3FLJA

Crystal structure of uncharacterized protein conserved in bacteria with a cystatin-like fold (yp_168589.1) from silicibacter pomeroyi dss-3 at 2.00 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
LYFQGMHPTIARMQEVVAKGDESLIHALLAEDVRFMPPTYYKTWTGRDPVAAVLGHVGQVFSEFRYRRIMGEGKDWALEFQCKVGELDAVGVDLITLNEGGLIQDFEVVMRPYKTVGALRDAMNARVMTDARFLKYREALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein conserved in bacteria with a cystati
publication title Crystal structure of uncharacterized protein conserved in bacteria with a cystatin-like fold (YP_168589.1) from SILICIBACTER POMEROYI DSS-3 at 2.00 A resolution
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Structural genomics, unknown function
total genus 36
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3fljA00
3DZLA 1OPYA 3RGAA 2XSHB 2GEYA 3ECFA 2CKFB 4XBTA 4LEHA 1GY5A 3F7XA 2F98A 2GBWB 1O7WB 3JUQA 3RGRA 3F7SA 3B4PA 3OWYA 1EA2A 3KZTA 2F99A 5TGNA 2Z7AA 3Q90A 2XSOB 1W00A 1W01A 3GZXB 3OWSA 3BLZA 5IEPA 3NBRA 4H3UA 3JUMA 4J8TA 3KE7A 3FKAA 5IG4A 8CHOA 1UUWB 2YFLB 5IENA 1WQLB 2XRXB 4ORLA 2HMLB 5JPPA 1O7NB 4L8OA 1GY7A 1EG9B 2Z77A 4LGQA 1Q40B 3EX9A 3T8NA 4LMIA 1TP6A 4L8PA 3FLJA 5AEWB 1ISKA 3IPTA 4FCMA 1JKGB 1VZZA 4XBXA 4HM5B 5JPUA 2YFJB 1NDOB 1O7PB 2K54A 1OF5B 3SOAA 4HM0B 3GWRA 4J9AA 2HMJB 1O7HB 5STDA 1E3RA 1NWWA 4Q53A 1Z1SA 3EJVA 5EVHA 5IG3A 2B1XB 5IG5A 1DMNA 3FSDA 1W02A 1GS3A 4WWUC 1C7HA 3JUOA 1JB2A 2RFRA 3DXOA 1IDPA 3MG2A 1NU3A 3H51A 3EBTA 4MJDA 3OX9A 3F9SA 2QIYA 3EQQB 1OUNA 4N3VA 4X2HA 2XR8B 4R1KA 3NV0B 4XBYA 3A76A 2R4IA 1DMQA 2JQ5A 3EBYA 1QJGA 1JB5A 3ROBA 3UNLA 3FH1A 4KVHA 3HZPA 4GB5A 1W6YA 5DRVA 4OVMA 3H3HA 3G16A 4L7KA 1TUHA 2IMJA 1E3VA 1QMAA 4WYKA 3GZBA 1GY6A 2GEXA 5BVBA 5CK6A 4HM1B 4XDVA 5KP4A 5DREA 2B24B 3EHCA 2BMOB 3JUNA 1HKXA 5AIFA 3VGNA 5AI1A 1ZX2A 4OUQA 3OXAA 1CQSA 3FF2A 3VSYA 3STDA 3GZRA 3MG3A 4HM7B 2HMNB 3LZAA 5G2GA 1K41A 1JN5B 1O7GB 1OGXA 2GBXB 3G0KA 4HM6B 6STDA 4HM3B 3B7CA 2UX0A 5AIHA 1ULIB 3FGYA 2RCDA 4FCJA 4HM8B 2INXA 2Z76A 5IG0A 1AR0A 3SOYA 1OGZA 3BB9A 3GRDA 3G8ZA 1SJWA 3OV4A 5IEOA 1UUVB 5AEUB 2OWPA 1OH0A 5AIGA 1OHPA 3F8HA 3D9RA 2A15A 4IIAA 1ZO2A 3ER7A 1JKGA 4U13A 2F86B 3CU3A 4X2OA 4RZMA 2STDA 5CXOA 5D82A 1OHSA 1ASKA 3GZYB 1U5OA 4STDA 1BUQA 2PZVA 5D83A 4HVNA 4WP5A 2QGUA 4HZ9B 3NM2A 5CF2A 4WYKB 1JB4A 3SEDA 4R9LA 3NXJA 4CDLA 2YFIB 2BMQB 3KSPA 1OHOA 3KKGA 3HX8A 2HMOB 3B8LA 3CPOA 3LYGA 7STDA 1A2KA 2RGQA 5BXQA 3NUVA 3CNXA 3K7CA 3DUKA 1GYBA 4R9KA 3MG1A 3MHEA 3NV0A 2I9WA 3E99A 5FW5A 1STDA 3WMDA 5IERA 3EN8A 3F40A 3DMCA 3MKIA 3EN1B 4HM2B 5HGRA 3JUPA 3F14A 3NHXA 3MYTA 4I4KA 3FF0A 3HK4A 4HZBB 5D81A 5IF6A 3CNMA 2BNGA 2HMKB 4PEJA 3B4OA 3FZWA 2CHCA 1OCVA 5KP3A 3DM8A 3T8UA 2W2CA 4XM4A 1E97A 5KP1A 1Q40A 5CLKA 1DMMA 5AIIA 2HMMB 4XDWA 1S5AA 3UJMA 3F8XA 3EC9A 1JN5A 3OWUA 3MSOA 4K1VA 2GXFA 3K0ZA 3S5CA 3EF8A 1ULJB 1O7MB 2BMRB 4K1UA 3I0YA 1OF5A 4HJLB 5CF1A 3M8CA 4XB5A 4HM4B 4HKVB 1Q42A
chains in the Genus database with same CATH superfamily
1BANA 3FG4A 1IYYA 3DZLA 1OPYA 4IT7A 3RGAA 2XSHB 2UUGC 4BU4A 2GEYA 2FNQA 3ECFA 1GMRA 1VQ63 4HKVB 1IVXA 3PS8A 4HAAA 1RKYA 2CKFB 1WMOA 4XBTA 4LEHA 2CG0A 1FZUA 3QK9A 1GY5A 3F7XA 3ZG0A 2F98A 2GBWB 3I553 2OQEA 1BOXA 1KC84 1B2MA 1QALA 1O7WB 1LRAA 3JUQA 3U97A 4CCVA 3S28A 3RGRA 3F7SA 3LH4A 3B4PA 3OWYA 5ELJA 1UGIA 3SLUA 1EA2A 2CX1A 2SBLA 3KZTA 2F99A 5TGNA 2Z7AA 2F56A 4ZM8A 1SQWA 3Q90A 2IUJA 3EB8A 3V92A 3QRDA 1IK3A 3LTCA 1G0TA 1FYSA 2XSOB 4KFFA 1RN1A 3LTDA 2CG1A 1W00A 1YJ93 1W01A 2H0HA 3GZXB 2M7OA 3OWSA 4BL3A 3BLZA 3JVCA 1YVSA 5IEPA 3NBRA 4H3UA 3JUMA 4J8TA 1STFI 3KE7A 4FCZA 2R41A 3FKAA 5IG4A 1RGLA 8CHOA 3LOYA 1R4CA 1UUWB 2YFLB 3HIGA 3BNDA 4TX4A 5IENA 1BNGA 1WQLB 2V1LA 1X1YA 3LXUX 2CWTA 1CH0A 1BSBA 2JDIH 2XRXB 2ZL8A 4BL2A 9RNTA 4ORLA 2HMLB 2P0XA 4O8SA 5JPPA 1O7NB 1T3BA 4L8OA 2GU3A 1GSPA 2WGOA 2ZA4A 1GY7A 4FMAA 4K90B 3T0UA 1TTOA 1K28A 1FGOA 1WNHA 2XFTA 1M1XB 3PCRA 2CWUA 2P09A 3SXXA 1EG9B 2CW9A 2XEPA 4JRFA 3WDGB 1ZGXA 2Z77A 3X3XA 4LGQA 3G713 1W2B2 1Q40B 1RRHA 3EX9A 3T8NA 1QVG2 4LMIA 1B27A 3D5IA 1TP6A 4L8PA 3D4AA 3FLJA 3CCU3 4EV2A 1JNQA 4NPBA 3AHSA 1V74A 3BNBA 1MNLA 1RN7A 3LTBA 1PFPA 1LOWA 1I0XA 3CC23 1EEJA 1RLSA 3ZFZA 1T2IA 2SARA 1K9M4 4WFOA 3WA3A 3CCL3 2CK3H 2O9UX 3PZWA 4BIRA 5AEWB 3CCE3 1ISKA 2KCDA 3V99A 2J8XB 3IPTA 1W6CA 4FCMA 1JKGB 3ZG5A 1LOXA 1VZZA 1Q814 