3RGAA

Crystal structure of epoxide hydrolase for polyether lasalocid a biosynthesis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
281
structure length
281
Chain Sequence
HMPAETVRKEVALEYCRRVNAGELEGVLQLFAPDARLVDPLGTEPVVGRAALAARLAPALRGAVHEEPGRPYAAHDGTSVVLPATVTVGAPGAPPQRRGRTRVMGVIEVGEDGLIREMRVMWGVTDSSWTARPAPDEERRKELAREHCLRINDGDVDGLLKLYSPRIRFEDPVGSWTRTGLEALRAHATMAVGSNVRETAGLTVAGQDGRHAAVTVSATMDYLPSGPLLARHHLMTLPAPADPHRALIGIEYVMVIGVDADGLIDEMRAYWGATDVSLLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Epoxide hydrolase
publication title Enzymatic catalysis of anti-Baldwin ring closure in polyether biosynthesis
pubmed doi rcsb
source organism Streptomyces lasaliensis
total genus 93
structure length 281
sequence length 281
ec nomenclature ec 3.3.2.-:
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3rgaA01
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3rgaA02
5KP4A 4FCMA 1O7MB 4HM2B 3WMDA 7STDA 3BLZA 3JUQA 3F9SA 4CDLA 4STDA 3NBRA 4R1KA 1GYBA 5FW5A 4L8OA 3F8XA 2YFIB 3GWRA 1OCVA 3OV4A 5IENA 3B4PA 5AIHA 2A15A 3LZAA 1Q40A 4RZMA 2XRXB 5IF6A 5IG0A 2HMNB 2BNGA 4FCJA 1DMQA 1ZX2A 2HMKB 4GB5A 5D82A 3A76A 3VGNA 3DMCA 3NXJA 1JB4A 3E99A 3G0KA 3DUKA 4HZ9B 1NU3A 1SJWA 2Z7AA 4H3UA 2RGQA 3M8CA 1DMNA 3OWSA 3ER7A 3KSPA 1UUVB 4K1VA 1GY6A 1TUHA 3UNLA 3CNMA 3EN1B 5CK6A 4HM1B 1U5OA 3F14A 4K1UA 3MHEA 3EN8A 3MG2A 1ZO2A 3F7SA 3F40A 1ULIB 4XDVA 3ROBA 4R9LA 2IMJA 4XM4A 1ULJB 3EF8A 4XB5A 3GZYB 2BMQB 3HZPA 3MSOA 2B1XB 1UUWB 2GEXA 4N3VA 3KKGA 4WYKA 1ASKA 5CLKA 5CXOA 1GY7A 5IEPA 2CKFB 1OUNA 5AIIA 5JPPA 4HM7B 3D9RA 4HM8B 3KE7A 3FF0A 5AI1A 2RFRA 4MJDA 4XBTA 3JUOA 5HGRA 4XDWA 2XSOB 2BMRB 5KP1A 5AEWB 5IEOA 1Q40B 1AR0A 1E97A 1OGXA 2GXFA 2XR8B 5D83A 1OHPA 1K41A 1ISKA 1OF5A 3GZXB 5BXQA 3SOYA 3VSYA 3EX9A 1STDA 1OGZA 5AIGA 6STDA 1OH0A 4J8TA 3T8NA 4HM0B 4IIAA 3IPTA 4PEJA 4WP5A 4KVHA 3JUMA 2PZVA 5BVBA 3K7CA 4HZBB 3RGRA 2BMOB 2HMOB 4HKVB 3RGAA 3MG3A 3G8ZA 2YFJB 3FSDA 4X2OA 3H51A 5AIFA 2Z76A 5AEUB 1DMMA 5KP3A 3EBYA 1QMAA 3NV0A 3CPOA 1JN5A 1O7GB 3EJVA 4WWUC 4WYKB 1HKXA 2INXA 1W00A 3JUPA 3Q90A 3B4OA 3OWUA 2B24B 2QIYA 1W6YA 1OHSA 1S5AA 3JUNA 3CNXA 3EBTA 3I0YA 2R4IA 1QJGA 2CHCA 4L8PA 1NWWA 3UJMA 1JB5A 2RCDA 3NHXA 2OWPA 4HJLB 1VZZA 3MG1A 3LYGA 3GRDA 4J9AA 1OF5B 3HK4A 3HX8A 2UX0A 1A2KA 1JKGA 5IG3A 3FGYA 3EHCA 5EVHA 2STDA 3OXAA 4HM6B 1OPYA 2W2CA 5CF1A 5CF2A 3FF2A 2HMJB 5DREA 3ECFA 3GZBA 4I4KA 1CQSA 1W02A 2HMLB 5IG4A 4HVNA 4HM3B 3NM2A 3STDA 1O7HB 4X2HA 1Z1SA 5DRVA 5IERA 5STDA 3FKAA 3F8HA 1O7NB 4LMIA 3SOAA 3NUVA 1W01A 4R9KA 1JB2A 3OX9A 4XBYA 5JPUA 3EC9A 3K0ZA 2GEYA 3H3HA 3KZTA 5IG5A 1EA2A 1E3VA 1NDOB 4LGQA 1OHOA 1O7PB 3FZWA 3NV0B 1JN5B 3DXOA 4LEHA 2F99A 3DM8A 5D81A 3S5CA 3FLJA 4U13A 4HM4B 4OVMA 1GS3A 1O7WB 1C7HA 2F86B 1E3RA 2HMMB 2QGUA 2JQ5A 5G2GA 3FH1A 3GZRA 3OWYA 3B7CA 1GY5A 2K54A 3MKIA 3EQQB 4XBXA 4ORLA 3G16A 3DZLA 5TGNA 1IDPA 3CU3A 4Q53A 1WQLB 4OUQA 1JKGB 2GBWB 3MYTA 1TP6A 2GBXB 3T8UA 8CHOA 2YFLB 4HM5B 1BUQA 3F7XA 4L7KA 2F98A 2XSHB 3B8LA 1Q42A 3BB9A 1EG9B 3SEDA 2Z77A 2I9WA
chains in the Genus database with same CATH superfamily
3X41A 5KP4A 1RHLA 2AADA 6RNTA 1FUSA 3AGNA 9RNTA 1TRPA 1U8CB 2OQEC 1YGEA 4FCMA 1O7MB 3DH2A 1BIRA 1GOYA 4HM2B 1RGAA 1WTHA 3CME3 1A67A 1BRJA 1MOLA 3WMDA 4HOHA 2BIRA 2OQEA 1KD14 7STDA 1N5PA 3LTDA 3BLZA 3JUQA 1Q824 1BNGA 1RNTA 3NBBA 2QA43 3F9SA 4CDLA 2MF7A 1W6GA 1EKMA 3NBRA 4STDA 3N54B 1IK3A 1X1WA 4R1KA 1GYBA 2P0XA 5FW5A 1DVDA 4L8OA 4O02B 3F8XA 2YFIB 1SPUA 2KCDA 1JZOA 3GWRA 1I0XA 1OCVA 3DGOA 1FYSA 3K63A 3OV4A 4H61A 4EBGA 1IV7A 1WMOA 1RGLA 1VQ83 5IENA 2GSPA 3AMOB 3LT8A 1VQ73 1BNRA 3PCSA 4NREA 4WHAA 5M18A 3B4PA 5AIHA 4BTXA 2A15A 1FGQA 1T2HA 3LZAA 1C54A 2CX1A 1Q40A 4RZMA 3V98A 2BU4A 2ZA4A 1JV2B 2XRXB 1V58A 5IF6A 4K90B 5IG0A 4JRFA 2HMNB 3ZFZA 2BNGA 1IV9A 2YX9A 