3RGAA

Crystal structure of epoxide hydrolase for polyether lasalocid a biosynthesis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
281
structure length
281
Chain Sequence
HMPAETVRKEVALEYCRRVNAGELEGVLQLFAPDARLVDPLGTEPVVGRAALAARLAPALRGAVHEEPGRPYAAHDGTSVVLPATVTVGAPGAPPQRRGRTRVMGVIEVGEDGLIREMRVMWGVTDSSWTARPAPDEERRKELAREHCLRINDGDVDGLLKLYSPRIRFEDPVGSWTRTGLEALRAHATMAVGSNVRETAGLTVAGQDGRHAAVTVSATMDYLPSGPLLARHHLMTLPAPADPHRALIGIEYVMVIGVDADGLIDEMRAYWGATDVSLLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxide hydrolase
publication title Enzymatic catalysis of anti-Baldwin ring closure in polyether biosynthesis
pubmed doi rcsb
source organism Streptomyces lasaliensis
molecule tags Isomerase
total genus 93
structure length 281
sequence length 281
ec nomenclature ec 3.3.2.-:
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3rgaA01
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3rgaA02
2GBWB 2HMKB 4H3UA 1ULJB 2UX0A 2BNGA 3RGRA 3NHXA 3CNXA 2STDA 5DRVA 1W00A 4IIAA 2GXFA 1Z1SA 2JQ5A 3F40A 1OHSA 4R9LA 5AI1A 2HMLB 2YFJB 4XBYA 4K1UA 2HMJB 1EA2A 3LYGA 2BMOB 6STDA 1ZO2A 1JKGA 1OUNA 5AEWB 2XRXB 4KVHA 2HMOB 2K54A 1O7PB 3EF8A 3ROBA 3NUVA 1C7HA 1TP6A 4WWUC 4HVNA 3EN1B 1OHPA 3GZRA 3GZBA 1STDA 3F9SA 4L7KA 1S5AA 5D83A 1GS3A 1JB4A 3F7XA 2QIYA 1GY5A 1GYBA 5CF1A 3FF2A 1E3VA 3B8LA 4LMIA 5BVBA 3E99A 1QMAA 1DMQA 4OUQA 2RCDA 5AIGA 5CF2A 4XBTA 3CNMA 1ULIB 2B24B 3EBTA 4HJLB 3SOYA 3EHCA 3CPOA 3RGAA 4HM5B 5AIFA 1BUQA 4PEJA 1WQLB 3I0YA 2XR8B 1GY6A 3B7CA 5D81A 3NXJA 3JUNA 4HKVB 7STDA 3G16A 1VZZA 3F8XA 4LGQA 2W2CA 3CU3A 3EJVA 1NU3A 1AR0A 4MJDA 3OWSA 4XBXA 3MG2A 5IF6A 3HZPA 3G8ZA 3FZWA 3H51A 1JB2A 3OWUA 3JUMA 3STDA 1JKGB 4XB5A 3VSYA 3JUOA 1DMNA 3JUQA 5G2GA 3OV4A 3Q90A 2GEYA 3VGNA 1OGZA 1Q40A 3DM8A 4HZ9B 4HM8B 5CXOA 3HK4A 1W02A 2GEXA 3MYTA 3BLZA 3F8HA 2F98A 3OX9A 1A2KA 1CQSA 1JN5A 3D9RA 2RFRA 5IEOA 3GZYB 1NDOB 4HM3B 2XSOB 5CK6A 1NWWA 4ORLA 3S5CA 1QJGA 1ASKA 5IENA 1O7HB 2A15A 2Z76A 3DMCA 3FGYA 3ECFA 3LZAA 3K0ZA 3A76A 1TUHA 1W6YA 3MHEA 1OH0A 3MG1A 3NV0A 1O7NB 4FCMA 5AIIA 3UJMA 1ZX2A 2YFLB 3SOAA 1IDPA 3IPTA 1UUVB 3KZTA 4J8TA 3KSPA 4R1KA 3G0KA 3F14A 4XDWA 1EG9B 5IG5A 8CHOA 2Z7AA 4OVMA 2QGUA 4CDLA 3GRDA 5IG4A 3T8UA 2IMJA 3MSOA 4L8PA 4STDA 2HMNB 4HM1B 1Q40B 3B4OA 4K1VA 5AEUB 2PZVA 3MG3A 5IERA 4HM2B 1Q42A 1JN5B 4WYKA 3FF0A 3OWYA 4HM6B 3FLJA 2R4IA 3OXAA 1U5OA 3NBRA 5FW5A 5TGNA 3EX9A 3EQQB 4N3VA 4FCJA 5HGRA 4HM4B 1OF5A 3MKIA 4HZBB 3EN8A 5AIHA 3M8CA 1O7GB 3NV0B 3JUPA 1E3RA 5IG3A 2CHCA 3NM2A 1OPYA 1SJWA 3KE7A 3F7SA 3DXOA 4RZMA 4Q53A 5JPPA 2GBXB 1GY7A 4XM4A 5KP3A 3T8NA 5DREA 4WP5A 2HMMB 3ER7A 2YFIB 4XDVA 4L8OA 4LEHA 4HM7B 2OWPA 1OCVA 3DUKA 2BMQB 3SEDA 3FKAA 1DMMA 3GWRA 3DZLA 4I4KA 1ISKA 3H3HA 3EBYA 2I9WA 5D82A 4R9KA 1JB5A 2CKFB 2Z77A 2XSHB 1UUWB 5BXQA 4WYKB 4X2OA 3KKGA 3WMDA 2F86B 1W01A 1OHOA 3B4PA 5JPUA 1HKXA 2B1XB 4X2HA 2RGQA 3HX8A 1OF5B 2INXA 1OGXA 4GB5A 1K41A 1O7MB 3EC9A 1E97A 5EVHA 2BMRB 3FSDA 3BB9A 5CLKA 3FH1A 4J9AA 5KP4A 4U13A 5KP1A 2F99A 4HM0B 3GZXB 1O7WB 3K7CA 5IEPA 5IG0A 3UNLA 5STDA
chains in the Genus database with same CATH superfamily
2WGOA 2OQEA 3FG4A 3BU4A 1T2HA 3K63A 3BNEA 3LTAA 3A5EA 2GBWB 2HMKB 4H3UA 1V57A 3D5IA 1ULJB 1BNIA 1RGHA 3CCR3 2UX0A 2C4BA 2BNGA 2WGQA 3G713 1SARA 1PU4A 3JVCA 2F56A 3WOFB 1VQ73 1RGKA 1QALA 3RGRA 3V99A 3NHXA 1LOVA 3RNTA 2P38A 3CNXA 5M19A 1VQ93 1DYUA 2STDA 1JZOA 1W00A 5DRVA 3PXMA 1IYYA 4LZIA 4IIAA 3QK9A 2GXFA 4FMDA 1Q824 1RMSA 1Z1SA 2FNQA 2JQ5A 3F40A 1IU7A 1OHSA 4R9LA 1QVG2 1IVVA 2HMLB 2YFJB 1R4CA 4XBYA 5AI1A 4K1UA 2HMJB 1EA2A 3LYGA 2RSXA 4NPBA 1M9GA 1BNJA 4AEQA 1Q814 2BMOB 1RGLA 3KCHA 3WA2X 1SIIA 2W0QA 1JBRA 1EUIC 4BIRA 2KCDA 6STDA 1CYVA 2E2VA 1ZO2A 1ZS7A 3MWZA 1JKGA 3ZG5A 1OUNA 3SXXA 1TTOA 5AEWB 2XRXB 2LQVA 2HMOB 2K54A 4KVHA 4O2HA 1O7PB 4AKYA 3HOHA 2IUKA 3EF8A 2KF6A 3ROBA 3NUVA 1AV4A 1BRGA 1C7HA 1GMQA 1TP6A 3PGBA 3U97A 2O9UX 1VQ83 4WWUC 1IQXA 1BSBA 4EBGA 1NB3I 2PNCA 4HVNA 3EN1B 2Y74A 1BNGA 1OHPA 3GZRA 4BL2A 3GZBA 1STDA 2XH9A 3L0RA 5JBSA 3F9SA 1IQ8A 3LH4A 1M904 4KFDA 4K90B 3U1WA 4L7KA 2CIUA 1S5AA 3PS8A 4R80A 2F5WA 5D83A 1GS3A 3CPW2 1JB4A 1B2XA 2E2UA 6RNTA 3F7XA 2QIYA 3LTCA 1JJ22 1GY5A 1GYBA 1NNVA 1WTHA 2C10A 1BUQA 4N6V0 1L5GB 1GD3A 4KT3B 5CF1A 3FF2A 1E3VA 1I2GA 1X1WA 3CCM3 3B8LA 4AKZA 3NBBA 4KFEA 4LMIA 5BVBA 1BRJA 2UUGC 3E99A 1DMQA 1LVNA 1QMAA 4OUQA 