4XBXA 2CC3A 4HM5B 5JPUA 3CPW2 1AVKA 1LQGC 3CXC2 1YGEA 2YFJB 1NDOB 1LXEA 1O7PB 1JBSA 3NQZA 4RBNA 3G4S3 1N5PA 1B2SA 2K54A 1BSCA 2RBIA 2KF5A 1OF5B 3SOAA 1BNSA 4HM0B 3GWRA 1NO3A 4J9AA 3DH2A 2AAEA 1WMNA 2C11A 3KIIA 2HMJB 2HOHA 3FCSB 1O7HB 5STDA 1BNIA 5M1AA 1E3RA 1IU7A 1RGEA 2C10A 3K5TA 1NWWA 3MWZA 3KN4A 4Q53A 1BRKA 1Z1SA 3LT9A 2RSXA 3OW22 1HU9A 3EJVA 5EVHA 5IG3A 5LC6A 2B1XB 5IG5A 1LNIA 1DMNA 3FSDA 1DVCA 1W02A 1Y4KA 3RNTA 1N8QA 1S723 1Q824 1MWTA 1GS3A 4WWUC 1C7HA 3X40A 1I70A 3JUOA 1NB5I 1JB2A 1UCLA 2CX0A 2RFRA 2W56A 1I8VA 4MMXB 3URPA 3I563 3DXOA 3HIIA 1W4NA 1IDPA 1BSDA 1IVVA 1NU3A 3H51A 3EBTA 3LT8A 3MG2A 4MJDA 3OX9A 2XH9A 3F9SA 4N6OB 1RGHA 3Q3FA 2QIYA 3CC43 1MOLA 3EQQB 1FUWA 5BU4A 1OUNA 4N3VA 4X2HA 2XR8B 4R1KA 3PXMA 1GOYA 1UCKA 3NV0B 4XBYA 3NQYA 1VQN3 3A76A 3CME3 1RRLA 2R4IA 1DMQA 1G96A 1A2VA 1LQMB 4O3VA 2JQ5A 3EBYA 1QJGA 1JB5A 3ROBA 1LNHA 1WMPA 2LYXA 1BRSA 3UNLA 1EKMA 1VQ43 2MF7A 1KSIA 1UI8A 2ZHXB 1L5GB 3FH1A 3WOFB 4KVHA 5M18A 1SARA 2OQEC 3HZPA 4EW5A 1RJOA 4GB5A 3HI7A 1W6YA 2XGLA 5DRVA 1MGRA 4OVMA 1IVWA 3H3HA 4AEQA 3G16A 4IPBA 4L7KA 3NBBA 4G1MB 1RCLA 2F4YA 5IW9A 1BRNL 1TUHA 3X3YA 2IMJA 3CCR3 1JBRA 5RNTA 4N6MA 2CH9A 1B3SA 1FUTA 1E3VA 1JJ22 3KFQC 3AMOA 2H0IA 1A2PA 1QMAA 3Q2PA 4WYKA 1GOVA 2WGQA 3S29A 1B21A 1UW1A 3GZBA 4EBGA 1MGWA 1GY6A 4EXRA 1JZOA 1HZ1A 1VQP3 2GEXA 4LSOA 5ELUA 5BVBA 1BNRA 5CK6A 4QWTA 4HM1B 1RGCA 2OOVA 4XDVA 3DGLA 1BNJA 1RDSA 1BU4A 5KP4A 1YGWA 1CYVA 6RNTA 1BUJA 5DREA 4RNYA 1B2XA 4MMZB 2B24B 1UUGB 3EHCA 4N6TA 2BMOB 2Y73A 1HKXA 3JUNA 3BNEA 3N8BA 1F8NA 3U1WA 2L4VA 1VQK3 5AIFA 1TIJA 3VGNA 1CEWI 3X3ZA 5AI1A 2KF3A 2CWVA 1VQM3 1X1UA 4FMBA 1Q864 1ZX2A 4OUQA 2O3OA 4RNTA 1MWUA 1Q9EA 1BRGA 1JRQA 3OXAA 1CQSA 3FF2A 3TDGA 1D6UA 1RCKA 3N54B 3S67A 3VSYA 1FGTA 1X1XA 3AGOA 3GZRA 3LTAA 3MG3A 3STDA 2IYJA 1RNBA 4HM7B 3DGOA 1DE3A 2D1WA 2K3DA 2CIUA 1B2UA 2HMNB 3LZAA 1U8CB 1DVDA 4CJNA 2XFSA 5GSPA 2P0MA 1FA3A 5G2GA 2F5WA 1ROAA 2RNTA 1K41A 2AADA 2ZDJA 3ALAA 1JN5B 4O2HA 3WODG 1I0VA 1O7GB 1FW7A 1T5YA 1OGXA 2GBXB 5AYRB 3G0KA 3CD63 1YI23 1HYFA 4GSPA 1KQS2 4HM6B 1J2BA 1IQXA 1W5ZA 1YNVX 6STDA 1BSEA 1RMSA 4EYCA 1WTHA 1I2FA 4HM3B 3B7CA 1M904 1BRHA 1I3IA 3PYJA 1DETA 4HYZA 1IT7A 2UX0A 5AIHA 4EC6A 5FGOA 1ULIB 3N9HA 3FGYA 1GD3A 2RCDA 2OTJ3 1PYLA 4FCJA 1TRQA 2INXA 4HM8B 3DGMA 4RNZA 2Z76A 5IG0A 1AR0A 1ZS7A 1OGZA 3SOYA 3GAXA 3J7Yd 1JBTA 3CCM3 1TU5A 1Q7Y4 4FR9A 3GRDA 1T2HA 3G8ZA 2GU1A 1SJWA 1FGMA 2W56B 3OV4A 5IEOA 1RSNA 5HOHA 2CFGA 2IA7A 1UUVB 4LZIA 5AEUB 2OWPA 3IJEB 1OH0A 3LMLA 1BRJA 1OACA 3UL6A 5AIGA 1BNEA 1OHPA 4R4KA 3GSPA 2P05A 3F8HA 1N9JA 1RGFA 1YJW3 1GMQA 3D9RA 1IV9A 1VQL3 2A15A 1BVIA 1JZDA 4KZ1A 4IIAA 1ZO2A 3ER7A 1GD4A 1JKGA 4U13A 2F86B 1ROVA 1V58A 3KSED 1PU4A 3BU4A 3CU3A 1BAOA 4X2OA 4RZMA 1G02A 2WO0A 1SIHA 2STDA 1RGGA 2W9PA 5CXOA 2K0MA 1LOYA 2PNCA 1IT8A 1GOUA 6GSPA 3VF1A 3X42A 5D82A 1BIRA 1LVNA 4JF8A 5I97A 1MWRA 1OHSA 1UCIA 1ASKA 4H61A 3GZYB 1U5OA 4DKIA 2FXTA 2CFLA 1BRIA 1IVUA 4STDA 1NJI4 1BUQA 3DGYA 2PZVA 5D83A 4HVNA 1W2ZA 4WP5A 2QGUA 1FUSA 4ILFA 4HZ9B 3AMOB 3FG1A 3NM2A 5LC7A 2CFKA 5CF2A 4WYKB 1JB4A 1RTUA 3SEDA 2L1SA 4R9LA 1Q7HA 3AGNA 1YIT3 3NXJA 2OTL3 1BSAA 3BIRA 3D79A 4KFDA 2YFIB 4CDLA 1VQ83 2KAAA 2BMQB 4CPKA 3KSPA 1OHOA 3KKGA 1K734 3HX8A 2HMOB 3WR2A 3B8LA 1YHQ3 3CPOA 4EV5A 2QEX3 4BTXA 3LYGA 7STDA 2LQVA 3O8YA 1A2KA 3PCSA 3IMAB 1RN4A 2RGQA 4J5GA 2E2TA 5BXQA 1IV7A 1X1WA 3NUVA 3CNXA 1AQZA 4LYLB 3DGNA 3K7CA 1EUIC 3DUKA 1AVLA 1SIIA 4NREA 1GYBA 1DYUA 1N8R4 1QAFA 3MG1A 4R9KA 1C54A 1W7CA 3MHEA 1W6GA 1RGAA 1NB3I 1UGHI 2Q07A 2WOHA 1YIJ3 1KWIA 3NV0A 2I9WA 1VQ53 1LOVA 1TJDA 2W6JH 3V98A 3D3LA 3KCHA 2KRTA 5BIRA 2D42A 3E99A 3L0RA 4GHOA 2GSPA 1IQ8A 5FW5A 1STDA 3WMDA 5IERA 1UI7A 2BU4A 3EE1A 3DY5A 3EN8A 3F40A 2KF4A 2OOVC 2YX9A 2OCTA 4R80A 3DMCA 1SPUA 3MKIA 2BO9B 3EN1B 1YVBI 4HM2B 5HGRA 5A0OB 1RNTA 1RHLA 4FMCA 4O02B 1VQO3 3JUPA 3F14A 4AKZA 2W04A 1N5HA 3FG3A 3K9MC 4HBRA 4MEIA 8RNTA 1US1A 3SX1A 1VQ73 4AKYA 1I2EA 3X41A 3CCS3 3SVAA 2BHMA 1TFKA 1QVF2 2E2UA 3NHXA 1AV4A 2Y74A 1A90A 3WOEB 7RNTA 3NBJA 3MYTA 4I4KA 2ML6A 3UB1A 1VQ93 3FF0A 3HK4A 1IQYA 4HZBB 5D81A 3Q1CA 3WA2X 5IF6A 1QAKA 1GMPA 2KXGA 3NX0A 4GL6A 1YJN3 4OK0A 1R4YA 3BNCA 2W0QA 3CCJ3 3CNMA 1TFOA 4HOHA 2FGTA 2BNGA 3CC73 2HMKB 4PEJA 5G1KA 5M19A 2F5MA 2QA43 3B4OA 3FZWA 2CHCA 1CYUA 1OCVA 1RGKA 2XF3A 1M9GA 5G1LA 2WOFA 1N9EA 1UDII 3DM8A 