1JKGA

Structural basis for the recognition of a nucleoporin fg-repeat by the ntf2-like domain of tap-p15 mrna nuclear export factor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
ASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords p15
publication title Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jkgA00
1HKXA 2GBXB 5CLKA 1TP6A 4L8PA 4R9KA 2GEYA 5IF6A 1OH0A 1UUWB 5IG0A 2HMKB 1O7WB 2YFIB 4LMIA 4R1KA 2HMOB 5KP3A 3F14A 3M8CA 3UNLA 3MG3A 1O7NB 1GY7A 5AIGA 5KP1A 1GY6A 3EN1B 3FKAA 1AR0A 5AIHA 3OXAA 3ROBA 3FH1A 3KZTA 1OGZA 2HMNB 3JUPA 2RGQA 1OCVA 5IERA 1E97A 4WYKA 5JPUA 3MKIA 1OPYA 3EQQB 3SEDA 4WP5A 5IG5A 3CNMA 3EC9A 3BB9A 2CHCA 5FW5A 3T8NA 1ZX2A 2OWPA 1Z1SA 3KKGA 3S5CA 3H51A 1ISKA 2STDA 4HZBB 1IDPA 4HM0B 3FGYA 3OX9A 4HM8B 3CPOA 1U5OA 2XRXB 2Z76A 2XR8B 3RGRA 4HJLB 1E3VA 4XDVA 7STDA 3EBTA 1JN5B 4HM3B 4LGQA 3UJMA 4HM6B 2K54A 3NM2A 3VSYA 3GZYB 3SOAA 3HZPA 1JKGB 2QIYA 5CF1A 1NDOB 3FF2A 3NBRA 1NWWA 3B4OA 4KVHA 1ULJB 2YFLB 2HMJB 5EVHA 1VZZA 1K41A 1A2KA 2BMOB 5AI1A 1JN5A 3SOYA 1S5AA 1OF5A 4IIAA 2CKFB 3F40A 4HM2B 3ECFA 1OHSA 3LZAA 3KSPA 4X2OA 1ZO2A 5DREA 3FSDA 2A15A 4HM4B 3HX8A 2BMQB 1CQSA 1Q42A 4LEHA 1GYBA 2B1XB 2F86B 3I0YA 2HMMB 5KP4A 4OUQA 2I9WA 2QGUA 3MG1A 1JB4A 4R9LA 2IMJA 3E99A 5IEPA 3NHXA 4XDWA 4HM1B 5JPPA 3G16A 1W00A 3EF8A 3CNXA 3G0KA 4ORLA 5AEUB 8CHOA 5TGNA 3DXOA 5DRVA 1OGXA 1DMMA 3VGNA 1O7GB 1QJGA 3STDA 4U13A 5IG4A 3B8LA 4HZ9B 2XSHB 4L8OA 5D81A 3F8XA 5CXOA 4XB5A 1DMNA 4GB5A 1EG9B 1WQLB 3FZWA 2Z7AA 4MJDA 4X2HA 5AIIA 3WMDA 1O7HB 2GEXA 3Q90A 3NXJA 3LYGA 3MSOA 5HGRA 4I4KA 1E3RA 1W01A 1JB5A 5AEWB 3BLZA 1OUNA 4HKVB 4STDA 3F8HA 5CK6A 4HVNA 1ASKA 3F7SA 4FCMA 2UX0A 3GZBA 5IENA 4XM4A 3HK4A 4FCJA 2HMLB 3OV4A 1STDA 2W2CA 3EX9A 4L7KA 3GZRA 3DZLA 4H3UA 5IG3A 4XBTA 3F9SA 1W6YA 1JKGA 5STDA 2GXFA 3MHEA 1GS3A 4Q53A 3DMCA 2BMRB 3NUVA 2JQ5A 2GBWB 3DUKA 4J8TA 3GWRA 2R4IA 1EA2A 1JB2A 3K7CA 3JUQA 5BXQA 3ER7A 2XSOB 4WYKB 1SJWA 3EHCA 3NV0B 3MYTA 5BVBA 3F7XA 1ULIB 4CDLA 3B4PA 3A76A 2F99A 2YFJB 1Q40B 1UUVB 3EN8A 1QMAA 3OWUA 2INXA 6STDA 3NV0A 2F98A 4N3VA 1DMQA 2BNGA 1OHOA 3OWSA 4XBXA 5D82A 2RFRA 4HM5B 1W02A 3IPTA 1C7HA 3FF0A 3K0ZA 1Q40A 4K1UA 3KE7A 3RGAA 4WWUC 3GRDA 3CU3A 3H3HA 2PZVA 1O7MB 3DM8A 5IEOA 1NU3A 2B24B 1OHPA 3GZXB 4K1VA 3B7CA 5AIFA 3D9RA 4HM7B 1TUHA 5D83A 1O7PB 4J9AA 3T8UA 3FLJA 4PEJA 3JUNA 1OF5B 4XBYA 2Z77A 1GY5A 2RCDA 5CF2A 1BUQA 4OVMA 3OWYA 3G8ZA 5G2GA 4RZMA 3JUOA 3JUMA 3MG2A 3EBYA 3EJVA
chains in the Genus database with same CATH superfamily
1HKXA 2P0MA 3CCU3 3D79A 3SVAA 1Y4KA 8RNTA 1MGRA 1D6UA 3S27A 1VQQA 3BIRA 2GBXB 2SBLA 3DGLA 5CLKA 4RNTA 1TP6A 3N54B 1KSIA 2RSXA 2IY2A 2GEYA 4IPBA 4L8PA 4R9KA 2BIRA 3DH2A 3ZG5A 5IF6A 1OH0A 1UUWB 3L0RA 1C54A 1LNIA 1QALA 3AGNA 2WO0A 1YJW3 5IG0A 1DYUA 2PNCA 4O3VA 4WHAA 4IT7A 2UGIA 1ZGXA 2HMKB 2E2UA 1O7WB 2YFIB 1X1XA 4KFEA 2LYXA 4LMIA 4R1KA 3LTCA 1ROVA 2HMOB 1TRQA 3NQYA 3KN4A 5KP3A 1AVLA 1FGQA 3F14A 3M8CA 3NBBA 3UNLA 3FCSB 3MG3A 3CD63 1O7NB 1GY7A 1B2MA 1FA3A 2XGLA 1BRGA 1VQO3 3X41A 5AIGA 1BNSA 1M1K4 3T0UA 1GY6A 5KP1A 3EN1B 2RBIA 2CW9A 2WGOA 3CC73 2BU4A 3ALAA 3FKAA 2CWTA 1Q864 1N9JA 1Q9EA 3S28A 1AR0A 5AIHA 1W7CA 2CWVA 4MMYB 1FZUA 1Q7HA 3OXAA 4FMDA 3LH4A 1BSAA 1LQGC 3UL6A 3ROBA 4EV2A 4FMAA 4R4KA 4EBGA 1M9GA 3FH1A 1B20A 2FNQA 2P09A 3KZTA 1R4CA 5G1KA 2CK3H 1OGZA 4LYLB 5LC6A 1F8NA 1IT7A 5RNTA 2HMNB 3DGYA 3JUPA 2C4BA 3HI7A 4TX4A 4KZ1A 4N6TA 4GSPA 2RGQA 4HOHA 1OCVA 3V99A 5IERA 4CJNA 1SIIA 3S29A 1E97A 2H0GA 4WYKA 3BNBA 2Y73A 1S723 1EKMA 5JPUA 2IYJA 3MKIA 1RNBA 1N9EA 4HBRA 3K5TA 3PXMA 1BNJA 1OPYA 1OACA 3LXUX 4NHFA 2GU1A 4O2HA 3EQQB 1I0VA 3SEDA 3J7Yd 3DGMA 3HOHA 4WP5A 1ZS7A 1FGTA 5IG5A 3KIIA 3CNMA 2XEPA 3BB9A 3EC9A 3UL5A 2CHCA 2MF7A 5FW5A 1B21A 3T8NA 1RLSA 3SYUA 1ZX2A 2OWPA 1BU4A 2V1LA 1Z1SA 2L4VA 3DGNA 2OOVC 3NQZA 4N6LA 2OQEA 1W2B2 1BRNL 1JJ22 1BNFA 3KKGA 3TDGA 2KRTA 3BU4A 3S5CA 3WA3A 1SIHA 3H51A 1B2UA 1UGHI 3WOFB 1I2GA 1ISKA 2STDA 4HZBB 2W0QA 2F56A 1KQS2 1B27A 5I97A 1IDPA 4AEQA 4HM0B 1MWSA 1GOYA 3AHWA 3FGYA 1V57A 3OX9A 4HM8B 1FGMA 3CPOA 3URPA 2XH9A 3FG4A 2CFLA 1U5OA 3X3XA 2XRXB 1IT8A 2P05A 1LVNA 2Z76A 3CXC2 2YX9A 1EQKA 1BANA 1NO3A 2XR8B 3RGRA 1TIJA 3WDGB 1WNHA 4HJLB 1ROAA 1IQYA 1NB3I 1WTHA 2K0MA 4H61A 1GMPA 2CX0A 1E3VA 4XDVA 7STDA 1BNRA 1RGAA 3EBTA 2CG0A 1A2VA 2SARA 4BTYA 4O8SA 2RNTA 2WOHA 1JN5B 2E2VA 2FGTA 4HM3B 1G96A 1RMSA 4LGQA 1TFKA 1BNGA 5AYSC 3CCL3 3UJMA 1NJI4 4HM6B 2K54A 1FGRA 3KFQC 2OQEC 3NM2A 4N6UA 1K734 3VF1A 2Y74A 3GZYB 1BRSA 3SOAA 3VSYA 3HZPA 1IYYA 3WHOA 1JKGB 5A0OB 2QIYA 5CF1A 2D42A 2W9QA 1NDOB 3FF2A 3PS8A 1AVKA 3GSPA 3Q1CA 3HIIA 4J5KA 4JRFA 3G713 1CYUA 1BGSA 3NBRA 1BNIA 1YJN3 1KC84 1GMQA 1NWWA 2KF5A 3BNEA 2AADA 1RGKA 3B4OA 3ZFZA 1JZOA 4KVHA 1ULJB 1YVBI 3D4AA 1VQK3 2YFLB 3QRDA 2O3OA 2HMJB 5EVHA 1BAOA 1VZZA 2OCTA 4MMZB 1K41A 4BL3A 4NREA 2XFSA 1A2KA 2BMOB 1DVDA 2GU3A 1LOYA 2BT3A 2O9UX 1JN5A 2CIUA 2W56B 1BNEA 1TJDA 3K9MC 1IQ8A 1UW1A 3SOYA 1S5AA 4RBNA 1VQ53 4HAAA 1IQXA 2HOHA 1OF5A 1PFPA 3LOYA 3PZWA 4IIAA 1HU9A 2CKFB 3F40A 3EB8A 6GSPA 1BRJA 1MOLA 4HM2B 3SXXA 3ECFA 1OHSA 1BOXA 3LZAA 3KSPA 4X2OA 2JDIH 1ZO2A 2GSPA 2W03A 5DREA 1RKYA 4EW5A 3UB1A 3FSDA 1YI23 2L1SA 1G0TA 4HYZA 2A15A 1AQZA 1PY3A 1WMPA 3HX8A 3JVCA 4HM4B 1QAFA 1RRLA 1CEWI 2BMQB 1CQSA 1Q42A 3EE1A 4LEHA 1GYBA 1LOWA 1B2ZA 1I2FA 2B1XB 2F86B 3FG1A 3I0YA 2HMMB 3PGBA 4KT3B 1YJ93 3KSED 5KP4A 4OUQA 3AMOB 2ML6A 1NB5I 1GD4A 1FUWA 2I9WA 2QGUA 1GMRA 3MG1A 2OOVA 1GSPA 1JB4A 4N6NB 4EXRA 1AY7A 4R9LA 2IMJA 3E99A 3LT9A 2WGQA 5IEPA 2ML5A 1GD3A 4FCZA 3NHXA 5EEOA 4XDWA 4HM1B 5JPPA 1T2HA 3G16A 1YHQ3 2CFKA 4BU4A 1RGCA 4QWTA 1MGWA 1W00A 1W6GA 5AI1A 3NX0A 3EF8A 3O8YA 4CPKA 3CCM3 3CNXA 3G0KA 1KD14 4ORLA 3G6E3 1VQ83 5AEUB 8CHOA 3DGOA 3V98A 1YIT3 1UI8A 1HZ1A 5TGNA 1B3SA 1YNVX 3DXOA 5DRVA 3Q2PA 3U1WA 1OGXA 1DMMA 1X1UA 3VGNA 1J2BA 1JNQA 1TTOA 3AMOA 1KWIA 1O7GB 2F4YA 1VQL3 1QJGA 3STDA 1N5PA 2XGNA 4WFOA 1R4YA 4U13A 3RDEA 1D6YA 4LSOA 2CH9A 5IG4A 3CME3 3B8LA 1MWUA 4FMCA 4HZ9B 1HYFA 2XSHB 2CG1A 7RNTA 4L8OA 5D81A 1RCLA 3F8XA 5CXOA 4XB5A 1DMNA 4BTXA 1RGFA 1U8CB 2CFWA 1WMOA 1A67A 1RN7A 5BIRA 4GB5A 1EG9B 2ZL8A 1X1YA 1WQLB 3X3YA 3FZWA 1IK3A 2Z7AA 4MJDA 4X2HA 5AIIA 3WMDA 1K8A4 2CC3A 1VQ93 1O7HB 4BTWA 2CFGA 2GEXA 3Q90A 3NXJA 4GHOA 1V58A 2C11A 1LRAA 1W6CA 1X1WA 4BIRA 4N6V0 3LYGA 4DKIA 2F5WA 2QA43 2LQVA 1W5ZA 3WR2A 4N6MA 3MSOA 5HGRA 5BU4A 1QAKA 1UUGB 4I4KA 3IMAB 1E3RA 1W01A 2C10A 5JBSA 4G1MB 2KXGA 1JB5A 1JZDA 5AEWB 5ELUA 4ZM8A 3BLZA 2CWUA 4BL2A 1N8QA 1OUNA 4HKVB 3PYJA 4STDA 1VQP3 2K3DA 3F8HA 3GAXA 4AKYA 1N5HA 4LZIA 5G1LA 5CK6A 4RNZA 4HVNA 1ASKA 3F7SA 4FCMA 4RNYA 3NBJA 1VQ63 3CCV3 2UX0A 5M1AA 1LOXA 3GZBA 1CH0A 1BRKA 5IENA 1Q814 3SX1A 1VQ43 1GOVA 1STFI 4XM4A 3HK4A 4JF8A 1FGOA 2M7OA 4FCJA 1QVG2 2HMLB 3OV4A 3I563 1RTUA 1STDA 1YGEA 2W2CA 3EX9A 3LTDA 3MWZA 2CFDA 4L7KA 4CCVA 3GZRA 1RN1A 9RNTA 3DZLA 1RGGA 3MPHA 1TRPA 1YVSA 3BNDA 3N9HA 1EEJA 4H3UA 3WA2X 4AKZA 2BHMA 1BIRA 5IG3A 1DE3A 4XBTA 1UDII 3F9SA 3N8BA 3DY5A 1W6YA 1UGIA 4NPBA 1JBRA 1JKGA 1PU4A 5STDA 2KF6A 2KF4A 2UUGC 3AHSA 2GXFA 2ZHXB 6RNTA 1BSCA 2QEX3 1YIJ3 1IVUA 3ZG0A 3CMA3 1A2PA 1WMNA 3MHEA 1BSBA 1GS3A 1JRQA 4Q53A 3DMCA 4J5GA 5IW9A 1VQ73 1VQN3 1IVXA 4R80A 2CX1A 5LC7A 3CCE3 1M1XB 1RJOA 2BMRB 2ZA4A 3NUVA 3CCR3 2JQ5A 1N8R4 4K90B 2F5MA 2GBWB 3D5IA 3DUKA 2IA7A 1LXEA 5EQLA 4J8TA 3HIGA 2W56A 3GWRA 1JBSA 3WOEB 1BUJA 2R4IA 3G4S3 1EA2A 1FYSA 1JB2A 3K7CA 4EYCA 1MNLA 1T3BA 3JUQA 5BXQA 1RDSA 1SARA 3ER7A 2XSOB 2AAEA 4KFDA 2IUJA 3LTAA 1SJWA 4WYKB 3EHCA 1B2SA 3NV0B 3MYTA 5AYRB 5BVBA 1IVVA 3F7XA 1VQM3 1ULIB 1T2IA 4O02B 4CDLA 2XFTA 1G02A 2J8XB 1I70A 1LQMB 3D3LA 1L5GB 1RSNA 3B4PA 1I3FA 3A76A 2KF3A 4MEIA 3CPW2 1JBTA 2F99A 3CCQ3 3WODG 1GOUA 2YFJB 1Q40B 1Q824 1UUVB 3CC43 1LNHA 4EC6A 2BO9B 1US1A 3EN8A 5M19A 1M904 1SPUA 4KFFA 3OW22 5ELJA 1QMAA 3OWUA 3S67A 2INXA 1RGEA 1RGLA 2Q07A 4ILFA 6STDA 3V92A 4FMBA 3NV0A 2F98A 1BSDA 2H0HA 1D6ZA 3AGOA 1RRHA 4N3VA 1DMQA 1JV2B 1UCIA 2BNGA 1OHOA 2Z6BA 3KCHA 3OWSA 4XBXA 5D82A 2RFRA 4HM5B 1DETA 3PCRA 1W02A 2D1WA 3IPTA 2IUKA 4MMXB 3CC23 3FG3A 3CCJ3 1Q7Y4 3K63A 1BRHA 1C7HA 1SQWA 1I8VA 3FF0A 1DVCA 3LT8A 5GSPA 1IU7A 3D5GA 3K0ZA 1YGWA 2KCDA 3Q3FA 1UCKA 1EUIC 1Q40A 4K1UA 3KE7A 3RGAA 2WOFA 1RCKA 4WWUC 4FR9A 1FUSA 1RN4A 3NM7A 1T5YA 1I3IA 1I0XA 3GRDA 1QVF2 4K61A 3RNTA 3CU3A 4I5QA 1BSEA 1V74A 4N6OB 3LTBA 2P38A 3PCSA 3H3HA 1BVIA 1W4NA 1MWRA 1LOVA 2PZVA 1O7MB 1UCJA 4EV5A 3U97A 5M18A 1CYVA 3BNCA 3I553 2E2TA 1MWTA 1RHLA 1IV7A 3DM8A 5IEOA 1NU3A 2B24B 2W6JH 1OHPA 1FW7A 1I2EA 3GZXB 4K1VA 3CCS3 1B2XA 3X3ZA 3B7CA 2KAAA 3SLUA 2FXTA 4OK0A 5AIFA 3X42A 3X40A 1RGHA 3D9RA 1K28A 1BRIA 4HM7B 1RNTA 1TUHA 5D83A 1IVWA 3IJEB 2W04A 1K9M4 1O7PB 2XF3A 4J9AA 3T8UA 3A5EA 2ZDJA 3FLJA 1IV9A 3LMLA 5HOHA 4PEJA 1UCLA 3QK9A 1PYLA 3JUNA 1A90A 1OF5B 4XBYA 2Z77A 1GY5A 2R41A 2RCDA 2H0IA 5CF2A 1BUQA 1AV4A 1FUTA 1W2ZA 4OVMA 3OWYA 3G8ZA 1TU5A 2OTL3 5G2GA 4RZMA 2MC8A 2OTJ3 1UI7A 3JUOA 4GL6A 2P0XA 3JUMA 7GSPA 1NNVA 2W9PA 3MG2A 5FGOA 3EBYA 3EJVA 1TFOA