3LT9A 2RCDA 2H0IA 1Y4KA 5AIGA 4XBTA 1LOYA 5CF2A 3CNMA 1VQL3 1J2BA 2OOVC 2W04A 2XF3A 1I0XA 2B24B 1IVUA 1ULIB 3EBTA 3KSED 4HJLB 4RNTA 1I0VA 2ML5A 3SOYA 3DGLA 1BRNL 1W6CA 2O3OA 1UCJA 3EHCA 3CPOA 1MWSA 3RGAA 5BIRA 3BIRA 4HM5B 2Y73A 4PEJA 1UGHI 1WQLB 3I0YA 1UCKA 1FGTA 1STFI 1GSPA 2AAEA 2XR8B 1FUWA 2L4VA 1GY6A 4IT7A 2CFGA 4J5GA 2C11A 1RCKA 1GOVA 1IQYA 3B7CA 1V74A 5G1KA 1FA3A 2CFWA 4HKVB 3NXJA 3JUNA 1N8QA 1YVSA 5D81A 2GSPA 1HYFA 7STDA 1YIT3 1NJI4 2WOFA 7GSPA 3DH2A 3G16A 1FGOA 3S27A 1VZZA 1TJDA 1N9EA 1MNLA 1UW1A 5ELJA 4O02B 3DY5A 4FCZA 3F8XA 4LGQA 1VQP3 1AVLA 1PFPA 2W2CA 1MWRA 1I3FA 3CU3A 4MMZB 1CEWI 3DGNA 3EJVA 1NU3A 1C54A 3CC43 1BRIA 1BGSA 1AR0A 1RGCA 5G1LA 1RGFA 4IPBA 4MJDA 2QEX3 3OWSA 4XBXA 5FGOA 3MG2A 1X1YA 1UGIA 5IF6A 4N6LA 4EV2A 3HZPA 3G8ZA 1YHQ3 3EE1A 1DETA 2CW9A 3FZWA 3H51A 1JB2A 3OWUA 5AYRB 3JUMA 1I2FA 3STDA 1JKGB 4XB5A 2M7OA 4QWTA 2XGLA 2ZA4A 2CG1A 1A2VA 1W7CA 3VSYA 1N9JA 3JUOA 1UI8A 2OQEC 1KQS2 1DMNA 1I3IA 2UGIA 3JUQA 2ZL8A 5G2GA 3OV4A 3Q90A 4GHOA 1YGEA 2GEYA 1S723 3VGNA 1BAOA 7RNTA 5HOHA 1VQK3 1OGZA 1FGMA 1Q40A 3TDGA 3DM8A 4HZ9B 1VQN3 3N9HA 1PY3A 2W9QA 1SQWA 4HM8B 2XEPA 3HK4A 5CXOA 3CC73 1W02A 2GEXA 3UB1A 4BL3A 1WMOA 3GSPA 1DVDA 2CWTA 3GAXA 4BTXA 3MYTA 1VQO3 1TIJA 5IW9A 3CCL3 3KIIA 1RLSA 3BLZA 3F8HA 3CCQ3 2F98A 1AVKA 1N5HA 1RN4A 3OX9A 2GU1A 1A2KA 1CQSA 1JN5A 3D9RA 3SLUA 2RFRA 5IEOA 4EW5A 3N54B 2CFDA 1K8A4 3GZYB 1B2UA 1NDOB 2IYJA 2XSOB 4HM3B 1YJ93 3I563 3IMAB 5CK6A 3G4S3 2P0MA 4CPKA 1JBTA 1NWWA 1RN7A 4ORLA 4HBRA 3S5CA 1QJGA 4HAAA 3FG1A 1NO3A 2ZDJA 1ASKA 4N6MA 5IENA 1O7HB 3ZG0A 4BTWA 4CCVA 2A15A 3CCJ3 1KC84 2V1LA 2Z76A 3DMCA 3FGYA 5ELUA 5AYSC 4KZ1A 1RKYA 3CCE3 3MPHA 1BOXA 3ECFA 1FGRA 3DGMA 3LZAA 3WR2A 1LOXA 3K0ZA 1KWIA 3A76A 1TUHA 4R4KA 2W03A 1BU4A 2JDIH 2KF3A 1W6YA 1K28A 1WNHA 3MHEA 3SX1A 2R41A 1OH0A 1GMPA 1LQGC 3MG1A 2MC8A 3NV0A 1IK3A 1BRHA 4RNYA 1O7NB 4FCMA 3OW22 3CCU3 3N8BA 5AIIA 4MMYB 3X40A 1BNFA 3AHSA 3UJMA 1PYLA 3V92A 1ZX2A 1BNSA 5GSPA 1RRLA 1M1XB 2BHMA 4KFFA 1I2EA 4JF8A 1YI23 2YFLB 5RNTA 3CD63 3SOAA 3X41A 1IDPA 2SARA 3LT8A 3IPTA 1UUVB 3DGOA 3KZTA 4WHAA 4J8TA 3KSPA 4HOHA 1LQMB 2P0XA 1BRKA 4R1KA 3G0KA 1VQM3 3FCSB 3F14A 3X3XA 4XDWA 2WO0A 3S67A 1EG9B 4LSOA 5IG5A 1GOYA 1RGEA 3T0UA 1K734 2ZHXB 5EQLA 8CHOA 2LYXA 1LRAA 2Z7AA 1MOLA 3URPA 1TU5A 1D6ZA 2Z6BA 1U8CB 2KF4A 4OVMA 2D42A 2OCTA 2K0MA 1ROAA 1I8VA 1WMNA 2QGUA 2MF7A 4CDLA 2OTL3 4OK0A 3GRDA 1UCLA 4N6OB 2GU3A 1IV7A 1B3SA 3NQZA 1UUGB 1QAKA 1EQKA 3LOYA 5IG4A 1D6YA 3T8UA 2IMJA 1MWTA 2L1SA 3UL5A 1VQ43 2RBIA 3MSOA 3BNCA 4L8PA 4STDA 3VF1A 3ALAA 3FG3A 2HMNB 1MGRA 1T3BA 1MGWA 4HM1B 2KAAA 1Q40B 1CYUA 1TRQA 1VQQA 4K61A 1RNTA 3D4AA 1IVWA 3B4OA 5BU4A 3LTBA 3CCV3 2OTJ3 4K1VA 1G02A 1RCLA 4MMXB 1YVBI 3RDEA 1X1XA 5EEOA 2PZVA 3MG3A 5LC7A 3DGYA 5AEUB 4EV5A 2W56A 1B2ZA 2XFSA 5IERA 1RSNA 1BVIA 3LTDA 1FUTA 1VQ53 4BTYA 1LNHA 2BT3A 1R4YA 3PCSA 4HM2B 1Q42A 4N6TA 1JN5B 4WYKA 1BNEA 3G6E3 2FGTA 3FF0A 3OWYA 4HM6B 3UL6A 2FXTA 2H0HA 1RRHA 2R4IA 3FLJA 2H0GA 1N5PA 3NBJA 3HIIA 3OXAA 1U5OA 1M1K4 3CC23 3NBRA 4FMAA 1G96A 3D5GA 4HYZA 3EB8A 1FYSA 1I70A 5FW5A 5TGNA 6GSPA 1QAFA 1YNVX 3EX9A 3S28A 1EKMA 1B20A 1B27A 2CX1A 2W6JH 1BUJA 1JNQA 1FW7A 5AIFA 3EQQB 4MEIA 4N3VA 4FCJA 5HGRA 1TFOA 1JRQA 4HM4B 3SYUA 1Q7Y4 1OF5A 4EC6A 3I553 1X1UA 3MKIA 4JRFA 4HZBB 3IJEB 1VQ63 3KFQC 3EN8A 4TX4A 5AIHA 1B21A 1QVF2 1AY7A 1A67A 3M8CA 3WA3A 1BRSA 1O7GB 4FMBA 1RJOA 1RDSA 1US1A 3NV0B 1BIRA 3JUPA 1BSAA 1E3RA 4I5QA 5IG3A 2CHCA 2QA43 3HIGA 1HU9A 3NM2A 1OPYA 1SJWA 1SPUA 3KE7A 3KN4A 3F7SA 1FUSA 3AMOA 3LXUX 3DXOA 4GSPA 4Q53A 4RZMA 1W4NA 5JPPA 2GBXB 3PCRA 2J8XB 1BSDA 1GY7A 3NX0A 3Q3FA 4XM4A 3WDGB 5KP3A 1RGGA 2CH9A 3V98A 2RNTA 1Q9EA 1RHLA 1K9M4 3ZFZA 3T8NA 1A90A 5DREA 4GL6A 1GD4A 2HMMB 4WP5A 2CFKA 3WOEB 1GOUA 2AADA 3ER7A 1LOWA 2YFIB 1SIHA 4NHFA 4XDVA 4L8OA 1JBSA 4LEHA 1G0TA 1UCIA 3NQYA 4HM7B 2OWPA 1OCVA 3D3LA 3CMA3 1ZGXA 3DUKA 1T2IA 2BMQB 2IUJA 3D79A 1BSCA 3SEDA 3FKAA 1B2MA 2K3DA 1DMMA 1F8NA 1RN1A 1UI7A 1N8R4 1IT7A 3GWRA 1D6UA 1NB5I 4N6NB 1W2ZA 4O8SA 4FMCA 4CJNA 4O3VA 3PYJA 2SBLA 3BNBA 2IA7A 2P09A 4ILFA 1LNIA 2BU4A 3DZLA 9RNTA 4I4KA 2CWUA 1JZDA 5LC6A 1B2SA 1ISKA 3Q2PA 2ML6A 1IVXA 1DVCA 1OACA 3H3HA 3Q1CA 3K5TA 1IV9A 3J7Yd 1W5ZA 3X3ZA 3EBYA 2F5MA 1GMRA 2I9WA 3BNDA 1MWUA 1BSEA 1AQZA 1V58A 1HZ1A 1JV2B 5D82A 4R9KA 4BU4A 3CXC2 3S29A 1JB5A 2W56B 2D1WA 3SVAA 2KF5A 2CKFB 2Z77A 1TFKA 