5KP3A 1JV2B 3RDEA 4BTYA 3MPHA 3T8UA 2UGIA 2W2CA 1PY3A 1E97A 1I2GA 4N6NB 4XM4A 5EQLA 5KP1A 1Q40A 3CCQ3 3K63A 5AYSC 2P38A 3AHWA 1TRPA 4K61A 5CLKA 4WHAA 2Z6BA 1DMMA 5AIIA 1UCJA 2ML5A 2W03A 1D6YA 2HMMB 2C4BA 4XDWA 2XGNA 1M1K4 1B20A 1FGQA 1S5AA 3UJMA 1I3FA 1AY7A 3F8XA 3CMA3 2BIRA 3EC9A 3UL5A 1JN5A 4N6V0 3WHOA 4NHFA 3OWUA 3MSOA 1NNVA 3NM7A 3SYUA 1EQKA 4K1VA 1BNFA 2H0GA 1K8A4 4KFEA 2IY2A 2GXFA 2KF6A 3K0ZA 3CCV3 3S5CA 1VQQA 3PGBA 2IUKA 1MWSA 1B2ZA 1ULJB 3EF8A 3S27A 3HOHA 4I5QA 1KD14 4KT3B 4N6LA 7GSPA 2W9QA 1O7MB 4J5KA 4N6UA 2BMRB 4K1UA 2BT3A 2CFDA 5JBSA 3A5EA 3I0YA 4FMDA 1OF5A 1BGSA 2E2VA 4HJLB 1FGRA 1D6ZA 2MC8A 1V57A 2CFWA 5CF1A 3M8CA 5EEOA 4XB5A 4HM4B 3D5GA 4MMYB 3BB9A 1Q42A 3G6E3 1A67A 4BTWA
chains in the Genus database with same CATH topology
3FG4A 3DZLA 1OPYA 4IT7A 3RGAA 2XSHB 2GEYA 2FNQA 3ECFA 1VQ63 4HKVB 1IVXA 3PS8A 1RKYA 2CKFB 1WMOA 4XBTA 4LEHA 2CG0A 3QK9A 1GY5A 3F7XA 2F98A 2GBWB 3I553 2OQEA 1KC84 1QALA 1O7WB 3JUQA 3U97A 4CCVA 3S28A 3RGRA 3F7SA 3LH4A 3B4PA 3OWYA 5ELJA 3SLUA 1EA2A 3KZTA 2SBLA 2F99A 5TGNA 2Z7AA 4ZM8A 1SQWA 3Q90A 2IUJA 3EB8A 3V92A 3QRDA 1IK3A 3LTCA 2XSOB 4KFFA 3LTDA 2CG1A 1YJ93 1W00A 1W01A 3GZXB 2M7OA 3OWSA 3BLZA 3JVCA 5IEPA 3NBRA 4H3UA 3JUMA 4J8TA 1STFI 3KE7A 4FCZA 3FKAA 5IG4A 8CHOA 3LOYA 1R4CA 1UUWB 2YFLB 3HIGA 3BNDA 4TX4A 5IENA 1WQLB 2V1LA 3LXUX 2CWTA 2XRXB 2JDIH 2ZL8A 4ORLA 2HMLB 2P0XA 4O8SA 5JPPA 1O7NB 4L8OA 2GU3A 2WGOA 4FMAA 1GY7A 4K90B 3T0UA 1K28A 1FGOA 1WNHA 2XFTA 1M1XB 3PCRA 2CWUA 2P09A 3SXXA 1EG9B 2CW9A 2XEPA 4JRFA 3WDGB 2Z77A 3X3XA 4LGQA 3G713 1W2B2 1Q40B 1RRHA 3EX9A 3T8NA 1QVG2 4LMIA 1TP6A 4L8PA 3CCU3 3FLJA 4EV2A 1JNQA 1V74A 3BNBA 1MNLA 1RN7A 3LTBA 1PFPA 3CC23 1K9M4 4WFOA 3WA3A 3CCL3 2CK3H 2O9UX 3PZWA 5AEWB 3CCE3 1ISKA 2KCDA 3V99A 3IPTA 1W6CA 4FCMA 1JKGB 1LOXA 1VZZA 1Q814 4XBXA 2CC3A 4HM5B 5JPUA 3CPW2 1AVKA 3CXC2 1YGEA 2YFJB 1NDOB 1LXEA 1O7PB 3NQZA 4RBNA 3G4S3 1N5PA 2K54A 1OF5B 3SOAA 4HM0B 3GWRA 1NO3A 4J9AA 1WMNA 2C11A 3KIIA 2HMJB 3FCSB 1O7HB 5STDA 1E3RA 1IU7A 2C10A 3K5TA 1NWWA 3MWZA 3KN4A 4Q53A 1Z1SA 3LT9A 2RSXA 3OW22 1HU9A 3EJVA 5EVHA 5IG3A 5LC6A 2B1XB 5IG5A 1DMNA 3FSDA 1DVCA 1W02A 1Y4KA 1N8QA 1S723 1Q824 1GS3A 4WWUC 1C7HA 3X40A 3JUOA 1NB5I 1JB2A 2RFRA 2W56A 4MMXB 3I563 3DXOA 3HIIA 1W4NA 1IDPA 1IVVA 1NU3A 3LT8A 3H51A 3EBTA 3MG2A 4MJDA 4N6OB 3OX9A 2XH9A 3F9SA 2QIYA 3CC43 1MOLA 3EQQB 1FUWA 1OUNA 4N3VA 4X2HA 2XR8B 4R1KA 3PXMA 3NV0B 4XBYA 3NQYA 1VQN3 3A76A 3CME3 1RRLA 2R4IA 1DMQA 1G96A 1A2VA 4O3VA 2JQ5A 3EBYA 1QJGA 1JB5A 3ROBA 1LNHA 1WMPA 2LYXA 3UNLA 1EKMA 1VQ43 2MF7A 1KSIA 1UI8A 1L5GB 3FH1A 3WOFB 4KVHA 2OQEC 3HZPA 1RJOA 4GB5A 3HI7A 1W6YA 2XGLA 5DRVA 4OVMA 4AEQA 1IVWA 3H3HA 3G16A 4IPBA 4L7KA 3NBBA 4G1MB 5IW9A 1TUHA 3X3YA 2IMJA 3CCR3 4N6MA 2CH9A 1JJ22 1E3VA 3KFQC 3AMOA 1QMAA 3Q2PA 4WYKA 3S29A 2WGQA 1UW1A 3GZBA 4EBGA 1GY6A 4EXRA 1VQP3 2GEXA 4LSOA 5ELUA 5BVBA 5CK6A 4QWTA 4HM1B 2OOVA 4XDVA 3DGLA 5KP4A 1CYVA 5DREA 4RNYA 4MMZB 2B24B 3EHCA 4N6TA 2BMOB 2Y73A 1HKXA 3JUNA 3BNEA 3N8BA 1F8NA 3U1WA 2L4VA 1VQK3 5AIFA 1TIJA 3VGNA 1CEWI 3X3ZA 5AI1A 2CWVA 1VQM3 4FMBA 1Q864 1ZX2A 4OUQA 2O3OA 1JRQA 3OXAA 1CQSA 3FF2A 3TDGA 1D6UA 3N54B 3S67A 3VSYA 1FGTA 3GZRA 3LTAA 3MG3A 3STDA 4HM7B 3DGOA 2D1WA 2CIUA 2HMNB 1DVDA 3LZAA 1U8CB 2XFSA 2P0MA 1FA3A 5G2GA 1ROAA 1K41A 2ZDJA 3ALAA 1JN5B 4O2HA 3WODG 1O7GB 1T5YA 1OGXA 2GBXB 5AYRB 3G0KA 3CD63 1YI23 1KQS2 4HM6B 1J2BA 1IQXA 1W5ZA 6STDA 4EYCA 1WTHA 4HM3B 1M904 3B7CA 3PYJA 4HYZA 1IT7A 2UX0A 5AIHA 4EC6A 5FGOA 1ULIB 3N9HA 3FGYA 1GD3A 2RCDA 2OTJ3 4FCJA 4HM8B 2INXA 4RNZA 3DGMA 2Z76A 5IG0A 1AR0A 3SOYA 1OGZA 3J7Yd 3GAXA 3CCM3 1TU5A 1Q7Y4 4FR9A 3GRDA 3G8ZA 2GU1A 1SJWA 1FGMA 2W56B 3OV4A 5IEOA 2CFGA 2IA7A 1UUVB 4LZIA 5AEUB 2OWPA 3IJEB 1OH0A 3LMLA 1OACA 3UL6A 5AIGA 1OHPA 4R4KA 2P05A 3F8HA 1N9JA 1YJW3 3D9RA 1IV9A 1VQL3 2A15A 4KZ1A 4IIAA 1ZO2A 3ER7A 1GD4A 1JKGA 4U13A 2F86B 1ROVA 3KSED 1PU4A 3CU3A 4X2OA 4RZMA 2WO0A 1SIHA 2STDA 2W9PA 5CXOA 2K0MA 2PNCA 1IT8A 3VF1A 3X42A 5D82A 1LVNA 5I97A 4JF8A 1OHSA 1ASKA 4H61A 3GZYB 1U5OA 2FXTA 2CFLA 1IVUA 4STDA 1BUQA 1NJI4 2PZVA 5D83A 4HVNA 1W2ZA 4WP5A 2QGUA 4HZ9B 3AMOB 3FG1A 3NM2A 5LC7A 2CFKA 5CF2A 4WYKB 1JB4A 3SEDA 4R9LA 1YIT3 3NXJA 2OTL3 4CDLA 4KFDA 1VQ83 2YFIB 2BMQB 3KSPA 1OHOA 3KKGA 1K734 3HX8A 2HMOB 3B8LA 1YHQ3 3CPOA 4EV5A 2QEX3 4BTXA 3LYGA 7STDA 2LQVA 3O8YA 1A2KA 3PCSA 3IMAB 2RGQA 