92A 1E97A 1GSPA 2CC3A 3UJMA 1KC84 2XGLA 1A90A 5AIFA 1JBTA 1NJI4 4MMZB 3CCJ3 5M19A 1YGEA 4Q53A 4WFOA 3G4S3 1BRGA 3EB8A 1MWRA 3D3LA 3F40A 1JB4A 1GD3A 3GZRA 3KSED 1RGLA 3ALAA 3OV4A 1X1XA 3X3YA 1BUQA 1IQXA 2A15A 1IU7A 3B7CA 4FMAA 2CFWA 1G02A 4PEJA 4ORLA 2W2CA 1SQWA 1IDPA 1OGZA 3IMAB 4IT7A 1FGTA 5IENA 4HVNA 4J5KA 1BNRA 1RGKA 1KSIA 2GEYA 3LYGA 3CNMA 1B21A 4OUQA 5KP1A 4TX4A 4GB5A 1BOXA 5D81A 1BSBA 1GD4A 4R80A 4EV2A 4N6V0 1VQ83 1M1K4 1K8A4 3V99A 2BMRB 2XGNA 2IA7A 1AV4A 1W6CA 2CX0A 1YJ93 1RN7A 2UUGC 2ZDJA 2R41A 3B4PA 3DM8A 1BRNL 1RN1A 5IG5A 3FG1A 5G1KA 3BNDA 3Q3FA 1Q40A 4O2HA 1JNQA 3MG1A 1YIT3 1RCLA 3X3ZA 1RTUA 1BRHA 4NHFA 3LH4A 1Q40B 4IIAA 4MEIA 1DMMA 1FGRA 2GU3A 3DGNA 3WOEB 1I0VA 1Q814 1TP6A 1CYVA 2O3OA 5GSPA 4ZM8A 5IG4A 3EJVA 2CG0A 1U8CB 1RCKA 4JRFA 1IT7A 3WA2X 3UB1A 4IPBA 1WTHA 3K63A 4X2OA 3S5CA 4ILFA 3D5IA 1V74A 2W03A 4N6MA 2F98A 2CIUA 1W2B2 4MMYB 2CH9A 1EUIC 3EQQB 1BNSA 9RNTA 3DZLA 1AVLA 2F5WA 1EKMA 4I4KA 1QAKA 1RGCA 3ZG5A 3CC73 1I70A 3HIIA 3FGYA 3CXC2 4HKVB 1K9M4 1Z1SA 2I9WA 3MG3A 4HJLB 3KN4A 5ELUA 3WDGB 1TU5A 4NPBA 2BNGA 2H0GA 3BB9A 1OPYA 1S723 2FNQA 1LXEA 1E3VA 1Q824 2H0HA 1VQP3 1CYUA 1I2EA 1QJGA 1V57A 3JUNA 1VQL3 1RGAA 1EQKA 2Q07A 2IUJA 3V98A 3KFQC 4KT3B 2BHMA 2H0IA 1B2SA 3VGNA 1BRIA 2KXGA 2IUKA 3WR2A 1BNEA 2ML6A 1MOLA 1FW7A 1UCLA 4R4KA 5D82A 5JPPA 2CWTA 2OQEC 2CG1A 1BSEA 2ZHXB 3L0RA 1TUHA 2RFRA 3AMOA 3NM2A 4MJDA 5IEOA 3KSPA 1IQYA 4BTYA 3D79A 3N9HA 2W9PA 2YFIB 3BNEA 4XBTA 1WQLB 1RGGA 3AMOB 3NBBA 1TTOA 3DGMA 3LMLA 1JN5A 3DUKA 1VQ43 1RGEA 2FXTA 3U1WA 1Y4KA 4FCZA 3T8UA 1UGIA 2CFKA 3X41A 4EXRA 3DXOA 5AIIA 1CEWI 2E2UA 1GOYA 4LZIA 2OQEA 4KVHA 1MGWA 4R1KA 3G0KA 1T5YA 1N9JA 1OCVA 2OWPA 2HOHA 3CME3 1JB5A 1D6ZA 3NQYA 4HM6B 3U97A 2YX9A 1QVG2 2RCDA 3DGLA 3FF0A 1BU4A 4XBXA 2F86B 1VQK3 2CFGA 4EC6A 1HKXA 2MF7A 1RN4A 2Z77A 4N6UA 1SJWA 3I0YA 4O02B 3H51A 1V58A 4LSOA 1J2BA 2GSPA 3DGYA 2HMKB 1U5OA 3LZAA 1ISKA 3EC9A 1B2UA 1RRHA 1TIJA 1W2ZA 4HM2B 1DVDA 1VQN3 3D9RA 3F14A 1YIJ3 3NQZA 4WHAA 1MWUA 4LGQA 2E2TA 1YJW3 1IVXA 2F99A 4L7KA 4N6LA 5IEPA 1SIIA 3VF1A 1RGHA 2BIRA 1VQ53 1PYLA 1PFPA 3M8CA 1SARA 3LT8A 4AKZA 3EBYA 3GZYB 3FG4A 1YVBI 1W7CA 3MYTA 1VQ63 2INXA 3BNBA 5HOHA 1N5HA 2J8XB 1KQS2 3NUVA 