2XSHB 1UUWB 1YJN3 5BXQA 5M18A 1UDII 4WYKB 1KSIA 4X2OA 3KKGA 1CH0A 2OOVA 3WMDA 1ROVA 4WFOA 2F86B 1W01A 4LYLB 1OHOA 5I97A 3QRDA 3B4PA 3PZWA 1DE3A 1YIJ3 2P05A 2WOHA 3LMLA 1W2B2 5JPUA 1HKXA 1RGAA 2CX0A 5M1AA 1A2PA 1YJW3 3O8YA 1FGQA 1LXEA 2B1XB 4H61A 4X2HA 2F4YA 2RGQA 3HX8A 3X3YA 1OF5B 2INXA 4ZM8A 4EXRA 2HOHA 2KXGA 4N6UA 4G1MB 1OGXA 1T5YA 4RNZA 4GB5A 1K41A 1O7MB 3EC9A 2XGNA 1Q7HA 2KRTA 3HI7A 1BNRA 1IT8A 1FZUA 2XFTA 1TRPA 3AGNA 3WODG 1EEJA 1E97A 5EVHA 2BMRB 1YGWA 3FSDA 3BB9A 1BANA 5CLKA 2CFLA 2IY2A 1Q864 2YX9A 3FH1A 2W9PA 4J9AA 5KP4A 4EYCA 2BIRA 3AMOB 4NREA 3AGOA 4U13A 2CWVA 3CME3 2Q07A 4FR9A 3WHOA 5A0OB 5KP1A 3CCS3 2F99A 4HM0B 3GZXB 1KD14 1RTUA 1WMPA 3K9MC 1O7WB 3K7CA 1W6GA 3AHWA 1RNBA 5IEPA 2BO9B 2CC3A 4RBNA 4DKIA 4J5KA 5IG0A 2CK3H 3X42A 8RNTA 2E2TA 2CG0A 3UNLA 3NM7A 5STDA
chains in the Genus database with same CATH topology
2WGOA 2OQEA 3FG4A 3K63A 3BNEA 3LTAA 2GBWB 2HMKB 4H3UA 1ULJB 3CCR3 2UX0A 2BNGA 2WGQA 3G713 1PU4A 3JVCA 3WOFB 1VQ73 3RGRA 1QALA 3V99A 3NHXA 2P38A 3CNXA 1VQ93 1DYUA 2STDA 1W00A 5DRVA 3PXMA 4LZIA 4IIAA 3QK9A 2GXFA 4FMDA 1Q824 1Z1SA 2FNQA 2JQ5A 3F40A 1IU7A 1OHSA 4R9LA 1QVG2 1IVVA 2HMLB 2YFJB 1R4CA 4XBYA 5AI1A 4K1UA 2HMJB 1EA2A 3LYGA 2RSXA 1M9GA 4AEQA 1Q814 2BMOB 3WA2X 1SIIA 2W0QA 2KCDA 6STDA 1CYVA 2E2VA 1ZO2A 3MWZA 1JKGA 1OUNA 3SXXA 5AEWB 2XRXB 2LQVA 2HMOB 2K54A 4KVHA 4O2HA 1O7PB 4AKYA 2IUKA 3EF8A 3ROBA 3NUVA 1AV4A 1C7HA 3U97A 1VQ83 1TP6A 3PGBA 2O9UX 4WWUC 1IQXA 4EBGA 1NB3I 2PNCA 4HVNA 3EN1B 2Y74A 1OHPA 3GZRA 3GZBA 2XH9A 1STDA 3L0RA 5JBSA 3F9SA 1IQ8A 3LH4A 1M904 4KFDA 4K90B 3U1WA 4L7KA 2CIUA 1S5AA 3PS8A 4R80A 5D83A 3CPW2 1GS3A 1JB4A 2E2UA 3F7XA 2QIYA 3LTCA 1JJ22 1GY5A 1GYBA 1WTHA 2C10A 4N6V0 1L5GB 1GD3A 5CF1A 3FF2A 1E3VA 3CCM3 3B8LA 4AKZA 3NBBA 4KFEA 4LMIA 5BVBA 3E99A 1DMQA 1LVNA 1QMAA 4OUQA 3LT9A 2RCDA 1Y4KA 5AIGA 4XBTA 5CF2A 3CNMA 1VQL3 1J2BA 2OOVC 2W04A 2XF3A 1ULIB 1IVUA 2B24B 3EBTA 3KSED 4HJLB 2ML5A 3SOYA 3DGLA 1W6CA 2O3OA 3EHCA 3CPOA 3RGAA 4HM5B 5AIFA 2Y73A 4PEJA 1WQLB 3I0YA 5EEOA 1BUQA 1FGTA 1STFI 1FUWA 2XR8B 2L4VA 1GY6A 4IT7A 2CFGA 2C11A 1IQYA 3B7CA 1V74A 1FA3A 2CFWA 4HKVB 3NXJA 3JUNA 1N8QA 5D81A 7STDA 1YIT3 1NJI4 2WOFA 3G16A 1FGOA 3S27A 1VZZA 1N9EA 1MNLA 1UW1A 5ELJA 4O02B 3DY5A 4FCZA 3F8XA 4LGQA 1VQP3 1AVLA 1PFPA 2W2CA 3CU3A 4MMZB 1CEWI 3DGNA 3EJVA 1NU3A 3CC43 1AR0A 4IPBA 4MJDA 2QEX3 3OWSA 4XBXA 5FGOA 3MG2A 5IF6A 4N6LA 4EV2A 3HZPA 3G8ZA 1YHQ3 3EE1A 2CW9A 3FZWA 3H51A 1JB2A 3OWUA 5AYRB 3JUMA 3STDA 1JKGB 4XB5A 2M7OA 4QWTA 2XGLA 2CG1A 1A2VA 1W7CA 3VSYA 1N9JA 3JUOA 1UI8A 2OQEC 1KQS2 1DMNA 3JUQA 2ZL8A 5G2GA 3OV4A 3Q90A 1YGEA 2GEYA 1S723 3VGNA 1VQK3 1OGZA 1FGMA 1Q40A 3TDGA 3DM8A 4HZ9B 1VQN3 3N9HA 2W9QA 1SQWA 4HM8B 2XEPA 3HK4A 5CXOA 3CC73 1W02A 2GEXA 3UB1A 1WMOA 1DVDA 2CWTA 3GAXA 4BTXA 3MYTA 1VQO3 1TIJA 5IW9A 3CCL3 3KIIA 3BLZA 3F8HA 3CCQ3 2F98A 1AVKA 1N5HA 3OX9A 2GU1A 1A2KA 1CQSA 1JN5A 3D9RA 3SLUA 2RFRA 5IEOA 3N54B 2CFDA 1K8A4 3GZYB 1NDOB 4HM3B 2XSOB 1YJ93 3I563 3IMAB 5CK6A 3G4S3 2P0MA 1NWWA 1RN7A 4ORLA 4HBRA 3S5CA 1QJGA 3FG1A 1NO3A 2ZDJA 1ASKA 4N6MA 5IENA 1O7HB 4BTWA 4CCVA 1KC84 2A15A 3CCJ3 2V1LA 2Z76A 3DMCA 3FGYA 5ELUA 5AYSC 4KZ1A 1RKYA 3CCE3 3MPHA 3ECFA 1FGRA 3DGMA 3LZAA 1LOXA 3K0ZA 1KWIA 3A76A 1TUHA 4R4KA 2W03A 2JDIH 1W6YA 1K28A 1WNHA 3MHEA 3SX1A 1OH0A 3MG1A 2MC8A 3OW22 3NV0A 1IK3A 4RNYA 1O7NB 4FCMA 3CCU3 3N8BA 5AIIA 4MMYB 3X40A 3UJMA 3V92A 1ZX2A 1RRLA 1M1XB 2BHMA 4KFFA 4JF8A 1YI23 2YFLB 3CD63 3SOAA 3X41A 1IDPA 3LT8A 3IPTA 1UUVB 3DGOA 3KZTA 4WHAA 4J8TA 3KSPA 2P0XA 4R1KA 3G0KA 1VQM3 3FCSB 3F14A 3X3XA 4XDWA 2WO0A 3S67A 1EG9B 4LSOA 5IG5A 1K734 3T0UA 5EQLA 8CHOA 2LYXA 2Z7AA 1MOLA 1TU5A 1D6ZA 2Z6BA 1U8CB 4OVMA 2D42A 2OCTA 2K0MA 1ROAA 2QGUA 1WMNA 2MF7A 4CDLA 2OTL3 4OK0A 3GRDA 4N6OB 2GU3A 1IV7A 3NQZA 1QAKA 1EQKA 3LOYA 5IG4A 1D6YA 3T8UA 2IMJA 3UL5A 1VQ43 3MSOA 3BNCA 4L8PA 4STDA 3VF1A 3ALAA 3FG3A 2HMNB 4HM1B 1Q40B 1CYUA 4K61A 3CCV3 1IVWA 3B4OA 3LTBA 2OTJ3 4K1VA 4MMXB 1YVBI 3RDEA 5LC7A 2PZVA 3MG3A 5AEUB 4EV5A 2W56A 2XFSA 5IERA 3LTDA 1VQ53 4BTYA 1LNHA 2BT3A 3PCSA 4HM2B 1Q42A 4N6TA 1JN5B 4WYKA 3G6E3 2FGTA 3FF0A 3OWYA 4HM6B 3UL6A 2FXTA 3FLJA 1RRHA 2R4IA 1N5PA 3NBJA 3HIIA 3OXAA 1U5OA 1M1K4 3CC23 3NBRA 4FMAA 1G96A 4HYZA 3EB8A 5FW5A 5TGNA 1QAFA 3EX9A 3S28A 1EKMA 2W6JH 1JNQA 3EQQB 4MEIA 4N3VA 4FCJA 5HGRA 1TFOA 1JRQA 4HM4B 1Q7Y4 1OF5A 4EC6A 3I553 3MKIA 4JRFA 