2E2TA 5BXQA 1IV7A 3NUVA 3CNXA 3DGNA 3K7CA 3DUKA 1AVLA 1SIIA 4NREA 1GYBA 1DYUA 1N8R4 1QAFA 3MG1A 4R9KA 1W7CA 3MHEA 1W6GA 1NB3I 2Q07A 2WOHA 1YIJ3 1KWIA 3NV0A 2I9WA 1VQ53 2W6JH 3V98A 3D3LA 2KRTA 2D42A 3E99A 3L0RA 1IQ8A 5FW5A 1STDA 3WMDA 5IERA 1UI7A 3EE1A 3DY5A 3EN8A 3F40A 2OOVC 2YX9A 4R80A 2OCTA 3DMCA 1SPUA 3MKIA 2BO9B 3EN1B 1YVBI 4HM2B 5HGRA 5A0OB 4FMCA 4O02B 1VQO3 3JUPA 3F14A 4AKZA 2W04A 1N5HA 3FG3A 3K9MC 4HBRA 4MEIA 1VQ73 1US1A 3SX1A 4AKYA 3X41A 3CCS3 3SVAA 2BHMA 1TFKA 1QVF2 2E2UA 3NHXA 1AV4A 2Y74A 1A90A 3WOEB 3NBJA 3MYTA 4I4KA 2ML6A 3UB1A 1VQ93 3FF0A 3HK4A 1IQYA 4HZBB 5D81A 3Q1CA 3WA2X 5IF6A 1QAKA 2KXGA 3NX0A 4GL6A 1YJN3 4OK0A 3BNCA 2W0QA 3CCJ3 3CNMA 1TFOA 2FGTA 2BNGA 3CC73 2HMKB 4PEJA 2QA43 3B4OA 3FZWA 2CHCA 1CYUA 1OCVA 2XF3A 5KP3A 1M9GA 2WOFA 1N9EA 3DM8A 3RDEA 4BTYA 1JV2B 3MPHA 3T8UA 2W2CA 4XM4A 4N6NB 1E97A 3CCQ3 5EQLA 5KP1A 1Q40A 3K63A 5AYSC 2P38A 4K61A 5CLKA 4WHAA 2Z6BA 1DMMA 5AIIA 2ML5A 2W03A 1D6YA 2HMMB 4XDWA 2XGNA 1M1K4 1FGQA 1S5AA 3UJMA 3CMA3 3F8XA 3EC9A 3UL5A 1JN5A 4N6V0 4NHFA 3OWUA 3MSOA 3NM7A 1EQKA 4K1VA 1K8A4 4KFEA 2GXFA 3K0ZA 3CCV3 3S5CA 3PGBA 2IUKA 3EF8A 3S27A 1ULJB 1KD14 4N6LA 2W9QA 1O7MB 4N6UA 2BMRB 4K1UA 2BT3A 2CFDA 5JBSA 3I0YA 4FMDA 1OF5A 2E2VA 4HJLB 1FGRA 1D6ZA 2MC8A 2CFWA 5CF1A 3M8CA 5EEOA 4XB5A 4HM4B 4MMYB 3BB9A 1Q42A 3G6E3 1A67A 4BTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZL A;  1OPY A;  3RGA A;  2XSH B;  2GEY A;  3ECF A;  2CKF B;  4XBT A;  4LEH A;  1GY5 A;  3F7X A;  2F98 A;  2GBW B;  1O7W B;  3JUQ A;  3RGR A;  3F7S A;  3B4P A;  3OWY A;  1EA2 A;  3KZT A;  2F99 A;  5TGN A;  2Z7A A;  3Q90 A;  2XSO B;  1W00 A;  1W01 A;  3GZX B;  3OWS A;  3BLZ A;  5IEP A;  3NBR A;  4H3U A;  3JUM A;  4J8T A;  3KE7 A;  3FKA A;  5IG4 A;  8CHO A;  1UUW B;  2YFL B;  5IEN A;  1WQL B;  2XRX B;  4ORL A;  2HML B;  5JPP A;  1O7N B;  4L8O A;  1GY7 A;  1EG9 B;  2Z77 A;  4LGQ A;  1Q40 B;  3EX9 A;  3T8N A;  4LMI A;  1TP6 A;  4L8P A;  3FLJ A;  5AEW B;  1ISK A;  3IPT A;  4FCM A;  1JKG B;  1VZZ A;  4XBX A;  4HM5 B;  5JPU A;  2YFJ B;  1NDO B;  1O7P B;  2K54 A;  1OF5 B;  3SOA A;  4HM0 B;  3GWR A;  4J9A A;  2HMJ B;  1O7H B;  5STD A;  1E3R A;  1NWW A;  4Q53 A;  1Z1S A;  3EJV A;  5EVH A;  5IG3 A;  2B1X B;  5IG5 A;  1DMN A;  3FSD A;  1W02 A;  1GS3 A;  4WWU C;  1C7H A;  3JUO A;  1JB2 A;  2RFR A;  3DXO A;  1IDP A;  3MG2 A;  1NU3 A;  3H51 A;  3EBT A;  4MJD A;  3OX9 A;  3F9S A;  2QIY A;  3EQQ B;  1OUN A;  4N3V A;  4X2H A;  2XR8 B;  4R1K A;  3NV0 B;  4XBY A;  3A76 A;  2R4I A;  1DMQ A;  2JQ5 A;  3EBY A;  1QJG A;  1JB5 A;  3ROB A;  3UNL A;  3FH1 A;  4KVH A;  3HZP A;  4GB5 A;  1W6Y A;  5DRV A;  4OVM A;  3H3H A;  3G16 A;  4L7K A;  1TUH A;  2IMJ A;  1E3V A;  1QMA A;  4WYK A;  3GZB A;  1GY6 A;  2GEX A;  5BVB A;  5CK6 A;  4HM1 B;  4XDV A;  5KP4 A;  5DRE A;  2B24 B;  3EHC A;  2BMO B;  3JUN A;  1HKX A;  5AIF A;  3VGN A;  5AI1 A;  1ZX2 A;  4OUQ A;  3OXA A;  1CQS A;  3FF2 A;  3VSY A;  3STD A;  3GZR A;  3MG3 A;  4HM7 B;  2HMN B;  3LZA A;  5G2G A;  1K41 A;  1JN5 B;  1O7G B;  1OGX A;  2GBX B;  3G0K A;  4HM6 B;  6STD A;  4HM3 B;  3B7C A;  2UX0 A;  5AIH A;  1ULI B;  3FGY A;  2RCD A;  4FCJ A;  4HM8 B;  2INX A;  2Z76 A;  5IG0 A;  1AR0 A;  3SOY A;  1OGZ A;  3BB9 A;  3GRD A;  3G8Z A;  1SJW A;  3OV4 A;  5IEO A;  1UUV B;  5AEU B;  2OWP A;  1OH0 A;  5AIG A;  1OHP A;  3F8H A;  3D9R A;  2A15 A;  4IIA A;  1ZO2 A;  3ER7 A;  1JKG A;  4U13 A;  2F86 B;  3CU3 A;  4X2O A;  4RZM A;  2STD A;  5CXO A;  5D82 A;  1OHS A;  1ASK A;  3GZY B;  1U5O A;  4STD A;  1BUQ A;  2PZV A;  5D83 A;  4HVN A;  4WP5 A;  2QGU A;  4HZ9 B;  3NM2 A;  5CF2 A;  4WYK B;  1JB4 A;  3SED A;  4R9L A;  3NXJ A;  4CDL A;  2YFI B;  2BMQ B;  3KSP A;  1OHO A;  3KKG A;  3HX8 A;  2HMO B;  3B8L A;  3CPO A;  3LYG A;  7STD A;  1A2K A;  2RGQ A;  5BXQ A;  3NUV A;  3CNX A;  3K7C A;  3DUK A;  1GYB A;  4R9K A;  3MG1 A;  3MHE A;  3NV0 A;  2I9W A;  3E99 A;  5FW5 A;  1STD A;  3WMD A;  5IER A;  3EN8 A;  3F40 A;  3DMC A;  3MKI A;  3EN1 B;  4HM2 B;  5HGR A;  3JUP A;  3F14 A;  3NHX A;  3MYT A;  4I4K A;  3FF0 A;  3HK4 A;  4HZB B;  5D81 A;  5IF6 A;  3CNM A;  2BNG A;  2HMK B;  4PEJ A;  3B4O A;  3FZW A;  2CHC A;  1OCV A;  5KP3 A;  3DM8 A;  3T8U A;  2W2C A;  4XM4 A;  1E97 A;  5KP1 A;  1Q40 A;  5CLK A;  1DMM A;  5AII A;  2HMM B;  4XDW A;  1S5A A;  3UJM A;  3F8X A;  3EC9 A;  1JN5 A;  3OWU A;  3MSO A;  4K1V A;  2GXF A;  3K0Z A;  3S5C A;  3EF8 A;  1ULJ B;  1O7M B;  2BMR B;  4K1U A;  3I0Y A;  1OF5 A;  4HJL B;  5CF1 A;  3M8C A;  4XB5 A;  4HM4 B;  4HKV B;  1Q42 A; 