2QA43 1B27A 5EQLA 5CK6A 3K7CA 3LOYA 3NXJA 1FA3A 3LTAA 3K0ZA 2C4BA 1UI8A 4OK0A 5LC7A 3SLUA 3GZBA 3OWSA 3CPOA 1ZGXA 4I5QA 5HGRA 4QWTA 1STDA 1NB5I 2UGIA 2P38A 3ZFZA 2KF4A 4J9AA 2IMJA 1GMQA 3A5EA 1RKYA 2K54A 1N8QA 4CJNA 3CCE3 1M904 3MKIA 1JBSA 4L8OA 7RNTA 1JRQA 1KWIA 1A67A 2P05A 3O8YA 2O9UX 3E99A 1O7WB 2CHCA 3F8HA 1CQSA 4K1UA 2D1WA 1Q7Y4 3FG3A 1YJN3 5G2GA 3DH2A 1QALA 3FCSB 1NWWA 3HI7A 3QK9A 4KFDA 3CC23 1R4YA 1LRAA 2GEXA 7GSPA 3NHXA 1LOWA 3NBJA 2PZVA 1VQQA 3GAXA 5IG0A 3N8BA 1OHPA 2CW9A 3GSPA 2HMOB 1O7MB 3AHSA 3LTDA 1OHSA 4J8TA 2WOHA 3NBRA 4N3VA 4N6TA 2MC8A 5RNTA 1FUTA 4HM1B 3I553 3GZXB 1GY7A 3GWRA 4N6NB 3CCM3 1GYBA 5TGNA 2OOVC 2QEX3 1O7NB 1BGSA 5BXQA 1ASKA 2RBIA 4HOHA 3SYUA 3FF2A 5CF2A 3BU4A 4HAAA 3H3HA 3LXUX 3ER7A 1I3IA 3G16A 5EEOA 3FLJA 1YVSA 4BTXA 3CCQ3 1LNHA 1X1YA 1ZS7A 3LT9A 2LQVA 3SXXA 2W9QA 3T8NA 8RNTA 1WMOA 1LQGC 2KF5A 4LYLB 2OOVA 1I2FA 3Q90A 3OW22 3AGNA 1D6UA 4H3UA 2P0MA 1FUSA 4CCVA 1LVNA 3G713 1B2MA 5IERA 2CWUA 1ULIB 1US1A 3I563 1BSDA 4RNYA 5FGOA 1NDOB 1DVCA 1W02A 2XRXB 4WYKB 4BTWA 2YFLB 2K3DA 4EYCA 2XFSA
chains in the Genus database with same CATH topology
1X1XA 1B20A 1RN4A 3AHWA 4GHOA 2F56A 1B3SA 2GSPA 3DGYA 1G02A 2KF3A 1B2UA 1LOYA 2BU4A 1JBRA 3BIRA 4J5KA 1BNRA 1RGKA 1I8VA 1RSNA 2F5MA 1B21A 1BAOA 1BOXA 1UCJA 1RMSA 1BSBA 1X1UA 1TRQA 1DE3A 1RNTA 1RGHA 1AY7A 2BIRA 1PYLA 1SARA 5HOHA 1BSAA 1BRNL 1RN1A 1B27A 4BU4A 1GMPA 1HYFA 1YGWA 3Q3FA 1T2IA 5BU4A 1RCLA 1BRKA 2KF6A 1RTUA 2C4BA 1BRHA 6GSPA 2AADA 1ZGXA 1BNGA 1GOUA 3RNTA 6RNTA 1IYYA 1GOVA 1BIRA 2KF4A 1BRSA 1HZ1A 1GMQA 1I0VA 2ZA4A 3A5EA 5GSPA 1JBSA 3AGOA 1A2PA 1RCKA 7RNTA 1BVIA 3WHOA 1BNFA 1UCKA 4J5GA 1BANA 3D5IA 3D4AA 1I2GA 2AAEA 1LNIA 1I0XA 2RNTA 1BNSA 3DH2A 9RNTA 2F5WA 1RGCA 1R4YA 1LRAA 7GSPA 1YNVX 1BUJA 1I70A 1LOWA 1RLSA 1FYSA 3GSPA 1BNJA 1BNIA 3AHSA 5RNTA 1FUTA 1MGRA 1RDSA 3KCHA 1Q9EA 1PY3A 1I2EA 1B2XA 1RGFA 1RGAA 2F4YA 1BRJA 1BGSA 1I3FA 1B2SA 1UCIA 1BRIA 1FW7A 3WR2A 1BNEA 2RBIA 1UCLA 4GSPA 1LOVA 1T2HA 1TRPA 4HOHA 4RNTA 3SYUA 3BU4A 1RNBA 1BSEA 4HAAA 3URPA 1I3IA 1GMRA 1RHLA 1AQZA 1YVSA 1RGGA 1X1YA 8RNTA 1TTOA 3HOHA 1BSCA 2KF5A 1RGEA 3D5GA 1I2FA 2KAAA 3AGNA 1C54A 1FUSA 1GSPA 1B2MA 1B2ZA 1GOYA 1MGWA 1X1WA 1JBTA 1BSDA 2HOHA 