4HZBB 3IJEB 1VQ63 3KFQC 3EN8A 4TX4A 5AIHA 1QVF2 1A67A 3M8CA 3WA3A 1O7GB 4FMBA 1RJOA 1US1A 3NV0B 3JUPA 2QA43 1E3RA 5IG3A 2CHCA 3HIGA 1HU9A 3NM2A 1OPYA 1SJWA 1SPUA 3KE7A 3KN4A 3F7SA 3AMOA 3LXUX 3DXOA 4Q53A 4RZMA 1W4NA 5JPPA 2GBXB 3PCRA 1GY7A 3NX0A 4XM4A 3WDGB 5KP3A 2CH9A 3V98A 1K9M4 3T8NA 1A90A 5DREA 4GL6A 2HMMB 1GD4A 4WP5A 2CFKA 3WOEB 3ER7A 2YFIB 1SIHA 4NHFA 4XDVA 4L8OA 4LEHA 3NQYA 4HM7B 2OWPA 1OCVA 3D3LA 3CMA3 3DUKA 2BMQB 2IUJA 3SEDA 3FKAA 1DMMA 1F8NA 1UI7A 1N8R4 1IT7A 3GWRA 1D6UA 1NB5I 4N6NB 1W2ZA 4O8SA 4FMCA 4O3VA 3PYJA 2SBLA 3BNBA 2IA7A 2P09A 3DZLA 4I4KA 2CWUA 1ISKA 5LC6A 3Q2PA 2ML6A 1IVXA 1DVCA 1OACA 3H3HA 3Q1CA 3K5TA 1IV9A 3J7Yd 1W5ZA 3X3ZA 3EBYA 2I9WA 3BNDA 1JV2B 5D82A 4R9KA 3CXC2 3S29A 1JB5A 2W56B 2D1WA 3SVAA 2CKFB 2Z77A 1TFKA 2XSHB 1UUWB 1YJN3 5BXQA 4WYKB 1KSIA 4X2OA 3KKGA 2OOVA 3WMDA 1ROVA 4WFOA 2F86B 1W01A 1OHOA 5I97A 3QRDA 3B4PA 3PZWA 1YIJ3 2P05A 2WOHA 3LMLA 1W2B2 5JPUA 1HKXA 1YJW3 3O8YA 1FGQA 1LXEA 2B1XB 4H61A 4X2HA 2RGQA 3HX8A 3X3YA 1OF5B 2INXA 4ZM8A 4EXRA 2KXGA 4N6UA 4G1MB 1OGXA 1T5YA 4RNZA 4GB5A 1K41A 1O7MB 3EC9A 2XGNA 2KRTA 3HI7A 1IT8A 2XFTA 3WODG 1E97A 5EVHA 2BMRB 3FSDA 3BB9A 5CLKA 2CFLA 1Q864 2YX9A 3FH1A 2W9PA 4J9AA 5KP4A 4EYCA 3AMOB 4NREA 4U13A 2CWVA 3CME3 2Q07A 4FR9A 5A0OB 5KP1A 3CCS3 2F99A 4HM0B 3GZXB 1KD14 1WMPA 3K9MC 1O7WB 3K7CA 1W6GA 5IEPA 2BO9B 2CC3A 4RBNA 5IG0A 2CK3H 3X42A 2E2TA 2CG0A 3UNLA 3NM7A 5STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBW B;  2HMK B;  4H3U A;  1ULJ B;  2UX0 A;  2BNG A;  3RGR A;  3NHX A;  3CNX A;  2STD A;  5DRV A;  1W00 A;  4IIA A;  2GXF A;  1Z1S A;  2JQ5 A;  3F40 A;  1OHS A;  4R9L A;  5AI1 A;  2HML B;  2YFJ B;  4XBY A;  4K1U A;  2HMJ B;  1EA2 A;  3LYG A;  2BMO B;  6STD A;  1ZO2 A;  1JKG A;  1OUN A;  5AEW B;  2XRX B;  4KVH A;  2HMO B;  2K54 A;  1O7P B;  3EF8 A;  3ROB A;  3NUV A;  1C7H A;  1TP6 A;  4WWU C;  4HVN A;  3EN1 B;  1OHP A;  3GZR A;  3GZB A;  1STD A;  3F9S A;  4L7K A;  1S5A A;  5D83 A;  1GS3 A;  1JB4 A;  3F7X A;  2QIY A;  1GY5 A;  1GYB A;  5CF1 A;  3FF2 A;  1E3V A;  3B8L A;  4LMI A;  5BVB A;  3E99 A;  1QMA A;  1DMQ A;  4OUQ A;  2RCD A;  5AIG A;  5CF2 A;  4XBT A;  3CNM A;  1ULI B;  2B24 B;  3EBT A;  4HJL B;  3SOY A;  3EHC A;  3CPO A;  3RGA A;  4HM5 B;  5AIF A;  1BUQ A;  4PEJ A;  1WQL B;  3I0Y A;  2XR8 B;  1GY6 A;  3B7C A;  5D81 A;  3NXJ A;  3JUN A;  4HKV B;  7STD A;  3G16 A;  1VZZ A;  3F8X A;  4LGQ A;  2W2C A;  3CU3 A;  3EJV A;  1NU3 A;  1AR0 A;  4MJD A;  3OWS A;  4XBX A;  3MG2 A;  5IF6 A;  3HZP A;  3G8Z A;  3FZW A;  3H51 A;  1JB2 A;  3OWU A;  3JUM A;  3STD A;  1JKG B;  4XB5 A;  3VSY A;  3JUO A;  1DMN A;  3JUQ A;  5G2G A;  3OV4 A;  3Q90 A;  2GEY A;  3VGN A;  1OGZ A;  1Q40 A;  3DM8 A;  4HZ9 B;  4HM8 B;  5CXO A;  3HK4 A;  1W02 A;  2GEX A;  3MYT A;  3BLZ A;  3F8H A;  2F98 A;  3OX9 A;  1A2K A;  1CQS A;  1JN5 A;  3D9R A;  2RFR A;  5IEO A;  3GZY B;  1NDO B;  4HM3 B;  2XSO B;  5CK6 A;  1NWW A;  4ORL A;  3S5C A;  1QJG A;  1ASK A;  5IEN A;  1O7H B;  2A15 A;  2Z76 A;  3DMC A;  3FGY A;  3ECF A;  3LZA A;  3K0Z A;  3A76 A;  1TUH A;  1W6Y A;  3MHE A;  1OH0 A;  3MG1 A;  3NV0 A;  1O7N B;  4FCM A;  5AII A;  3UJM A;  1ZX2 A;  2YFL B;  3SOA A;  1IDP A;  3IPT A;  1UUV B;  3KZT A;  4J8T A;  3KSP A;  4R1K A;  3G0K A;  3F14 A;  4XDW A;  1EG9 B;  5IG5 A;  8CHO A;  2Z7A A;  4OVM A;  2QGU A;  4CDL A;  3GRD A;  5IG4 A;  3T8U A;  2IMJ A;  3MSO A;  4L8P A;  4STD A;  2HMN B;  4HM1 B;  1Q40 B;  3B4O A;  4K1V A;  5AEU B;  2PZV A;  3MG3 A;  5IER A;  4HM2 B;  1Q42 A;  1JN5 B;  4WYK A;  3FF0 A;  3OWY A;  4HM6 B;  3FLJ A;  2R4I A;  3OXA A;  1U5O A;  3NBR A;  5FW5 A;  5TGN A;  3EX9 A;  3EQQ B;  4N3V A;  4FCJ A;  5HGR A;  4HM4 B;  1OF5 A;  3MKI A;  4HZB B;  3EN8 A;  5AIH A;  3M8C A;  1O7G B;  3NV0 B;  3JUP A;  1E3R A;  5IG3 A;  2CHC A;  3NM2 A;  1OPY A;  1SJW A;  3KE7 A;  3F7S A;  3DXO A;  4RZM A;  4Q53 A;  5JPP A;  2GBX B;  1GY7 A;  4XM4 A;  5KP3 A;  3T8N A;  5DRE A;  4WP5 A;  2HMM B;  3ER7 A;  2YFI B;  4XDV A;  4L8O A;  4LEH A;  4HM7 B;  2OWP A;  1OCV A;  3DUK A;  2BMQ B;  3SED A;  3FKA A;  1DMM A;  3GWR A;  3DZL A;  4I4K A;  1ISK A;  3H3H A;  3EBY A;  2I9W A;  5D82 A;  4R9K A;  1JB5 A;  2CKF B;  2Z77 A;  2XSH B;  1UUW B;  5BXQ A;  4WYK B;  4X2O A;  3KKG A;  3WMD A;  2F86 B;  1W01 A;  1OHO A;  3B4P A;  5JPU A;  1HKX A;  2B1X B;  4X2H A;  2RGQ A;  3HX8 A;  1OF5 B;  2INX A;  1OGX A;  4GB5 A;  1K41 A;  1O7M B;  3EC9 A;  1E97 A;  5EVH A;  2BMR B;  3FSD A;  3BB9 A;  5CLK A;  3FH1 A;  4J9A A;  5KP4 A;  4U13 A;  5KP1 A;  2F99 A;  4HM0 B;  3GZX B;  1O7W B;  3K7C A;  5IEP A;  5IG0 A;  3UNL A;  5STD A; 