#chains in the Genus database with same CATH topology
 1BAN A;  3FG4 A;  1IYY A;  3DZL A;  1OPY A;  4IT7 A;  3RGA A;  2XSH B;  2UUG C;  4BU4 A;  2GEY A;  2FNQ A;  3ECF A;  1GMR A;  1VQ6 3;  4HKV B;  1IVX A;  3PS8 A;  4HAA A;  1RKY A;  2CKF B;  1WMO A;  4XBT A;  4LEH A;  2CG0 A;  1FZU A;  3QK9 A;  1GY5 A;  3F7X A;  3ZG0 A;  2F98 A;  2GBW B;  3I55 3;  2OQE A;  1BOX A;  1KC8 4;  1B2M A;  1QAL A;  1O7W B;  1LRA A;  3JUQ A;  3U97 A;  4CCV A;  3S28 A;  3RGR A;  3F7S A;  3LH4 A;  3B4P A;  3OWY A;  5ELJ A;  1UGI A;  3SLU A;  1EA2 A;  2CX1 A;  2SBL A;  3KZT A;  2F99 A;  5TGN A;  2Z7A A;  2F56 A;  4ZM8 A;  1SQW A;  3Q90 A;  2IUJ A;  3EB8 A;  3V92 A;  3QRD A;  1IK3 A;  3LTC A;  1G0T A;  1FYS A;  2XSO B;  4KFF A;  1RN1 A;  3LTD A;  2CG1 A;  1W00 A;  1YJ9 3;  1W01 A;  2H0H A;  3GZX B;  2M7O A;  3OWS A;  4BL3 A;  3BLZ A;  3JVC A;  1YVS A;  5IEP A;  3NBR A;  4H3U A;  3JUM A;  4J8T A;  1STF I;  3KE7 A;  4FCZ A;  2R41 A;  3FKA A;  5IG4 A;  1RGL A;  8CHO A;  3LOY A;  1R4C A;  1UUW B;  2YFL B;  3HIG A;  3BND A;  4TX4 A;  5IEN A;  1BNG A;  1WQL B;  2V1L A;  1X1Y A;  3LXU X;  2CWT A;  1CH0 A;  1BSB A;  2JDI H;  2XRX B;  2ZL8 A;  4BL2 A;  9RNT A;  4ORL A;  2HML B;  2P0X A;  4O8S A;  5JPP A;  1O7N B;  1T3B A;  4L8O A;  2GU3 A;  1GSP A;  2WGO A;  2ZA4 A;  1GY7 A;  4FMA A;  4K90 B;  3T0U A;  1TTO A;  1K28 A;  1FGO A;  1WNH A;  2XFT A;  1M1X B;  3PCR A;  2CWU A;  2P09 A;  3SXX A;  1EG9 B;  2CW9 A;  2XEP A;  4JRF A;  3WDG B;  1ZGX A;  2Z77 A;  3X3X A;  4LGQ A;  3G71 3;  1W2B 2;  1Q40 B;  1RRH A;  3EX9 A;  3T8N A;  1QVG 2;  4LMI A;  1B27 A;  3D5I A;  1TP6 A;  4L8P A;  3D4A A;  3FLJ A;  3CCU 3;  4EV2 A;  1JNQ A;  4NPB A;  3AHS A;  1V74 A;  3BNB A;  1MNL A;  1RN7 A;  3LTB A;  1PFP A;  1LOW A;  1I0X A;  3CC2 3;  1EEJ A;  1RLS A;  3ZFZ A;  1T2I A;  2SAR A;  1K9M 4;  4WFO A;  3WA3 A;  3CCL 3;  2CK3 H;  2O9U X;  3PZW A;  4BIR A;  5AEW B;  3CCE 3;  1ISK A;  2KCD A;  3V99 A;  2J8X B;  3IPT A;  1W6C A;  4FCM A;  1JKG B;  3ZG5 A;  1LOX A;  1VZZ A;  1Q81 4;  4XBX A;  2CC3 A;  4HM5 B;  5JPU A;  3CPW 2;  1AVK A;  1LQG C;  3CXC 2;  1YGE A;  2YFJ B;  1NDO B;  1LXE A;  1O7P B;  1JBS A;  3NQZ A;  4RBN A;  3G4S 3;  1N5P A;  1B2S A;  2K54 A;  1BSC A;  2RBI A;  2KF5 A;  1OF5 B;  3SOA A;  1BNS A;  4HM0 B;  3GWR A;  1NO3 A;  4J9A A;  3DH2 A;  2AAE A;  1WMN A;  2C11 A;  3KII A;  2HMJ B;  2HOH A;  3FCS B;  1O7H B;  5STD A;  1BNI A;  5M1A A;  1E3R A;  1IU7 A;  1RGE A;  2C10 A;  3K5T A;  1NWW A;  3MWZ A;  3KN4 A;  4Q53 A;  1BRK A;  1Z1S A;  3LT9 A;  2RSX A;  3OW2 2;  1HU9 A;  3EJV A;  5EVH A;  5IG3 A;  5LC6 A;  2B1X B;  5IG5 A;  1LNI A;  1DMN A;  3FSD A;  1DVC A;  1W02 A;  1Y4K A;  3RNT A;  1N8Q A;  1S72 3;  1Q82 4;  1MWT A;  1GS3 A;  4WWU C;  1C7H A;  3X40 A;  1I70 A;  3JUO A;  1NB5 I;  1JB2 A;  1UCL A;  2CX0 A;  2RFR A;  2W56 A;  1I8V A;  4MMX B;  3URP A;  3I56 3;  3DXO A;  3HII A;  1W4N A;  1IDP A;  1BSD A;  1IVV A;  1NU3 A;  3H51 A;  3EBT A;  3LT8 A;  3MG2 A;  4MJD A;  3OX9 A;  2XH9 A;  3F9S A;  4N6O B;  1RGH A;  3Q3F A;  2QIY A;  3CC4 3;  1MOL A;  3EQQ B;  1FUW A;  5BU4 A;  1OUN A;  4N3V A;  4X2H A;  2XR8 B;  4R1K A;  3PXM A;  1GOY A;  1UCK A;  3NV0 B;  4XBY A;  3NQY A;  1VQN 3;  3A76 A;  3CME 3;  1RRL A;  2R4I A;  1DMQ A;  1G96 A;  1A2V A;  1LQM B;  4O3V A;  2JQ5 A;  3EBY A;  1QJG A;  1JB5 A;  3ROB A;  1LNH A;  1WMP A;  2LYX A;  1BRS A;  3UNL A;  1EKM A;  1VQ4 3;  2MF7 A;  1KSI A;  1UI8 A;  2ZHX B;  1L5G B;  3FH1 A;  3WOF B;  4KVH A;  5M18 A;  1SAR A;  2OQE C;  3HZP A;  4EW5 A;  1RJO A;  4GB5 A;  3HI7 A;  1W6Y A;  2XGL A;  5DRV A;  1MGR A;  4OVM A;  1IVW A;  3H3H A;  4AEQ A;  3G16 A;  4IPB A;  4L7K A;  3NBB A;  4G1M B;  1RCL A;  2F4Y A;  5IW9 A;  1BRN L;  1TUH A;  3X3Y A;  2IMJ A;  3CCR 3;  1JBR A;  5RNT A;  4N6M A;  2CH9 A;  1B3S A;  1FUT A;  1E3V A;  1JJ2 2;  3KFQ C;  3AMO A;  2H0I A;  1A2P A;  1QMA A;  3Q2P A;  4WYK A;  1GOV A;  2WGQ A;  3S29 A;  1B21 A;  1UW1 A;  3GZB A;  4EBG A;  1MGW A;  1GY6 A;  4EXR A;  1JZO A;  1HZ1 A;  1VQP 3;  2GEX A;  4LSO A;  5ELU A;  5BVB A;  1BNR