3FLJA

Crystal structure of uncharacterized protein conserved in bacteria with a cystatin-like fold (yp_168589.1) from silicibacter pomeroyi dss-3 at 2.00 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
LYFQGMHPTIARMQEVVAKGDESLIHALLAEDVRFMPPTYYKTWTGRDPVAAVLGHVGQVFSEFRYRRIMGEGKDWALEFQCKVGELDAVGVDLITLNEGGLIQDFEVVMRPYKTVGALRDAMNARVMTDARFLKYREALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein conserved in bacteria with a cystati
publication title Crystal structure of uncharacterized protein conserved in bacteria with a cystatin-like fold (YP_168589.1) from SILICIBACTER POMEROYI DSS-3 at 2.00 A resolution
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Structural genomics, unknown function
total genus 36
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3fljA00
4OUQA 3F7SA 3F14A 4HZ9B 2GBWB 4STDA 1OHSA 4XB5A 1UUWB 1C7HA 1DMMA 3JUQA 1S5AA 1OF5A 4U13A 5CK6A 3OWYA 5HGRA 2XRXB 3MG1A 3RGAA 3E99A 1GY7A 3BB9A 3EF8A 3DZLA 3G8ZA 1VZZA 4Q53A 4R9KA 3KZTA 3GZBA 4I4KA 2I9WA 3VGNA 3UNLA 1O7NB 3SEDA 3SOYA 3GRDA 3JUMA 5D83A 1NDOB 2W2CA 3FSDA 4FCMA 1AR0A 3VSYA 3LZAA 1QMAA 5IEOA 4K1VA 5D82A 1ZO2A 3NV0A 1JB4A 3EX9A 3FZWA 5KP4A 3NXJA 4WP5A 4XBTA 3G0KA 1W02A 3HX8A 1OHPA 3KE7A 1O7PB 8CHOA 3RGRA 2HMMB 2CKFB 5IG3A 3MKIA 1ASKA 3GZRA 1Q42A 3EN1B 4HZBB 5AIIA 1Q40A 3FF0A 4J9AA 5DRVA 5IG0A 3CPOA 5AIFA 1W6YA 5JPUA 3B4PA 5AEWB 3EQQB 5DREA 2YFIB 4CDLA 1E97A 3A76A 2JQ5A 4HM1B 1WQLB 3MHEA 1O7HB 3BLZA 3ECFA 1U5OA 1K41A 2BNGA 5CXOA 3OWSA 3T8NA 4HM2B 1JKGA 3MG3A 5CF2A 2GXFA 4HM6B 3F8HA 4FCJA 3F9SA 1OF5B 2HMOB 5IG4A 2CHCA 1O7GB 3JUPA 4MJDA 3IPTA 7STDA 2HMKB 4H3UA 3FF2A 4HKVB 5FW5A 1ULJB 3DUKA 1TUHA 3H3HA 4XDWA 4HM8B 1ZX2A 3I0YA 1GY5A 3NHXA 2QIYA 1E3RA 1W01A 1OH0A 3GZYB 3MSOA 3EC9A 4XM4A 3NV0B 2Z76A 1JB2A 1O7MB 1A2KA 1JN5B 3F40A 3NBRA 2R4IA 4HM3B 1DMQA 3OX9A 3KSPA 3F8XA 4WYKA 1OGZA 3MG2A 1NWWA 2STDA 3MYTA 1Q40B 1W00A 5EVHA 2RCDA 1STDA 3NM2A 1NU3A 3DXOA 1ISKA 4HM0B 2GEXA 2HMJB 2HMLB 2UX0A 3EN8A 3EHCA 2F86B 2F98A 3CNXA 2BMRB 4R9LA 3DMCA 3K0ZA 5KP3A 3ROBA 2BMQB 3S5CA 4R1KA 3B4OA 2YFLB 3LYGA 5KP1A 2XSOB 1ULIB 4HM7B 5AIHA 4XDVA 3FGYA 2BMOB 3K7CA 4K1UA 3B8LA 5AEUB 1QJGA 3HZPA 4J8TA 3SOAA 2YFJB 2B24B 2Z77A 2HMNB 1EG9B 4HJLB 3GWRA 5TGNA 1JB5A 5IENA 1OGXA 2B1XB 4PEJA 1GYBA 4HVNA 3UJMA 1DMNA 4HM4B 3OWUA 4KVHA 3FH1A 2XR8B 4X2HA 3H51A 4XBXA 3GZXB 5AIGA 5D81A 1E3VA 2QGUA 4L8OA 2K54A 4LMIA 3FKAA 4L8PA 5STDA 4XBYA 4WYKB 2INXA 2RFRA 4WWUC 2F99A 2Z7AA 5IG5A 3EJVA 1IDPA 1GS3A 1OCVA 1Z1SA 4ORLA 3CNMA 4X2OA 3HK4A 5IEPA 3STDA 3M8CA 2A15A 4N3VA 4RZMA 4LEHA 1JN5A 3B7CA 1OPYA 2GEYA 1OHOA 2PZVA 2IMJA 3JUOA 3EBYA 5AI1A 1SJWA 4IIAA 5BXQA 2RGQA 3T8UA 3G16A 3OV4A 2XSHB 3CU3A 3ER7A 5IERA 3EBTA 3F7XA 1OUNA 3FLJA 3Q90A 6STDA 1GY6A 1JKGB 4OVMA 3NUVA 1O7WB 3JUNA 3WMDA 4L7KA 3D9RA 5JPPA 1BUQA 3DM8A 2GBXB 1HKXA 4LGQA 1TP6A 5BVBA 5IF6A 4GB5A 1EA2A 1CQSA 3KKGA 4HM5B 3OXAA 5G2GA 1UUVB 5CF1A 2OWPA 5CLKA
chains in the Genus database with same CATH superfamily
1LVNA 1B21A 2L1SA 1UCLA 4OUQA 2KF6A 1AVKA 3S67A 4AKYA 4JRFA 2F5WA 1I3FA 3AMOB 1GOVA 3F7SA 5EEOA 1QAFA 1V57A 3RDEA 3F14A 4HZ9B 2BO9B 4QWTA 1RLSA 3HIGA 2GBWB 4STDA 1OHSA 4EV5A 4XB5A 1UUWB 1C7HA 4MMZB 1DMMA 3JUQA 1S5AA 5G1LA 1BIRA 1LRAA 2KF5A 1OF5A 4KZ1A 4GL6A 4U13A 5CK6A 4ZM8A 1BAOA 3OWYA 5HGRA 3K9MC 4LZIA 2XRXB 1B3SA 2XEPA 3MG1A 3LXUX 2AADA 3CCE3 3RGAA 4J5KA 2W56A 3GSPA 1RMSA 1BNIA 1X1XA 3E99A 3L0RA 3D4AA 2IY2A 1GY7A 3BB9A 4FCZA 3EF8A 3DZLA 3G8ZA 2CFLA 2C11A 2D42A 1JZDA 1VZZA 3NQZA 4Q53A 4R9KA 3X3ZA 5A0OB 1TU5A 3KZTA 1YIJ3 3GZBA 4I4KA 1BOXA 2I9WA 3VGNA 1BNGA 1RGLA 2CWVA 1RN4A 3UNLA 1O7NB 1L5GB 2ML6A 3SEDA 3SOYA 1D6ZA 1ZGXA 5M19A 3GRDA 3JUMA 5D83A 2O9UX 1T3BA 1EUIC 1GOYA 1NDOB 2W2CA 3FSDA 4FCMA 1AR0A 2M7OA 1TRPA 2IUJA 1W2B2 4I5QA 4NPBA 3VSYA 3LZAA 3CD63 1QMAA 3LTAA 5LC7A 1I2FA 1PFPA 5IEOA 3EB8A 2CWTA 4K1VA 2QA43 4FMBA 5D82A 1WNHA 3D3LA 1ZO2A 3N9HA 3LTDA 5IW9A 3KFQC 1K734 3BNCA 2ZL8A 2F4YA 3PS8A 1IVWA 1SQWA 3K63A 3NV0A 1JB4A 1FGMA 2H0HA 4BU4A 2GU3A 2OTJ3 1Q7HA 3EX9A 3FZWA 5KP4A 3J7Yd 3NXJA 4WP5A 2K0MA 4XBTA 1BGSA 3G0KA 1N9EA 4R4KA 4WFOA 3DGOA 1W02A 3QK9A 4FMAA 1KD14 3HX8A 4BTXA 1UCJA 1A67A 1OHPA 4AEQA 2OOVA 5I97A 3KE7A 1O7PB 1U8CB 1UI8A 3T0UA 1C54A 2WOHA 8CHOA 3A5EA 3DGMA 1RGFA 1GOUA 3ALAA 2CG1A 3RGRA 1IV7A 4O2HA 1W5ZA 1R4CA 3S28A 5AYSC 2HMMB 2CIUA 