#chains in the Genus database with same CATH topology
 2WGO A;  2OQE A;  3FG4 A;  3BU4 A;  1T2H A;  3K63 A;  3BNE A;  3LTA A;  3A5E A;  2GBW B;  2HMK B;  4H3U A;  1V57 A;  3D5I A;  1ULJ B;  1BNI A;  1RGH A;  3CCR 3;  2UX0 A;  2C4B A;  2BNG A;  2WGQ A;  3G71 3;  1SAR A;  1PU4 A;  3JVC A;  2F56 A;  3WOF B;  1VQ7 3;  1RGK A;  1QAL A;  3RGR A;  3V99 A;  3NHX A;  1LOV A;  3RNT A;  2P38 A;  3CNX A;  5M19 A;  1VQ9 3;  1DYU A;  2STD A;  1JZO A;  1W00 A;  5DRV A;  3PXM A;  1IYY A;  4LZI A;  4IIA A;  3QK9 A;  2GXF A;  4FMD A;  1Q82 4;  1RMS A;  1Z1S A;  2FNQ A;  2JQ5 A;  3F40 A;  1IU7 A;  1OHS A;  4R9L A;  1QVG 2;  1IVV A;  2HML B;  2YFJ B;  1R4C A;  4XBY A;  5AI1 A;  4K1U A;  2HMJ B;  1EA2 A;  3LYG A;  2RSX A;  4NPB A;  1M9G A;  1BNJ A;  4AEQ A;  1Q81 4;  2BMO B;  1RGL A;  3KCH A;  3WA2 X;  1SII A;  2W0Q A;  1JBR A;  1EUI C;  4BIR A;  2KCD A;  6STD A;  1CYV A;  2E2V A;  1ZO2 A;  1ZS7 A;  3MWZ A;  1JKG A;  3ZG5 A;  1OUN A;  3SXX A;  1TTO A;  5AEW B;  2XRX B;  2LQV A;  2HMO B;  2K54 A;  4KVH A;  4O2H A;  1O7P B;  4AKY A;  3HOH A;  2IUK A;  3EF8 A;  2KF6 A;  3ROB A;  3NUV A;  1AV4 A;  1BRG A;  1C7H A;  1GMQ A;  1TP6 A;  3PGB A;  3U97 A;  2O9U X;  1VQ8 3;  4WWU C;  1IQX A;  1BSB A;  4EBG A;  1NB3 I;  2PNC A;  4HVN A;  3EN1 B;  2Y74 A;  1BNG A;  1OHP A;  3GZR A;  4BL2 A;  3GZB A;  1STD A;  2XH9 A;  3L0R A;  5JBS A;  3F9S A;  1IQ8 A;  3LH4 A;  1M90 4;  4KFD A;  4K90 B;  3U1W A;  4L7K A;  2CIU A;  1S5A A;  3PS8 A;  4R80 A;  2F5W A;  5D83 A;  1GS3 A;  3CPW 2;  1JB4 A;  1B2X A;  2E2U A;  6RNT A;  3F7X A;  2QIY A;  3LTC A;  1JJ2 2;  1GY5 A;  1GYB A;  1NNV A;  1WTH A;  2C10 A;  1BUQ A;  4N6V 0;  1L5G B;  1GD3 A;  4KT3 B;  5CF1 A;  3FF2 A;  1E3V A;  1I2G A;  1X1W A;  3CCM 3;  3B8L A;  4AKZ A;  3NBB A;  4KFE A;  4LMI A;  5BVB A;  1BRJ A;  2UUG C;  3E99 A;  1DMQ A;  1LVN A;  1QMA A;  4OUQ A;  3LT9 A;  2RCD A;  2H0I A;  1Y4K A;  5AIG A;  4XBT A;  1LOY A;  5CF2 A;  3CNM A;  1VQL 3;  1J2B A;  2OOV C;  2W04 A;  2XF3 A;  1I0X A;  2B24 B;  1IVU A;  1ULI B;  3EBT A;  3KSE D;  4HJL B;  4RNT A;  1I0V A;  2ML5 A;  3SOY A;  3DGL A;  1BRN L;  1W6C A;  2O3O A;  1UCJ A;  3EHC A;  3CPO A;  1MWS A;  3RGA A;  5BIR A;  3BIR A;  4HM5 B;  2Y73 A;  4PEJ A;  1UGH I;  1WQL B;  3I0Y A;  1UCK A;  1FGT A;  1STF I;  1GSP A;  2AAE A;  2XR8 B;  1FUW A;  2L4V A;  1GY6 A;  4IT7 A;  2CFG A;  4J5G A;  2C11 A;  1RCK A;  1GOV A;  1IQY A;  3B7C A;  1V74 A;  5G1K A;  1FA3 A;  2CFW A;  4HKV B;  3NXJ A;  3JUN A;  1N8Q A;  1YVS A;  5D81 A;  2GSP A;  1HYF A;  7STD A;  1YIT 3;  1NJI 4;  2WOF A;  7GSP A;  3DH2 A;  3G16 A;  1FGO A;  3S27 A;  1VZZ A;  1TJD A;  1N9E A;  1MNL A;  1UW1 A;  5ELJ A;  4O02 B;  3DY5 A;  4FCZ A;  3F8X A;  4LGQ A;  1VQP 3;  1AVL A;  1PFP A;  2W2C A;  1MWR A;  1I3F A;  3CU3 A;  4MMZ B;  1CEW I;  3DGN A;  3EJV A;  1NU3 A;  1C54 A;  3CC4 3;  1BRI A;  1BGS A;  1AR0 A;  1RGC A;  5G1L A;  1RGF A;  4IPB A;  4MJD A;  2QEX 3;  3OWS A;  4XBX A;  5FGO A;  3MG2 A;  1X1Y A;  1UGI A;  5IF6 A;  4N6L A;  4EV2 A;  3HZP A;  3G8Z A;  1YHQ 3;  3EE1 A;  1DET A;  2CW9 A;  3FZW A;  3H51 A;  1JB2 A;  3OWU A;  5AYR B;  3JUM A;  1I2F A;  3STD A;  1JKG B;  4XB5 A;  2M7O A;  4QWT A;  2XGL A;  2ZA4 A;  2CG1 A;  1A2V A;  1W7C A;  3VSY A;  1N9J A;  3JUO A;  1UI8 A;  2OQE C;  1KQS 2;  1DMN A;  1I3I A;  2UGI A;  3JUQ A;  2ZL8 A;  5G2G A;  3OV4 A;  3Q90 A;  4GHO A;  1YGE A;  2GEY A;  1S72 3;  3VGN A;  1BAO A;  7RNT A;  5HOH A;  1VQK 3;  1OGZ A;  1FGM A;  1Q40 A;  3TDG A;  3DM8 A;  4HZ9 B;  1VQN 3;  3N9H A;  1PY3 A;  2W9Q A;  1SQW A;  4HM8 B;  2XEP A;  3HK4 A;  5CXO A;  3CC7 3;  1W02 A;  2GEX A;  3UB1 A;  4BL3 A;  1WMO A;  3GSP A;  1DVD A;  2CWT A;  3GAX A;  4BTX A;  3MYT A;  1VQO 3;  1TIJ A;  5IW9 A;  3CCL 3;  3KII A;  1RLS A;  3BLZ A;  3F8H A;  3CCQ 3;  2F98 A;  1AVK A;  1N5H A;  1RN4 A;  3OX9 A;  2GU1 A;  1A2K A;  1CQS A;  1JN5 A;  3D9R A;  3SLU A;  2RFR A;  5IEO A;  4EW5 A;  3N54 B;  2CFD A;  1K8A 4;  3GZY B;  1B2U A;  1NDO B;  2IYJ A;  2XSO B;  4HM3 B;  1YJ9 