1CH0A 4BIRA 5BIRA 1BRGA 1FZUA 1BU4A 2SARA 1RGLA 1DETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1X A;  1B20 A;  1RN4 A;  3AHW A;  4GHO A;  2F56 A;  1B3S A;  2GSP A;  3DGY A;  1G02 A;  2KF3 A;  1B2U A;  1LOY A;  2BU4 A;  1JBR A;  3BIR A;  4J5K A;  1BNR A;  1RGK A;  1I8V A;  1RSN A;  2F5M A;  1B21 A;  1BAO A;  1BOX A;  1UCJ A;  1RMS A;  1BSB A;  1X1U A;  1TRQ A;  1DE3 A;  1RNT A;  1RGH A;  1AY7 A;  2BIR A;  1PYL A;  1SAR A;  5HOH A;  1BSA A;  1BRN L;  1RN1 A;  1B27 A;  4BU4 A;  1GMP A;  1HYF A;  1YGW A;  3Q3F A;  1T2I A;  5BU4 A;  1RCL A;  1BRK A;  2KF6 A;  1RTU A;  2C4B A;  1BRH A;  6GSP A;  2AAD A;  1ZGX A;  1BNG A;  1GOU A;  3RNT A;  6RNT A;  1IYY A;  1GOV A;  1BIR A;  2KF4 A;  1BRS A;  1HZ1 A;  1GMQ A;  1I0V A;  2ZA4 A;  3A5E A;  5GSP A;  1JBS A;  3AGO A;  1A2P A;  1RCK A;  7RNT A;  1BVI A;  3WHO A;  1BNF A;  1UCK A;  4J5G A;  1BAN A;  3D5I A;  3D4A A;  1I2G A;  2AAE A;  1LNI A;  1I0X A;  2RNT A;  1BNS A;  3DH2 A;  9RNT A;  2F5W A;  1RGC A;  1R4Y A;  1LRA A;  7GSP A;  1YNV X;  1BUJ A;  1I70 A;  1LOW A;  1RLS A;  1FYS A;  3GSP A;  1BNJ A;  1BNI A;  3AHS A;  5RNT A;  1FUT A;  1MGR A;  1RDS A;  3KCH A;  1Q9E A;  1PY3 A;  1I2E A;  1B2X A;  1RGF A;  1RGA A;  2F4Y A;  1BRJ A;  1BGS A;  1I3F A;  1B2S A;  1UCI A;  1BRI A;  1FW7 A;  3WR2 A;  1BNE A;  2RBI A;  1UCL A;  4GSP A;  1LOV A;  1T2H A;  1TRP A;  4HOH A;  4RNT A;  3SYU A;  3BU4 A;  1RNB A;  1BSE A;  4HAA A;  3URP A;  1I3I A;  1GMR A;  1RHL A;  1AQZ A;  1YVS A;  1RGG A;  1X1Y A;  8RNT A;  1TTO A;  3HOH A;  1BSC A;  2KF5 A;  1RGE A;  3D5G A;  1I2F A;  2KAA A;  3AGN A;  1C54 A;  1FUS A;  1GSP A;  1B2M A;  1B2Z A;  1GOY A;  1MGW A;  1X1W A;  1JBT A;  1BSD A;  2HOH A;  1CH0 A;  4BIR A;  5BIR A;  1BRG A;  1FZU A;  1BU4 A;  2SAR A;  1RGL A;  1DET A; 
#chains in the Genus database with same CATH topology
 1M1X B;  3BNC A;  2P0X A;  1VZZ A;  3AHW A;  1EG9 B;  3F9S A;  1SPU A;  2Z6B A;  3HK4 A;  2P09 A;  1D6Y A;  4O8S A;  2XSH B;  3CMA 3;  1T3B A;  1LOX A;  3SX1 A;  3JUO A;  1LOY A;  3S27 A;  1JZO A;  1JBR A;  1UUW B;  3BIR A;  4O3V A;  4GL6 A;  3OWU A;  1EEJ A;  2F5M A;  3F8X A;  2KRT A;  1W4N A;  2ML5 A;  1BAO A;  1UCJ A;  4JF8 A;  1RMS A;  1OUN A;  2K0M A;  3PGB A;  4XDW A;  1W5Z A;  1A2V A;  2HMN B;  1TRQ A;  3B8L A;  4AKY A;  1DE3 A;  3UNL A;  1AY7 A;  4L8P A;  1IVW A;  2B24 B;  1NU3 A;  1UUV B;  1A2K A;  2E2V A;  8CHO A;  2C11 A;  1VQM 3;  3NX0 A;  5KP3 A;  3Q2P A;  4K1V A;  4BU4 A;  1UW1 A;  1JKG B;  1GMP A;  1HYF A;  2Y73 A;  1Q86 4;  1QMA A;  1T2I A;  1TJD A;  3SVA A;  2XR8 B;  1VQ7 3;  5BU4 A;  4FMD A;  1BRK A;  1W6G A;  1AVK A;  3G8Z A;  2RGQ A;  1W01 A;  3KII A;  2Z76 A;  3HZP A;  2AAD A;  1FGO A;  3EX9 A;  3FSD A;  3PYJ A;  5AYS C;  1GOU A;  2OTL 3;  6RNT A;  1S5A A;  1K41 A;  1BRS A;  1HZ1 A;  1EA2 A;  1M9G A;  2QIY A;  3X42 A;  2Y74 A;  5I97 A;  1A2P A;  3EBT A;  1OF5 A;  7STD A;  1TFK A;  3KKG A;  3WHO A;  1N5P A;  1BNF A;  1DMN A;  1UCK A;  1BAN A;  3F7X A;  3K5T A;  3KZT A;  2JQ5 A;  4HBR A;  4RBN A;  1SIH A;  3D4A A;  5IF6 A;  1OF5 B;  1MWT A;  1ZO2 A;  2GBX B;  5DRE A;  3SOA A;  3BLZ A;  1GY6 A;  1I0X A;  2HML B;  3CCR 3;  4KFE A;  1HU9 A;  2GBW B;  3CCU 3;  3PCR A;  4XBY A;  1PU4 A;  3JUQ A;  4X2H A;  4HM8 B;  1E3R A;  2R4I A;  1YNV X;  1OHO A;  2XF3 A;  1UDI I;  2IYJ A;  4FCM A;  1RLS A;  4LEH A;  4HYZ A;  5DRV A;  2STD A;  2XEP A;  3RGR A;  1WMP A;  1O7H B;  2HMJ B;  3CU3 A;  3RDE A;  1MGR A;  5A0O B;  3CC4 3;  2CFD A;  3FKA A;  4R9L A;  1B2X A;  1RGF A;  3QRD A;  4CPK A;  4FR9 A;  1OH0 A;  2F4Y A;  1AR0 A;  3CNX A;  1I3F A;  3X3X A;  4XM4 A;  3EE1 A;  1OAC A;  5CLK A;  5BVB A;  3LTB A;  1IVV A;  3WOF B;  2CKF B;  1LOV A;  4R9K A;  4HM0 B;  4RNT A;  1RNB A;  2WGO A;  4HM5 B;  3CD6 3;  2C10 A;  3URP A;  3FZW A;  2YFJ B;  1RHL A;  3GRD A;  5KP4 A;  3B4O A;  1WMN A;  2OTJ 3;  3DGO A;  3K9M C;  4LMI A;  1DYU A;  3MWZ A;  5D83 A;  5EVH A;  3MG2 A;  3EHC A;  3D5G A;  4OVM A;  2CWV A;  2GU1 A;  1VQO 3;  3EN8 A;  2XSO B;  2FGT A;  2KAA A;  1C54 A;  1G0T A;  1B2Z A;  3S29 A;  3ECF A;  5ELJ A;  3MPH A;  3F7S A;  5CF1 A;  1X1W A;  3HX8 A;  3ROB A;  1CH0 A;  4BIR A;  3NV0 A;  1VQ9 3;  5BIR A;  1QVF 2;  1FZU A;  1IK3 A;  3OXA A;  2SAR A;  3NV0 B;  3RGA A;  4XB5 A;  1DET A;  4BL2 A;  2BMQ B;  1B20 A;  3FH1 A;  4HM3 B;  4HZ9 B;  4GHO A;  2D42 A;  4RZM A;  5G1L A;  2F56 A;  2WGQ A;  1UUG B;  1C7H A;  1YHQ 3;  4G1M B;  5CXO A;  1B3S A;  1YI2 3;  5JPU A;  1K73 4;  1W00 A;  3ZG0 A;  5AIH A;  2CFL A;  2KF3 A;  1L5G B;  2BU4 A;  2BT3 A;  1JZD A;  2IY2 A;  1FGM A;  2W56 A;  1IQ8 A;  4WP5 A;  2OCT A;  2W04 A;  1TFO A;  4NRE A;  1G96 A;  1I8V A;  1RSN A;  4HM4 B;  2W56 B;  1STF I;  5LC6 A;  2WO0 A;  2QGU A;  1X1U A;  2WOF A;  4EV5 A;  2L4V A;  1RNT A;  3Q1C A;  4WYK A;  3VSY A;  1Q42 A;  2BMO B;  2RSX A;  1R4C A;  4FMB A;  2Z7A A;  1GS3 A;  2GXF A;  3JUP A;  3STD A;  4STD A;  4FCJ A;  1BSA A;  3MSO A;  2KCD A;  2SBL A;  3SOY A;  1W6Y A;  5AEW B;  3IJE B;  3WA3 A;  1ROV A;  1YGW A;  4WWU C;  3CPW 2;  1KD1 4;  1DMQ A;  4EBG A;  2KF6 A;  3PCS A;  3PS8 A;  1IT8 A;  6GSP A;  4AEQ A;  3UL6 A;  5M18 A;  1BNG A;  2JDI H;  3RNT A;  3CCL 3;  1IYY A;  1GOV A;  1BIR A;  3EN1 B;  2ZA4 A;  3IPT A;  4KFF A;  3T0U A;  3KE7 A;  2XFT A;  5AI1 A;  4DKI A;  3OWY A;  3AGO A;  1RJO A;  3G6E 3;  1BVI A;  1NB3 I;  2L1S A;  2M7O A;  4MMX B;  3A76 A;  4J5G A;  3CCS 3;  3SED A;  3NM7 A;  1N8R 4;  1JB2 A;  4RNZ A;  1ZX2 A;  1LQM B;  1I2G A;  2W0Q A;  2AAE A;  5JBS A;  1LNI A;  3OX9 A;  1UGH I;  1WNH A;  1JKG A;  2RNT A;  3DMC A;  4HZB B;  2HMM B;  3TDG A;  1IVU A;  3HIG A;  5AEU B;  4N6O B;  1ULJ B;  1N9E A;  3PZW A;  1GY5 A;  3EF8 A;  1BUJ A;  3J7Y d;  4K61 A;  3PXM A;  1FGQ A;  5STD A;  4BL3 A;  1NO3 A;  1O7G B;  3S28 A;  3CCV 3;  1QAF A;  4KZ1 A;  2UX0 A;  1FYS A;  1BNJ A;  1BNI A;  1JN5 B;  1K28 A;  2V1L A;  3UL5 A;  4HM7 B;  1JJ2 2;  2BO9 B;  1MWS A;  1RDS A;  3KCH A;  1Q7H A;  1Q9E A;  1PY3 A;  5AIG A;  1F8N A;  3WMD A;  4FMC A;  6STD A;  3LTC A;  1BRJ A;  1ROA A;  1JV2 B;  1UI7 A;  5M1A A;  2W6J H;  3S67 A;  5IG3 A;  1UCI A;  5FW5 A;  1OGX A;  1IV9 A;  3MHE A;  3WOD G;  3X40 A;  2PNC A;  4GSP A;  1TRP A;  1T2H A;  4U13 A;  5IW9 A;  4K90 B;  4H61 A;  4EW5 A;  1GMR A;  1RRL A;  1IV7 A;  2B1X B;  1AQZ A;  2CK3 H;  2ZL8 A;  2CX1 A;  1MNL A;  4CDL A;  2LYX A;  3JUM A;  3HOH A;  2XH9 A;  1BSC A;  1NNV A;  5AYR B;  3JVC A;  4XDV A;  1O7P B;  1FUW A;  3DY5 A;  3N54 B;  3V92 A;  1E97 A;  1GSP A;  2CC3 A;  3UJM A;  1KC8 4;  2XGL A;  1A90 A;  5AIF A;  1JBT A;  1NJI 4;  4MMZ B;  3CCJ 