A;  5CK6 A;  4QWT A;  4HM1 B;  1RGC A;  2OOV A;  4XDV A;  3DGL A;  1BNJ A;  1RDS A;  1BU4 A;  5KP4 A;  1YGW A;  1CYV A;  6RNT A;  1BUJ A;  5DRE A;  4RNY A;  1B2X A;  4MMZ B;  2B24 B;  1UUG B;  3EHC A;  4N6T A;  2BMO B;  2Y73 A;  1HKX A;  3JUN A;  3BNE A;  3N8B A;  1F8N A;  3U1W A;  2L4V A;  1VQK 3;  5AIF A;  1TIJ A;  3VGN A;  1CEW I;  3X3Z A;  5AI1 A;  2KF3 A;  2CWV A;  1VQM 3;  1X1U A;  4FMB A;  1Q86 4;  1ZX2 A;  4OUQ A;  2O3O A;  4RNT A;  1MWU A;  1Q9E A;  1BRG A;  1JRQ A;  3OXA A;  1CQS A;  3FF2 A;  3TDG A;  1D6U A;  1RCK A;  3N54 B;  3S67 A;  3VSY A;  1FGT A;  1X1X A;  3AGO A;  3GZR A;  3LTA A;  3MG3 A;  3STD A;  2IYJ A;  1RNB A;  4HM7 B;  3DGO A;  1DE3 A;  2D1W A;  2K3D A;  2CIU A;  1B2U A;  2HMN B;  3LZA A;  1U8C B;  1DVD A;  4CJN A;  2XFS A;  5GSP A;  2P0M A;  1FA3 A;  5G2G A;  2F5W A;  1ROA A;  2RNT A;  1K41 A;  2AAD A;  2ZDJ A;  3ALA A;  1JN5 B;  4O2H A;  3WOD G;  1I0V A;  1O7G B;  1FW7 A;  1T5Y A;  1OGX A;  2GBX B;  5AYR B;  3G0K A;  3CD6 3;  1YI2 3;  1HYF A;  4GSP A;  1KQS 2;  4HM6 B;  1J2B A;  1IQX A;  1W5Z A;  1YNV X;  6STD A;  1BSE A;  1RMS A;  4EYC A;  1WTH A;  1I2F A;  4HM3 B;  3B7C A;  1M90 4;  1BRH A;  1I3I A;  3PYJ A;  1DET A;  4HYZ A;  1IT7 A;  2UX0 A;  5AIH A;  4EC6 A;  5FGO A;  1ULI B;  3N9H A;  3FGY A;  1GD3 A;  2RCD A;  2OTJ 3;  1PYL A;  4FCJ A;  1TRQ A;  2INX A;  4HM8 B;  3DGM A;  4RNZ A;  2Z76 A;  5IG0 A;  1AR0 A;  1ZS7 A;  1OGZ A;  3SOY A;  3GAX A;  3J7Y d;  1JBT A;  3CCM 3;  1TU5 A;  1Q7Y 4;  4FR9 A;  3GRD A;  1T2H A;  3G8Z A;  2GU1 A;  1SJW A;  1FGM A;  2W56 B;  3OV4 A;  5IEO A;  1RSN A;  5HOH A;  2CFG A;  2IA7 A;  1UUV B;  4LZI A;  5AEU B;  2OWP A;  3IJE B;  1OH0 A;  3LML A;  1BRJ A;  1OAC A;  3UL6 A;  5AIG A;  1BNE A;  1OHP A;  4R4K A;  3GSP A;  2P05 A;  3F8H A;  1N9J A;  1RGF A;  1YJW 3;  1GMQ A;  3D9R A;  1IV9 A;  1VQL 3;  2A15 A;  1BVI A;  1JZD A;  4KZ1 A;  4IIA A;  1ZO2 A;  3ER7 A;  1GD4 A;  1JKG A;  4U13 A;  2F86 B;  1ROV A;  1V58 A;  3KSE D;  1PU4 A;  3BU4 A;  3CU3 A;  1BAO A;  4X2O A;  4RZM A;  1G02 A;  2WO0 A;  1SIH A;  2STD A;  1RGG A;  2W9P A;  5CXO A;  2K0M A;  1LOY A;  2PNC A;  1IT8 A;  1GOU A;  6GSP A;  3VF1 A;  3X42 A;  5D82 A;  1BIR A;  1LVN A;  4JF8 A;  5I97 A;  1MWR A;  1OHS A;  1UCI A;  1ASK A;  4H61 A;  3GZY B;  1U5O A;  4DKI A;  2FXT A;  2CFL A;  1BRI A;  1IVU A;  4STD A;  1NJI 4;  1BUQ A;  3DGY A;  2PZV A;  5D83 A;  4HVN A;  1W2Z A;  4WP5 A;  2QGU A;  1FUS A;  4ILF A;  4HZ9 B;  3AMO B;  3FG1 A;  3NM2 A;  5LC7 A;  2CFK A;  5CF2 A;  4WYK B;  1JB4 A;  1RTU A;  3SED A;  2L1S A;  4R9L A;  1Q7H A;  3AGN A;  1YIT 3;  3NXJ A;  2OTL 3;  1BSA A;  3BIR A;  3D79 A;  4KFD A;  2YFI B;  4CDL A;  1VQ8 3;  2KAA A;  2BMQ B;  4CPK A;  3KSP A;  1OHO A;  3KKG A;  1K73 4;  3HX8 A;  2HMO B;  3WR2 A;  3B8L A;  1YHQ 3;  3CPO A;  4EV5 A;  2QEX 3;  4BTX A;  3LYG A;  7STD A;  2LQV A;  3O8Y A;  1A2K A;  3PCS A;  3IMA B;  1RN4 A;  2RGQ A;  4J5G A;  2E2T A;  5BXQ A;  1IV7 A;  1X1W A;  3NUV A;  3CNX A;  1AQZ A;  4LYL B;  3DGN A;  3K7C A;  1EUI C;  3DUK A;  1AVL A;  1SII A;  4NRE A;  1GYB A;  1DYU A;  1N8R 4;  1QAF A;  3MG1 A;  4R9K A;  1C54 A;  1W7C A;  3MHE A;  1W6G A;  1RGA A;  1NB3 I;  1UGH I;  2Q07 A;  2WOH A;  1YIJ 3;  1KWI A;  3NV0 A;  2I9W A;  1VQ5 3;  1LOV A;  1TJD A;  2W6J H;  3V98 A;  3D3L A;  3KCH A;  2KRT A;  5BIR A;  2D42 A;  3E99 A;  3L0R A;  4GHO A;  2GSP A;  1IQ8 A;  5FW5 A;  1STD A;  3WMD A;  5IER A;  1UI7 A;  2BU4 A;  3EE1 A;  3DY5 A;  3EN8 A;  3F40 A;  2KF4 A;  2OOV C;  2YX9 A;  2OCT A;  4R80 A;  3DMC A;  1SPU A;  3MKI A;  2BO9 B;  3EN1 B;  1YVB I;  4HM2 B;  5HGR A;  5A0O B;  1RNT A;  1RHL A;  4FMC A;  4O02 B;  1VQO 3;  3JUP A;  3F14 A;  4AKZ A;  2W04 A;  1N5H A;  3FG3 A;  3K9M C;  4HBR A;  4MEI A;  8RNT A;  1US1 A;  3SX1 A;  1VQ7 3;  4AKY A;  1I2E A;  3X41 A;  3CCS 3;  3SVA A;  2BHM A;  1TFK A;  1QVF 2;  2E2U A;  3NHX A;  1AV4 A;  2Y74 A;  1A90 A;  3WOE B;  7RNT A;  3NBJ A;  3MYT A;  4I4K A;  2ML6 A;  3UB1 A;  1VQ9 3;  3FF0 A;  3HK4 A;  1IQY A;  4HZB B;  5D81 A;  3Q1C A;  3WA2 X;  5IF6 A;  1QAK A;  1GMP A;  2KXG A;  3NX0 A;  4GL6 A;  1YJN 3;  4OK0 A;  1R4Y A;  3BNC A;  2W0Q A;  3CCJ 3;  3CNM A;  1TFO A;  4HOH A;  2FGT A;  2BNG A;  3CC7 3;  2HMK B;  4PEJ A;  5G1K A;  5M19 A;  2F5M A;  2QA4 3;  3B4O