1RNBA 1VQ93 2CFDA 4FCJA 4MMZB 1FGTA 2Y73A 4R4KA 1Q9EA 1NO3A 1DMQA 1N5HA 1ZX2A 1T2IA 2HMKB 3PYJA 4GB5A 1W7CA 4LZIA 5D82A 1NB3I 1LOXA 3A76A 4J5GA 4N6MA 5LC6A 3VGNA 8RNTA 5RNTA 1FZUA 3DMCA 3NXJA 1JB4A 3E99A 1MWRA 3G0KA 3CCQ3 1KWIA 3DUKA 3LTAA 4HZ9B 1LRAA 7GSPA 1NU3A 3BIRA 3QRDA 1SJWA 1V74A 2Z7AA 1TFOA 2FGTA 3LXUX 3N9HA 1PFPA 3PCRA 2RGQA 4H3UA 3BNCA 4HBRA 3S67A 3CCU3 3M8CA 1K9M4 1DMNA 3NM7A 3OWSA 1OACA 1Q7Y4 3D5IA 4LSOA 2KF4A 3ER7A 3KSPA 1JBTA 2OOVC 3CC73 1UUVB 2WGOA 4GHOA 2WO0A 1M904 2P05A 1Q7HA 5BIRA 4K1VA 3Q2PA 1GY6A 1TUHA 1I70A 4QWTA 3UNLA 1BNJA 3MWZA 3JVCA 3CNMA 2D1WA 3EN1B 5CK6A 4HM1B 1U5OA 3F14A 3GSPA 4RNZA 1YNVX 1RKYA 5FGOA 4K1UA 1QVG2 1RCKA 1DYUA 2XFSA 3MHEA 3EN8A 3HIIA 3X3XA 3MG2A 1YJ93 1ZO2A 3F7SA 1JJ22 1W5ZA 3F40A 3DGLA 3S27A 1BRHA 1ULIB 2H0GA 1BVIA 3IJEB 3LTBA 4JF8A 4XDVA 3ROBA 2W56B 4HAAA 3SLUA 1IVVA 4ZM8A 1IU7A 1S723 4WFOA 3D3LA 4AEQA 3I553 1RGFA 3DY5A 4R9LA 3CCL3 2IMJA 1W2B2 4XM4A 1BNIA 3KSED 4O2HA 1ULJB 3EF8A 4XB5A 2KAAA 1NJI4 1AVLA 3HI7A 3GZYB 3LTCA 2BMQB 1VQP3 1EUIC 3HZPA 1RGKA 3MSOA 3ALAA 2B1XB 1WMPA 2F5MA 4FR9A 1MWSA 1RGCA 2UGIA 2V1LA 1K8A4 1RDSA 4NPBA 1RN7A 1UUWB 1GD3A 1EEJA 1X1UA 2GEXA 3X42A 4O3VA 4N3VA 3KKGA 4WYKA 3WOEB 3G713 1K734 1VQK3 1ASKA 5CLKA 5CXOA 1GY7A 4GSPA 1JRQA 1IQXA 5IEPA 1QAFA 1Q814 1BUJA 2CKFB 1OUNA 4AKZA 1TJDA 1T5YA 5AIIA 5JPPA 4HM7B 3D9RA 1TTOA 4HM8B 2I9WA 3HOHA 3KE7A 4BL2A 3FF0A 5AI1A 2RFRA 1VQL3 1I2EA 2KXGA 3EE1A 4MJDA 1US1A 3ZG5A 1KC84 1RJOA 1QVF2 1FUWA 3L0RA 4XBTA 1BRIA 1TU5A 3JUOA 5HGRA 2XGNA 4XDWA 2CFLA 1TFKA 2LYXA 2XSOB 1YIJ3 2BMRB 2ML6A 4K61A 5AEWB 5KP1A 5IEOA 1VQ53 5HOHA 1Q40B 1AR0A 1E97A 4IPBA 4EXRA 1OGXA 2GXFA 1UUGB 3Q1CA 1T3BA 4N6LA 4BL3A 2XR8B 4FMBA 1B20A 1MGRA 2H0HA 5D83A 1X1XA 2Q07A 1LOYA 1OHPA 3CCJ3 3OW22 1I8VA 1K41A 3KFQC 1OF5A 1ISKA 2IY2A 2CWUA 3GZXB 5BXQA 2AAEA 1UGIA 2WGQA 3K9MC 5M1AA 3SOYA 2H0IA 2E2UA 3VSYA 3EX9A 3SVAA 1STDA 1OGZA 5AIGA 2QEX3 3WOFB 6STDA 1OH0A 1DE3A 2JDIH 3G4S3 1GOVA 2E2TA 4J8TA 2CK3H 2ZHXB 3CPW2 2CIUA 1FUTA 3BNBA 2P09A 3FCSB 3PS8A 4RNYA 1L5GB 3T8NA 4GL6A 4CPKA 3CCE3 4J5KA 1B2UA 4HM0B 5AYRB 1QALA 1RRHA 4IIAA 2W03A 4N6V0 1CEWI 3IPTA 4PEJA 4OK0A 1BAOA 3X3YA 2UUGC 4WP5A 3S29A 4KVHA 3JUMA 2PZVA 3FG3A 5BVBA 2ZDJA 4BU4A 1AVKA 1WNHA 1BGSA 3S28A 3K7CA 4HZBB 1AY7A 1GOUA 1FGOA 3RGRA 1YGWA 3URPA 1IQ8A 1D6ZA 2CC3A 2Y74A 1GSPA 3LOYA 1BRNL 2BMOB 2C11A 2HMOB 1BSAA 1BSCA 4HKVB 1B3SA 3RGAA 3MG3A 3G8ZA 2OOVA 2YFJB 1G96A 1BRKA 1BRSA 3FSDA 1MWTA 1AQZA 4X2OA 3H51A 5AIFA 1RGGA 4BTWA 3KIIA 3UB1A 1CH0A 2Z76A 4KFEA 3D5GA 3LT9A 1N8R4 2SBLA 5AEUB 1DMMA 5KP3A 1I2GA 3EBYA 4N6NB 1I3FA 1QMAA 1G0TA 4ILFA 3NV0A 1SQWA 3CPOA 1JN5A 1O7GB 3EJVA 4WWUC 2XEPA 4WYKB 4BIRA 1EQKA 3LH4A 5EEOA 1HKXA 1I2FA 2CFWA 3BNDA 3RNTA 2INXA 1W00A 4MMXB 3JUPA 2XFTA 4MMYB 3Q90A 3B4OA 3OWUA 2B24B 2KF5A 2IYJA 1W6YA 2QIYA 1FW7A 2C10A 1IVXA 2E2VA 1UCKA 1BNFA 2RBIA 1B27A 1OHSA 1S5AA 3TDGA 4DKIA 3JUNA 1DVCA 1YVBI 3CNXA 3EBTA 3I0YA 1VQ63 2R4IA 1JBRA 3WA3A 3AGOA 3PZWA 1LNHA 3EB8A 1QAKA 1QJGA 3LMLA 1RMSA 2PNCA 2CHCA 3G6E3 4L8PA 1BNEA 1NWWA 1X1YA 1IVWA 1TRQA 2RSXA 1VQQA 1JB5A 3GAXA 3UJMA 1LVNA 2CW9A 2RCDA 3U1WA 3CCM3 1MGWA 1ROVA 3NHXA 3T0UA 1A2PA 2OWPA 4RNTA 4HJLB 3AHSA 1D6UA 5BU4A 1CYUA 2RNTA 1YVSA 1YJW3 1VZZA 3MG1A 2Z6BA 3LYGA 2CH9A 1IQYA 3GRDA 2R41A 2W04A 4EW5A 1VQ43 1I0VA 4J9AA 1OF5B 3HK4A 1ROAA 2OTJ3 1VQN3 3HX8A 1JNQA 2UX0A 1UCJA 1N8QA 3CXC2 2GU3A 1HZ1A 1M1XB 1A2KA 1GMPA 4CJNA 1YI23 4CCVA 3ZG0A 1JKGA 5IG3A 3FGYA 1JBSA 3WDGB 3EHCA 3CC23 2CWVA 1W6CA 5EVHA 3CCV3 5G1KA 3CCS3 3V99A 2STDA 3OXAA 4HM6B 1GMQA 1OPYA 1BNSA 2W2CA 3FG4A 1VQM3 5CF1A 5CF2A 1KSIA 3FF2A 2HMJB 5DREA 3ECFA 1W4NA 1SIIA 3GZBA 4IT7A 4I4KA 3D4AA 2CX0A 4R80A 1CQSA 3U97A 1W02A 1A90A 1Y4KA 1LOWA 1J2BA 5JBSA 3NBJA 1LQGC 2BT3A 2IUKA 2LQVA 2OCTA 2HMLB 3SX1A 1UI7A 1RN1A 1HYFA 2KRTA 