chains in the Genus database with same CATH topology
1HKXA 2P0MA 3CCU3 3SVAA 1Y4KA 1D6UA 3S27A 2GBXB 2SBLA 3DGLA 5CLKA 1TP6A 3N54B 1KSIA 2RSXA 4IPBA 2GEYA 4L8PA 4R9KA 5IF6A 1OH0A 1UUWB 3L0RA 1QALA 2WO0A 1YJW3 5IG0A 1DYUA 2PNCA 4O3VA 4WHAA 4IT7A 2HMKB 2E2UA 1O7WB 2YFIB 4KFEA 2LYXA 4LMIA 4R1KA 3LTCA 1ROVA 2HMOB 3NQYA 3KN4A 5KP3A 1AVLA 1FGQA 3F14A 3M8CA 3NBBA 3UNLA 3FCSB 3MG3A 3CD63 1O7NB 1GY7A 1FA3A 2XGLA 1VQO3 3X41A 5AIGA 1M1K4 3T0UA 1GY6A 5KP1A 3EN1B 2WGOA 2CW9A 3CC73 3ALAA 3FKAA 2CWTA 1Q864 1N9JA 3S28A 1AR0A 5AIHA 1W7CA 2CWVA 4MMYB 3OXAA 4FMDA 3LH4A 4EV2A 3UL6A 3ROBA 4FMAA 4R4KA 4EBGA 1M9GA 3FH1A 2FNQA 2P09A 3KZTA 1R4CA 2CK3H 1OGZA 5LC6A 1F8NA 1IT7A 2HMNB 3JUPA 3HI7A 4TX4A 4KZ1A 4N6TA 2RGQA 1OCVA 3V99A 5IERA 1SIIA 3S29A 1E97A 4WYKA 3BNBA 2Y73A 1S723 1EKMA 5JPUA 3MKIA 1N9EA 4HBRA 3K5TA 3PXMA 1OPYA 1OACA 3LXUX 4NHFA 2GU1A 4O2HA 3EQQB 3J7Yd 3SEDA 3DGMA 4WP5A 1FGTA 5IG5A 3KIIA 3CNMA 2XEPA 3BB9A 3EC9A 3UL5A 2CHCA 2MF7A 5FW5A 3T8NA 1ZX2A 2OWPA 2V1LA 1Z1SA 2L4VA 3DGNA 2OOVC 3NQZA 4N6LA 2OQEA 1W2B2 1JJ22 3KKGA 3TDGA 2KRTA 3S5CA 3WA3A 1SIHA 3H51A 3WOFB 1ISKA 2STDA 4HZBB 2W0QA 1KQS2 5I97A 1IDPA 4AEQA 4HM0B 3FGYA 3OX9A 4HM8B 1FGMA 3CPOA 2XH9A 3FG4A 2CFLA 1U5OA 3X3XA 2XRXB 1IT8A 2P05A 1LVNA 2Z76A 3CXC2 2YX9A 1EQKA 2XR8B 1NO3A 3RGRA 1TIJA 3WDGB 1WNHA 4HJLB 1ROAA 1IQYA 1NB3I 1WTHA 2K0MA 4H61A 1E3VA 4XDVA 7STDA 3EBTA 2CG0A 1A2VA 4BTYA 4O8SA 2WOHA 1JN5B 2E2VA 2FGTA 4HM3B 1G96A 4LGQA 1TFKA 5AYSC 3CCL3 3UJMA 1NJI4 4HM6B 2K54A 1FGRA 3KFQC 2OQEC 3NM2A 4N6UA 1K734 3VF1A 2Y74A 3GZYB 3SOAA 3VSYA 3HZPA 1JKGB 5A0OB 2QIYA 5CF1A 2D42A 2W9QA 1NDOB 3FF2A 3PS8A 1AVKA 3Q1CA 4JRFA 3HIIA 3G713 1CYUA 3NBRA 1YJN3 1KC84 1NWWA 3BNEA 3B4OA 4KVHA 1ULJB 1YVBI 1VQK3 2YFLB 3QRDA 2O3OA 2HMJB 5EVHA 1VZZA 2OCTA 4MMZB 1K41A 4NREA 2XFSA 1A2KA 2BMOB 1DVDA 2GU3A 2BT3A 5AI1A 2O9UX 1JN5A 2CIUA 2W56B 3SOYA 3K9MC 1IQ8A 1UW1A 1S5AA 4RBNA 1VQ53 1IQXA 1OF5A 1PFPA 3LOYA 3PZWA 4IIAA 1HU9A 2CKFB 3F40A 3EB8A 1MOLA 4HM2B 3SXXA 3ECFA 1OHSA 3LZAA 3KSPA 4X2OA 2JDIH 1ZO2A 2W03A 5DREA 1RKYA 3UB1A 3FSDA 1YI23 4HYZA 2A15A 4HM4B 1WMPA 3HX8A 3JVCA 1QAFA 1RRLA 1CEWI 2BMQB 1CQSA 1Q42A 3EE1A 4LEHA 1GYBA 2B1XB 2F86B 3FG1A 3I0YA 2HMMB 3PGBA 1YJ93 3KSED 5KP4A 4OUQA 3AMOB 2ML6A 1NB5I 1GD4A 1FUWA 2I9WA 2QGUA 3MG1A 2OOVA 1JB4A 4N6NB 4EXRA 4R9LA 2IMJA 3E99A 3LT9A 2WGQA 5IEPA 2ML5A 1GD3A 4FCZA 3NHXA 5EEOA 4XDWA 4HM1B 5JPPA 3G16A 1YHQ3 2CFKA 4QWTA 1W00A 1W6GA 3NX0A 3EF8A 3O8YA 3CCM3 3CNXA 3G0KA 1KD14 4ORLA 3G6E3 1VQ83 5AEUB 8CHOA 3DGOA 3V98A 1YIT3 1UI8A 5TGNA 3U1WA 3DXOA 5DRVA 3Q2PA 1OGXA 1DMMA 1J2BA 3VGNA 1JNQA 3AMOA 1KWIA 1O7GB 1VQL3 1QJGA 3STDA 2XGNA 1N5PA 4WFOA 4U13A 3RDEA 1D6YA 4LSOA 2CH9A 5IG4A 3CME3 3B8LA 4FMCA 2CG1A 4HZ9B 2XSHB 4L8OA 5D81A 3F8XA 5CXOA 4XB5A 1DMNA 4BTXA 1U8CB 2CFWA 1WMOA 1A67A 1RN7A 4GB5A 1EG9B 2ZL8A 1WQLB 3X3YA 3FZWA 1IK3A 2Z7AA 4MJDA 4X2HA 5AIIA 3WMDA 1K8A4 2CC3A 1VQ93 1O7HB 4BTWA 2CFGA 2GEXA 3Q90A 3NXJA 2C11A 1W6CA 4N6V0 3LYGA 2QA43 2LQVA 1W5ZA 4N6MA 3MSOA 5HGRA 1QAKA 4I4KA 3IMAB 1E3RA 1W01A 2C10A 5JBSA 4G1MB 2KXGA 1JB5A 5AEWB 5ELUA 4ZM8A 3BLZA 2CWUA 1N8QA 1OUNA 4HKVB 3PYJA 4STDA 1VQP3 3F8HA 3GAXA 4AKYA 1N5HA 4LZIA 5CK6A 4RNZA 4HVNA 1ASKA 3F7SA 4FCMA 4RNYA 3NBJA 1VQ63 3CCV3 2UX0A 1LOXA 3GZBA 5IENA 1Q814 3SX1A 1VQ43 1STFI 4XM4A 3HK4A 4JF8A 1FGOA 2M7OA 4FCJA 1QVG2 2HMLB 3OV4A 3I563 1STDA 1YGEA 2W2CA 3EX9A 3LTDA 3MWZA 2CFDA 4L7KA 4CCVA 3GZRA 3DZLA 3MPHA 3BNDA 3N9HA 4H3UA 3WA2X 5IG3A 4AKZA 2BHMA 4XBTA 3F9SA 3N8BA 3DY5A 1W6YA 1JKGA 1PU4A 5STDA 2GXFA 2QEX3 1YIJ3 1IVUA 3CMA3 1WMNA 3MHEA 1GS3A 1JRQA 4Q53A 3DMCA 1VQ73 5IW9A 1VQN3 1IVXA 4R80A 5LC7A 3CCE3 1M1XB 1RJOA 2BMRB 3NUVA 3CCR3 2JQ5A 1N8R4 4K90B 2GBWB 3DUKA 2IA7A 1LXEA 5EQLA 4J8TA 3HIGA 2W56A 3GWRA 3WOEB 2R4IA 3G4S3 1EA2A 1JB2A 3K7CA 4EYCA 1MNLA 3JUQA 5BXQA 3ER7A 2XSOB 4KFDA 2IUJA 3LTAA 1SJWA 4WYKB 3EHCA 3NV0B 5AYRB 3MYTA 5BVBA 1VQM3 1IVVA 3F7XA 1ULIB 