1GMQA 1YGEA 2CKFB 3KN4A 2ZDJA 3RNTA 5IG3A 3MKIA 1BSCA 1ASKA 3GZRA 1Q42A 4G1MB 4O02B 1VQ43 3NBJA 1PYLA 1TFOA 3EN1B 4HZBB 5AIIA 1Q40A 1TJDA 1WMOA 4HOHA 1I0VA 3FF0A 4J9AA 5DRVA 3CPOA 5IG0A 7GSPA 3IJEB 1FA3A 5AIFA 3X40A 2P05A 1W6YA 2P09A 5JPUA 1BNRA 3B4PA 3PZWA 1YVBI 1N9JA 1N8R4 5AEWB 2WOFA 3EQQB 1Q824 5DREA 2YFIB 2RBIA 4CDLA 1E97A 1X1UA 3A76A 2JQ5A 4HM1B 3S29A 3CC43 2C10A 2XFTA 3CCJ3 1BNFA 1WQLB 1TFKA 3MHEA 1O7HB 2D1WA 3DH2A 3BLZA 4K90B 3ZFZA 4CCVA 5HOHA 3ECFA 1VQM3 1U5OA 2HOHA 1YJ93 1W2ZA 1K41A 3WDGB 3CC73 1EQKA 1KC84 1W6GA 2BNGA 3LT9A 1NJI4 1RNBA 5CXOA 1QVF2 3LOYA 1AVLA 3OWSA 2ML5A 3T8NA 3X42A 4HM2B 3QRDA 4MMXB 3SXXA 2W03A 4BL2A 1AV4A 1JKGA 3HIIA 4EC6A 1QVG2 1VQ53 2AAEA 3MG3A 3SX1A 2KCDA 5CF2A 2XGLA 2RSXA 1W7CA 2GXFA 4HM6B 1VQL3 3F8HA 1PY3A 1I0XA 4FCJA 1VQ73 1RNTA 1JV2B 2CH9A 3CPW2 3F9SA 2XFSA 5G1KA 1OF5B 2HMOB 1GD3A 1RN1A 5IG4A 1BSEA 2CHCA 1O7GB 4BL3A 3PCRA 4RNZA 2UGIA 3JUPA 1MWUA 4MJDA 3IPTA 1N8QA 2W56B 1BRSA 7STDA 1BSAA 2HMKB 4H3UA 3FF2A 1B2SA 4HKVB 5FW5A 2ZHXB 4BTWA 1ROAA 2WGQA 1ULJB 1LXEA 2H0GA 2WGOA 3BNEA 3DUKA 1YIT3 4IPBA 1IQYA 1TUHA 3H3HA 1WTHA 4XDWA 1BU4A 3WOFB 4HM8B 3AGOA 1N5HA 1CH0A 1UGIA 1ZX2A 3I0YA 1GY5A 1RGKA 3LTCA 3AGNA 1RCLA 1B2ZA 3NHXA 2E2VA 2QIYA 1IVUA 1LQGC 3UL5A 1E3RA 2ZA4A 1W01A 3HI7A 1HYFA 4FMCA 3OW22 1YI23 1OH0A 3LMLA 3GZYB 1FGOA 3MSOA 3PCSA 3EC9A 4XM4A 1M1XB 3IMAB 1A2VA 3NV0B 1RDSA 1UUGB 1D6UA 2CFKA 4RNTA 4OK0A 1T2IA 2JDIH 3D5GA 3BNDA 3I563 2Z76A 1JB2A 1M1K4 1O7MB 1A2KA 1BNSA 4ILFA 1RN7A 1RJOA 4FMDA 1YJN3 3GAXA 1JN5B 1JRQA 1RRLA 3F40A 1BRNL 2BIRA 2SBLA 3TDGA 1SIIA 1FGQA 2GU1A 3NBRA 5GSPA 1ZS7A 1BRKA 1SARA 3AHWA 1G02A 2R4IA 4HM3B 1A2PA 1IT7A 1DMQA 1LOVA 3V99A 1EEJA 3OX9A 3F8XA 3FG1A 3KSPA 3N54B 4WYKA 3MPHA 3Q2PA 2O3OA 1MNLA 1OGZA 2BU4A 2LYXA 3S27A 1KSIA 1UGHI 1Q814 3MG2A 1Y4KA 3DGNA 1YJW3 1I8VA 1GMPA 4N6MA 4TX4A 1DYUA 1NWWA 1V74A 2STDA 3MYTA 1IV9A 3UB1A 9RNTA 2BHMA 1Q40B 1W00A 5EVHA 1VQ83 2OQEC 4EV2A 1VQK3 2RCDA 1VQQA 3Q3FA 4KFFA 3I553 1STDA 1T5YA 4H61A 1BRIA 2XF3A 2XGNA 1AQZA 3NM2A 1NU3A 2KRTA 3DXOA 5BU4A 1NB5I 3LH4A 1ISKA 1VQ93 4HM0B 4EBGA 1STFI 1TRQA 2GEXA 1A90A 2HMJB 5JBSA 1NO3A 1UW1A 1G96A 2HMLB 2UX0A 4RBNA 3EN8A 1MWSA 2W9PA 1Q9EA 2J8XB 3Q1CA 1JZOA 1FGRA 3EHCA 6GSPA 1M904 3CCU3 2CC3A 1RSNA 2CWUA 2F86B 1CEWI 2Y73A 3U97A 1VQ63 1RTUA 3JVCA 2F98A 3BNBA 3CNXA 7RNTA 1IQXA 2CG0A 1Q864 1MGWA 1CYUA 1B2XA 3CCQ3 5ELJA 1GSPA 2BMRB 2IUKA 1YGWA 1J2BA 4R9LA 2K3DA 1IVXA 3DMCA 3K0ZA 5KP3A 3ROBA 1RKYA 2BMQB 3S5CA 1TTOA 3WODG 3LTBA 4R1KA 3X3XA 3B4OA 3PXMA 1US1A 1LOXA 2YFLB 1FW7A 1B27A 3X41A 2OCTA 5M18A 3LYGA 1ROVA 4N6TA 5KP1A 2XSOB 4R80A 1ULIB 4HM7B 5AIHA 4XDVA 2CX1A 2F5MA 1LOYA 1VQO3 1UCKA 1WMPA 2P0MA 3FGYA 4HBRA 2BMOB 1EKMA 1B20A 1GD4A 5BIRA 2F56A 3K7CA 4O3VA 4K1UA 3B8LA 1DETA 3ZG0A 2KF3A 5AEUB 1W4NA 1TIJA 1V58A 1QJGA 1W6CA 1IVVA 1FZUA 3HZPA 4J8TA 4O8SA 1DVDA 1RRHA 4LYLB 1I2GA 1G0TA 1SPUA 3SOAA 2CFGA 2YFJB 4CJNA 3CC23 1K9M4 1X1YA 3U1WA 2B24B 5AYRB 1BVIA 1IQ8A 2Z77A 2HMNB 2E2TA 1EG9B 4HJLB 1FYSA 3GWRA 1IK3A 3CCS3 1JB5A 5TGNA 5IENA 1OGXA 2B1XB 4GHOA 1R4YA 2CFDA 1GYBA 2MF7A 4PEJA 4HVNA 2XH9A 1D6YA 3G4S3 2IYJA 4GSPA 3X3YA 3WA2X 1FUWA 6RNTA 1RGAA 3UJMA 2PNCA 3NM7A 1IYYA 1YHQ3 3AMOA 4K61A 1NNVA 2L4VA 1DMNA 3K5TA 4HM4B 4KFDA 3OWUA 3NQYA 3SLUA 4KVHA 2WO0A 2MC8A 1FUSA 3FH1A 2XR8B 1FGTA 1S723 1MOLA 2W04A 4CPKA 4X2HA 3V92A 1LQMB 3AHSA 4MMYB 3H51A 4XBXA 3GZXB 5EQLA 3DY5A 1BRJA 2OQEA 3KIIA 4N6OB 5AIGA 4HAAA 1IU7A 5D81A 1I2EA 2RNTA 1E3VA 1KQS2 2W9QA 1DE3A 2FXTA 4NREA 1MGRA 2QGUA 3V98A 2W0QA 1HU9A 1K28A 4L8OA 1BSBA 3WR2A 3CXC2 1VQN3 1X1WA 3CCR3 2K54A 4HYZA 4LSOA 4LMIA 3FKAA 4L8PA 5M1AA 4XBYA 1QAKA 2YX9A 3NBBA 1OACA 4N6LA 5STDA 1JBSA 3URPA 1Q7Y4 4WYKB 3DGLA 3EE1A 2C4BA 1BRGA 2INXA 2RFRA 2Y74A 4AKZA 1IT8A 1RCKA 4WWUC 1JBRA 1DVCA 2F99A 1B2MA 2UUGC 1BRHA 1JNQA 2Z7AA 5IG5A 2GSPA 1LOWA 1N5PA 3EJVA 1IDPA 3WOEB 2QEX3 1QALA 3MWZA 1M9GA 4FR9A 1GS3A 3CCM3 1OCVA 1RGHA 1UI7A 1RGEA 1RHLA 1BSDA 1YNVX 1Z1SA 4IT7A 4KFEA 3DGYA 4WHAA 3SYUA 3VF1A 4ORLA 3NX0A 3PYJA 3CNMA 3CME3 2OTL3 1KWIA 3O8YA 3CMA3 2CX0A 1B2UA 4X2OA 3HK4A 5IEPA 3STDA 2KXGA 1K8A4 1YVSA 3M8CA 1MWRA 2A15A 2E2UA 4N3VA 3UL6A 1CYVA 2P38A 4RZMA 4LEHA 3BU4A 1JN5A 3B7CA 1MWTA 1OPYA 2FGTA 4JF8A 2GEYA 1OHOA 1GMRA 1RGGA 2PZVA 3SVAA 1JJ22 4J5GA 1JBTA 4KT3B 4N6NB 2IMJA 3JUOA 4N6V0 2KF4A 1NB3I 3EBYA 1I3IA 3WA3A 8RNTA 