3PXMA 3BNEA 4FMAA 2KF6A 5IG4A 2W9PA 1UW1A 1IYYA 3BU4A 4HVNA 1RTUA 2SARA 4HM3B 2BHMA 4MEIA 3WHOA 1IT7A 3NM2A 3V92A 1NNVA 3FG1A 1O7HB 3STDA 4X2HA 3PGBA 2KF3A 1Z1SA 2D42A 3KCHA 5DRVA 1TIJA 4KFFA 5IERA 3CCR3 1YHQ3 1RRLA 4EV2A 2OTL3 5STDA 2M7OA 3FKAA 4O8SA 3F8HA 1CYVA 5A0OB 3O8YA 2IUJA 1O7NB 2WOHA 3Q3FA 4LYLB 3A5EA 4KZ1A 4LMIA 3NUVA 1STFI 1W01A 3SOAA 2CFKA 2F4YA 1UGHI 4R9KA 1JB2A 1BU4A 3I563 3OX9A 1BSDA 5ELJA 4XBYA 5JPUA 1PYLA 3EC9A 3K0ZA 1B2XA 1IT8A 2GEYA 3H3HA 2CFGA 3KZTA 5IG5A 2P38A 3HIGA 1EA2A 1E3VA 1NDOB 1DETA 1OHOA 1O7PB 1R4YA 2WOFA 3K5TA 3NQYA 4LGQA 4BTYA 2HOHA 2XH9A 3FZWA 3CD63 3NV0B 5LC7A 1UDII 1JN5B 1B21A 5AYSC 1HU9A 3AMOA 3DXOA 3UL6A 4LEHA 4G1MB 2F99A 1YJN3 1SARA 2BO9B 3IMAB 2K3DA 1BSEA 1BOXA 2K0MA 3DM8A 1GMRA 4NHFA 5D81A 3S5CA 1MWUA 3FLJA 3UL5A 7RNTA 4U13A 3VF1A 1GD4A 1KQS2 1K28A 3NX0A 4N6TA 4HM4B 4OVMA 1GS3A 1LOVA 1RGEA 1UCIA 4I5QA 1B2SA 2W9QA 1BRGA 1C7HA 1O7WB 2F86B 1E3RA 1RSNA 1SIHA 4KFDA 5ELUA 1RGHA 5IW9A 1V57A 1FA3A 1BANA 2W0QA 2HMMB 2O9UX 2GU1A 2QGUA 3DGYA 2F56A 2IA7A 3MPHA 1ZS7A 4EYCA 1PU4A 1YIT3 2JQ5A 5G2GA 1F8NA 3FH1A 3WODG 3J7Yd 2CG0A 2J8XB 1R4CA 3CMA3 3GZRA 3OWYA 3B7CA 1ZGXA 1GY5A 5M19A 2P0MA 2K54A 2O3OA 2ML5A 3MKIA 3EQQB 3NQZA 3DGMA 4ORLA 4N6UA 4XBXA 2CG1A 3AHWA 1NB5I 3G16A 3DZLA 5I97A 5TGNA 1N9JA 2FNQA 1FGMA 1IDPA 1WMNA 3WR2A 1M9GA 3CU3A 4Q53A 1LQMB 2MC8A 1WQLB 1FGRA 4OUQA 1AV4A 1IVUA 1JKGB 2GBWB 3WA2X 1VQO3 1W2ZA 3X40A 1M1K4 1D6YA 2W6JH 1A2VA 1LNIA 3MYTA 3CC43 1I3IA 2L4VA 1TP6A 3KN4A 2FXTA 2CWTA 3QK9A 1BSBA 2XF3A 2GBXB 4FMCA 5GSPA 1G02A 2ZL8A 4RBNA 3T8UA 3X3ZA 4EC6A 3SYUA 8CHOA 2XGLA 2YFLB 4HM5B 4KT3B 1BUQA 3F7XA 4FMDA 1N9EA 2W56A 5G1LA 1RN4A 6GSPA 4L7KA 4N6OB 4EV5A 3D79A 2F98A 2L1SA 3RDEA 2XSHB 3SXXA 3B8LA 1B2ZA 4HYZA 1Q42A 1PY3A 1B2MA 1UI8A 3N8BA 1MNLA 1LXEA 1UCLA 2F5WA 1Q864 3BB9A 2C4BA 1RCLA 5EQLA 1EG9B 3SEDA 2Z77A 1RLSA 3DGNA 4TX4A 4AKYA 4FCZA 1JZDA
chains in the Genus database with same CATH topology
3X41A 5KP4A 1U8CB 2OQEC 1YGEA 4FCMA 1O7MB 3CME3 4HM2B 1A67A 1WTHA 1MOLA 3WMDA 2OQEA 1KD14 7STDA 1N5PA 3LTDA 3BLZA 3JUQA 1Q824 2QA43 3NBBA 3F9SA 4CDLA 2MF7A 1W6GA 1EKMA 3NBRA 4STDA 3N54B 1IK3A 4R1KA 1GYBA 2P0XA 5FW5A 1DVDA 4L8OA 4O02B 3F8XA 2YFIB 1SPUA 2KCDA 3GWRA 4H61A 1OCVA 3DGOA 3K63A 3OV4A 4EBGA 1IV7A 1WMOA 1VQ83 5IENA 3LT8A 3AMOB 1VQ73 3PCSA 4NREA 4WHAA 3B4PA 5AIHA 4BTXA 2A15A 1FGQA 3LZAA 1Q40A 4RZMA 3V98A 1JV2B 2XRXB 5IF6A 4K90B 5IG0A 4JRFA 2HMNB 2BNGA 1IV9A 2YX9A 1VQ93 2CFDA 4FCJA 4MMZB 1FGTA 2Y73A 4R4KA 1NO3A 1DMQA 1N5HA 1ZX2A 2HMKB 3PYJA 4GB5A 1W7CA 4LZIA 5D82A 1NB3I 1LOXA 3A76A 4N6MA 5LC6A 3VGNA 3DMCA 3NXJA 1JB4A 3E99A 3G0KA 3CCQ3 1KWIA 3DUKA 3LTAA 4HZ9B 1NU3A 3QRDA 1SJWA 1V74A 2Z7AA 1TFOA 2FGTA 3LXUX 3N9HA 1PFPA 3PCRA 2RGQA 4H3UA 3BNCA 4HBRA 3S67A 3CCU3 3M8CA 1K9M4 1DMNA 3NM7A 3OWSA 1OACA 1Q7Y4 4LSOA 3ER7A 3KSPA 2OOVC 3CC73 1UUVB 2WGOA 2WO0A 1M904 2P05A 4K1VA 3Q2PA 1GY6A 1TUHA 4QWTA 3UNLA 3MWZA 3JVCA 3CNMA 2D1WA 3EN1B 5CK6A 4HM1B 1U5OA 3F14A 4RNZA 1RKYA 5FGOA 4K1UA 1QVG2 1DYUA 2XFSA 3MHEA 3EN8A 3HIIA 3X3XA 3MG2A 1YJ93 1ZO2A 3F7SA 1JJ22 1W5ZA 3F40A 3DGLA 3S27A 1ULIB 3IJEB 4XDVA 4JF8A 3LTBA 3ROBA 3SLUA 2W56B 1IVVA 4ZM8A 1IU7A 1S723 4WFOA 3D3LA 4AEQA 3I553 3DY5A 4R9LA 3CCL3 2IMJA 1W2B2 4XM4A 3KSED 4O2HA 1ULJB 3EF8A 4XB5A 1NJI4 1AVLA 3HI7A 3GZYB 3LTCA 2BMQB 1VQP3 3HZPA 3MSOA 3ALAA 2B1XB 1WMPA 4FR9A 2V1LA 1K8A4 1RN7A 1UUWB 1GD3A 2GEXA 3X42A 4O3VA 4N3VA 3KKGA 4WYKA 3WOEB 3G713 1K734 1VQK3 1ASKA 5CLKA 5CXOA 1GY7A 1JRQA 1IQXA 5IEPA 1QAFA 1Q814 2CKFB 1OUNA 4AKZA 1T5YA 5AIIA 5JPPA 4HM7B 3D9RA 4HM8B 3KE7A 3FF0A 5AI1A 2RFRA 1VQL3 2KXGA 3EE1A 4MJDA 1US1A 1KC84 1RJOA 1QVF2 1FUWA 3L0RA 4XBTA 1TU5A 3JUOA 5HGRA 2XGNA 4XDWA 2CFLA 1TFKA 2LYXA 2XSOB 1YIJ3 2BMRB 2ML6A 4K61A 5AEWB 5KP1A 5IEOA 1VQ53 1Q40B 1AR0A 1E97A 4IPBA 4EXRA 