4O02B 4CDLA 2XFTA 3D3LA 1L5GB 3B4PA 3A76A 4MEIA 3CPW2 2F99A 3CCQ3 3WODG 2YFJB 1Q40B 1Q824 1UUVB 3CC43 1LNHA 4EC6A 2BO9B 1US1A 3EN8A 1M904 1SPUA 4KFFA 3OW22 5ELJA 1QMAA 3OWUA 3S67A 2INXA 2Q07A 6STDA 3V92A 4FMBA 3NV0A 2F98A 1D6ZA 1RRHA 4N3VA 1DMQA 1JV2B 2BNGA 1OHOA 2Z6BA 3OWSA 4XBXA 5D82A 2RFRA 4HM5B 3PCRA 1W02A 2D1WA 3IPTA 2IUKA 4MMXB 3CC23 3FG3A 3CCJ3 1Q7Y4 3K63A 1C7HA 1SQWA 3FF0A 1DVCA 3LT8A 1IU7A 3K0ZA 2KCDA 1Q40A 4K1UA 3KE7A 3RGAA 2WOFA 4WWUC 4FR9A 3NM7A 1T5YA 3GRDA 1QVF2 4K61A 3CU3A 1V74A 4N6OB 3LTBA 2P38A 3PCSA 3H3HA 1W4NA 2PZVA 1O7MB 4EV5A 3U97A 1CYVA 3BNCA 3I553 2E2TA 1IV7A 3DM8A 5IEOA 1NU3A 2B24B 2W6JH 1OHPA 3GZXB 4K1VA 3CCS3 3X3ZA 3B7CA 3SLUA 2FXTA 4OK0A 5AIFA 3X42A 3X40A 3D9RA 1K28A 4HM7B 1TUHA 5D83A 1IVWA 3IJEB 2W04A 1K9M4 1O7PB 2XF3A 4J9AA 3T8UA 2ZDJA 3FLJA 1IV9A 3LMLA 4PEJA 3QK9A 3JUNA 1A90A 1OF5B 4XBYA 2Z77A 1GY5A 2RCDA 5CF2A 1BUQA 1AV4A 1W2ZA 4OVMA 3OWYA 3G8ZA 1TU5A 2OTL3 5G2GA 4RZMA 2MC8A 2OTJ3 1UI7A 3JUOA 4GL6A 2P0XA 3JUMA 2W9PA 3MG2A 5FGOA 3EBYA 3EJVA 1TFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKX A;  2GBX B;  5CLK A;  1TP6 A;  4L8P A;  4R9K A;  2GEY A;  5IF6 A;  1OH0 A;  1UUW B;  5IG0 A;  2HMK B;  1O7W B;  2YFI B;  4LMI A;  4R1K A;  2HMO B;  5KP3 A;  3F14 A;  3M8C A;  3UNL A;  3MG3 A;  1O7N B;  1GY7 A;  5AIG A;  5KP1 A;  1GY6 A;  3EN1 B;  3FKA A;  1AR0 A;  5AIH A;  3OXA A;  3ROB A;  3FH1 A;  3KZT A;  1OGZ A;  2HMN B;  3JUP A;  2RGQ A;  1OCV A;  5IER A;  1E97 A;  4WYK A;  5JPU A;  3MKI A;  1OPY A;  3EQQ B;  3SED A;  4WP5 A;  5IG5 A;  3CNM A;  3EC9 A;  3BB9 A;  2CHC A;  5FW5 A;  3T8N A;  1ZX2 A;  2OWP A;  1Z1S A;  3KKG A;  3S5C A;  3H51 A;  1ISK A;  2STD A;  4HZB B;  1IDP A;  4HM0 B;  3FGY A;  3OX9 A;  4HM8 B;  3CPO A;  1U5O A;  2XRX B;  2Z76 A;  2XR8 B;  3RGR A;  4HJL B;  1E3V A;  4XDV A;  7STD A;  3EBT A;  1JN5 B;  4HM3 B;  4LGQ A;  3UJM A;  4HM6 B;  2K54 A;  3NM2 A;  3VSY A;  3GZY B;  3SOA A;  3HZP A;  1JKG B;  2QIY A;  5CF1 A;  1NDO B;  3FF2 A;  3NBR A;  1NWW A;  3B4O A;  4KVH A;  1ULJ B;  2YFL B;  2HMJ B;  5EVH A;  1VZZ A;  1K41 A;  1A2K A;  2BMO B;  5AI1 A;  1JN5 A;  3SOY A;  1S5A A;  1OF5 A;  4IIA A;  2CKF B;  3F40 A;  4HM2 B;  3ECF A;  1OHS A;  3LZA A;  3KSP A;  4X2O A;  1ZO2 A;  5DRE A;  3FSD A;  2A15 A;  4HM4 B;  3HX8 A;  2BMQ B;  1CQS A;  1Q42 A;  4LEH A;  1GYB A;  2B1X B;  2F86 B;  3I0Y A;  2HMM B;  5KP4 A;  4OUQ A;  2I9W A;  2QGU A;  3MG1 A;  1JB4 A;  4R9L A;  2IMJ A;  3E99 A;  5IEP A;  3NHX A;  4XDW A;  4HM1 B;  5JPP A;  3G16 A;  1W00 A;  3EF8 A;  3CNX A;  3G0K A;  4ORL A;  5AEU B;  8CHO A;  5TGN A;  3DXO A;  5DRV A;  1OGX A;  1DMM A;  3VGN A;  1O7G B;  1QJG A;  3STD A;  4U13 A;  5IG4 A;  3B8L A;  4HZ9 B;  2XSH B;  4L8O A;  5D81 A;  3F8X A;  5CXO A;  4XB5 A;  1DMN A;  4GB5 A;  1EG9 B;  1WQL B;  3FZW A;  2Z7A A;  4MJD A;  4X2H A;  5AII A;  3WMD A;  1O7H B;  2GEX A;  3Q90 A;  3NXJ A;  3LYG A;  3MSO A;  5HGR A;  4I4K A;  1E3R A;  1W01 A;  1JB5 A;  5AEW B;  3BLZ A;  1OUN A;  4HKV B;  4STD A;  3F8H A;  5CK6 A;  4HVN A;  1ASK A;  3F7S A;  4FCM A;  2UX0 A;  3GZB A;  5IEN A;  4XM4 A;  3HK4 A;  4FCJ A;  2HML B;  3OV4 A;  1STD A;  2W2C A;  3EX9 A;  4L7K A;  3GZR A;  3DZL A;  4H3U A;  5IG3 A;  4XBT A;  3F9S A;  1W6Y A;  1JKG A;  5STD A;  2GXF A;  3MHE A;  1GS3 A;  4Q53 A;  3DMC A;  2BMR B;  3NUV A;  2JQ5 A;  2GBW B;  3DUK A;  4J8T A;  3GWR A;  2R4I A;  1EA2 A;  1JB2 A;  3K7C A;  3JUQ A;  5BXQ A;  3ER7 A;  2XSO B;  4WYK B;  1SJW A;  3EHC A;  3NV0 B;  3MYT A;  5BVB A;  3F7X A;  1ULI B;  4CDL A;  3B4P A;  3A76 A;  2F99 A;  2YFJ B;  1Q40 B;  1UUV B;  3EN8 A;  1QMA A;  3OWU A;  2INX A;  6STD A;  3NV0 A;  2F98 A;  4N3V A;  1DMQ A;  2BNG A;  1OHO A;  3OWS A;  4XBX A;  5D82 A;  2RFR A;  4HM5 B;  1W02 A;  3IPT A;  1C7H A;  3FF0 A;  3K0Z A;  1Q40 A;  4K1U A;  3KE7 A;  3RGA A;  4WWU C;  3GRD A;  3CU3 A;  3H3H A;  2PZV A;  1O7M B;  3DM8 A;  5IEO A;  1NU3 A;  2B24 B;  1OHP A;  3GZX B;  4K1V A;  3B7C A;  5AIF A;  3D9R A;  4HM7 B;  1TUH A;  5D83 A;  1O7P B;  4J9A A;  3T8U A;  3FLJ A;  4PEJ A;  3JUN A;  1OF5 B;  4XBY A;  2Z77 A;  1GY5 A;  2RCD A;  5CF2 A;  1BUQ A;  4OVM A;  3OWY A;  3G8Z A;  5G2G A;  4RZM A;  3JUO A;  3JUM A;  3MG2 A;  3EBY A;  3EJV A; 