1PU4A 1VQP3 1RGCA 5AI1A 3PGBA 5FGOA 3CCV3 1SJWA 2P0XA 3FCSB 2CK3H 2R41A 4IIAA 5ELUA 5BXQA 2RGQA 1UDII 3LT8A 3T8UA 1T2HA 3D79A 3G16A 3OV4A 1AY7A 3ZG5A 2XSHB 1BUJA 2BT3A 3N8BA 3CU3A 3ER7A 5IERA 3EBTA 3F7XA 1OUNA 3FLJA 1HZ1A 3Q90A 6STDA 3D5IA 1GY6A 1JKGB 2W6JH 4MEIA 4OVMA 1LNHA 2FNQA 4RNYA 1BANA 2Z6BA 1BNEA 3NUVA 1SIHA 1O7WB 3FG3A 1I70A 3JUNA 3WMDA 4L7KA 3D9RA 5JPPA 1BUQA 3DM8A 3KCHA 4N6UA 2GBXB 3G6E3 4NHFA 5LC6A 1HKXA 4BIRA 3CCL3 2IA7A 3FG4A 1FUTA 4LGQA 4BTYA 1TP6A 2V1LA 4EYCA 3BIRA 5BVBA 2Q07A 1BNJA 4GB5A 5IF6A 1UCIA 1EA2A 1CQSA 2LQVA 2OOVC 2KAAA 1LNIA 3KSED 2CFWA 1WMNA 3KKGA 4HM5B 3OXAA 4EXRA 5G2GA 1UUVB 5CF1A 4EW5A 5RNTA 1F8NA 3G713 2CW9A 2SARA 4DKIA 3HOHA 2OWPA 2H0IA 5CLKA 3WHOA
chains in the Genus database with same CATH topology
1LVNA 4OUQA 1AVKA 3S67A 4AKYA 4JRFA 3AMOB 3F7SA 5EEOA 1QAFA 3RDEA 3F14A 4HZ9B 2BO9B 4QWTA 3HIGA 2GBWB 4STDA 1OHSA 4EV5A 4XB5A 1UUWB 1C7HA 4MMZB 1DMMA 3JUQA 1S5AA 1OF5A 4KZ1A 4GL6A 4U13A 5CK6A 4ZM8A 3OWYA 5HGRA 3K9MC 4LZIA 2XRXB 2XEPA 3MG1A 3LXUX 3CCE3 3RGAA 2W56A 3E99A 3L0RA 1GY7A 3BB9A 4FCZA 3EF8A 3DZLA 3G8ZA 2CFLA 2C11A 2D42A 1VZZA 3NQZA 4Q53A 4R9KA 3X3ZA 5A0OB 1TU5A 1YIJ3 3KZTA 3GZBA 4I4KA 2I9WA 3VGNA 2CWVA 3UNLA 1O7NB 1L5GB 2ML6A 3SEDA 3SOYA 1D6ZA 3GRDA 3JUMA 5D83A 2O9UX 1NDOB 2W2CA 3FSDA 2IUJA 4FCMA 1KQS2 1AR0A 2M7OA 1W2B2 3VSYA 3LZAA 3CD63 1QMAA 3LTAA 5LC7A 5IEOA 1PFPA 3EB8A 2CWTA 4K1VA 2QA43 4FMBA 5D82A 1WNHA 3D3LA 1ZO2A 3N9HA 3LTDA 5IW9A 3KFQC 1K734 3BNCA 2ZL8A 3PS8A 1IVWA 1SQWA 3K63A 3NV0A 1JB4A 1FGMA 2GU3A 2OTJ3 3EX9A 3FZWA 5KP4A 3J7Yd 3NXJA 4WP5A 2K0MA 4XBTA 3G0KA 1N9EA 4R4KA 4WFOA 3DGOA 1W02A 3QK9A 4FMAA 1KD14 3HX8A 4BTXA 1A67A 1OHPA 4AEQA 2OOVA 5I97A 3KE7A 1O7PB 1U8CB 1UI8A 3T0UA 2WOHA 8CHOA 3DGMA 3ALAA 2CG1A 3RGRA 1IV7A 4O2HA 1W5ZA 1R4CA 3S28A 5AYSC 2HMMB 2CIUA 1YGEA 2CKFB 3KN4A 2ZDJA 5IG3A 3MKIA 1ASKA 3GZRA 1Q42A 4G1MB 4O02B 1VQ43 3NBJA 1TFOA 3EN1B 4HZBB 5AIIA 1Q40A 1WMOA 3FF0A 4J9AA 5DRVA 5IG0A 3CPOA 1FA3A 3IJEB 5AIFA 3X40A 2P05A 1W6YA 2P09A 5JPUA 3B4PA 3PZWA 1YVBI 1N9JA 1N8R4 5AEWB 2WOFA 3EQQB 1Q824 5DREA 2YFIB 4CDLA 1E97A 3A76A 2JQ5A 4HM1B 3S29A 3CC43 2C10A 2XFTA 3CCJ3 1WQLB 1TFKA 3MHEA 1O7HB 2D1WA 4K90B 3BLZA 1VQM3 4CCVA 3ECFA 1U5OA 1W2ZA 1K41A 3WDGB 3CC73 1EQKA 1KC84 1W6GA 2BNGA 3LT9A 1NJI4 5CXOA 1QVF2 3LOYA 1AVLA 3OWSA 2ML5A 3T8NA 3X42A 4HM2B 3QRDA 4MMXB 3SXXA 2W03A 4EC6A 1AV4A 1JKGA 3HIIA 1QVG2 1VQ53 3MG3A 3SX1A 2KCDA 5CF2A 2XGLA 2RSXA 1W7CA 2GXFA 4HM6B 1VQL3 3F8HA 4FCJA 1VQ73 1JV2B 2CH9A 3CPW2 3F9SA 2XFSA 1OF5B 2HMOB 1GD3A 5IG4A 2CHCA 1O7GB 3PCRA 4RNZA 3JUPA 4MJDA 3IPTA 1N8QA 2W56B 7STDA 2HMKB 4H3UA 3FF2A 4HKVB 5FW5A 4BTWA 2WGQA 1ROAA 1ULJB 1LXEA 2WGOA 3BNEA 3DUKA 1YIT3 4IPBA 1IQYA 1TUHA 3H3HA 1WTHA 4XDWA 3WOFB 4HM8B 1N5HA 1ZX2A 3I0YA 1GY5A 3LTCA 3NHXA 2E2VA 2QIYA 1IVUA 3UL5A 1E3RA 1W01A 3HI7A 4FMCA 3OW22 1YI23 1OH0A 3LMLA 3GZYB 1FGOA 3MSOA 3PCSA 3EC9A 4XM4A 1M1XB 3IMAB 1A2VA 3NV0B 1D6UA 2CFKA 4OK0A 3I563 2JDIH 3BNDA 2Z76A 1JB2A 1M1K4 1O7MB 1A2KA 1RN7A 1RJOA 4FMDA 1YJN3 3GAXA 1JN5B 1JRQA 1RRLA 3F40A 2SBLA 3TDGA 1SIIA 1FGQA 2GU1A 3NBRA 2R4IA 4HM3B 1IT7A 1DMQA 3V99A 3OX9A 3F8XA 3FG1A 3KSPA 3N54B 4WYKA 3MPHA 3Q2PA 2O3OA 1MNLA 1OGZA 2LYXA 3S27A 1KSIA 1Q814 3MG2A 1Y4KA 3DGNA 1YJW3 4N6MA 4TX4A 1DYUA 1NWWA 1V74A 2STDA 3MYTA 1IV9A 3UB1A 2BHMA 1Q40B 1W00A 5EVHA 1VQ83 2OQEC 4EV2A 1VQK3 2RCDA 4KFFA 3I553 1STDA 1T5YA 4H61A 2XF3A 2XGNA 3NM2A 1NU3A 2KRTA 3DXOA 1NB5I 3LH4A 1ISKA 1VQ93 4HM0B 4EBGA 1STFI 2GEXA 1A90A 2HMJB 5JBSA 1NO3A 1UW1A 1G96A 2HMLB 2UX0A 4RBNA 3EN8A 2W9PA 1M904 3Q1CA 1FGRA 3EHCA 3CCU3 2CC3A 2CWUA 2F86B 1CEWI 2Y73A 3U97A 1VQ63 3JVCA 2F98A 3BNBA 3CNXA 1IQXA 2CG0A 1Q864 1CYUA 3CCQ3 5ELJA 2BMRB 2IUKA 1J2BA 4R9LA 1IVXA 3DMCA 3K0ZA 5KP3A 3ROBA 1RKYA 2BMQB 3S5CA 3WODG 3LTBA 4R1KA 3X3XA 3B4OA 3PXMA 1US1A 1LOXA 2YFLB 3X41A 2OCTA 3LYGA 1ROVA 4N6TA 5KP1A 2XSOB 4R80A 1ULIB 4HM7B 5AIHA 4XDVA 1VQO3 2P0MA 1WMPA 3FGYA 4HBRA 2BMOB 1EKMA 1GD4A 3K7CA 4O3VA 4K1UA 3B8LA 5AEUB 1W4NA 1TIJA 1QJGA 1W6CA 1IVVA 3HZPA 4J8TA 4O8SA 1DVDA 1RRHA 1SPUA 3SOAA 1K9M4 2CFGA 2YFJB 3U1WA 2B24B 5AYRB 1IQ8A 2Z77A 2HMNB 2E2TA 1EG9B 4HJLB 3GWRA 1IK3A 3CCS3 1JB5A 5TGNA 5IENA 1OGXA 2B1XB 4PEJA 2CFDA 1GYBA 2MF7A 4HVNA 2XH9A 1D6YA 3G4S3 3X3YA 3WA2X 1FUWA 3UJMA 2PNCA 3NM7A 1YHQ3 3AMOA 4K61A 2L4VA 1DMNA 3K5TA 4HM4B 4KFDA 3OWUA 3NQYA 