A;  3FZW A;  2CHC A;  1CYU A;  1OCV A;  1RGK A;  2XF3 A;  1M9G A;  5G1L A;  2WOF A;  1N9E A;  1UDI I;  3DM8 A;  5KP3 A;  1JV2 B;  3RDE A;  4BTY A;  3MPH A;  3T8U A;  2UGI A;  2W2C A;  1PY3 A;  1E97 A;  1I2G A;  4N6N B;  4XM4 A;  5EQL A;  5KP1 A;  1Q40 A;  3CCQ 3;  3K63 A;  5AYS C;  2P38 A;  3AHW A;  1TRP A;  4K61 A;  5CLK A;  4WHA A;  2Z6B A;  1DMM A;  5AII A;  1UCJ A;  2ML5 A;  2W03 A;  1D6Y A;  2HMM B;  2C4B A;  4XDW A;  2XGN A;  1M1K 4;  1B20 A;  1FGQ A;  1S5A A;  3UJM A;  1I3F A;  1AY7 A;  3F8X A;  3CMA 3;  2BIR A;  3EC9 A;  3UL5 A;  1JN5 A;  4N6V 0;  3WHO A;  4NHF A;  3OWU A;  3MSO A;  1NNV A;  3NM7 A;  3SYU A;  1EQK A;  4K1V A;  1BNF A;  2H0G A;  1K8A 4;  4KFE A;  2IY2 A;  2GXF A;  2KF6 A;  3K0Z A;  3CCV 3;  3S5C A;  1VQQ A;  3PGB A;  2IUK A;  1MWS A;  1B2Z A;  1ULJ B;  3EF8 A;  3S27 A;  3HOH A;  4I5Q A;  1KD1 4;  4KT3 B;  4N6L A;  7GSP A;  2W9Q A;  1O7M B;  4J5K A;  4N6U A;  2BMR B;  4K1U A;  2BT3 A;  2CFD A;  5JBS A;  3A5E A;  3I0Y A;  4FMD A;  1OF5 A;  1BGS A;  2E2V A;  4HJL B;  1FGR A;  1D6Z A;  2MC8 A;  1V57 A;  2CFW A;  5CF1 A;  3M8C A;  5EEO A;  4XB5 A;  4HM4 B;  3D5G A;  4MMY B;  3BB9 A;  1Q42 A;  3G6E 3;  1A67 A;  4BTW A; 
#chains in the Genus database with same CATH homology
 3FG4 A;  3DZL A;  1OPY A;  4IT7 A;  3RGA A;  2XSH B;  2GEY A;  2FNQ A;  3ECF A;  1VQ6 3;  4HKV B;  1IVX A;  3PS8 A;  1RKY A;  2CKF B;  1WMO A;  4XBT A;  4LEH A;  2CG0 A;  3QK9 A;  1GY5 A;  3F7X A;  2F98 A;  2GBW B;  3I55 3;  2OQE A;  1KC8 4;  1QAL A;  1O7W B;  3JUQ A;  3U97 A;  4CCV A;  3S28 A;  3RGR A;  3F7S A;  3LH4 A;  3B4P A;  3OWY A;  5ELJ A;  3SLU A;  1EA2 A;  3KZT A;  2SBL A;  2F99 A;  5TGN A;  2Z7A A;  4ZM8 A;  1SQW A;  3Q90 A;  2IUJ A;  3EB8 A;  3V92 A;  3QRD A;  1IK3 A;  3LTC A;  2XSO B;  4KFF A;  3LTD A;  2CG1 A;  1YJ9 3;  1W00 A;  1W01 A;  3GZX B;  2M7O A;  3OWS A;  3BLZ A;  3JVC A;  5IEP A;  3NBR A;  4H3U A;  3JUM A;  4J8T A;  1STF I;  3KE7 A;  4FCZ A;  3FKA A;  5IG4 A;  8CHO A;  3LOY A;  1R4C A;  1UUW B;  2YFL B;  3HIG A;  3BND A;  4TX4 A;  5IEN A;  1WQL B;  2V1L A;  3LXU X;  2CWT A;  2XRX B;  2JDI H;  2ZL8 A;  4ORL A;  2HML B;  2P0X A;  4O8S A;  5JPP A;  1O7N B;  4L8O A;  2GU3 A;  2WGO A;  4FMA A;  1GY7 A;  4K90 B;  3T0U A;  1K28 A;  1FGO A;  1WNH A;  2XFT A;  1M1X B;  3PCR A;  2CWU A;  2P09 A;  3SXX A;  1EG9 B;  2CW9 A;  2XEP A;  4JRF A;  3WDG B;  2Z77 A;  3X3X A;  4LGQ A;  3G71 3;  1W2B 2;  1Q40 B;  1RRH A;  3EX9 A;  3T8N A;  1QVG 2;  4LMI A;  1TP6 A;  4L8P A;  3CCU 3;  3FLJ A;  4EV2 A;  1JNQ A;  1V74 A;  3BNB A;  1MNL A;  1RN7 A;  3LTB A;  1PFP A;  3CC2 3;  1K9M 4;  4WFO A;  3WA3 A;  3CCL 3;  2CK3 H;  2O9U X;  3PZW A;  5AEW B;  3CCE 3;  1ISK A;  2KCD A;  3V99 A;  3IPT A;  1W6C A;  4FCM A;  1JKG B;  1LOX A;  1VZZ A;  1Q81 4;  4XBX A;  2CC3 A;  4HM5 B;  5JPU A;  3CPW 2;  1AVK A;  3CXC 2;  1YGE A;  2YFJ B;  1NDO B;  1LXE A;  1O7P B;  3NQZ A;  4RBN A;  3G4S 3;  1N5P A;  2K54 A;  1OF5 B;  3SOA A;  4HM0 B;  3GWR A;  1NO3 A;  4J9A A;  1WMN A;  2C11 A;  3KII A;  2HMJ B;  3FCS B;  1O7H B;  5STD A;  1E3R A;  1IU7 A;  2C10 A;  3K5T A;  1NWW A;  3MWZ A;  3KN4 A;  4Q53 A;  1Z1S A;  3LT9 A;  2RSX A;  3OW2 2;  1HU9 A;  3EJV A;  5EVH A;  5IG3 A;  5LC6 A;  2B1X B;  5IG5 A;  1DMN A;  3FSD A;  1DVC A;  1W02 A;  1Y4K A;  1N8Q A;  1S72 3;  1Q82 4;  1GS3 A;  4WWU C;  1C7H A;  3X40 A;  3JUO A;  1NB5 I;  1JB2 A;  2RFR A;  2W56 A;  4MMX B;  3I56 3;  3DXO A;  3HII A;  1W4N A;  1IDP A;  1IVV A;  1NU3 A;  3LT8 A;  3H51 A;  3EBT A;  3MG2 A;  4MJD A;  4N6O B;  3OX9 A;  2XH9 A;  3F9S A;  2QIY A;  3CC4 3;  1MOL A;  3EQQ B;  1FUW A;  1OUN A;  4N3V A;  4X2H A;  2XR8 B;  4R1K A;  3PXM A;  3NV0 B;  4XBY A;  3NQY A;  1VQN 3;  3A76 A;  3CME 3;  1RRL A;  2R4I A;  1DMQ A;  1G96 A;  1A2V A;  4O3V A;  2JQ5 A;  3EBY A;  1QJG A;  1JB5 A;  3ROB A;  1LNH A;  1WMP A;  2LYX A;  3UNL A;  1EKM A;  1VQ4 3;  2MF7 A;  1KSI A;  1UI8 A;  1L5G B;  3FH1 A;  3WOF B;  4KVH A;  2OQE C;  3HZP A;  1RJO A;  4GB5 A;  3HI7 A;  1W6Y A;  2XGL A;  5DRV A;  4OVM A;  4AEQ A;  1IVW A;  3H3H A;  3G16 A;  4IPB A;  4L7K A;  3NBB A;  4G1M B;  5IW9 A;  1TUH A;  3X3Y A;  2IMJ A;  3CCR 3;  4N6M A;  2CH9 A;  1JJ2 2;  1E3V A;  3KFQ C;  3AMO A;  1QMA A;  3Q2P A;  4WYK A;  3S29 A;  2WGQ A;  1UW1 A;  3GZB A;  4EBG A;  