3;  5M19 A;  1YGE A;  4Q53 A;  4WFO A;  3G4S 3;  1BRG A;  3EB8 A;  1MWR A;  3D3L A;  3F40 A;  1JB4 A;  1GD3 A;  3GZR A;  3KSE D;  1RGL A;  3ALA A;  3OV4 A;  1X1X A;  3X3Y A;  1BUQ A;  1IQX A;  2A15 A;  1IU7 A;  3B7C A;  4FMA A;  2CFW A;  1G02 A;  4PEJ A;  4ORL A;  2W2C A;  1SQW A;  1IDP A;  1OGZ A;  3IMA B;  4IT7 A;  1FGT A;  5IEN A;  4HVN A;  4J5K A;  1BNR A;  1RGK A;  1KSI A;  2GEY A;  3LYG A;  3CNM A;  1B21 A;  4OUQ A;  5KP1 A;  4TX4 A;  4GB5 A;  1BOX A;  5D81 A;  1BSB A;  1GD4 A;  4R80 A;  4EV2 A;  4N6V 0;  1VQ8 3;  1M1K 4;  1K8A 4;  3V99 A;  2BMR B;  2XGN A;  2IA7 A;  1AV4 A;  1W6C A;  2CX0 A;  1YJ9 3;  1RN7 A;  2UUG C;  2ZDJ A;  2R41 A;  3B4P A;  3DM8 A;  1BRN L;  1RN1 A;  5IG5 A;  3FG1 A;  5G1K A;  3BND A;  3Q3F A;  1Q40 A;  4O2H A;  1JNQ A;  3MG1 A;  1YIT 3;  1RCL A;  3X3Z A;  1RTU A;  1BRH A;  4NHF A;  3LH4 A;  1Q40 B;  4IIA A;  4MEI A;  1DMM A;  1FGR A;  2GU3 A;  3DGN A;  3WOE B;  1I0V A;  1Q81 4;  1TP6 A;  1CYV A;  2O3O A;  5GSP A;  4ZM8 A;  5IG4 A;  3EJV A;  2CG0 A;  1U8C B;  1RCK A;  4JRF A;  1IT7 A;  3WA2 X;  3UB1 A;  4IPB A;  1WTH A;  3K63 A;  4X2O A;  3S5C A;  4ILF A;  3D5I A;  1V74 A;  2W03 A;  4N6M A;  2F98 A;  2CIU A;  1W2B 2;  4MMY B;  2CH9 A;  1EUI C;  3EQQ B;  1BNS A;  9RNT A;  3DZL A;  1AVL A;  2F5W A;  1EKM A;  4I4K A;  1QAK A;  1RGC A;  3ZG5 A;  3CC7 3;  1I70 A;  3HII A;  3FGY A;  3CXC 2;  4HKV B;  1K9M 4;  1Z1S A;  2I9W A;  3MG3 A;  4HJL B;  3KN4 A;  5ELU A;  3WDG B;  1TU5 A;  4NPB A;  2BNG A;  2H0G A;  3BB9 A;  1OPY A;  1S72 3;  2FNQ A;  1LXE A;  1E3V A;  1Q82 4;  2H0H A;  1VQP 3;  1CYU A;  1I2E A;  1QJG A;  1V57 A;  3JUN A;  1VQL 3;  1RGA A;  1EQK A;  2Q07 A;  2IUJ A;  3V98 A;  3KFQ C;  4KT3 B;  2BHM A;  2H0I A;  1B2S A;  3VGN A;  1BRI A;  2KXG A;  2IUK A;  3WR2 A;  1BNE A;  2ML6 A;  1MOL A;  1FW7 A;  1UCL A;  4R4K A;  5D82 A;  5JPP A;  2CWT A;  2OQE C;  2CG1 A;  1BSE A;  2ZHX B;  3L0R A;  1TUH A;  2RFR A;  3AMO A;  3NM2 A;  4MJD A;  5IEO A;  3KSP A;  1IQY A;  4BTY A;  3D79 A;  3N9H A;  2W9P A;  2YFI B;  3BNE A;  4XBT A;  1WQL B;  1RGG A;  3AMO B;  3NBB A;  1TTO A;  3DGM A;  3LML A;  1JN5 A;  3DUK A;  1VQ4 3;  1RGE A;  2FXT A;  3U1W A;  1Y4K