#chains in the Genus database with same CATH topology
 1HKX A;  2P0M A;  3CCU 3;  3D79 A;  3SVA A;  1Y4K A;  8RNT A;  1MGR A;  1D6U A;  3S27 A;  1VQQ A;  3BIR A;  2GBX B;  2SBL A;  3DGL A;  5CLK A;  4RNT A;  1TP6 A;  3N54 B;  1KSI A;  2RSX A;  2IY2 A;  2GEY A;  4IPB A;  4L8P A;  4R9K A;  2BIR A;  3DH2 A;  3ZG5 A;  5IF6 A;  1OH0 A;  1UUW B;  3L0R A;  1C54 A;  1LNI A;  1QAL A;  3AGN A;  2WO0 A;  1YJW 3;  5IG0 A;  1DYU A;  2PNC A;  4O3V A;  4WHA A;  4IT7 A;  2UGI A;  1ZGX A;  2HMK B;  2E2U A;  1O7W B;  2YFI B;  1X1X A;  4KFE A;  2LYX A;  4LMI A;  4R1K A;  3LTC A;  1ROV A;  2HMO B;  1TRQ A;  3NQY A;  3KN4 A;  5KP3 A;  1AVL A;  1FGQ A;  3F14 A;  3M8C A;  3NBB A;  3UNL A;  3FCS B;  3MG3 A;  3CD6 3;  1O7N B;  1GY7 A;  1B2M A;  1FA3 A;  2XGL A;  1BRG A;  1VQO 3;  3X41 A;  5AIG A;  1BNS A;  1M1K 4;  3T0U A;  1GY6 A;  5KP1 A;  3EN1 B;  2RBI A;  2CW9 A;  2WGO A;  3CC7 3;  2BU4 A;  3ALA A;  3FKA A;  2CWT A;  1Q86 4;  1N9J A;  1Q9E A;  3S28 A;  1AR0 A;  5AIH A;  1W7C A;  2CWV A;  4MMY B;  1FZU A;  1Q7H A;  3OXA A;  4FMD A;  3LH4 A;  1BSA A;  1LQG C;  3UL6 A;  3ROB A;  4EV2 A;  4FMA A;  4R4K A;  4EBG A;  1M9G A;  3FH1 A;  1B20 A;  2FNQ A;  2P09 A;  3KZT A;  1R4C A;  5G1K A;  2CK3 H;  1OGZ A;  4LYL B;  5LC6 A;  1F8N A;  1IT7 A;  5RNT A;  2HMN B;  3DGY A;  3JUP A;  2C4B A;  3HI7 A;  4TX4 A;  4KZ1 A;  4N6T A;  4GSP A;  2RGQ A;  4HOH A;  1OCV A;  3V99 A;  5IER A;  4CJN A;  1SII A;  3S29 A;  1E97 A;  2H0G A;  4WYK A;  3BNB A;  2Y73 A;  1S72 3;  1EKM A;  5JPU A;  2IYJ A;  3MKI A;  1RNB A;  1N9E A;  4HBR A;  3K5T A;  3PXM A;  1BNJ A;  1OPY A;  1OAC A;  3LXU X;  4NHF A;  2GU1 A;  4O2H A;  3EQQ B;  1I0V A;  3SED A;  3J7Y d;  3DGM A;  3HOH A;  4WP5 A;  1ZS7 A;  1FGT A;  5IG5 A;  3KII A;  3CNM A;  2XEP A;  3BB9 A;  3EC9 A;  3UL5 A;  2CHC A;  2MF7 A;  5FW5 A;  1B21 A;  3T8N A;  1RLS A;  3SYU A;  1ZX2 A;  2OWP A;  1BU4 A;  2V1L A;  1Z1S A;  2L4V A;  3DGN A;  2OOV C;  3NQZ A;  4N6L A;  2OQE A;  1W2B 2;  1BRN L;  1JJ2 2;  1BNF A;  3KKG A;  3TDG A;  2KRT A;  3BU4 A;  3S5C A;  3WA3 A;  1SIH A;  3H51 A;  1B2U A;  1UGH I;  3WOF B;  1I2G A;  1ISK A;  2STD A;  4HZB B;  2W0Q A;  2F56 A;  1KQS 2;  1B27 A;  5I97 A;  1IDP A;  4AEQ A;  4HM0 B;  1MWS A;  1GOY A;  3AHW A;  3FGY A;  1V57 A;  3OX9 A;  4HM8 B;  1FGM A;  3CPO A;  3URP A;  2XH9 A;  3FG4 A;  2CFL A;  1U5O A;  3X3X A;  2XRX B;  1IT8 A;  2P05 A;  1LVN A;  2Z76 A;  3CXC 2;  2YX9 A;  1EQK A;  1BAN A;  1NO3 A;  2XR8 B;  3RGR A;  1TIJ A;  3WDG B;  1WNH A;  4HJL B;  1ROA A;  1IQY A;  1NB3 I;  1WTH A;  2K0M A;  4H61 A;  1GMP A;  2CX0 A;  1E3V A;  4XDV A;  7STD A;  1BNR A;  1RGA A;  3EBT A;  2CG0 A;  1A2V A;  2SAR A;  4BTY A;  4O8S A;  2RNT A;  2WOH A;  1JN5 B;  2E2V A;  2FGT A;  4HM3 B;  1G96 A;  1RMS A;  4LGQ A;  1TFK A;  1BNG A;  5AYS C;  3CCL 3;  3UJM A;  1NJI 4;  4HM6 B;  2K54 A;  1FGR A;  3KFQ C;  2OQE C;  3NM2 A;  4N6U A;  1K73 4;  3VF1 A;  2Y74 A;  3GZY B;  1BRS A;  3SOA A;  3VSY A;  3HZP A;  1IYY A;  3WHO A;  1JKG B;  5A0O B;  2QIY A;  5CF1 A;  2D42 A;  2W9Q A;  1NDO B;  3FF2 A;  3PS8 A;  1AVK A;  3GSP A;  3Q1C A;  3HII A;  4J5K A;  4JRF A;  3G71 3;  1CYU A;  1BGS A;  3NBR A;  1BNI A;  1YJN 3;  1KC8 4;  1GMQ A;  1NWW A;  2KF5 A;  3BNE A;  2AAD A;  1RGK A;  3B4O A;  3ZFZ A;  1JZO A;  4KVH A;  1ULJ B;  1YVB I;  3D4A A;  1VQK 3;  2YFL B;  3QRD A;  2O3O A;  2HMJ B;  5EVH A;  1BAO A;  1VZZ A;  2OCT A;  4MMZ B;  1K41 A;  4BL3 A;  4NRE A;  2XFS A;  1A2K A;  2BMO B;  1DVD A;  2GU3 A;  1LOY A;  2BT3 A;  2O9U X;  1JN5 A;  2CIU A;  2W56 B;  1BNE A;  1TJD A;  3K9M C;  1IQ8 A;  1UW1 A;  3SOY A;  1S5A A;  4RBN A;  1VQ5 3;  4HAA A;  1IQX A;  2HOH A;  1OF5 A;  1PFP A;  3LOY A;  3PZW A;  4IIA A;  1HU9 A;  2CKF B;  3F40 A;  3EB8 A;  6GSP A;  1BRJ A;  1MOL A;  4HM2 B;  3SXX A;  3ECF A;  1OHS A;  1BOX A;  3LZA A;  3KSP A;  4X2O A;  2JDI H;  1ZO2 A;  2GSP A;  2W03 A;  5DRE A;  1RKY A;  4EW5 A;  3UB1 A;  3FSD A;  1YI2 3;  2L1S A;  1G0T A;  4HYZ A;  2A15 A;  1AQZ A;  1PY3 A;  1WMP A;  3HX8 A;  3JVC A;  4HM4 B;  1QAF A;  1RRL A;  1CEW I;  2BMQ B;  1CQS A;  1Q42 A;  3EE1 A;  4LEH A;  1GYB A;  1LOW A;  1B2Z A;  1I2F A;  2B1X B;  2F86 B;  3FG1 A;  3I0Y A;  2HMM B;  3PGB A;  4KT3 B;  1YJ9 3;  3KSE D;  5KP4 