1GY6 A;  4EXR A;  1VQP 3;  2GEX A;  4LSO A;  5ELU A;  5BVB A;  5CK6 A;  4QWT A;  4HM1 B;  2OOV A;  4XDV A;  3DGL A;  5KP4 A;  1CYV A;  5DRE A;  4RNY A;  4MMZ B;  2B24 B;  3EHC A;  4N6T A;  2BMO B;  2Y73 A;  1HKX A;  3JUN A;  3BNE A;  3N8B A;  1F8N A;  3U1W A;  2L4V A;  1VQK 3;  5AIF A;  1TIJ A;  3VGN A;  1CEW I;  3X3Z A;  5AI1 A;  2CWV A;  1VQM 3;  4FMB A;  1Q86 4;  1ZX2 A;  4OUQ A;  2O3O A;  1JRQ A;  3OXA A;  1CQS A;  3FF2 A;  3TDG A;  1D6U A;  3N54 B;  3S67 A;  3VSY A;  1FGT A;  3GZR A;  3LTA A;  3MG3 A;  3STD A;  4HM7 B;  3DGO A;  2D1W A;  2CIU A;  2HMN B;  1DVD A;  3LZA A;  1U8C B;  2XFS A;  2P0M A;  1FA3 A;  5G2G A;  1ROA A;  1K41 A;  2ZDJ A;  3ALA A;  1JN5 B;  4O2H A;  3WOD G;  1O7G B;  1T5Y A;  1OGX A;  2GBX B;  5AYR B;  3G0K A;  3CD6 3;  1YI2 3;  1KQS 2;  4HM6 B;  1J2B A;  1IQX A;  1W5Z A;  6STD A;  4EYC A;  1WTH A;  4HM3 B;  1M90 4;  3B7C A;  3PYJ A;  4HYZ A;  1IT7 A;  2UX0 A;  5AIH A;  4EC6 A;  5FGO A;  1ULI B;  3N9H A;  3FGY A;  1GD3 A;  2RCD A;  2OTJ 3;  4FCJ A;  4HM8 B;  2INX A;  4RNZ A;  3DGM A;  2Z76 A;  5IG0 A;  1AR0 A;  3SOY A;  1OGZ A;  3J7Y d;  3GAX A;  3CCM 3;  1TU5 A;  1Q7Y 4;  4FR9 A;  3GRD A;  3G8Z A;  2GU1 A;  1SJW A;  1FGM A;  2W56 B;  3OV4 A;  5IEO A;  2CFG A;  2IA7 A;  1UUV B;  4LZI A;  5AEU B;  2OWP A;  3IJE B;  1OH0 A;  3LML A;  1OAC A;  3UL6 A;  5AIG A;  1OHP A;  4R4K A;  2P05 A;  3F8H A;  1N9J A;  1YJW 3;  3D9R A;  1IV9 A;  1VQL 3;  2A15 A;  4KZ1 A;  4IIA A;  1ZO2 A;  3ER7 A;  1GD4 A;  1JKG A;  4U13 A;  2F86 B;  1ROV A;  3KSE D;  1PU4 A;  3CU3 A;  4X2O A;  4RZM A;  2WO0 A;  1SIH A;  2STD A;  2W9P A;  5CXO A;  2K0M A;  2PNC A;  1IT8 A;  3VF1 A;  3X42 A;  5D82 A;  1LVN A;  5I97 A;  4JF8 A;  1OHS A;  1ASK A;  4H61 A;  3GZY B;  1U5O A;  2FXT A;  2CFL A;  1IVU A;  4STD A;  1BUQ A;  1NJI 4;  2PZV A;  5D83 A;  4HVN A;  1W2Z A;  4WP5 A;  2QGU A;  4HZ9 B;  3AMO B;  3FG1 A;  3NM2 A;  5LC7 A;  2CFK A;  5CF2 A;  4WYK B;  1JB4 A;  3SED A;  4R9L A;  1YIT 3;  3NXJ A;  2OTL 3;  4CDL A;  4KFD A;  1VQ8 3;  2YFI B;  2BMQ B;  3KSP A;  1OHO A;  3KKG A;  1K73 4;  3HX8 A;  2HMO B;  3B8L A;  1YHQ 3;  3CPO A;  4EV5 A;  2QEX 3;  4BTX A;  3LYG A;  7STD A;  2LQV A;  3O8Y A;  1A2K A;  3PCS A;  3IMA B;  2RGQ A;  2E2T A;  5BXQ A;  1IV7 A;  3NUV A;  3CNX A;  3DGN A;  3K7C A;  3DUK A;  1AVL A;  1SII A;  4NRE A;  1GYB A;  1DYU A;  1N8R 4;  1QAF A;  3MG1 A;  4R9K A;  1W7C A;  3MHE A;  1W6G A;  1NB3 I;  2Q07 A;  2WOH A;  1YIJ 3;  1KWI A;  3NV0 A;  2I9W A;  1VQ5 3;  2W6J H;  3V98 A;  3D3L A;  2KRT A;  2D42 A;  3E99 A;  3L0R A;  1IQ8 A;  5FW5 A;  1STD A;  3WMD A;  5IER A;  1UI7 A;  3EE1 A;  3DY5 A;  3EN8 A;  3F40 A;  2OOV C;  2YX9 A;  4R80 A;  2OCT A;  3DMC A;  1SPU A;  3MKI A;  2BO9 B;  3EN1 B;  1YVB I;  4HM2 B;  5HGR A;  5A0O B;  4FMC A;  4O02 B;  1VQO 3;  3JUP A;  3F14 A;  4AKZ A;  2W04 A;  1N5H A;  3FG3 A;  3K9M C;  4HBR A;  4MEI A;  1VQ7 3;  1US1 A;  3SX1 A;  4AKY A;  3X41 A;  3CCS 3;  3SVA A;  2BHM A;  1TFK A;  1QVF 2;  2E2U A;  3NHX A;  1AV4 A;  2Y74 A;  1A90 A;  3WOE B;  3NBJ A;  3MYT A;  4I4K A;  2ML6 A;  3UB1 A;  1VQ9 3;  3FF0 A;  3HK4 A;  1IQY A;  4HZB B;  5D81 A;  3Q1C A;  3WA2 X;  5IF6 A;  1QAK A;  2KXG A;  3NX0 A;  4GL6 A;  1YJN 3;  4OK0 A;  3BNC A;  2W0Q A;  3CCJ 3;  3CNM A;  1TFO A;  2FGT A;  2BNG A;  3CC7 3;  2HMK B;  4PEJ A;  2QA4 3;  3B4O A;  3FZW A;  2CHC A;  1CYU A;  1OCV A;  2XF3 A;  5KP3 A;  1M9G A;  2WOF A;  1N9E A;  3DM8 A;  3RDE A;  4BTY A;  1JV2 B;  3MPH A;  3T8U A;  2W2C A;  4XM4 A;  4N6N B;  1E97 A;  3CCQ 3;  5EQL A;  5KP1 A;  1Q40 A;  3K63 A;  5AYS C;  2P38 A;  4K61 A;  5CLK A;  4WHA A;  2Z6B A;  1DMM A;  5AII A;  2ML5 A;  2W03 A;  1D6Y A;  2HMM B;  4XDW A;  2XGN A;  1M1K 4;  1FGQ A;  1S5A A;  3UJM A;  3CMA 3;  3F8X A;  3EC9 A;  3UL5 A;  1JN5 A;  4N6V 0;  4NHF A;  3OWU A;  3MSO A;  3NM7 A;  1EQK A;  4K1V A;  1K8A 4;  4KFE A;  2GXF A;  3K0Z A;  3CCV 3;  3S5C A;  3PGB A;  2IUK A;  3EF8 A;  3S27 A;  1ULJ B;  1KD1 4;  4N6L A;  2W9Q A;  1O7M B;  4N6U A;  2BMR B;  4K1U A;  2BT3 A;  2CFD A;  5JBS A;  3I0Y A;  4FMD A;  1OF5 A;  2E2V A;  4HJL B;  1FGR A;  1D6Z A;  2MC8 A;  2CFW A;  5CF1 A;  3M8C A;  5EEO A;  4XB5 A;  4HM4 B;  4MMY B;  3BB9 A;  1Q42 A;  3G6E 3;  1A67 A;  4BTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...