3;  3I56 3;  3IMA B;  5CK6 A;  3G4S 3;  2P0M A;  4CPK A;  1JBT A;  1NWW A;  1RN7 A;  4ORL A;  4HBR A;  3S5C A;  1QJG A;  4HAA A;  3FG1 A;  1NO3 A;  2ZDJ A;  1ASK A;  4N6M A;  5IEN A;  1O7H B;  3ZG0 A;  4BTW A;  4CCV A;  2A15 A;  3CCJ 3;  1KC8 4;  2V1L A;  2Z76 A;  3DMC A;  3FGY A;  5ELU A;  5AYS C;  4KZ1 A;  1RKY A;  3CCE 3;  3MPH A;  1BOX A;  3ECF A;  1FGR A;  3DGM A;  3LZA A;  3WR2 A;  1LOX A;  3K0Z A;  1KWI A;  3A76 A;  1TUH A;  4R4K A;  2W03 A;  1BU4 A;  2JDI H;  2KF3 A;  1W6Y A;  1K28 A;  1WNH A;  3MHE A;  3SX1 A;  2R41 A;  1OH0 A;  1GMP A;  1LQG C;  3MG1 A;  2MC8 A;  3NV0 A;  1IK3 A;  1BRH A;  4RNY A;  1O7N B;  4FCM A;  3OW2 2;  3CCU 3;  3N8B A;  5AII A;  4MMY B;  3X40 A;  1BNF A;  3AHS A;  3UJM A;  1PYL A;  3V92 A;  1ZX2 A;  1BNS A;  5GSP A;  1RRL A;  1M1X B;  2BHM A;  4KFF A;  1I2E A;  4JF8 A;  1YI2 3;  2YFL B;  5RNT A;  3CD6 3;  3SOA A;  3X41 A;  1IDP A;  2SAR A;  3LT8 A;  3IPT A;  1UUV B;  3DGO A;  3KZT A;  4WHA A;  4J8T A;  3KSP A;  4HOH A;  1LQM B;  2P0X A;  1BRK A;  4R1K A;  3G0K A;  1VQM 3;  3FCS B;  3F14 A;  3X3X A;  4XDW A;  2WO0 A;  3S67 A;  1EG9 B;  4LSO A;  5IG5 A;  1GOY A;  1RGE A;  3T0U A;  1K73 4;  2ZHX B;  5EQL A;  8CHO A;  2LYX A;  1LRA A;  2Z7A A;  1MOL A;  3URP A;  1TU5 A;  1D6Z A;  2Z6B A;  1U8C B;  2KF4 A;  4OVM A;  2D42 A;  2OCT A;  2K0M A;  1ROA A;  1I8V A;  1WMN A;  2QGU A;  2MF7 A;  4CDL A;  2OTL 3;  4OK0 A;  3GRD A;  1UCL A;  4N6O B;  2GU3 A;  1IV7 A;  1B3S A;  3NQZ A;  1UUG B;  1QAK A;  1EQK A;  3LOY A;  5IG4 A;  1D6Y A;  3T8U A;  2IMJ A;  1MWT A;  2L1S A;  3UL5 A;  1VQ4 3;  2RBI A;  3MSO A;  3BNC A;  4L8P A;  4STD A;  3VF1 A;  3ALA A;  3FG3 A;  2HMN B;  1MGR A;  1T3B A;  1MGW A;  4HM1 B;  2KAA A;  1Q40 B;  1CYU A;  1TRQ A;  1VQQ A;  4K61 A;  1RNT A;  3D4A A;  1IVW A;  3B4O A;  5BU4 A;  3LTB A;  3CCV 3;  2OTJ 3;  4K1V A;  1G02 A;  1RCL A;  4MMX B;  1YVB I;  3RDE A;  1X1X A;  5EEO A;  2PZV A;  3MG3 A;  5LC7 A;  3DGY A;  5AEU B;  4EV5 A;  2W56 A;  1B2Z A;  2XFS A;  5IER A;  1RSN A;  1BVI A;  3LTD A;  1FUT A;  1VQ5 3;  4BTY A;  1LNH A;  2BT3 A;  1R4Y A;  3PCS A;  4HM2 B;  1Q42 A;  4N6T A;  1JN5 B;  4WYK A;  1BNE A;  3G6E 3;  2FGT A;  3FF0 A;  3OWY A;  4HM6 B;  3UL6 A;  2FXT A;  2H0H A;  1RRH A;  2R4I A;  3FLJ A;  2H0G A;  1N5P A;  3NBJ A;  3HII A;  3OXA A;  1U5O A;  1M1K 4;  3CC2 3;  3NBR A;  4FMA A;  1G96 A;  3D5G A;  4HYZ A;  3EB8 A;  1FYS A;  1I70 A;  5FW5 A;  5TGN A;  6GSP A;  1QAF A;  1YNV X;  3EX9 A;  3S28 A;  1EKM A;  1B20 A;  1B27 A;  2CX1 A;  2W6J H;  1BUJ A;  1JNQ A;  1FW7 A;  5AIF A;  3EQQ B;  4MEI A;  4N3V A;  4FCJ A;  5HGR A;  1TFO A;  1JRQ A;  4HM4 B;  3SYU A;  1Q7Y 4;  1OF5 A;  4EC6 A;  3I55 3;  1X1U A;  3MKI A;  4JRF A;  4HZB B;  3IJE B;  1VQ6 3;  3KFQ C;  3EN8 A;  4TX4 A;  5AIH A;  1B21 A;  1QVF 2;  1AY7 A;  1A67 A;  3M8C A;  3WA3 A;  1BRS A;  1O7G B;  4FMB A;  1RJO A;  1RDS A;  1US1 A;  3NV0 B;  1BIR A;  3JUP A;  1BSA A;  1E3R A;  4I5Q A;  5IG3 A;  2CHC A;  2QA4 3;  3HIG A;  1HU9 A;  3NM2 A;  1OPY A;  1SJW A;  1SPU A;  3KE7 A;  3KN4 A;  3F7S A;  1FUS A;  3AMO A;  3LXU X;  3DXO A;  4GSP A;  4Q53 A;  4RZM A;  1W4N A;  5JPP A;  2GBX B;  3PCR A;  2J8X B;  1BSD A;  1GY7 A;  3NX0 A;  3Q3F A;  4XM4 A;  3WDG B;  5KP3 A;  1RGG A;  2CH9 A;  3V98 A;  2RNT A;  1Q9E A;  1RHL A;  1K9M 4;  3ZFZ A;  3T8N A;  1A90 A;  5DRE A;  4GL6 A;  1GD4 A;  2HMM B;  4WP5 A;  2CFK A;  3WOE B;  1GOU A;  2AAD A;  3ER7 A;  1LOW A;  2YFI B;  1SIH A;  4NHF A;  4XDV A;  4L8O A;  1JBS A;  4LEH A;  1G0T A;  1UCI A;  3NQY A;  4HM7 B;  2OWP A;  1OCV A;  3D3L A;  3CMA 3;  1ZGX A;  3DUK A;  1T2I A;  2BMQ B;  2IUJ A;  3D79 A;  1BSC A;  3SED A;  3FKA A;  1B2M A;  2K3D A;  1DMM A;  1F8N A;  1RN1 A;  1UI7 A;  1N8R 4;  1IT7 A;  3GWR A;  1D6U A;  1NB5 I;  4N6N B;  1W2Z A;  4O8S A;  4FMC A;  4CJN A;  4O3V A;  3PYJ A;  2SBL A;  3BNB A;  2IA7 A;  2P09 A;  4ILF A;  1LNI A;  2BU4 A;  3DZL A;  9RNT A;  4I4K A;  2CWU A;  1JZD A;  5LC6 A;  1B2S A;  1ISK A;  3Q2P A;  2ML6 A;  1IVX A;  1DVC A;  1OAC A;  3H3H A;  3Q1C A;  3K5T A;  1IV9 A;  3J7Y d;  1W5Z A;  3X3Z A;  3EBY A;  2F5M A;  1GMR A;  2I9W A;  3BND A;  1MWU A;  1BSE A;  1AQZ A;  1V58 A;  1HZ1 A;  1JV2 B;  5D82 A;  4R9K A;  4BU4 A;  3CXC 2;  3S29 A;  1JB5 A;  2W56 B;  2D1W A;  3SVA A;  2KF5 A;  2CKF B;  2Z77 