3SLUA 4KVHA 2WO0A 2MC8A 3FH1A 2XR8B 1FGTA 1S723 1MOLA 2W04A 4X2HA 3V92A 4MMYB 3H51A 4XBXA 3GZXB 5EQLA 3DY5A 2OQEA 3KIIA 4N6OB 5AIGA 5D81A 1IU7A 1E3VA 2W9QA 2FXTA 4NREA 2QGUA 3V98A 2W0QA 1HU9A 1K28A 4L8OA 3CXC2 1VQN3 3CCR3 2K54A 4HYZA 4LSOA 4LMIA 3FKAA 4L8PA 5STDA 4XBYA 1QAKA 2YX9A 3NBBA 1OACA 4N6LA 1Q7Y4 4WYKB 3DGLA 3EE1A 2INXA 2RFRA 2Y74A 4AKZA 1IT8A 4WWUC 1DVCA 2F99A 2Z7AA 1JNQA 5IG5A 1N5PA 3EJVA 1IDPA 3WOEB 2QEX3 1QALA 3MWZA 1M9GA 4FR9A 1GS3A 3CCM3 1OCVA 4IT7A 1UI7A 1Z1SA 3VF1A 4WHAA 4KFEA 4ORLA 3NX0A 3PYJA 3CNMA 3CME3 2OTL3 1KWIA 3O8YA 3CMA3 4X2OA 3HK4A 5IEPA 3STDA 2KXGA 1K8A4 3M8CA 2A15A 2E2UA 4N3VA 3UL6A 1CYVA 2P38A 4RZMA 4LEHA 1JN5A 3B7CA 1OPYA 2FGTA 4JF8A 2GEYA 1OHOA 1JJ22 2PZVA 3SVAA 4N6NB 2IMJA 3JUOA 4N6V0 1NB3I 3EBYA 3WA3A 1PU4A 1VQP3 5AI1A 5FGOA 3PGBA 3CCV3 1SJWA 2P0XA 3FCSB 2CK3H 4IIAA 5ELUA 5BXQA 2RGQA 3CC23 3LT8A 3T8UA 3G16A 3OV4A 2XSHB 2BT3A 3N8BA 3CU3A 3ER7A 5IERA 3EBTA 3F7XA 1OUNA 3FLJA 3Q90A 6STDA 1GY6A 1JKGB 2W6JH 4MEIA 4OVMA 1LNHA 2FNQA 4RNYA 2Z6BA 3NUVA 1SIHA 1O7WB 3FG3A 3JUNA 3WMDA 4L7KA 3D9RA 5JPPA 1BUQA 3DM8A 4N6UA 2GBXB 3G6E3 4NHFA 5LC6A 1HKXA 3CCL3 2IA7A 3FG4A 4LGQA 4BTYA 1YJ93 1TP6A 2V1LA 4EYCA 5BVBA 5IF6A 2Q07A 4GB5A 1EA2A 1CQSA 2LQVA 2OOVC 3KSED 2CFWA 1WMNA 3KKGA 4HM5B 3OXAA 4EXRA 5G2GA 1UUVB 5CF1A 1F8NA 3G713 2CW9A 2OWPA 5CLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OUQ A;  3F7S A;  3F14 A;  4HZ9 B;  2GBW B;  4STD A;  1OHS A;  4XB5 A;  1UUW B;  1C7H A;  1DMM A;  3JUQ A;  1S5A A;  1OF5 A;  4U13 A;  5CK6 A;  3OWY A;  5HGR A;  2XRX B;  3MG1 A;  3RGA A;  3E99 A;  1GY7 A;  3BB9 A;  3EF8 A;  3DZL A;  3G8Z A;  1VZZ A;  4Q53 A;  4R9K A;  3KZT A;  3GZB A;  4I4K A;  2I9W A;  3VGN A;  3UNL A;  1O7N B;  3SED A;  3SOY A;  3GRD A;  3JUM A;  5D83 A;  1NDO B;  2W2C A;  3FSD A;  4FCM A;  1AR0 A;  3VSY A;  3LZA A;  1QMA A;  5IEO A;  4K1V A;  5D82 A;  1ZO2 A;  3NV0 A;  1JB4 A;  3EX9 A;  3FZW A;  5KP4 A;  3NXJ A;  4WP5 A;  4XBT A;  3G0K A;  1W02 A;  3HX8 A;  1OHP A;  3KE7 A;  1O7P B;  8CHO A;  3RGR A;  2HMM B;  2CKF B;  5IG3 A;  3MKI A;  1ASK A;  3GZR A;  1Q42 A;  3EN1 B;  4HZB B;  5AII A;  1Q40 A;  3FF0 A;  4J9A A;  5DRV A;  5IG0 A;  3CPO A;  5AIF A;  1W6Y A;  5JPU A;  3B4P A;  5AEW B;  3EQQ B;  5DRE A;  2YFI B;  4CDL A;  1E97 A;  3A76 A;  2JQ5 A;  4HM1 B;  1WQL B;  3MHE A;  1O7H B;  3BLZ A;  3ECF A;  1U5O A;  1K41 A;  2BNG A;  5CXO A;  3OWS A;  3T8N A;  4HM2 B;  1JKG A;  3MG3 A;  5CF2 A;  2GXF A;  4HM6 B;  3F8H A;  4FCJ A;  3F9S A;  1OF5 B;  2HMO B;  5IG4 A;  2CHC A;  1O7G B;  3JUP A;  4MJD A;  3IPT A;  7STD A;  2HMK B;  4H3U A;  3FF2 A;  4HKV B;  5FW5 A;  1ULJ B;  3DUK A;  1TUH A;  3H3H A;  4XDW A;  4HM8 B;  1ZX2 A;  3I0Y A;  1GY5 A;  3NHX A;  2QIY A;  1E3R A;  1W01 A;  1OH0 A;  3GZY B;  3MSO A;  3EC9 A;  4XM4 A;  3NV0 B;  2Z76 A;  1JB2 A;  1O7M B;  1A2K A;  1JN5 B;  3F40 A;  3NBR A;  2R4I A;  4HM3 B;  1DMQ A;  3OX9 A;  3KSP A;  3F8X A;  4WYK A;  1OGZ A;  3MG2 A;  1NWW A;  2STD A;  3MYT A;  1Q40 B;  1W00 A;  5EVH A;  2RCD A;  1STD A;  3NM2 A;  1NU3 A;  3DXO A;  1ISK A;  4HM0 B;  2GEX A;  2HMJ B;  2HML B;  2UX0 A;  3EN8 A;  3EHC A;  2F86 B;  2F98 A;  3CNX A;  2BMR B;  4R9L A;  3DMC A;  3K0Z A;  5KP3 A;  3ROB A;  2BMQ B;  3S5C A;  4R1K A;  3B4O A;  2YFL B;  3LYG A;  5KP1 A;  2XSO B;  1ULI B;  4HM7 B;  5AIH A;  4XDV A;  3FGY A;  2BMO B;  3K7C A;  4K1U A;  3B8L A;  5AEU B;  1QJG A;  3HZP A;  4J8T A;  3SOA A;  2YFJ B;  2B24 B;  2Z77 A;  2HMN B;  1EG9 B;  4HJL B;  3GWR A;  5TGN A;  1JB5 A;  5IEN A;  1OGX A;  2B1X B;  4PEJ A;  1GYB A;  4HVN A;  3UJM A;  1DMN A;  4HM4 B;  3OWU A;  4KVH A;  3FH1 A;  2XR8 B;  4X2H A;  3H51 A;  4XBX A;  3GZX B;  5AIG A;  5D81 A;  1E3V A;  2QGU A;  4L8O A;  2K54 A;  4LMI A;  3FKA A;  4L8P A;  5STD A;  4XBY A;  4WYK B;  2INX A;  2RFR A;  4WWU C;  2F99 A;  2Z7A A;  5IG5 A;  3EJV A;  1IDP A;  1GS3 A;  1OCV A;  1Z1S A;  4ORL A;  3CNM A;  4X2O A;  3HK4 A;  5IEP A;  3STD A;  3M8C A;  2A15 A;  4N3V A;  4RZM A;  4LEH A;  1JN5 A;  3B7C A;  1OPY A;  2GEY A;  1OHO A;  2PZV A;  2IMJ A;  3JUO A;  3EBY A;  5AI1 A;  1SJW A;  4IIA A;  5BXQ A;  2RGQ A;  3T8U A;  3G16 A;  3OV4 A;  2XSH B;  3CU3 A;  3ER7 A;  5IER A;  3EBT A;  3F7X A;  1OUN A;  3FLJ A;  3Q90 A;  6STD A;  1GY6 A;  1JKG B;  4OVM A;  3NUV A;  1O7W B;  3JUN A;  3WMD A;  4L7K A;  3D9R A;  5JPP A;  1BUQ A;  3DM8 A;  2GBX B;  1HKX A;  4LGQ A;  1TP6 A;  5BVB A;  5IF6 A;  4GB5 A;  1EA2 A;  1CQS A;  3KKG A;  4HM5 B;  3OXA A;  5G2G A;  1UUV B;  5CF1 A;  2OWP A;  5CLK A; 