1OGXA 2GXFA 3Q1CA 4N6LA 2XR8B 4FMBA 5D83A 2Q07A 1OHPA 3CCJ3 3OW22 1K41A 3KFQC 1OF5A 1ISKA 2CWUA 3GZXB 5BXQA 2WGQA 3K9MC 3SOYA 2E2UA 3VSYA 3EX9A 3SVAA 1STDA 1OGZA 5AIGA 2QEX3 3WOFB 6STDA 1OH0A 2JDIH 3G4S3 2E2TA 4J8TA 2CK3H 3CPW2 2CIUA 3BNBA 2P09A 3FCSB 3PS8A 4RNYA 1L5GB 3T8NA 4GL6A 3CCE3 4HM0B 5AYRB 1QALA 1RRHA 4IIAA 2W03A 4N6V0 1CEWI 3IPTA 4PEJA 4OK0A 3X3YA 4WP5A 3S29A 4KVHA 3JUMA 2PZVA 3FG3A 5BVBA 2ZDJA 1AVKA 1WNHA 3S28A 3K7CA 4HZBB 1FGOA 3RGRA 1IQ8A 1D6ZA 2CC3A 2Y74A 3LOYA 2BMOB 2C11A 2HMOB 4HKVB 3RGAA 3MG3A 3G8ZA 2OOVA 2YFJB 1G96A 3FSDA 4X2OA 3H51A 5AIFA 4BTWA 3KIIA 3UB1A 2Z76A 4KFEA 3LT9A 1N8R4 2SBLA 5AEUB 1DMMA 5KP3A 3EBYA 4N6NB 1QMAA 3NV0A 1SQWA 3CPOA 1JN5A 1O7GB 3EJVA 4WWUC 2XEPA 4WYKB 1EQKA 3LH4A 5EEOA 1HKXA 2CFWA 3BNDA 2INXA 1W00A 4MMXB 3JUPA 2XFTA 4MMYB 3Q90A 3B4OA 3OWUA 2B24B 2QIYA 1W6YA 2C10A 1IVXA 2E2VA 1OHSA 1S5AA 3TDGA 3JUNA 1DVCA 1YVBI 3CNXA 3EBTA 3I0YA 1VQ63 2R4IA 3WA3A 3PZWA 1LNHA 3EB8A 1QAKA 1QJGA 3LMLA 2PNCA 2CHCA 3G6E3 4L8PA 1NWWA 1IVWA 2RSXA 3UJMA 1JB5A 3GAXA 3CCM3 1LVNA 2CW9A 2RCDA 3U1WA 1ROVA 3NHXA 3T0UA 2OWPA 4HJLB 1D6UA 1CYUA 1YJW3 1VZZA 3MG1A 2Z6BA 3LYGA 2CH9A 1IQYA 3GRDA 2W04A 1VQ43 4J9AA 1OF5B 3HK4A 1ROAA 2OTJ3 1VQN3 3HX8A 1JNQA 2UX0A 1N8QA 3CXC2 2GU3A 1M1XB 1A2KA 1YI23 4CCVA 1JKGA 5IG3A 3FGYA 3WDGB 3EHCA 3CC23 2CWVA 1W6CA 5EVHA 3CCV3 3CCS3 3V99A 2STDA 3OXAA 4HM6B 1OPYA 2W2CA 3FG4A 1VQM3 5CF1A 5CF2A 1KSIA 3FF2A 2HMJB 5DREA 3ECFA 1W4NA 1SIIA 3GZBA 4IT7A 4I4KA 4R80A 1CQSA 3U97A 1W02A 1A90A 1Y4KA 1J2BA 5JBSA 3NBJA 2BT3A 2IUKA 2LQVA 2OCTA 2HMLB 3SX1A 1UI7A 4FMAA 2KRTA 3PXMA 3BNEA 5IG4A 2W9PA 1UW1A 4HVNA 4HM3B 2BHMA 4MEIA 1IT7A 3NM2A 3V92A 3FG1A 1O7HB 3STDA 4X2HA 3PGBA 1Z1SA 2D42A 5DRVA 1TIJA 4KFFA 5IERA 3CCR3 1YHQ3 1RRLA 4EV2A 2OTL3 5STDA 2M7OA 3FKAA 4O8SA 3F8HA 1CYVA 5A0OB 3O8YA 2IUJA 1O7NB 2WOHA 4KZ1A 4LMIA 3SOAA 3NUVA 1STFI 1W01A 2CFKA 4R9KA 1JB2A 3I563 3OX9A 5ELJA 4XBYA 5JPUA 3EC9A 3K0ZA 1IT8A 2GEYA 3H3HA 2CFGA 3KZTA 5IG5A 2P38A 3HIGA 1EA2A 1E3VA 1NDOB 3NQYA 1OHOA 1O7PB 2WOFA 3K5TA 4LGQA 4BTYA 2XH9A 3FZWA 3CD63 3NV0B 5LC7A 1JN5B 5AYSC 1HU9A 3AMOA 3DXOA 3UL6A 4LEHA 4G1MB 2F99A 1YJN3 2BO9B 3IMAB 2K0MA 3DM8A 4NHFA 5D81A 3S5CA 3FLJA 3UL5A 4U13A 3VF1A 1GD4A 1KQS2 1K28A 3NX0A 4N6TA 4HM4B 4OVMA 1GS3A 2W9QA 1O7WB 1C7HA 2F86B 1E3RA 4KFDA 1SIHA 5ELUA 5IW9A 1FA3A 2W0QA 2HMMB 2O9UX 2GU1A 2QGUA 2IA7A 3MPHA 4EYCA 1PU4A 1YIT3 2JQ5A 5G2GA 1F8NA 3FH1A 3WODG 3J7Yd 2CG0A 1R4CA 3CMA3 3GZRA 3OWYA 3B7CA 1GY5A 2P0MA 2K54A 2O3OA 2ML5A 3MKIA 3EQQB 3NQZA 3DGMA 4ORLA 4N6UA 4XBXA 2CG1A 1NB5I 3G16A 3DZLA 5I97A 5TGNA 1N9JA 2FNQA 1FGMA 1IDPA 1WMNA 1M9GA 3CU3A 4Q53A 2MC8A 1WQLB 1FGRA 4OUQA 1AV4A 1IVUA 1JKGB 2GBWB 3WA2X 1VQO3 1W2ZA 3X40A 1M1K4 1D6YA 2W6JH 1A2VA 3CC43 3MYTA 2L4VA 1TP6A 3KN4A 2FXTA 2CWTA 3QK9A 2XF3A 4FMCA 2GBXB 3T8UA 3X3ZA 4RBNA 2ZL8A 4EC6A 8CHOA 2XGLA 2YFLB 4HM5B 1BUQA 3F7XA 4FMDA 1N9EA 2W56A 4L7KA 4N6OB 4EV5A 2F98A 3RDEA 2XSHB 3SXXA 3B8LA 4HYZA 1Q42A 1UI8A 3N8BA 1MNLA 1LXEA 1Q864 3BB9A 5EQLA 1EG9B 3SEDA 2Z77A 4AKYA 3DGNA 4TX4A 4FCZA 2I9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP4 A;  4FCM A;  1O7M B;  4HM2 B;  3WMD A;  7STD A;  3BLZ A;  3JUQ A;  3F9S A;  4CDL A;  4STD A;  3NBR A;  4R1K A;  1GYB A;  5FW5 A;  4L8O A;  3F8X A;  2YFI B;  3GWR A;  1OCV A;  3OV4 A;  5IEN A;  3B4P A;  5AIH A;  2A15 A;  3LZA A;  1Q40 A;  4RZM A;  2XRX B;  5IF6 A;  5IG0 A;  2HMN B;  2BNG A;  4FCJ A;  1DMQ A;  1ZX2 A;  2HMK B;  4GB5 A;  5D82 A;  3A76 A;  3VGN A;  3DMC A;  3NXJ A;  1JB4 A;  3E99 A;  3G0K A;  3DUK A;  4HZ9 B;  1NU3 A;  1SJW A;  2Z7A A;  4H3U A;  2RGQ A;  3M8C A;  1DMN A;  3OWS A;  3ER7 A;  3KSP A;  1UUV B;  4K1V A;  1GY6 A;  1TUH A;  3UNL A;  3CNM A;  3EN1 B;  5CK6 A;  4HM1 B;  1U5O A;  3F14 A;  4K1U A;  3MHE A;  3EN8 A;  3MG2 