A;  4OUQ A;  3AMO B;  2ML6 A;  1NB5 I;  1GD4 A;  1FUW A;  2I9W A;  2QGU A;  1GMR A;  3MG1 A;  2OOV A;  1GSP A;  1JB4 A;  4N6N B;  4EXR A;  1AY7 A;  4R9L A;  2IMJ A;  3E99 A;  3LT9 A;  2WGQ A;  5IEP A;  2ML5 A;  1GD3 A;  4FCZ A;  3NHX A;  5EEO A;  4XDW A;  4HM1 B;  5JPP A;  1T2H A;  3G16 A;  1YHQ 3;  2CFK A;  4BU4 A;  1RGC A;  4QWT A;  1MGW A;  1W00 A;  1W6G A;  5AI1 A;  3NX0 A;  3EF8 A;  3O8Y A;  4CPK A;  3CCM 3;  3CNX A;  3G0K A;  1KD1 4;  4ORL A;  3G6E 3;  1VQ8 3;  5AEU B;  8CHO A;  3DGO A;  3V98 A;  1YIT 3;  1UI8 A;  1HZ1 A;  5TGN A;  1B3S A;  1YNV X;  3DXO A;  5DRV A;  3Q2P A;  3U1W A;  1OGX A;  1DMM A;  1X1U A;  3VGN A;  1J2B A;  1JNQ A;  1TTO A;  3AMO A;  1KWI A;  1O7G B;  2F4Y A;  1VQL 3;  1QJG A;  3STD A;  1N5P A;  2XGN A;  4WFO A;  1R4Y A;  4U13 A;  3RDE A;  1D6Y A;  4LSO A;  2CH9 A;  5IG4 A;  3CME 3;  3B8L A;  1MWU A;  4FMC A;  4HZ9 B;  1HYF A;  2XSH B;  2CG1 A;  7RNT A;  4L8O A;  5D81 A;  1RCL A;  3F8X A;  5CXO A;  4XB5 A;  1DMN A;  4BTX A;  1RGF A;  1U8C B;  2CFW A;  1WMO A;  1A67 A;  1RN7 A;  5BIR A;  4GB5 A;  1EG9 B;  2ZL8 A;  1X1Y A;  1WQL B;  3X3Y A;  3FZW A;  1IK3 A;  2Z7A A;  4MJD A;  4X2H A;  5AII A;  3WMD A;  1K8A 4;  2CC3 A;  1VQ9 3;  1O7H B;  4BTW A;  2CFG A;  2GEX A;  3Q90 A;  3NXJ A;  4GHO A;  1V58 A;  2C11 A;  1LRA A;  1W6C A;  1X1W A;  4BIR A;  4N6V 0;  3LYG A;  4DKI A;  2F5W A;  2QA4 3;  2LQV A;  1W5Z A;  3WR2 A;  4N6M A;  3MSO A;  5HGR A;  5BU4 A;  1QAK A;  1UUG B;  4I4K A;  3IMA B;  1E3R A;  1W01 A;  2C10 A;  5JBS A;  4G1M B;  2KXG A;  1JB5 A;  1JZD A;  5AEW B;  5ELU A;  4ZM8 A;  3BLZ A;  2CWU A;  4BL2 A;  1N8Q A;  1OUN A;  4HKV B;  3PYJ A;  4STD A;  1VQP 3;  2K3D A;  3F8H A;  3GAX A;  4AKY A;  1N5H A;  4LZI A;  5G1L A;  5CK6 A;  4RNZ A;  4HVN A;  1ASK A;  3F7S A;  4FCM A;  4RNY A;  3NBJ A;  1VQ6 3;  3CCV 3;  2UX0 A;  5M1A A;  1LOX A;  3GZB A;  1CH0 A;  1BRK A;  5IEN A;  1Q81 4;  3SX1 A;  1VQ4 3;  1GOV A;  1STF I;  4XM4 A;  3HK4 A;  4JF8 A;  1FGO A;  2M7O A;  4FCJ A;  1QVG 2;  2HML B;  3OV4 A;  3I56 3;  1RTU A;  1STD A;  1YGE A;  2W2C A;  3EX9 A;  3LTD A;  3MWZ A;  2CFD A;  4L7K A;  4CCV A;  3GZR A;  1RN1 A;  9RNT A;  3DZL A;  1RGG A;  3MPH A;  1TRP A;  1YVS A;  3BND A;  3N9H A;  1EEJ A;  4H3U A;  3WA2 X;  4AKZ A;  2BHM A;  1BIR A;  5IG3 A;  1DE3 A;  4XBT A;  1UDI I;  3F9S A;  3N8B A;  3DY5 A;  1W6Y A;  1UGI A;  4NPB A;  1JBR A;  1JKG A;  1PU4 A;  5STD A;  2KF6 A;  2KF4 A;  2UUG C;  3AHS A;  2GXF A;  2ZHX B;  6RNT A;  1BSC A;  2QEX 3;  1YIJ 3;  1IVU A;  3ZG0 A;  3CMA 3;  1A2P A;  1WMN A;  3MHE A;  1BSB A;  1GS3 A;  1JRQ A;  4Q53 A;  3DMC A;  4J5G A;  5IW9 A;  1VQ7 3;  1VQN 3;  1IVX A;  4R80 A;  2CX1 A;  5LC7 A;  3CCE 3;  1M1X B;  1RJO A;  2BMR B;  2ZA4 A;  3NUV A;  3CCR 3;  2JQ5 A;  1N8R 4;  4K90 B;  2F5M A;  2GBW B;  3D5I A;  3DUK A;  2IA7 A;  1LXE A;  5EQL A;  4J8T A;  3HIG A;  2W56 A;  3GWR A;  1JBS A;  3WOE B;  1BUJ A;  2R4I A;  3G4S 3;  1EA2 A;  1FYS A;  1JB2 A;  3K7C A;  4EYC A;  1MNL A;  1T3B A;  3JUQ A;  5BXQ A;  1RDS A;  1SAR A;  3ER7 A;  2XSO B;  2AAE A;  4KFD A;  2IUJ A;  3LTA A;  1SJW A;  4WYK B;  3EHC A;  1B2S A;  3NV0 B;  3MYT A;  5AYR B;  5BVB A;  1IVV A;  3F7X A;  1VQM 3;  1ULI B;  1T2I A;  4O02 B;  4CDL A;  2XFT A;  1G02 A;  2J8X B;  1I70 A;  1LQM B;  3D3L A;  1L5G B;  1RSN A;  3B4P A;  1I3F A;  3A76 A;  2KF3 A;  4MEI A;  3CPW 2;  1JBT A;  2F99 A;  3CCQ 3;  3WOD G;  1GOU A;  2YFJ B;  1Q40 B;  1Q82 4;  1UUV B;  3CC4 3;  1LNH A;  4EC6 A;  2BO9 B;  1US1 A;  3EN8 A;  5M19 A;  1M90 4;  1SPU A;  4KFF A;  3OW2 2;  5ELJ A;  1QMA A;  3OWU A;  3S67 A;  2INX A;  1RGE A;  1RGL A;  2Q07 A;  4ILF A;  6STD A;  3V92 A;  4FMB A;  3NV0 A;  2F98 A;  1BSD A;  2H0H A;  1D6Z A;  3AGO A;  1RRH A;  4N3V A;  1DMQ A;  1JV2 B;  1UCI A;  2BNG A;  1OHO A;  2Z6B A;  3KCH A;  3OWS A;  4XBX A;  5D82 A;  2RFR A;  4HM5 B;  1DET A;  3PCR A;  1W02 A;  2D1W A;  3IPT A;  2IUK A;  4MMX B;  3CC2 3;  3FG3 A;  3CCJ 3;  1Q7Y 4;  3K63 A;  1BRH A;  1C7H A;  1SQW A;  1I8V A;  3FF0 A;  1DVC A;  3LT8 A;  5GSP A;  1IU7 A;  3D5G A;  3K0Z A;  1YGW A;  2KCD A;  3Q3F A;  1UCK A;  1EUI C;  1Q40 A;  4K1U A;  3KE7 A;  3RGA A;  2WOF A;  1RCK A;  4WWU C;  4FR9 A;  1FUS A;  1RN4 A;  3NM7 A;  1T5Y