#chains in the Genus database with same CATH topology
 1LVN A;  1B21 A;  2L1S A;  1UCL A;  4OUQ A;  2KF6 A;  1AVK A;  3S67 A;  4AKY A;  4JRF A;  2F5W A;  1I3F A;  3AMO B;  1GOV A;  3F7S A;  5EEO A;  1QAF A;  1V57 A;  3RDE A;  3F14 A;  4HZ9 B;  2BO9 B;  4QWT A;  1RLS A;  3HIG A;  2GBW B;  4STD A;  1OHS A;  4EV5 A;  4XB5 A;  1UUW B;  1C7H A;  4MMZ B;  1DMM A;  3JUQ A;  1S5A A;  5G1L A;  1BIR A;  1LRA A;  2KF5 A;  1OF5 A;  4KZ1 A;  4GL6 A;  4U13 A;  5CK6 A;  4ZM8 A;  1BAO A;  3OWY A;  5HGR A;  3K9M C;  4LZI A;  2XRX B;  1B3S A;  2XEP A;  3MG1 A;  3LXU X;  2AAD A;  3CCE 3;  3RGA A;  4J5K A;  2W56 A;  3GSP A;  1RMS A;  1BNI A;  1X1X A;  3E99 A;  3L0R A;  3D4A A;  2IY2 A;  1GY7 A;  3BB9 A;  4FCZ A;  3EF8 A;  3DZL A;  3G8Z A;  2CFL A;  2C11 A;  2D42 A;  1JZD A;  1VZZ A;  3NQZ A;  4Q53 A;  4R9K A;  3X3Z A;  5A0O B;  1TU5 A;  3KZT A;  1YIJ 3;  3GZB A;  4I4K A;  1BOX A;  2I9W A;  3VGN A;  1BNG A;  1RGL A;  2CWV A;  1RN4 A;  3UNL A;  1O7N B;  1L5G B;  2ML6 A;  3SED A;  3SOY A;  1D6Z A;  1ZGX A;  5M19 A;  3GRD A;  3JUM A;  5D83 A;  2O9U X;  1T3B A;  1EUI C;  1GOY A;  1NDO B;  2W2C A;  3FSD A;  4FCM A;  1AR0 A;  2M7O A;  1TRP A;  2IUJ A;  1W2B 2;  4I5Q A;  4NPB A;  3VSY A;  3LZA A;  3CD6 3;  1QMA A;  3LTA A;  5LC7 A;  1I2F A;  1PFP A;  5IEO A;  3EB8 A;  2CWT A;  4K1V A;  2QA4 3;  4FMB A;  5D82 A;  1WNH A;  3D3L A;  1ZO2 A;  3N9H A;  3LTD A;  5IW9 A;  3KFQ C;  1K73 4;  3BNC A;  2ZL8 A;  2F4Y A;  3PS8 A;  1IVW A;  1SQW A;  3K63 A;  3NV0 A;  1JB4 A;  1FGM A;  2H0H A;  4BU4 A;  2GU3 A;  2OTJ 3;  1Q7H A;  3EX9 A;  3FZW A;  5KP4 A;  3J7Y d;  3NXJ A;  4WP5 A;  2K0M A;  4XBT A;  1BGS A;  3G0K A;  1N9E A;  4R4K A;  4WFO A;  3DGO A;  1W02 A;  3QK9 A;  4FMA A;  1KD1 4;  3HX8 A;  4BTX A;  1UCJ A;  1A67 A;  1OHP A;  4AEQ A;  2OOV A;  5I97 A;  3KE7 A;  1O7P B;  1U8C B;  1UI8 A;  3T0U A;  1C54 A;  2WOH A;  8CHO A;  3A5E A;  3DGM A;  1RGF A;  1GOU A;  3ALA A;  2CG1 A;  3RGR A;  1IV7 A;  4O2H A;  1W5Z A;  1R4C A;  3S28 A;  5AYS C;  2HMM B;  2CIU A;  1GMQ A;  1YGE A;  2CKF B;  3KN4 A;  2ZDJ A;  3RNT A;  5IG3 A;  3MKI A;  1BSC A;  1ASK A;  3GZR A;  1Q42 A;  4G1M B;  4O02 B;  1VQ4 3;  3NBJ A;  1PYL A;  1TFO A;  3EN1 B;  4HZB B;  5AII A;  1Q40 A;  1TJD A;  1WMO A;  4HOH A;  1I0V A;  3FF0 A;  4J9A A;  5DRV A;  3CPO A;  5IG0 A;  7GSP A;  3IJE B;  1FA3 A;  5AIF A;  3X40 A;  2P05 A;  1W6Y A;  2P09 A;  5JPU A;  1BNR A;  3B4P A;  3PZW A;  1YVB I;  1N9J A;  1N8R 4;  5AEW B;  2WOF A;  3EQQ B;  1Q82 4;  5DRE A;  2YFI B;  2RBI A;  4CDL A;  1E97 A;  1X1U A;  3A76 A;  2JQ5 A;  4HM1 B;  3S29 A;  3CC4 3;  2C10 A;  2XFT A;  3CCJ 3;  1BNF A;  1WQL B;  1TFK A;  3MHE A;  1O7H B;  2D1W A;  3DH2 A;  3BLZ A;  4K90 B;  3ZFZ A;  4CCV A;  5HOH A;  3ECF A;  1VQM 3;  1U5O A;  2HOH A;  1YJ9 3;  1W2Z A;  1K41 A;  3WDG B;  3CC7 3;  1EQK A;  1KC8 4;  1W6G A;  2BNG A;  3LT9 A;  1NJI 4;  1RNB A;  5CXO A;  1QVF 2;  3LOY A;  1AVL A;  3OWS A;  2ML5 A;  3T8N A;  3X42 A;  4HM2 B;  3QRD A;  4MMX B;  3SXX A;  2W03 A;  4BL2 A;  1AV4 A;  1JKG A;  3HII A;  4EC6 A;  1QVG 2;  1VQ5 3;  2AAE A;  3MG3 A;  3SX1 A;  2KCD A;  5CF2 A;  2XGL A;  2RSX A;  1W7C A;  2GXF A;  4HM6 B;  1VQL 3;  3F8H A;  1PY3 A;  1I0X A;  4FCJ A;  1VQ7 3;  1RNT A;  1JV2 B;  2CH9 A;  3CPW 2;  3F9S A;  2XFS A;  5G1K A;  1OF5 B;  2HMO B;  1GD3 A;  1RN1 A;  5IG4 A;  1BSE A;  2CHC A;  1O7G B;  4BL3 A;  3PCR A;  4RNZ A;  2UGI A;  3JUP A;  1MWU A;  4MJD A;  3IPT A;  1N8Q A;  2W56 B;  1BRS A;  7STD A;  1BSA A;  2HMK B;  4H3U A;  3FF2 A;  1B2S A;  4HKV B;  5FW5 A;  2ZHX B;  4BTW A;  1ROA A;  2WGQ A;  1ULJ B;  1LXE A;  2H0G A;  2WGO A;  3BNE A;  3DUK A;  1YIT 3;  4IPB A;  1IQY A;  1TUH A;  3H3H A;  1WTH A;  4XDW A;  1BU4 A;  3WOF B;  4HM8 B;  3AGO A;  1N5H A;  1CH0 A;  1UGI A;  1ZX2 A;  3I0Y A;  1GY5 A;  1RGK A;  3LTC A;  3AGN A;  1RCL A;  1B2Z A;  3NHX A;  2E2V A;  2QIY A;  1IVU A;  1LQG C;  3UL5 A;  1E3R A;  2ZA4 A;  1W01 A;  3HI7 A;  1HYF A;  4FMC A;  3OW2 2;  1YI2 3;  1OH0 A;  3LML A;  3GZY B;  1FGO A;  3MSO A;  3PCS A;  3EC9 A;  4XM4 A;  1M1X B;  3IMA B;  1A2V A;  3NV0 B;  1RDS A;  1UUG B;  1D6U A;  2CFK A;  4RNT A;  4OK0 A;  1T2I A;  2JDI H;  3D5G A;  3BND A;  3I56 3;  2Z76 A;  1JB2 A;  1M1K 4;  1O7M B;  1A2K A;  1BNS A;  4ILF A;  1RN7 A;  1RJO A;  4FMD A;  1YJN 3;  3GAX A;  1JN5 B;  1JRQ A;  1RRL A;  3F40 A;  1BRN L;  2BIR A;  2SBL A;  3TDG A;  1SII A;  1FGQ A;  2GU1 A;  3NBR A;  5GSP A;  1ZS7 A;  1BRK A;  1SAR A;  3AHW A;  1G02 A;  2R4I A;  4HM3 B;  1A2P A;  1IT7 A;  1DMQ A;  1LOV A;  3V99 A;  1EEJ A;  3OX9 A;  3F8X A;  3FG1 A;  3KSP A;  3N54 B;  4WYK A;  3MPH A;  3Q2P A;  2O3O A;  1MNL A;  1OGZ A;  2BU4 A;  2LYX A;  3S27 A;  1KSI A;  1UGH I;  1Q81 4;  3MG2 A;  1Y4K A;  3DGN A;  1YJW 3;  1I8V A;  1GMP A;  4N6M A;  4TX4 A;  1DYU A;  1NWW A;  1V74 A;  2STD A;  3MYT A;  1IV9 A;  3UB1 A;  9RNT A;  2BHM A;  1Q40 B;  1W00 A;  5EVH A;  1VQ8 3;  2OQE C;  4EV2 A;  1VQK 3;  2RCD A;  1VQQ A;  3Q3F A;  4KFF A;  3I55 3;  1STD A;  1T5Y A;  4H61 A;  1BRI A;  2XF3 A;  2XGN A;  1AQZ A;  3NM2 A;  1NU3 A;  2KRT A;  3DXO A;  5BU4 A;  1NB5 I;  3LH4 A;  1ISK A;  1VQ9 3;  4HM0 B;  4EBG A;  1STF I;  1TRQ A;  2GEX A;  1A90 A;  2HMJ B;  5JBS A;  1NO3 A;  1UW1 A;  1G96 A;  2HML B;  2UX0 A;  4RBN A;  3EN8 A;  1MWS A;  2W9P A;  1Q9E A;  2J8X B;  3Q1C A;  1JZO A;  1FGR A;  3EHC A;  6GSP A;  1M90 4;  3CCU 3;  2CC3 A;  1RSN A;  2CWU A;  2F86 B;  1CEW I;  2Y73 A;  3U97 A;  1VQ6 3;  1RTU A;  3JVC A;  2F98 A;  3BNB A;  3CNX A;  7RNT A;  1IQX A;  2CG0 A;  1Q86 4;  1MGW A;  1CYU A;  1B2X A;  3CCQ 3;  5ELJ A;  1GSP A;  2BMR B;  2IUK A;  1YGW A;  1J2B A;  4R9L A;  2K3D A;  1IVX A;  3DMC A;  3K0Z A;  5KP3 A;  3ROB A;  1RKY A;  2BMQ B;  3S5C A;  1TTO A;  3WOD G;  3LTB A;  4R1K A;  3X3X A;  3B4O A;  3PXM A;  1US1 A;  1LOX A;  2YFL B;  1FW7 A;  1B27 A;  3X41 A;  2OCT A;  5M18 A;  3LYG A;  1ROV A;  4N6T A;  5KP1 A;  2XSO B;  4R80 A;  1ULI B;  4HM7 B;  5AIH A;  4XDV A;  2CX1 A;  2F5M A;  1LOY A;  1VQO 3;  1UCK A;  1WMP A;  2P0M A;  3FGY A;  4HBR A;  2BMO B;  1EKM A;  1B20 A;  1GD4 A;  5BIR A;  2F56 A;  3K7C A;  4O3V A;  4K1U A;  3B8L A;  1DET A;  3ZG0 A;  2KF3 A;  5AEU B;  1W4N A;  1TIJ A;  1V58 A;  1QJG A;  1W6C A;  1IVV A;  1FZU A;  3HZP A;  4J8T A;  4O8S A;  1DVD A;  1RRH A;  4LYL B;  1I2G A;  1G0T A;  1SPU A;  3SOA A;  2CFG A;  2YFJ B;  4CJN A;  3CC2 3;  1K9M 4;  1X1Y A;  3U1W A;  2B24 B;  5AYR B;  1BVI A;  1IQ8 A;  2Z77 A;  2HMN B;  2E2T A;  1EG9 B;  4HJL B;  1FYS A;  3GWR A;  1IK3 A;  3CCS 3;  1JB5 A;  5TGN A;  5IEN A;  1OGX A;  2B1X B;  4GHO A;  1R4Y A;  2CFD A;  1GYB A;  2MF7 A;  4PEJ A;  4HVN A;  2XH9 A;  1D6Y A;  3G4S 3;  2IYJ A;  4GSP A;  3X3Y A;  3WA2 X;  1FUW A;  6RNT A;  1RGA A;  3UJM A;  2PNC A;  3NM7 A;  1IYY A;  1YHQ 3;  3AMO A;  4K61 A;  1NNV A;  2L4V A;  1DMN A;  3K5T A;  4HM4 B;  4KFD A;  3OWU A;  3NQY A;  3SLU A;  4KVH A;  2WO0 A;  2MC8 A;  1FUS A;  3FH1 A;  2XR8 B;  1FGT A;  1S72 3;  1MOL A;  2W04 A;  4CPK A;  4X2H A;  3V92 A;  1LQM B;  3AHS A;  4MMY B;  3H51 A;  4XBX A;  3GZX B;  5EQL A;  3DY5 A;  1BRJ A;  2OQE A;  3KII A;  4N6O B;  5AIG A;  4HAA A;  1IU7 A;  5D81 A;  1I2E A;  2RNT A;  1E3V A;  1KQS 2;  2W9Q A;  1DE3 A;  2FXT A;  4NRE A;  1MGR A;  2QGU A;  3V98 A;  2W0Q A;  1HU9 A;  1K28 A;  4L8O A;  1BSB A;  3WR2 A;  3CXC 2;  1VQN 3;  1X1W A;  3CCR 3;  2K54 A;  4HYZ A;  4LSO A;  4LMI A;  3FKA A;  4L8P A;  5M1A A;  4XBY A;  1QAK A;  2YX9 A;  3NBB A;  1OAC A;  4N6L A;  5STD A;  1JBS A;  3URP A;  1Q7Y 4;  4WYK B;  3DGL A;  3EE1 A;  2C4B A;  1BRG A;  2INX A;  2RFR A;  2Y74 A;  4AKZ A;  1IT8 A;  1RCK A;  4WWU C;  1JBR A;  1DVC A;  2F99 A;  1B2M A;  2UUG C;  1BRH A;  1JNQ A;  2Z7A A;  5IG5 A;  2GSP A;  1LOW A;  1N5P A;  3EJV A;  1IDP A;  3WOE B;  2QEX 3;  1QAL A;  3MWZ A;  1M9G A;  4FR9 A;  1GS3 A;  3CCM 3;  1OCV A;  1RGH A;  1UI7 A;  1RGE A;  1RHL A;  1BSD A;  1YNV X;  1Z1S A;  4IT7 A;  4KFE A;  3DGY A;  4WHA A;  3SYU A;  3VF1 A;  4ORL A;  3NX0 A;  3PYJ A;  3CNM A;  3CME 3;  2OTL 3;  1KWI A;  3O8Y A;  3CMA 3;  2CX0 A;  1B2U A;  4X2O A;  3HK4 A;  5IEP A;  3STD A;  2KXG A;  1K8A 4;  1YVS A;  3M8C A;  1MWR A;  2A15 A;  2E2U A;  4N3V A;  3UL6 A;  1CYV A;  2P38 A;  4RZM A;  4LEH A;  3BU4 A;  1JN5 A;  3B7C A;  1MWT A;  1OPY A;  2FGT A;  4JF8 A;  2GEY A;  1OHO A;  1GMR A;  1RGG A;  2PZV A;  3SVA A;  1JJ2 