A;  1ZO2 A;  3F7S A;  3F40 A;  1ULI B;  4XDV A;  3ROB A;  4R9L A;  2IMJ A;  4XM4 A;  1ULJ B;  3EF8 A;  4XB5 A;  3GZY B;  2BMQ B;  3HZP A;  3MSO A;  2B1X B;  1UUW B;  2GEX A;  4N3V A;  3KKG A;  4WYK A;  1ASK A;  5CLK A;  5CXO A;  1GY7 A;  5IEP A;  2CKF B;  1OUN A;  5AII A;  5JPP A;  4HM7 B;  3D9R A;  4HM8 B;  3KE7 A;  3FF0 A;  5AI1 A;  2RFR A;  4MJD A;  4XBT A;  3JUO A;  5HGR A;  4XDW A;  2XSO B;  2BMR B;  5KP1 A;  5AEW B;  5IEO A;  1Q40 B;  1AR0 A;  1E97 A;  1OGX A;  2GXF A;  2XR8 B;  5D83 A;  1OHP A;  1K41 A;  1ISK A;  1OF5 A;  3GZX B;  5BXQ A;  3SOY A;  3VSY A;  3EX9 A;  1STD A;  1OGZ A;  5AIG A;  6STD A;  1OH0 A;  4J8T A;  3T8N A;  4HM0 B;  4IIA A;  3IPT A;  4PEJ A;  4WP5 A;  4KVH A;  3JUM A;  2PZV A;  5BVB A;  3K7C A;  4HZB B;  3RGR A;  2BMO B;  2HMO B;  4HKV B;  3RGA A;  3MG3 A;  3G8Z A;  2YFJ B;  3FSD A;  4X2O A;  3H51 A;  5AIF A;  2Z76 A;  5AEU B;  1DMM A;  5KP3 A;  3EBY A;  1QMA A;  3NV0 A;  3CPO A;  1JN5 A;  1O7G B;  3EJV A;  4WWU C;  4WYK B;  1HKX A;  2INX A;  1W00 A;  3JUP A;  3Q90 A;  3B4O A;  3OWU A;  2B24 B;  2QIY A;  1W6Y A;  1OHS A;  1S5A A;  3JUN A;  3CNX A;  3EBT A;  3I0Y A;  2R4I A;  1QJG A;  2CHC A;  4L8P A;  1NWW A;  3UJM A;  1JB5 A;  2RCD A;  3NHX A;  2OWP A;  4HJL B;  1VZZ A;  3MG1 A;  3LYG A;  3GRD A;  4J9A A;  1OF5 B;  3HK4 A;  3HX8 A;  2UX0 A;  1A2K A;  1JKG A;  5IG3 A;  3FGY A;  3EHC A;  5EVH A;  2STD A;  3OXA A;  4HM6 B;  1OPY A;  2W2C A;  5CF1 A;  5CF2 A;  3FF2 A;  2HMJ B;  5DRE A;  3ECF A;  3GZB A;  4I4K A;  1CQS A;  1W02 A;  2HML B;  5IG4 A;  4HVN A;  4HM3 B;  3NM2 A;  3STD A;  1O7H B;  4X2H A;  1Z1S A;  5DRV A;  5IER A;  5STD A;  3FKA A;  3F8H A;  1O7N B;  4LMI A;  3SOA A;  3NUV A;  1W01 A;  4R9K A;  1JB2 A;  3OX9 A;  4XBY A;  5JPU A;  3EC9 A;  3K0Z A;  2GEY A;  3H3H A;  3KZT A;  5IG5 A;  1EA2 A;  1E3V A;  1NDO B;  4LGQ A;  1OHO A;  1O7P B;  3FZW A;  3NV0 B;  1JN5 B;  3DXO A;  4LEH A;  2F99 A;  3DM8 A;  5D81 A;  3S5C A;  3FLJ A;  4U13 A;  4HM4 B;  4OVM A;  1GS3 A;  1O7W B;  1C7H A;  2F86 B;  1E3R A;  2HMM B;  2QGU A;  2JQ5 A;  5G2G A;  3FH1 A;  3GZR A;  3OWY A;  3B7C A;  1GY5 A;  2K54 A;  3MKI A;  3EQQ B;  4XBX A;  4ORL A;  3G16 A;  3DZL A;  5TGN A;  1IDP A;  3CU3 A;  4Q53 A;  1WQL B;  4OUQ A;  1JKG B;  2GBW B;  3MYT A;  1TP6 A;  2GBX B;  3T8U A;  8CHO A;  2YFL B;  4HM5 B;  1BUQ A;  3F7X A;  4L7K A;  2F98 A;  2XSH B;  3B8L A;  1Q42 A;  3BB9 A;  1EG9 B;  3SED A;  2Z77 A;  2I9W A; 
#chains in the Genus database with same CATH topology
 3X41 A;  5KP4 A;  1RHL A;  2AAD A;  6RNT A;  1FUS A;  3AGN A;  9RNT A;  1TRP A;  1U8C B;  2OQE C;  1YGE A;  4FCM A;  1O7M B;  3DH2 A;  1BIR A;  1GOY A;  4HM2 B;  1RGA A;  1WTH A;  3CME 3;  1A67 A;  1BRJ A;  1MOL A;  3WMD A;  4HOH A;  2BIR A;  2OQE A;  1KD1 4;  7STD A;  1N5P A;  3LTD A;  3BLZ A;  3JUQ A;  1Q82 4;  1BNG A;  1RNT A;  3NBB A;  2QA4 3;  3F9S A;  4CDL A;  2MF7 A;  1W6G A;  1EKM A;  3NBR A;  4STD A;  3N54 B;  1IK3 A;  1X1W A;  4R1K A;  1GYB A;  2P0X A;  5FW5 A;  1DVD A;  4L8O A;  4O02 B;  3F8X A;  2YFI B;  1SPU A;  2KCD A;  1JZO A;  3GWR A;  1I0X A;  1OCV A;  3DGO A;  1FYS A;  3K63 A;  3OV4 A;  4H61 A;  4EBG A;  1IV7 A;  1WMO A;  1RGL A;  1VQ8 3;  5IEN A;  2GSP A;  3AMO B;  3LT8 A;  1VQ7 3;  1BNR A;  3PCS A;  4NRE A;  4WHA A;  5M18 A;  3B4P A;  5AIH A;  4BTX A;  2A15 A;  1FGQ A;  1T2H A;  3LZA A;  1C54 A;  2CX1 A;  1Q40 A;  4RZM A;  3V98 A;  2BU4 A;  2ZA4 A;  1JV2 B;  2XRX B;  1V58 A;  5IF6 A;  4K90 B;  5IG0 A;  4JRF A;  2HMN B;  3ZFZ A;  2BNG A;  1IV9 A;  2YX9 A;  1RNB A;  1VQ9 3;  2CFD A;  4FCJ A;  4MMZ B;  1FGT A;  2Y73 A;  4R4K A;  1Q9E A;  1NO3 A;  1DMQ A;  1N5H A;  1ZX2 A;  1T2I A;  2HMK B;  3PYJ A;  4GB5 A;  1W7C A;  4LZI A;  5D82 A;  1NB3 I;  1LOX A;  3A76 A;  