A;  1TFK A;  2XSH B;  1UUW B;  1YJN 3;  5BXQ A;  5M18 A;  1UDI I;  4WYK B;  1KSI A;  4X2O A;  3KKG A;  1CH0 A;  2OOV A;  3WMD A;  1ROV A;  4WFO A;  2F86 B;  1W01 A;  4LYL B;  1OHO A;  5I97 A;  3QRD A;  3B4P A;  3PZW A;  1DE3 A;  1YIJ 3;  2P05 A;  2WOH A;  3LML A;  1W2B 2;  5JPU A;  1HKX A;  1RGA A;  2CX0 A;  5M1A A;  1A2P A;  1YJW 3;  3O8Y A;  1FGQ A;  1LXE A;  2B1X B;  4H61 A;  4X2H A;  2F4Y A;  2RGQ A;  3HX8 A;  3X3Y A;  1OF5 B;  2INX A;  4ZM8 A;  4EXR A;  2HOH A;  2KXG A;  4N6U A;  4G1M B;  1OGX A;  1T5Y A;  4RNZ A;  4GB5 A;  1K41 A;  1O7M B;  3EC9 A;  2XGN A;  1Q7H A;  2KRT A;  3HI7 A;  1BNR A;  1IT8 A;  1FZU A;  2XFT A;  1TRP A;  3AGN A;  3WOD G;  1EEJ A;  1E97 A;  5EVH A;  2BMR B;  1YGW A;  3FSD A;  3BB9 A;  1BAN A;  5CLK A;  2CFL A;  2IY2 A;  1Q86 4;  2YX9 A;  3FH1 A;  2W9P A;  4J9A A;  5KP4 A;  4EYC A;  2BIR A;  3AMO B;  4NRE A;  3AGO A;  4U13 A;  2CWV A;  3CME 3;  2Q07 A;  4FR9 A;  3WHO A;  5A0O B;  5KP1 A;  3CCS 3;  2F99 A;  4HM0 B;  3GZX B;  1KD1 4;  1RTU A;  1WMP A;  3K9M C;  1O7W B;  3K7C A;  1W6G A;  3AHW A;  1RNB A;  5IEP A;  2BO9 B;  2CC3 A;  4RBN A;  4DKI A;  4J5K A;  5IG0 A;  2CK3 H;  3X42 A;  8RNT A;  2E2T A;  2CG0 A;  3UNL A;  3NM7 A;  5STD A; 
#chains in the Genus database with same CATH homology
 2WGO A;  2OQE A;  3FG4 A;  3K63 A;  3BNE A;  3LTA A;  2GBW B;  2HMK B;  4H3U A;  1ULJ B;  3CCR 3;  2UX0 A;  2BNG A;  2WGQ A;  3G71 3;  1PU4 A;  3JVC A;  3WOF B;  1VQ7 3;  3RGR A;  1QAL A;  3V99 A;  3NHX A;  2P38 A;  3CNX A;  1VQ9 3;  1DYU A;  2STD A;  1W00 A;  5DRV A;  3PXM A;  4LZI A;  4IIA A;  3QK9 A;  2GXF A;  4FMD A;  1Q82 4;  1Z1S A;  2FNQ A;  2JQ5 A;  3F40 A;  1IU7 A;  1OHS A;  4R9L A;  1QVG 2;  1IVV A;  2HML B;  2YFJ B;  1R4C A;  4XBY A;  5AI1 A;  4K1U A;  2HMJ B;  1EA2 A;  3LYG A;  2RSX A;  1M9G A;  4AEQ A;  1Q81 4;  2BMO B;  3WA2 X;  1SII A;  2W0Q A;  2KCD A;  6STD A;  1CYV A;  2E2V A;  1ZO2 A;  3MWZ A;  1JKG A;  1OUN A;  3SXX A;  5AEW B;  2XRX B;  2LQV A;  2HMO B;  2K54 A;  4KVH A;  4O2H A;  1O7P B;  4AKY A;  2IUK A;  3EF8 A;  3ROB A;  3NUV A;  1AV4 A;  1C7H A;  3U97 A;  1VQ8 3;  1TP6 A;  3PGB A;  2O9U X;  4WWU C;  1IQX A;  4EBG A;  1NB3 I;  2PNC A;  4HVN A;  3EN1 B;  2Y74 A;  1OHP A;  3GZR A;  3GZB A;  2XH9 A;  1STD A;  3L0R A;  5JBS A;  3F9S A;  1IQ8 A;  3LH4 A;  1M90 4;  4KFD A;  4K90 B;  3U1W A;  4L7K A;  2CIU A;  1S5A A;  3PS8 A;  4R80 A;  5D83 A;  3CPW 2;  1GS3 A;  1JB4 A;  2E2U A;  3F7X A;  2QIY A;  3LTC A;  1JJ2 2;  1GY5 A;  1GYB A;  1WTH A;  2C10 A;  4N6V 0;  1L5G B;  1GD3 A;  5CF1 A;  3FF2 A;  1E3V A;  3CCM 3;  3B8L A;  4AKZ A;  3NBB A;  4KFE A;  4LMI A;  5BVB A;  3E99 A;  1DMQ A;  1LVN A;  1QMA A;  4OUQ A;  3LT9 A;  2RCD A;  1Y4K A;  5AIG A;  4XBT A;  5CF2 A;  3CNM A;  1VQL 3;  1J2B A;  2OOV C;  2W04 A;  2XF3 A;  1ULI B;  1IVU A;  2B24 B;  3EBT A;  3KSE D;  4HJL B;  2ML5 A;  3SOY A;  3DGL A;  1W6C A;  2O3O A;  3EHC A;  3CPO A;  3RGA A;  4HM5 B;  5AIF A;  2Y73 A;  4PEJ A;  1WQL B;  3I0Y A;  5EEO A;  1BUQ A;  1FGT A;  1STF I;  1FUW A;  2XR8 B;  2L4V A;  1GY6 A;  4IT7 A;  2CFG A;  2C11 A;  1IQY A;  3B7C A;  1V74 A;  1FA3 A;  2CFW A;  4HKV B;  3NXJ A;  3JUN A;  1N8Q A;  5D81 A;  7STD A;  1YIT 3;  1NJI 4;  2WOF A;  3G16 A;  1FGO A;  3S27 A;  1VZZ A;  1N9E A;  1MNL A;  1UW1 A;  5ELJ A;  4O02 B;  3DY5 A;  4FCZ A;  3F8X A;  4LGQ A;  1VQP 3;  1AVL A;  1PFP A;  2W2C A;  3CU3 A;  4MMZ B;  1CEW I;  3DGN A;  3EJV A;  1NU3 A;  3CC4 3;  1AR0 A;  4IPB A;  4MJD A;  2QEX 3;  3OWS A;  4XBX A;  5FGO A;  3MG2 A;  5IF6 A;  4N6L A;  4EV2 A;  3HZP A;  3G8Z A;  1YHQ 3;  3EE1 A;  2CW9 A;  3FZW A;  3H51 A;  1JB2 A;  3OWU A;  5AYR B;  3JUM A;  3STD A;  1JKG B;  4XB5 A;  2M7O A;  4QWT A;  2XGL A;  2CG1 A;  1A2V A;  1W7C A;  3VSY A;  1N9J A;  3JUO A;  1UI8 A;  2OQE C;  1KQS 2;  1DMN A;  3JUQ A;  2ZL8 A;  5G2G A;  3OV4 A;  3Q90 A;  1YGE A;  2GEY A;  1S72 3;  3VGN A;  1VQK 3;  1OGZ A;  1FGM A;  1Q40 A;  3TDG A;  3DM8 A;  4HZ9 B;  1VQN 3;  3N9H A;  2W9Q A;  1SQW A;  4HM8 B;  2XEP A;  3HK4 A;  5CXO A;  3CC7 3;  1W02 A;  2GEX A;  3UB1 A;  1WMO A;  1DVD A;  2CWT A;  3GAX A;  4BTX A;  3MYT A;  1VQO 3;  1TIJ A;  5IW9 A;  3CCL 3;  3KII A;  3BLZ A;  3F8H A;  3CCQ 3;  2F98 A;  1AVK A;  1N5H A;  3OX9 A;  2GU1 A;  1A2K A;  1CQS A;  1JN5 A;  3D9R A;  3SLU A;  2RFR