2;  4J5G A;  1JBT A;  4KT3 B;  4N6N B;  2IMJ A;  3JUO A;  4N6V 0;  2KF4 A;  1NB3 I;  3EBY A;  1I3I A;  3WA3 A;  8RNT A;  1PU4 A;  1VQP 3;  1RGC A;  5AI1 A;  3PGB A;  5FGO A;  3CCV 3;  1SJW A;  2P0X A;  3FCS B;  2CK3 H;  2R41 A;  4IIA A;  5ELU A;  5BXQ A;  2RGQ A;  1UDI I;  3LT8 A;  3T8U A;  1T2H A;  3D79 A;  3G16 A;  3OV4 A;  1AY7 A;  3ZG5 A;  2XSH B;  1BUJ A;  2BT3 A;  3N8B A;  3CU3 A;  3ER7 A;  5IER A;  3EBT A;  3F7X A;  1OUN A;  3FLJ A;  1HZ1 A;  3Q90 A;  6STD A;  3D5I A;  1GY6 A;  1JKG B;  2W6J H;  4MEI A;  4OVM A;  1LNH A;  2FNQ A;  4RNY A;  1BAN A;  2Z6B A;  1BNE A;  3NUV A;  1SIH A;  1O7W B;  3FG3 A;  1I70 A;  3JUN A;  3WMD A;  4L7K A;  3D9R A;  5JPP A;  1BUQ A;  3DM8 A;  3KCH A;  4N6U A;  2GBX B;  3G6E 3;  4NHF A;  5LC6 A;  1HKX A;  4BIR A;  3CCL 3;  2IA7 A;  3FG4 A;  1FUT A;  4LGQ A;  4BTY A;  1TP6 A;  2V1L A;  4EYC A;  3BIR A;  5BVB A;  2Q07 A;  1BNJ A;  4GB5 A;  5IF6 A;  1UCI A;  1EA2 A;  1CQS A;  2LQV A;  2OOV C;  2KAA A;  1LNI A;  3KSE D;  2CFW A;  1WMN A;  3KKG A;  4HM5 B;  3OXA A;  4EXR A;  5G2G A;  1UUV B;  5CF1 A;  4EW5 A;  5RNT A;  1F8N A;  3G71 3;  2CW9 A;  2SAR A;  4DKI A;  3HOH A;  2OWP A;  2H0I A;  5CLK A;  3WHO A; 
#chains in the Genus database with same CATH homology
 1LVN A;  4OUQ A;  1AVK A;  3S67 A;  4AKY A;  4JRF A;  3AMO B;  3F7S A;  5EEO A;  1QAF A;  3RDE A;  3F14 A;  4HZ9 B;  2BO9 B;  4QWT A;  3HIG A;  2GBW B;  4STD A;  1OHS A;  4EV5 A;  4XB5 A;  1UUW B;  1C7H A;  4MMZ B;  1DMM A;  3JUQ A;  1S5A A;  1OF5 A;  4KZ1 A;  4GL6 A;  4U13 A;  5CK6 A;  4ZM8 A;  3OWY A;  5HGR A;  3K9M C;  4LZI A;  2XRX B;  2XEP A;  3MG1 A;  3LXU X;  3CCE 3;  3RGA A;  2W56 A;  3E99 A;  3L0R A;  1GY7 A;  3BB9 A;  4FCZ A;  3EF8 A;  3DZL A;  3G8Z A;  2CFL A;  2C11 A;  2D42 A;  1VZZ A;  3NQZ A;  4Q53 A;  4R9K A;  3X3Z A;  5A0O B;  1TU5 A;  1YIJ 3;  3KZT A;  3GZB A;  4I4K A;  2I9W A;  3VGN A;  2CWV A;  3UNL A;  1O7N B;  1L5G B;  2ML6 A;  3SED A;  3SOY A;  1D6Z A;  3GRD A;  3JUM A;  5D83 A;  2O9U X;  1NDO B;  2W2C A;  3FSD A;  2IUJ A;  4FCM A;  1KQS 2;  1AR0 A;  2M7O A;  1W2B 2;  3VSY A;  3LZA A;  3CD6 3;  1QMA A;  3LTA A;  5LC7 A;  5IEO A;  1PFP A;  3EB8 A;  2CWT A;  4K1V A;  2QA4 3;  4FMB A;  5D82 A;  1WNH A;  3D3L A;  1ZO2 A;  3N9H A;  3LTD A;  5IW9 A;  3KFQ C;  1K73 4;  3BNC A;  2ZL8 A;  3PS8 A;  1IVW A;  1SQW A;  3K63 A;  3NV0 A;  1JB4 A;  1FGM A;  2GU3 A;  2OTJ 3;  3EX9 A;  3FZW A;  5KP4 A;  3J7Y d;  3NXJ A;  4WP5 A;  2K0M A;  4XBT A;  3G0K A;  1N9E A;  4R4K A;  4WFO A;  3DGO A;  1W02 A;  3QK9 A;  4FMA A;  1KD1 4;  3HX8 A;  4BTX A;  1A67 A;  1OHP A;  4AEQ A;  2OOV A;  5I97 A;  3KE7 A;  1O7P B;  1U8C B;  1UI8 A;  3T0U A;  2WOH A;  8CHO A;  3DGM A;  3ALA A;  2CG1 A;  3RGR A;  1IV7 A;  4O2H A;  1W5Z A;  1R4C A;  3S28 A;  5AYS C;  2HMM B;  2CIU A;  1YGE A;  2CKF B;  3KN4 A;  2ZDJ A;  5IG3 A;  3MKI A;  1ASK A;  3GZR A;  1Q42 A;  4G1M B;  4O02 B;  1VQ4 3;  3NBJ A;  1TFO A;  3EN1 B;  4HZB B;  5AII A;  1Q40 A;  1WMO A;  3FF0 A;  4J9A A;  5DRV A;  5IG0 A;  3CPO A;  1FA3 A;  3IJE B;  5AIF A;  3X40 A;  2P05 A;  1W6Y A;  2P09 A;  5JPU A;  3B4P A;  3PZW A;  1YVB I;  1N9J A;  1N8R 4;  5AEW B;  2WOF A;  3EQQ B;  1Q82 4;  5DRE A;  2YFI B;  4CDL A;  1E97 A;  3A76 A;  2JQ5 A;  4HM1 B;  3S29 A;  3CC4 3;  2C10 A;  2XFT A;  3CCJ 3;  1WQL B;  1TFK A;  3MHE A;  1O7H B;  2D1W A;  4K90 B;  3BLZ A;  1VQM 3;  4CCV A;  3ECF A;  1U5O A;  1W2Z A;  1K41 A;  3WDG B;  3CC7 3;  1EQK A;  1KC8 4;  1W6G A;  2BNG A;  3LT9 A;  1NJI 4;  5CXO A;  1QVF 2;  3LOY A;  1AVL A;  3OWS A;  2ML5 A;  3T8N A;  3X42 A;  4HM2 B;  3QRD A;  4MMX B;  3SXX A;  2W03 A;  4EC6 A;  1AV4 A;  1JKG A;  3HII A;  1QVG 2;  1VQ5 3;  3MG3 A;  3SX1 A;  2KCD A;  5CF2 A;  2XGL A;  2RSX A;  1W7C A;  2GXF A;  4HM6 B;  1VQL 3;  3F8H A;  4FCJ A;  1VQ7 3;  1JV2 B;  2CH9 A;  3CPW 2;  3F9S A;  2XFS A;  1OF5 B;  2HMO B;  1GD3 A;  5IG4 A;  2CHC A;  1O7G B;  3PCR A;  4RNZ A;  3JUP A;  4MJD A;  3IPT A;  1N8Q A;  2W56 B;  7STD A;  2HMK B;  4H3U A;  3FF2 A;  4HKV B;  5FW5 A;  4BTW A;  2WGQ A;  1ROA A;  1ULJ B;  1LXE A;  2WGO A;  3BNE A;  3DUK A;  1YIT 3;  4IPB A;  1IQY A;  1TUH A;  3H3H A;  1WTH A;  4XDW A;  3WOF B;  4HM8 B;  1N5H A;  1ZX2 A;  3I0Y A;  1GY5 A;  3LTC A;  3NHX A;  2E2V A;  2QIY A;  1IVU A;  3UL5 A;  1E3R A;  