4J5G A;  4N6M A;  5LC6 A;  3VGN A;  8RNT A;  5RNT A;  1FZU A;  3DMC A;  3NXJ A;  1JB4 A;  3E99 A;  1MWR A;  3G0K A;  3CCQ 3;  1KWI A;  3DUK A;  3LTA A;  4HZ9 B;  1LRA A;  7GSP A;  1NU3 A;  3BIR A;  3QRD A;  1SJW A;  1V74 A;  2Z7A A;  1TFO A;  2FGT A;  3LXU X;  3N9H A;  1PFP A;  3PCR A;  2RGQ A;  4H3U A;  3BNC A;  4HBR A;  3S67 A;  3CCU 3;  3M8C A;  1K9M 4;  1DMN A;  3NM7 A;  3OWS A;  1OAC A;  1Q7Y 4;  3D5I A;  4LSO A;  2KF4 A;  3ER7 A;  3KSP A;  1JBT A;  2OOV C;  3CC7 3;  1UUV B;  2WGO A;  4GHO A;  2WO0 A;  1M90 4;  2P05 A;  1Q7H A;  5BIR A;  4K1V A;  3Q2P A;  1GY6 A;  1TUH A;  1I70 A;  4QWT A;  3UNL A;  1BNJ A;  3MWZ A;  3JVC A;  3CNM A;  2D1W A;  3EN1 B;  5CK6 A;  4HM1 B;  1U5O A;  3F14 A;  3GSP A;  4RNZ A;  1YNV X;  1RKY A;  5FGO A;  4K1U A;  1QVG 2;  1RCK A;  1DYU A;  2XFS A;  3MHE A;  3EN8 A;  3HII A;  3X3X A;  3MG2 A;  1YJ9 3;  1ZO2 A;  3F7S A;  1JJ2 2;  1W5Z A;  3F40 A;  3DGL A;  3S27 A;  1BRH A;  1ULI B;  2H0G A;  1BVI A;  3IJE B;  3LTB A;  4JF8 A;  4XDV A;  3ROB A;  2W56 B;  4HAA A;  3SLU A;  1IVV A;  4ZM8 A;  1IU7 A;  1S72 3;  4WFO A;  3D3L A;  4AEQ A;  3I55 3;  1RGF A;  3DY5 A;  4R9L A;  3CCL 3;  2IMJ A;  1W2B 2;  4XM4 A;  1BNI A;  3KSE D;  4O2H A;  1ULJ B;  3EF8 A;  4XB5 A;  2KAA A;  1NJI 4;  1AVL A;  3HI7 A;  3GZY B;  3LTC A;  2BMQ B;  1VQP 3;  1EUI C;  3HZP A;  1RGK A;  3MSO A;  3ALA A;  2B1X B;  1WMP A;  2F5M A;  4FR9 A;  1MWS A;  1RGC A;  2UGI A;  2V1L A;  1K8A 4;  1RDS A;  4NPB A;  1RN7 A;  1UUW B;  1GD3 A;  1EEJ A;  1X1U A;  2GEX A;  3X42 A;  4O3V A;  4N3V A;  3KKG A;  4WYK A;  3WOE B;  3G71 3;  1K73 4;  1VQK 3;  1ASK A;  5CLK A;  5CXO A;  1GY7 A;  4GSP A;  1JRQ A;  1IQX A;  5IEP A;  1QAF A;  1Q81 4;  1BUJ A;  2CKF B;  1OUN A;  4AKZ A;  1TJD A;  1T5Y A;  5AII A;  5JPP A;  4HM7 B;  3D9R A;  1TTO A;  4HM8 B;  2I9W A;  3HOH A;  3KE7 A;  4BL2 A;  3FF0 A;  5AI1 A;  2RFR A;  1VQL 3;  1I2E A;  2KXG A;  3EE1 A;  4MJD A;  1US1 A;  3ZG5 A;  1KC8 4;  1RJO A;  1QVF 2;  1FUW A;  3L0R A;  4XBT A;  1BRI A;  1TU5 A;  3JUO A;  5HGR A;  2XGN A;  4XDW A;  2CFL A;  1TFK A;  2LYX A;  2XSO B;  1YIJ 3;  2BMR B;  2ML6 A;  4K61 A;  5AEW B;  5KP1 A;  5IEO A;  1VQ5 3;  5HOH A;  1Q40 B;  1AR0 A;  1E97 A;  4IPB A;  4EXR A;  1OGX A;  2GXF A;  1UUG B;  3Q1C A;  1T3B A;  4N6L A;  4BL3 A;  2XR8 B;  4FMB A;  1B20 A;  1MGR A;  2H0H A;  5D83 A;  1X1X A;  2Q07 A;  1LOY A;  1OHP A;  3CCJ 3;  3OW2 2;  1I8V A;  1K41 A;  3KFQ C;  1OF5 A;  1ISK A;  2IY2 A;  2CWU A;  3GZX B;  5BXQ A;  2AAE A;  1UGI A;  2WGQ A;  3K9M C;  5M1A A;  3SOY A;  2H0I A;  2E2U A;  3VSY A;  3EX9 A;  3SVA A;  1STD A;  1OGZ A;  5AIG A;  2QEX 3;  3WOF B;  6STD A;  1OH0 A;  1DE3 A;  2JDI H;  3G4S 3;  1GOV A;  2E2T A;  4J8T A;  2CK3 H;  2ZHX B;  3CPW 2;  2CIU A;  1FUT A;  3BNB A;  2P09 A;  3FCS B;  3PS8 A;  4RNY A;  1L5G B;  3T8N A;  4GL6 A;  4CPK A;  3CCE 3;  4J5K A;  1B2U A;  4HM0 B;  5AYR B;  1QAL A;  1RRH A;  4IIA A;  2W03 A;  4N6V 0;  1CEW I;  3IPT A;  4PEJ A;  4OK0 A;  1BAO A;  3X3Y A;  2UUG C;  4WP5 A;  3S29 A;  4KVH A;  3JUM A;  2PZV A;  3FG3 A;  5BVB A;  2ZDJ A;  4BU4 A;  1AVK A;  1WNH A;  1BGS A;  3S28 A;  3K7C A;  4HZB B;  1AY7 A;  1GOU A;  1FGO A;  3RGR A;  1YGW A;  3URP A;  1IQ8 A;  1D6Z A;  2CC3 A;  2Y74 A;  1GSP A;  3LOY A;  1BRN L;  2BMO B;  2C11 A;  2HMO B;  1BSA A;  1BSC A;  4HKV B;  1B3S A;  3RGA A;  3MG3 A;  3G8Z A;  2OOV A;  2YFJ B;  1G96 A;  1BRK A;  1BRS A;  3FSD A;  1MWT A;  1AQZ A;  4X2O A;  3H51 A;  5AIF A;  1RGG A;  4BTW A;  3KII A;  3UB1 A;  1CH0 A;  2Z76 A;  4KFE A;  3D5G A;  3LT9 A;  1N8R 4;  2SBL A;  5AEU B;  1DMM A;  5KP3 A;  1I2G A;  3EBY A;  4N6N B;  1I3F A;  1QMA A;  1G0T A;  4ILF A;  3NV0 A;  1SQW A;  3CPO A;  1JN5 A;  1O7G B;  3EJV A;  4WWU C;  2XEP A;  4WYK B;  