A;  4FCZ A;  3T8U A;  1UGI A;  2CFK A;  3X41 A;  4EXR A;  3DXO A;  5AII A;  1CEW I;  2E2U A;  1GOY A;  4LZI A;  2OQE A;  4KVH A;  1MGW A;  4R1K A;  3G0K A;  1T5Y A;  1N9J A;  1OCV A;  2OWP A;  2HOH A;  3CME 3;  1JB5 A;  1D6Z A;  3NQY A;  4HM6 B;  3U97 A;  2YX9 A;  1QVG 2;  2RCD A;  3DGL A;  3FF0 A;  1BU4 A;  4XBX A;  2F86 B;  1VQK 3;  2CFG A;  4EC6 A;  1HKX A;  2MF7 A;  1RN4 A;  2Z77 A;  4N6U A;  1SJW A;  3I0Y A;  4O02 B;  3H51 A;  1V58 A;  4LSO A;  1J2B A;  2GSP A;  3DGY A;  2HMK B;  1U5O A;  3LZA A;  1ISK A;  3EC9 A;  1B2U A;  1RRH A;  1TIJ A;  1W2Z A;  4HM2 B;  1DVD A;  1VQN 3;  3D9R A;  3F14 A;  1YIJ 3;  3NQZ A;  4WHA A;  1MWU A;  4LGQ A;  2E2T A;  1YJW 3;  1IVX A;  2F99 A;  4L7K A;  4N6L A;  5IEP A;  1SII A;  3VF1 A;  1RGH A;  2BIR A;  1VQ5 3;  1PYL A;  1PFP A;  3M8C A;  1SAR A;  3LT8 A;  4AKZ A;  3EBY A;  3GZY B;  3FG4 A;  1YVB I;  1W7C A;  3MYT A;  1VQ6 3;  2INX A;  3BNB A;  5HOH A;  1N5H A;  2J8X B;  1KQS 2;  3NUV A;  2QA4 3;  1B27 A;  5EQL A;  5CK6 A;  3K7C A;  3LOY A;  3NXJ A;  1FA3 A;  3LTA A;  3K0Z A;  2C4B A;  1UI8 A;  4OK0 A;  5LC7 A;  3SLU A;  3GZB A;  3OWS A;  3CPO A;  1ZGX A;  4I5Q A;  5HGR A;  4QWT A;  1STD A;  1NB5 I;  2UGI A;  2P38 A;  3ZFZ A;  2KF4 A;  4J9A A;  2IMJ A;  1GMQ A;  3A5E A;  1RKY A;  2K54 A;  1N8Q A;  4CJN A;  3CCE 3;  1M90 4;  3MKI A;  1JBS A;  4L8O A;  7RNT A;  1JRQ A;  1KWI A;  1A67 A;  2P05 A;  3O8Y A;  2O9U X;  3E99 A;  1O7W B;  2CHC A;  3F8H A;  1CQS A;  4K1U A;  2D1W A;  1Q7Y 4;  3FG3 A;  1YJN 3;  5G2G A;  3DH2 A;  1QAL A;  3FCS B;  1NWW A;  3HI7 A;  3QK9 A;  4KFD A;  3CC2 3;  1R4Y A;  1LRA A;  2GEX A;  7GSP A;  3NHX A;  1LOW A;  3NBJ A;  2PZV A;  1VQQ A;  3GAX A;  5IG0 A;  3N8B A;  1OHP A;  2CW9 A;  3GSP A;  2HMO B;  1O7M B;  3AHS A;  3LTD A;  1OHS A;  4J8T A;  2WOH A;  3NBR A;  4N3V A;  4N6T A;  2MC8 A;  5RNT A;  1FUT A;  4HM1 B;  3I55 3;  3GZX B;  1GY7 A;  3GWR A;  4N6N B;  3CCM 3;  1GYB A;  5TGN A;  2OOV C;  2QEX 3;  1O7N B;  1BGS A;  5BXQ A;  1ASK A;  2RBI A;  4HOH A;  3SYU A;  3FF2 A;  5CF2 A;  3BU4 A;  4HAA A;  3H3H A;  3LXU X;  3ER7 A;  1I3I A;  3G16 A;  5EEO A;  3FLJ A;  1YVS A;  4BTX A;  3CCQ 3;  1LNH A;  1X1Y A;  1ZS7 