1W01 A;  3HI7 A;  4FMC A;  3OW2 2;  1YI2 3;  1OH0 A;  3LML A;  3GZY B;  1FGO A;  3MSO A;  3PCS A;  3EC9 A;  4XM4 A;  1M1X B;  3IMA B;  1A2V A;  3NV0 B;  1D6U A;  2CFK A;  4OK0 A;  3I56 3;  2JDI H;  3BND A;  2Z76 A;  1JB2 A;  1M1K 4;  1O7M B;  1A2K A;  1RN7 A;  1RJO A;  4FMD A;  1YJN 3;  3GAX A;  1JN5 B;  1JRQ A;  1RRL A;  3F40 A;  2SBL A;  3TDG A;  1SII A;  1FGQ A;  2GU1 A;  3NBR A;  2R4I A;  4HM3 B;  1IT7 A;  1DMQ A;  3V99 A;  3OX9 A;  3F8X A;  3FG1 A;  3KSP A;  3N54 B;  4WYK A;  3MPH A;  3Q2P A;  2O3O A;  1MNL A;  1OGZ A;  2LYX A;  3S27 A;  1KSI A;  1Q81 4;  3MG2 A;  1Y4K A;  3DGN A;  1YJW 3;  4N6M A;  4TX4 A;  1DYU A;  1NWW A;  1V74 A;  2STD A;  3MYT A;  1IV9 A;  3UB1 A;  2BHM A;  1Q40 B;  1W00 A;  5EVH A;  1VQ8 3;  2OQE C;  4EV2 A;  1VQK 3;  2RCD A;  4KFF A;  3I55 3;  1STD A;  1T5Y A;  4H61 A;  2XF3 A;  2XGN A;  3NM2 A;  1NU3 A;  2KRT A;  3DXO A;  1NB5 I;  3LH4 A;  1ISK A;  1VQ9 3;  4HM0 B;  4EBG A;  1STF I;  2GEX A;  1A90 A;  2HMJ B;  5JBS A;  1NO3 A;  1UW1 A;  1G96 A;  2HML B;  2UX0 A;  4RBN A;  3EN8 A;  2W9P A;  1M90 4;  3Q1C A;  1FGR A;  3EHC A;  3CCU 3;  2CC3 A;  2CWU A;  2F86 B;  1CEW I;  2Y73 A;  3U97 A;  1VQ6 3;  3JVC A;  2F98 A;  3BNB A;  3CNX A;  1IQX A;  2CG0 A;  1Q86 4;  1CYU A;  3CCQ 3;  5ELJ A;  2BMR B;  2IUK A;  1J2B A;  4R9L A;  1IVX A;  3DMC A;  3K0Z A;  5KP3 A;  3ROB A;  1RKY A;  2BMQ B;  3S5C A;  3WOD G;  3LTB A;  4R1K A;  3X3X A;  3B4O A;  3PXM A;  1US1 A;  1LOX A;  2YFL B;  3X41 A;  2OCT A;  3LYG A;  1ROV A;  4N6T A;  5KP1 A;  2XSO B;  4R80 A;  1ULI B;  4HM7 B;  5AIH A;  4XDV A;  1VQO 3;  2P0M A;  1WMP A;  3FGY A;  4HBR A;  2BMO B;  1EKM A;  1GD4 A;  3K7C A;  4O3V A;  4K1U A;  3B8L A;  5AEU B;  1W4N A;  1TIJ A;  1QJG A;  1W6C A;  1IVV A;  3HZP A;  4J8T A;  4O8S A;  1DVD A;  1RRH A;  1SPU A;  3SOA A;  1K9M 4;  2CFG A;  2YFJ B;  3U1W A;  2B24 B;  5AYR B;  1IQ8 A;  2Z77 A;  2HMN B;  2E2T A;  1EG9 B;  4HJL B;  3GWR A;  1IK3 A;  3CCS 3;  1JB5 A;  5TGN A;  5IEN A;  1OGX A;  2B1X B;  4PEJ A;  2CFD A;  1GYB A;  2MF7 A;  4HVN A;  2XH9 A;  1D6Y A;  3G4S 3;  3X3Y A;  3WA2 X;  1FUW A;  3UJM A;  2PNC A;  3NM7 A;  1YHQ 3;  3AMO A;  4K61 A;  2L4V A;  1DMN A;  3K5T A;  4HM4 B;  4KFD A;  3OWU A;  3NQY A;  3SLU A;  4KVH A;  2WO0 A;  2MC8 A;  3FH1 A;  2XR8 B;  1FGT A;  1S72 3;  1MOL A;  2W04 A;  4X2H A;  3V92 A;  4MMY B;  3H51 A;  4XBX A;  3GZX B;  5EQL A;  3DY5 A;  2OQE A;  3KII A;  4N6O B;  5AIG A;  5D81 A;  1IU7 A;  1E3V A;  2W9Q A;  2FXT A;  4NRE A;  2QGU A;  3V98 A;  2W0Q A;  1HU9 A;  1K28 A;  4L8O A;  3CXC 2;  1VQN 3;  3CCR 3;  2K54 A;  4HYZ A;  4LSO A;  4LMI A;  3FKA A;  4L8P A;  5STD A;  4XBY A;  1QAK A;  2YX9 A;  3NBB A;  1OAC A;  4N6L A;  1Q7Y 4;  4WYK B;  3DGL A;  3EE1 A;  2INX A;  2RFR A;  2Y74 A;  4AKZ A;  1IT8 A;  4WWU C;  1DVC A;  2F99 A;  2Z7A A;  1JNQ A;  5IG5 A;  1N5P A;  3EJV A;  1IDP A;  3WOE B;  2QEX 3;  1QAL A;  3MWZ A;  1M9G A;  4FR9 A;  1GS3 A;  3CCM 3;  1OCV A;  4IT7 A;  1UI7 A;  1Z1S A;  3VF1 A;  4WHA A;  4KFE A;  4ORL A;  3NX0 A;  3PYJ A;  3CNM A;  3CME 3;  2OTL 3;  1KWI A;  3O8Y A;  3CMA 3;  4X2O A;  3HK4 A;  5IEP A;  3STD A;  2KXG A;  1K8A 4;  3M8C A;  2A15 A;  2E2U A;  4N3V A;  3UL6 A;  1CYV A;  2P38 A;  4RZM A;  4LEH A;  1JN5 A;  3B7C A;  1OPY A;  2FGT A;  4JF8 A;  2GEY A;  1OHO A;  1JJ2 2;  2PZV A;  3SVA A;  4N6N B;  2IMJ A;  3JUO A;  4N6V 0;  1NB3 I;  3EBY A;  3WA3 A;  1PU4 A;  1VQP 3;  5AI1 A;  5FGO A;  3PGB A;  3CCV 3;  1SJW A;  2P0X A;  3FCS B;  2CK3 H;  4IIA A;  5ELU A;  5BXQ A;  2RGQ A;  3CC2 3;  3LT8 A;  3T8U A;  3G16 A;  3OV4 A;  2XSH B;  2BT3 A;  3N8B A;  3CU3 A;  3ER7 A;  5IER A;  3EBT A;  3F7X A;  1OUN A;  3FLJ A;  3Q90 A;  6STD A;  1GY6 A;  1JKG B;  2W6J H;  4MEI A;  4OVM A;  1LNH A;  2FNQ A;  4RNY A;  2Z6B A;  3NUV A;  1SIH A;  1O7W B;  3FG3 A;  3JUN A;  3WMD A;  4L7K A;  3D9R A;  5JPP A;  1BUQ A;  3DM8 A;  4N6U A;  2GBX B;  3G6E 3;  4NHF A;  5LC6 A;  1HKX A;  3CCL 3;  2IA7 A;  3FG4 A;  4LGQ A;  4BTY A;  1YJ9 3;  1TP6 A;  2V1L A;  4EYC A;  5BVB A;  5IF6 A;  2Q07 A;  4GB5 A;  1EA2 A;  1CQS A;  2LQV A;  2OOV C;  3KSE D;  2CFW A;  1WMN A;  3KKG A;  4HM5 B;  3OXA A;  4EXR A;  5G2G A;  1UUV B;  5CF1 A;  1F8N A;  3G71 3;  2CW9 A;  2OWP A;  5CLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...