4BIR A;  1EQK A;  3LH4 A;  5EEO A;  1HKX A;  1I2F A;  2CFW A;  3BND A;  3RNT A;  2INX A;  1W00 A;  4MMX B;  3JUP A;  2XFT A;  4MMY B;  3Q90 A;  3B4O A;  3OWU A;  2B24 B;  2KF5 A;  2IYJ A;  1W6Y A;  2QIY A;  1FW7 A;  2C10 A;  1IVX A;  2E2V A;  1UCK A;  1BNF A;  2RBI A;  1B27 A;  1OHS A;  1S5A A;  3TDG A;  4DKI A;  3JUN A;  1DVC A;  1YVB I;  3CNX A;  3EBT A;  3I0Y A;  1VQ6 3;  2R4I A;  1JBR A;  3WA3 A;  3AGO A;  3PZW A;  1LNH A;  3EB8 A;  1QAK A;  1QJG A;  3LML A;  1RMS A;  2PNC A;  2CHC A;  3G6E 3;  4L8P A;  1BNE A;  1NWW A;  1X1Y A;  1IVW A;  1TRQ A;  2RSX A;  1VQQ A;  1JB5 A;  3GAX A;  3UJM A;  1LVN A;  2CW9 A;  2RCD A;  3U1W A;  3CCM 3;  1MGW A;  1ROV A;  3NHX A;  3T0U A;  1A2P A;  2OWP A;  4RNT A;  4HJL B;  3AHS A;  1D6U A;  5BU4 A;  1CYU A;  2RNT A;  1YVS A;  1YJW 3;  1VZZ A;  3MG1 A;  2Z6B A;  3LYG A;  2CH9 A;  1IQY A;  3GRD A;  2R41 A;  2W04 A;  4EW5 A;  1VQ4 3;  1I0V A;  4J9A A;  1OF5 B;  3HK4 A;  1ROA A;  2OTJ 3;  1VQN 3;  3HX8 A;  1JNQ A;  2UX0 A;  1UCJ A;  1N8Q A;  3CXC 2;  2GU3 A;  1HZ1 A;  1M1X B;  1A2K A;  1GMP A;  4CJN A;  1YI2 3;  4CCV A;  3ZG0 A;  1JKG A;  5IG3 A;  3FGY A;  1JBS A;  3WDG B;  3EHC A;  3CC2 3;  2CWV A;  1W6C A;  5EVH A;  3CCV 3;  5G1K A;  3CCS 3;  3V99 A;  2STD A;  3OXA A;  4HM6 B;  1GMQ A;  1OPY A;  1BNS A;  2W2C A;  3FG4 A;  1VQM 3;  5CF1 A;  5CF2 A;  1KSI A;  3FF2 A;  2HMJ B;  5DRE A;  3ECF A;  1W4N A;  1SII A;  3GZB A;  4IT7 A;  4I4K A;  3D4A A;  2CX0 A;  4R80 A;  1CQS A;  3U97 A;  1W02 A;  1A90 A;  1Y4K A;  1LOW A;  1J2B A;  5JBS A;  3NBJ A;  1LQG C;  2BT3 A;  2IUK A;  2LQV A;  2OCT A;  2HML B;  3SX1 A;  1UI7 A;  1RN1 A;  1HYF A;  2KRT A;  3PXM A;  3BNE A;  4FMA A;  2KF6 A;  5IG4 A;  2W9P A;  1UW1 A;  1IYY A;  3BU4 A;  4HVN A;  1RTU A;  2SAR A;  4HM3 B;  2BHM A;  4MEI A;  3WHO A;  1IT7 A;  3NM2 A;  3V92 A;  1NNV A;  3FG1 A;  1O7H B;  3STD A;  4X2H A;  3PGB A;  2KF3 A;  1Z1S A;  2D42 A;  3KCH A;  5DRV A;  1TIJ A;  4KFF A;  5IER A;  3CCR 3;  1YHQ 3;  1RRL A;  4EV2 A;  2OTL 3;  5STD A;  2M7O A;  3FKA A;  4O8S A;  3F8H A;  1CYV A;  5A0O B;  3O8Y A;  2IUJ A;  1O7N B;  2WOH A;  3Q3F A;  4LYL B;  3A5E A;  4KZ1 A;  4LMI A;  3NUV A;  1STF I;  1W01 A;  3SOA A;  2CFK A;  2F4Y A;  1UGH I;  4R9K A;  1JB2 A;  1BU4 A;  3I56 3;  3OX9 A;  1BSD A;  5ELJ A;  4XBY A;  5JPU A;  1PYL A;  3EC9 A;  3K0Z A;  1B2X A;  1IT8 A;  2GEY A;  3H3H A;  2CFG A;  3KZT A;  5IG5 A;  2P38 A;  3HIG A;  1EA2 A;  1E3V A;  1NDO B;  1DET A;  1OHO A;  1O7P B;  1R4Y A;  2WOF A;  3K5T A;  3NQY A;  4LGQ A;  4BTY A;  2HOH A;  2XH9 A;  3FZW A;  3CD6 3;  3NV0 B;  5LC7 A;  1UDI I;  1JN5 B;  1B21 A;  5AYS C;  1HU9 A;  3AMO A;  3DXO A;  3UL6 A;  4LEH A;  4G1M B;  2F99 A;  1YJN 3;  1SAR A;  2BO9 B;  3IMA B;  2K3D A;  1BSE A;  1BOX A;  2K0M A;  3DM8 A;  1GMR A;  4NHF A;  5D81 A;  3S5C A;  1MWU A;  3FLJ A;  3UL5 A;  7RNT A;  4U13 A;  3VF1 A;  1GD4 A;  1KQS 2;  1K28 A;  3NX0 A;  4N6T A;  4HM4 B;  4OVM A;  1GS3 A;  1LOV A;  1RGE A;  1UCI A;  4I5Q A;  1B2S A;  2W9Q A;  1BRG A;  1C7H A;  1O7W B;  2F86 B;  1E3R A;  1RSN A;  1SIH A;  4KFD A;  5ELU A;  1RGH A;  5IW9 A;  1V57 A;  1FA3 A;  1BAN A;  2W0Q A;  2HMM B;  2O9U X;  2GU1 A;  2QGU A;  3DGY A;  2F56 A;  2IA7 A;  3MPH A;  1ZS7 A;  4EYC A;  1PU4 A;  1YIT 3;  2JQ5 A;  5G2G A;  1F8N A;  3FH1 A;  3WOD G;  3J7Y d;  2CG0 A;  2J8X B;  1R4C A;  3CMA 3;  3GZR A;  3OWY A;  3B7C A;  1ZGX A;  1GY5 A;  5M19 A;  2P0M A;  2K54 A;  2O3O A;  2ML5 A;  3MKI A;  3EQQ B;  3NQZ A;  3DGM A;  4ORL A;  4N6U A;  4XBX A;  2CG1 A;  3AHW A;  1NB5 I;  3G16 A;  3DZL A;  5I97 A;  5TGN A;  1N9J A;  2FNQ A;  1FGM A;  1IDP A;  1WMN A;  3WR2 A;  1M9G A;  3CU3 A;  4Q53 A;  1LQM B;  2MC8 A;  1WQL B;  1FGR A;  4OUQ A;  1AV4 A;  1IVU A;  1JKG B;  2GBW