A;  1I3I A;  1I0X A;  3GRD A;  1QVF 2;  4K61 A;  3RNT A;  3CU3 A;  4I5Q A;  1BSE A;  1V74 A;  4N6O B;  3LTB A;  2P38 A;  3PCS A;  3H3H A;  1BVI A;  1W4N A;  1MWR A;  1LOV A;  2PZV A;  1O7M B;  1UCJ A;  4EV5 A;  3U97 A;  5M18 A;  1CYV A;  3BNC A;  3I55 3;  2E2T A;  1MWT A;  1RHL A;  1IV7 A;  3DM8 A;  5IEO A;  1NU3 A;  2B24 B;  2W6J H;  1OHP A;  1FW7 A;  1I2E A;  3GZX B;  4K1V A;  3CCS 3;  1B2X A;  3X3Z A;  3B7C A;  2KAA A;  3SLU A;  2FXT A;  4OK0 A;  5AIF A;  3X42 A;  3X40 A;  1RGH A;  3D9R A;  1K28 A;  1BRI A;  4HM7 B;  1RNT A;  1TUH A;  5D83 A;  1IVW A;  3IJE B;  2W04 A;  1K9M 4;  1O7P B;  2XF3 A;  4J9A A;  3T8U A;  3A5E A;  2ZDJ A;  3FLJ A;  1IV9 A;  3LML A;  5HOH A;  4PEJ A;  1UCL A;  3QK9 A;  1PYL A;  3JUN A;  1A90 A;  1OF5 B;  4XBY A;  2Z77 A;  1GY5 A;  2R41 A;  2RCD A;  2H0I A;  5CF2 A;  1BUQ A;  1AV4 A;  1FUT A;  1W2Z A;  4OVM A;  3OWY A;  3G8Z A;  1TU5 A;  2OTL 3;  5G2G A;  4RZM A;  2MC8 A;  2OTJ 3;  1UI7 A;  3JUO A;  4GL6 A;  2P0X A;  3JUM A;  7GSP A;  1NNV A;  2W9P A;  3MG2 A;  5FGO A;  3EBY A;  3EJV A;  1TFO A; 
#chains in the Genus database with same CATH homology
 1HKX A;  2P0M A;  3CCU 3;  3SVA A;  1Y4K A;  1D6U A;  3S27 A;  2GBX B;  2SBL A;  3DGL A;  5CLK A;  1TP6 A;  3N54 B;  1KSI A;  2RSX A;  4IPB A;  2GEY A;  4L8P A;  4R9K A;  5IF6 A;  1OH0 A;  1UUW B;  3L0R A;  1QAL A;  2WO0 A;  1YJW 3;  5IG0 A;  1DYU A;  2PNC A;  4O3V A;  4WHA A;  4IT7 A;  2HMK B;  2E2U A;  1O7W B;  2YFI B;  4KFE A;  2LYX A;  4LMI A;  4R1K A;  3LTC A;  1ROV A;  2HMO B;  3NQY A;  3KN4 A;  5KP3 A;  1AVL A;  1FGQ A;  3F14 A;  3M8C A;  3NBB A;  3UNL A;  3FCS B;  3MG3 A;  3CD6 3;  1O7N B;  1GY7 A;  1FA3 A;  2XGL A;  1VQO 3;  3X41 A;  5AIG A;  1M1K 4;  3T0U A;  1GY6 A;  5KP1 A;  3EN1 B;  2WGO A;  2CW9 A;  3CC7 3;  3ALA A;  3FKA A;  2CWT A;  1Q86 4;  1N9J A;  3S28 A;  1AR0 A;  5AIH A;  1W7C A;  2CWV A;  4MMY B;  3OXA A;  4FMD A;  3LH4 A;  4EV2 A;  3UL6 A;  3ROB A;  4FMA A;  4R4K A;  4EBG A;  1M9G A;  3FH1 A;  2FNQ A;  2P09 A;  3KZT A;  1R4C A;  2CK3 H;  1OGZ A;  5LC6 A;  1F8N A;  1IT7 A;  2HMN B;  3JUP A;  3HI7 A;  4TX4 A;  4KZ1 A;  4N6T A;  2RGQ A;  1OCV A;  3V99 A;  5IER A;  1SII A;  3S29 A;  1E97 A;  4WYK A;  3BNB A;  2Y73 A;  1S72 3;  1EKM A;  5JPU A;  3MKI A;  1N9E A;  4HBR A;  3K5T A;  3PXM A;  1OPY A;  1OAC A;  3LXU X;  4NHF A;  2GU1 A;  4O2H A;  3EQQ B;  3J7Y d;  3SED A;  3DGM A;  4WP5 A;  1FGT A;  5IG5 A;  3KII A;  3CNM A;  2XEP A;  3BB9 A;  3EC9 A;  3UL5 A;  2CHC A;  2MF7 A;  5FW5 A;  3T8N A;  1ZX2 A;  2OWP A;  2V1L A;  1Z1S A;  2L4V A;  3DGN A;  2OOV C;  3NQZ A;  4N6L A;  2OQE A;  1W2B 2;  1JJ2 2;  3KKG A;  3TDG A;  2KRT A;  3S5C A;  3WA3 A;  1SIH A;  3H51 A;  3WOF B;  1ISK A;  2STD A;  4HZB B;  2W0Q A;  1KQS 2;  5I97 A;  1IDP A;  4AEQ A;  4HM0 B;  3FGY A;  3OX9 A;  4HM8 B;  1FGM A;  3CPO A;  2XH9 A;  3FG4 A;  2CFL A;  1U5O A;  3X3X A;  2XRX B;  1IT8 A;  2P05 A;  1LVN A;  2Z76 A;  3CXC 2;  2YX9 A;  1EQK A;  2XR8 B;  1NO3 A;  3RGR A;  1TIJ A;  3WDG B;  1WNH A;  4HJL B;  1ROA A;  1IQY A;  1NB3 I;  1WTH A;  2K0M A;  4H61 A;  1E3V A;  4XDV A;  7STD A;  3EBT A;  2CG0 A;  1A2V A;  4BTY A;  4O8S A;  2WOH A;  1JN5 B;  2E2V A;  2FGT A;  4HM3 B;  1G96 A;  4LGQ A;  1TFK A;  5AYS C;  3CCL 3;  3UJM A;  1NJI 4;  4HM6 B;  2K54 A;  1FGR A;  3KFQ C;  2OQE C;  3NM2 A;  4N6U A;  1K73 4;  3VF1 A;  2Y74 A;  3GZY B;  3SOA A;  3VSY A;  3HZP A;  1JKG B;  5A0O B;  2QIY A;  5CF1 A;  2D42 A;  2W9Q A;  1NDO B;  3FF2 A;  3PS8 A;  1AVK A;  3Q1C A;  4JRF A;  3HII A;  3G71 3;  1CYU A;  3NBR A;  1YJN 3;  1KC8 4;  1NWW A;  3BNE A;  3B4O A;  4KVH A;  1ULJ B;  1YVB I;  1VQK 3;  2YFL B;  3QRD A;  2O3O A;  2HMJ B;  5EVH A;  1VZZ A;  2OCT A;  4MMZ B;  1K41 A;  4NRE A;  2XFS A;  1A2K A;  2BMO B;  1DVD A;  2GU3 A;  2BT3 A;  5AI1 A;  2O9U X;  1JN5 A;  2CIU A;  2W56 B;  3SOY A;  3K9M C;  1IQ8 A;  1UW1 A;  1S5A A;  4RBN A;  1VQ5 3;  1IQX A;  1OF5 A;  1PFP A;  3LOY A;  3PZW A;  4IIA A;  1HU9 A;  2CKF B;  3F40 A;  3EB8 A;  1MOL A;  4HM2 B;  3SXX A;  3ECF A;  1OHS A;  3LZA A;  3KSP A;  4X2O A;  2JDI H;  1ZO2 A;  2W03 A;  5DRE A;  1RKY A;  3UB1 A;  3FSD A;  1YI2 3;  4HYZ A;  2A15 A;  4HM4 B;  1WMP A;  3HX8 A;  3JVC A;  1QAF A;  1RRL A;  1CEW