A;  3LT9 A;  2LQV A;  3SXX A;  2W9Q A;  3T8N A;  8RNT A;  1WMO A;  1LQG C;  2KF5 A;  4LYL B;  2OOV A;  1I2F A;  3Q90 A;  3OW2 2;  3AGN A;  1D6U A;  4H3U A;  2P0M A;  1FUS A;  4CCV A;  1LVN A;  3G71 3;  1B2M A;  5IER A;  2CWU A;  1ULI B;  1US1 A;  3I56 3;  1BSD A;  4RNY A;  5FGO A;  1NDO B;  1DVC A;  1W02 A;  2XRX B;  4WYK B;  4BTW A;  2YFL B;  2K3D A;  4EYC A;  2XFS A; 
#chains in the Genus database with same CATH homology
 1X1X A;  1B20 A;  1RN4 A;  3AHW A;  4GHO A;  2F56 A;  1B3S A;  2GSP A;  3DGY A;  1G02 A;  2KF3 A;  1B2U A;  1LOY A;  2BU4 A;  1JBR A;  3BIR A;  4J5K A;  1BNR A;  1RGK A;  1I8V A;  1RSN A;  2F5M A;  1B21 A;  1BAO A;  1BOX A;  1UCJ A;  1RMS A;  1BSB A;  1X1U A;  1TRQ A;  1DE3 A;  1RNT A;  1RGH A;  1AY7 A;  2BIR A;  1PYL A;  1SAR A;  5HOH A;  1BSA A;  1BRN L;  1RN1 A;  1B27 A;  4BU4 A;  1GMP A;  1HYF A;  1YGW A;  3Q3F A;  1T2I A;  5BU4 A;  1RCL A;  1BRK A;  2KF6 A;  1RTU A;  2C4B A;  1BRH A;  6GSP A;  2AAD A;  1ZGX A;  1BNG A;  1GOU A;  3RNT A;  6RNT A;  1IYY A;  1GOV A;  1BIR A;  2KF4 A;  1BRS A;  1HZ1 A;  1GMQ A;  1I0V A;  2ZA4 A;  3A5E A;  5GSP A;  1JBS A;  3AGO A;  1A2P A;  1RCK A;  7RNT A;  1BVI A;  3WHO A;  1BNF A;  1UCK A;  4J5G A;  1BAN A;  3D5I A;  3D4A A;  1I2G A;  2AAE A;  1LNI A;  1I0X A;  2RNT A;  1BNS A;  3DH2 A;  9RNT A;  2F5W A;  1RGC A;  1R4Y A;  1LRA A;  7GSP A;  1YNV X;  1BUJ A;  1I70 A;  1LOW A;  1RLS A;  1FYS A;  3GSP A;  1BNJ A;  1BNI A;  3AHS A;  5RNT A;  1FUT A;  1MGR A;  1RDS A;  3KCH A;  1Q9E A;  1PY3 A;  1I2E A;  1B2X A;  1RGF A;  1RGA A;  2F4Y A;  1BRJ A;  1BGS A;  1I3F A;  1B2S A;  1UCI A;  1BRI A;  1FW7 A;  3WR2 A;  1BNE A;  2RBI A;  1UCL A;  4GSP A;  1LOV A;  1T2H A;  1TRP A;  4HOH A;  4RNT A;  3SYU A;  3BU4 A;  1RNB A;  1BSE A;  4HAA A;  3URP A;  1I3I A;  1GMR A;  1RHL A;  1AQZ A;  1YVS A;  1RGG A;  1X1Y A;  8RNT A;  1TTO A;  3HOH A;  1BSC A;  2KF5 A;  1RGE A;  3D5G A;  1I2F A;  2KAA A;  3AGN A;  1C54 A;  1FUS A;  1GSP A;  1B2M A;  1B2Z A;  1GOY A;  1MGW A;  1X1W A;  1JBT A;  1BSD A;  2HOH A;  1CH0 A;  4BIR A;  5BIR A;  1BRG A;  1FZU A;  1BU4 A;  2SAR A;  1RGL A;  1DET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...