A;  5IEO A;  3N54 B;  2CFD A;  1K8A 4;  3GZY B;  1NDO B;  4HM3 B;  2XSO B;  1YJ9 3;  3I56 3;  3IMA B;  5CK6 A;  3G4S 3;  2P0M A;  1NWW A;  1RN7 A;  4ORL A;  4HBR A;  3S5C A;  1QJG A;  3FG1 A;  1NO3 A;  2ZDJ A;  1ASK A;  4N6M A;  5IEN A;  1O7H B;  4BTW A;  4CCV A;  1KC8 4;  2A15 A;  3CCJ 3;  2V1L A;  2Z76 A;  3DMC A;  3FGY A;  5ELU A;  5AYS C;  4KZ1 A;  1RKY A;  3CCE 3;  3MPH A;  3ECF A;  1FGR A;  3DGM A;  3LZA A;  1LOX A;  3K0Z A;  1KWI A;  3A76 A;  1TUH A;  4R4K A;  2W03 A;  2JDI H;  1W6Y A;  1K28 A;  1WNH A;  3MHE A;  3SX1 A;  1OH0 A;  3MG1 A;  2MC8 A;  3OW2 2;  3NV0 A;  1IK3 A;  4RNY A;  1O7N B;  4FCM A;  3CCU 3;  3N8B A;  5AII A;  4MMY B;  3X40 A;  3UJM A;  3V92 A;  1ZX2 A;  1RRL A;  1M1X B;  2BHM A;  4KFF A;  4JF8 A;  1YI2 3;  2YFL B;  3CD6 3;  3SOA A;  3X41 A;  1IDP A;  3LT8 A;  3IPT A;  1UUV B;  3DGO A;  3KZT A;  4WHA A;  4J8T A;  3KSP A;  2P0X A;  4R1K A;  3G0K A;  1VQM 3;  3FCS B;  3F14 A;  3X3X A;  4XDW A;  2WO0 A;  3S67 A;  1EG9 B;  4LSO A;  5IG5 A;  1K73 4;  3T0U A;  5EQL A;  8CHO A;  2LYX A;  2Z7A A;  1MOL A;  1TU5 A;  1D6Z A;  2Z6B A;  1U8C B;  4OVM A;  2D42 A;  2OCT A;  2K0M A;  1ROA A;  2QGU A;  1WMN A;  2MF7 A;  4CDL A;  2OTL 3;  4OK0 A;  3GRD A;  4N6O B;  2GU3 A;  1IV7 A;  3NQZ A;  1QAK A;  1EQK A;  3LOY A;  5IG4 A;  1D6Y A;  3T8U A;  2IMJ A;  3UL5 A;  1VQ4 3;  3MSO A;  3BNC A;  4L8P A;  4STD A;  3VF1 A;  3ALA A;  3FG3 A;  2HMN B;  4HM1 B;  1Q40 B;  1CYU A;  4K61 A;  3CCV 3;  1IVW A;  3B4O A;  3LTB A;  2OTJ 3;  4K1V A;  4MMX B;  1YVB I;  3RDE A;  5LC7 A;  2PZV A;  3MG3 A;  5AEU B;  4EV5 A;  2W56 A;  2XFS A;  5IER A;  3LTD A;  1VQ5 3;  4BTY A;  1LNH A;  2BT3 A;  3PCS A;  4HM2 B;  1Q42 A;  4N6T A;  1JN5 B;  4WYK A;  3G6E 3;  2FGT A;  3FF0 A;  3OWY A;  4HM6 B;  3UL6 A;  2FXT A;  3FLJ A;  1RRH A;  2R4I A;  1N5P A;  3NBJ A;  3HII A;  3OXA A;  1U5O A;  1M1K 4;  3CC2 3;  3NBR A;  4FMA A;  1G96 A;  4HYZ A;  3EB8 A;  5FW5 A;  5TGN A;  1QAF A;  3EX9 A;  3S28 A;  1EKM A;  2W6J H;  1JNQ A;  3EQQ B;  4MEI A;  4N3V A;  4FCJ A;  5HGR A;  1TFO A;  1JRQ A;  4HM4 B;  1Q7Y 4;  1OF5 A;  4EC6 A;  3I55 3;  3MKI A;  4JRF A;  4HZB B;  3IJE B;  1VQ6 3;  3KFQ C;  3EN8 A;  4TX4 A;  5AIH A;  1QVF 2;  1A67 A;  3M8C A;  3WA3 A;  1O7G B;  4FMB A;  1RJO A;  1US1 A;  3NV0 B;  3JUP A;  2QA4 3;  1E3R A;  5IG3 A;  2CHC A;  3HIG A;  1HU9 A;  3NM2 A;  1OPY A;  1SJW A;  1SPU A;  3KE7 A;  3KN4 A;  3F7S A;  3AMO A;  3LXU X;  3DXO A;  4Q53 A;  4RZM A;  1W4N A;  5JPP A;  2GBX B;  3PCR A;  1GY7 A;  3NX0 A;  4XM4 A;  3WDG B;  5KP3 A;  2CH9 A;  3V98 A;  1K9M 4;  3T8N A;  1A90 A;  5DRE A;  4GL6 A;  2HMM B;  1GD4 A;  4WP5 A;  2CFK A;  3WOE B;  3ER7 A;  2YFI B;  1SIH A;  4NHF A;  4XDV A;  4L8O A;  4LEH A;  3NQY A;  4HM7 B;  2OWP A;  1OCV A;  3D3L A;  3CMA 3;  3DUK A;  2BMQ B;  2IUJ A;  3SED A;  3FKA A;  1DMM A;  1F8N A;  1UI7 A;  1N8R 4;  1IT7 A;  3GWR A;  1D6U A;  1NB5 I;  4N6N B;  1W2Z A;  4O8S A;  4FMC A;  4O3V A;  3PYJ A;  2SBL A;  3BNB A;  2IA7 A;  2P09 A;  3DZL A;  4I4K A;  2CWU A;  1ISK A;  5LC6 A;  3Q2P A;  2ML6 A;  1IVX A;  1DVC A;  1OAC A;  3H3H A;  3Q1C A;  3K5T A;  1IV9 A;  3J7Y d;  1W5Z A;  3X3Z A;  3EBY A;  2I9W A;  3BND A;  1JV2 B;  5D82 A;  4R9K A;  3CXC 2;  3S29 A;  1JB5 A;  2W56 B;  2D1W A;  3SVA A;  2CKF B;  2Z77 A;  1TFK A;  2XSH B;  1UUW B;  1YJN 3;  5BXQ A;  4WYK B;  1KSI A;  4X2O A;  3KKG A;  2OOV A;  3WMD A;  1ROV A;  4WFO A;  2F86 B;  1W01 A;  1OHO A;  5I97 A;  3QRD A;  3B4P A;  3PZW A;  1YIJ 3;  2P05 A;  2WOH A;  3LML A;  1W2B 2;  5JPU A;  1HKX A;  1YJW 3;  3O8Y A;  1FGQ A;  1LXE A;  2B1X B;  4H61 A;  4X2H A;  2RGQ A;  3HX8 A;  3X3Y A;  1OF5 B;  2INX A;  4ZM8 A;  4EXR A;  2KXG A;  4N6U A;  4G1M B;  1OGX A;  1T5Y A;  4RNZ A;  4GB5 A;  1K41 A;  1O7M B;  3EC9 A;  2XGN A;  2KRT A;  3HI7 A;  1IT8 A;  2XFT A;  3WOD G;  1E97 A;  5EVH A;  2BMR B;  3FSD A;  3BB9 A;  5CLK A;  2CFL A;  1Q86 4;  2YX9 A;  3FH1 A;  2W9P A;  4J9A A;  5KP4 A;  4EYC A;  3AMO B;  4NRE A;  4U13 A;  2CWV A;  3CME 3;  2Q07 A;  4FR9 A;  5A0O B;  5KP1 A;  3CCS 3;  2F99 A;  4HM0 B;  3GZX B;  1KD1 4;  1WMP A;  3K9M C;  1O7W B;  3K7C A;  1W6G A;  5IEP A;  2BO9 B;  2CC3 A;  4RBN A;  5IG0 A;  2CK3 H;  3X42 A;  2E2T A;  2CG0 A;  3UNL A;  3NM7 A;  5STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...