I;  2BMQ B;  1CQS A;  1Q42 A;  3EE1 A;  4LEH A;  1GYB A;  2B1X B;  2F86 B;  3FG1 A;  3I0Y A;  2HMM B;  3PGB A;  1YJ9 3;  3KSE D;  5KP4 A;  4OUQ A;  3AMO B;  2ML6 A;  1NB5 I;  1GD4 A;  1FUW A;  2I9W A;  2QGU A;  3MG1 A;  2OOV A;  1JB4 A;  4N6N B;  4EXR A;  4R9L A;  2IMJ A;  3E99 A;  3LT9 A;  2WGQ A;  5IEP A;  2ML5 A;  1GD3 A;  4FCZ A;  3NHX A;  5EEO A;  4XDW A;  4HM1 B;  5JPP A;  3G16 A;  1YHQ 3;  2CFK A;  4QWT A;  1W00 A;  1W6G A;  3NX0 A;  3EF8 A;  3O8Y A;  3CCM 3;  3CNX A;  3G0K A;  1KD1 4;  4ORL A;  3G6E 3;  1VQ8 3;  5AEU B;  8CHO A;  3DGO A;  3V98 A;  1YIT 3;  1UI8 A;  5TGN A;  3U1W A;  3DXO A;  5DRV A;  3Q2P A;  1OGX A;  1DMM A;  1J2B A;  3VGN A;  1JNQ A;  3AMO A;  1KWI A;  1O7G B;  1VQL 3;  1QJG A;  3STD A;  2XGN A;  1N5P A;  4WFO A;  4U13 A;  3RDE A;  1D6Y A;  4LSO A;  2CH9 A;  5IG4 A;  3CME 3;  3B8L A;  4FMC A;  2CG1 A;  4HZ9 B;  2XSH B;  4L8O A;  5D81 A;  3F8X A;  5CXO A;  4XB5 A;  1DMN A;  4BTX A;  1U8C B;  2CFW A;  1WMO A;  1A67 A;  1RN7 A;  4GB5 A;  1EG9 B;  2ZL8 A;  1WQL B;  3X3Y A;  3FZW A;  1IK3 A;  2Z7A A;  4MJD A;  4X2H A;  5AII A;  3WMD A;  1K8A 4;  2CC3 A;  1VQ9 3;  1O7H B;  4BTW A;  2CFG A;  2GEX A;  3Q90 A;  3NXJ A;  2C11 A;  1W6C A;  4N6V 0;  3LYG A;  2QA4 3;  2LQV A;  1W5Z A;  4N6M A;  3MSO A;  5HGR A;  1QAK A;  4I4K A;  3IMA B;  1E3R A;  1W01 A;  2C10 A;  5JBS A;  4G1M B;  2KXG A;  1JB5 A;  5AEW B;  5ELU A;  4ZM8 A;  3BLZ A;  2CWU A;  1N8Q A;  1OUN A;  4HKV B;  3PYJ A;  4STD A;  1VQP 3;  3F8H A;  3GAX A;  4AKY A;  1N5H A;  4LZI A;  5CK6 A;  4RNZ A;  4HVN A;  1ASK A;  3F7S A;  4FCM A;  4RNY A;  3NBJ A;  1VQ6 3;  3CCV 3;  2UX0 A;  1LOX A;  3GZB A;  5IEN A;  1Q81 4;  3SX1 A;  1VQ4 3;  1STF I;  4XM4 A;  3HK4 A;  4JF8 A;  1FGO A;  2M7O A;  4FCJ A;  1QVG 2;  2HML B;  3OV4 A;  3I56 3;  1STD A;  1YGE A;  2W2C A;  3EX9 A;  3LTD A;  3MWZ A;  2CFD A;  4L7K A;  4CCV A;  3GZR A;  3DZL A;  3MPH A;  3BND A;  3N9H A;  4H3U A;  3WA2 X;  5IG3 A;  4AKZ A;  2BHM A;  4XBT A;  3F9S A;  3N8B A;  3DY5 A;  1W6Y A;  1JKG A;  1PU4 A;  5STD A;  2GXF A;  2QEX 3;  1YIJ 3;  1IVU A;  3CMA 3;  1WMN A;  3MHE A;  1GS3 A;  1JRQ A;  4Q53 A;  3DMC A;  1VQ7 3;  5IW9 A;  1VQN 3;  1IVX A;  4R80 A;  5LC7 A;  3CCE 3;  1M1X B;  1RJO A;  2BMR B;  3NUV A;  3CCR 3;  2JQ5 A;  1N8R 4;  4K90 B;  2GBW B;  3DUK A;  2IA7 A;  1LXE A;  5EQL A;  4J8T A;  3HIG A;  2W56 A;  3GWR A;  3WOE B;  2R4I A;  3G4S 3;  1EA2 A;  1JB2 A;  3K7C A;  4EYC A;  1MNL A;  3JUQ A;  5BXQ A;  3ER7 A;  2XSO B;  4KFD A;  2IUJ A;  3LTA A;  1SJW A;  4WYK B;  3EHC A;  3NV0 B;  5AYR B;  3MYT A;  5BVB A;  1VQM 3;  1IVV A;  3F7X A;  1ULI B;  4O02 B;  4CDL A;  2XFT A;  3D3L A;  1L5G B;  3B4P A;  3A76 A;  4MEI A;  3CPW 2;  2F99 A;  3CCQ 3;  3WOD G;  2YFJ B;  1Q40 B;  1Q82 4;  1UUV B;  3CC4 3;  1LNH A;  4EC6 A;  2BO9 B;  1US1 A;  3EN8 A;  1M90 4;  1SPU A;  4KFF A;  3OW2 2;  5ELJ A;  1QMA A;  3OWU A;  3S67 A;  2INX A;  2Q07 A;  6STD A;  3V92 A;  4FMB A;  3NV0 A;  2F98 A;  1D6Z A;  1RRH A;  4N3V A;  1DMQ A;  1JV2 B;  2BNG A;  1OHO A;  2Z6B A;  3OWS A;  4XBX A;  5D82 A;  2RFR A;  4HM5 B;  3PCR A;  1W02 A;  2D1W A;  3IPT A;  2IUK A;  4MMX B;  3CC2 3;  3FG3 A;  3CCJ 3;  1Q7Y 4;  3K63 A;  1C7H A;  1SQW A;  3FF0 A;  1DVC A;  3LT8 A;  1IU7 A;  3K0Z A;  2KCD A;  1Q40 A;  4K1U A;  3KE7 A;  3RGA A;  2WOF A;  4WWU C;  4FR9 A;  3NM7 A;  1T5Y A;  3GRD A;  1QVF 2;  4K61 A;  3CU3 A;  1V74 A;  4N6O B;  3LTB A;  2P38 A;  3PCS A;  3H3H A;  1W4N A;  2PZV A;  1O7M B;  4EV5 A;  3U97 A;  1CYV A;  3BNC A;  3I55 3;  2E2T A;  1IV7 A;  3DM8 A;  5IEO A;  1NU3 A;  2B24 B;  2W6J H;  1OHP A;  3GZX B;  4K1V A;  3CCS 3;  3X3Z A;  3B7C A;  3SLU A;  2FXT A;  4OK0 A;  5AIF A;  3X42 A;  3X40 A;  3D9R A;  1K28 A;  4HM7 B;  1TUH A;  5D83 A;  1IVW A;  3IJE B;  2W04 A;  1K9M 4;  1O7P B;  2XF3 A;  4J9A A;  3T8U A;  2ZDJ A;  3FLJ A;  1IV9 A;  3LML A;  4PEJ A;  3QK9 A;  3JUN A;  1A90 A;  1OF5 B;  4XBY A;  2Z77 A;  1GY5 A;  2RCD A;  5CF2 A;  1BUQ A;  1AV4 A;  1W2Z A;  4OVM A;  3OWY A;  3G8Z A;  1TU5 A;  2OTL 3;  5G2G A;  4RZM A;  2MC8 A;  2OTJ 3;  1UI7 A;  3JUO A;  4GL6 A;  2P0X A;  3JUM A;  2W9P A;  3MG2 A;  5FGO A;  3EBY A;  3EJV A;  1TFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...