B;  3WA2 X;  1VQO 3;  1W2Z A;  3X40 A;  1M1K 4;  1D6Y A;  2W6J H;  1A2V A;  1LNI A;  3MYT A;  3CC4 3;  1I3I A;  2L4V A;  1TP6 A;  3KN4 A;  2FXT A;  2CWT A;  3QK9 A;  1BSB A;  2XF3 A;  2GBX B;  4FMC A;  5GSP A;  1G02 A;  2ZL8 A;  4RBN A;  3T8U A;  3X3Z A;  4EC6 A;  3SYU A;  8CHO A;  2XGL A;  2YFL B;  4HM5 B;  4KT3 B;  1BUQ A;  3F7X A;  4FMD A;  1N9E A;  2W56 A;  5G1L A;  1RN4 A;  6GSP A;  4L7K A;  4N6O B;  4EV5 A;  3D79 A;  2F98 A;  2L1S A;  3RDE A;  2XSH B;  3SXX A;  3B8L A;  1B2Z A;  4HYZ A;  1Q42 A;  1PY3 A;  1B2M A;  1UI8 A;  3N8B A;  1MNL A;  1LXE A;  1UCL A;  2F5W A;  1Q86 4;  3BB9 A;  2C4B A;  1RCL A;  5EQL A;  1EG9 B;  3SED A;  2Z77 A;  1RLS A;  3DGN A;  4TX4 A;  4AKY A;  4FCZ A;  1JZD A; 
#chains in the Genus database with same CATH homology
 3X41 A;  5KP4 A;  1U8C B;  2OQE C;  1YGE A;  4FCM A;  1O7M B;  3CME 3;  4HM2 B;  1A67 A;  1WTH A;  1MOL A;  3WMD A;  2OQE A;  1KD1 4;  7STD A;  1N5P A;  3LTD A;  3BLZ A;  3JUQ A;  1Q82 4;  2QA4 3;  3NBB A;  3F9S A;  4CDL A;  2MF7 A;  1W6G A;  1EKM A;  3NBR A;  4STD A;  3N54 B;  1IK3 A;  4R1K A;  1GYB A;  2P0X A;  5FW5 A;  1DVD A;  4L8O A;  4O02 B;  3F8X A;  2YFI B;  1SPU A;  2KCD A;  3GWR A;  4H61 A;  1OCV A;  3DGO A;  3K63 A;  3OV4 A;  4EBG A;  1IV7 A;  1WMO A;  1VQ8 3;  5IEN A;  3LT8 A;  3AMO B;  1VQ7 3;  3PCS A;  4NRE A;  4WHA A;  3B4P A;  5AIH A;  4BTX A;  2A15 A;  1FGQ A;  3LZA A;  1Q40 A;  4RZM A;  3V98 A;  1JV2 B;  2XRX B;  5IF6 A;  4K90 B;  5IG0 A;  4JRF A;  2HMN B;  2BNG A;  1IV9 A;  2YX9 A;  1VQ9 3;  2CFD A;  4FCJ A;  4MMZ B;  1FGT A;  2Y73 A;  4R4K A;  1NO3 A;  1DMQ A;  1N5H A;  1ZX2 A;  2HMK B;  3PYJ A;  4GB5 A;  1W7C A;  4LZI A;  5D82 A;  1NB3 I;  1LOX A;  3A76 A;  4N6M A;  5LC6 A;  3VGN A;  3DMC A;  3NXJ A;  1JB4 A;  3E99 A;  3G0K A;  3CCQ 3;  1KWI A;  3DUK A;  3LTA A;  4HZ9 B;  1NU3 A;  3QRD A;  1SJW A;  1V74 A;  2Z7A A;  1TFO A;  2FGT A;  3LXU X;  3N9H A;  1PFP A;  3PCR A;  2RGQ A;  4H3U A;  3BNC A;  4HBR A;  3S67 A;  3CCU 3;  3M8C A;  1K9M 4;  1DMN A;  3NM7 A;  3OWS A;  1OAC A;  1Q7Y 4;  4LSO A;  3ER7 A;  3KSP A;  2OOV C;  3CC7 3;  1UUV B;  2WGO A;  2WO0 A;  1M90 4;  2P05 A;  4K1V A;  3Q2P A;  1GY6 A;  1TUH A;  4QWT A;  3UNL A;  3MWZ A;  3JVC A;  3CNM A;  2D1W A;  3EN1 B;  5CK6 A;  4HM1 B;  1U5O A;  3F14 A;  4RNZ A;  1RKY A;  5FGO A;  4K1U A;  1QVG 2;  1DYU A;  2XFS A;  3MHE A;  3EN8 A;  3HII A;  3X3X A;  3MG2 A;  1YJ9 3;  1ZO2 A;  3F7S A;  1JJ2 2;  1W5Z A;  3F40 A;  3DGL A;  3S27 A;  1ULI B;  3IJE B;  4XDV A;  4JF8 A;  3LTB A;  3ROB A;  3SLU A;  2W56 B;  1IVV A;  4ZM8 A;  1IU7 A;  1S72 3;  4WFO A;  3D3L A;  4AEQ A;  3I55 3;  3DY5 A;  4R9L A;  3CCL 3;  2IMJ A;  1W2B 2;  4XM4 A;  3KSE D;  4O2H A;  1ULJ B;  3EF8 A;  4XB5 A;  1NJI 4;  1AVL A;  3HI7 A;  3GZY B;  3LTC A;  2BMQ B;  1VQP 3;  3HZP A;  3MSO A;  3ALA A;  2B1X B;  1WMP A;  4FR9 A;  2V1L A;  1K8A 4;  1RN7 A;  1UUW B;  1GD3 A;  2GEX A;  3X42 A;  4O3V A;  4N3V A;  3KKG A;  4WYK A;  3WOE B;  3G71 3;  1K73 4;  1VQK 3;  1ASK A;  5CLK A;  5CXO A;  1GY7 A;  1JRQ A;  1IQX A;  5IEP A;  1QAF A;  1Q81 4;  2CKF B;  1OUN A;  4AKZ A;  1T5Y A;  5AII A;  5JPP A;  4HM7 B;  3D9R A;  4HM8 B;  3KE7 A;  3FF0 A;  5AI1 A;  2RFR A;  1VQL 3;  2KXG A;  3EE1 A;  4MJD A;  1US1 A;  1KC8 4;  1RJO A;  1QVF 2;  1FUW A;  3L0R A;  4XBT A;  1TU5 A;  3JUO A;  5HGR A;  2XGN A;  4XDW A;  2CFL A;  1TFK A;  2LYX A;  2XSO B;  1YIJ 3;  2BMR B;  2ML6 A;  4K61 A;  5AEW B;  5KP1 A;  5IEO A;  1VQ5 3;  1Q40 B;  1AR0 A;  1E97 A;  4IPB A;  4EXR A;  1OGX A;  2GXF A;  3Q1C A;  4N6L A;  2XR8 B;  4FMB A;  5D83 A;  2Q07 A;  1OHP A;  3CCJ 3;  3OW2 2;  1K41 A;  3KFQ C;  1OF5 A;  1ISK A;  2CWU A;  3GZX B;  5BXQ A;  2WGQ A;  3K9M C;  3SOY A;  2E2U A;  3VSY A;  3EX9 A;  3SVA A;  1STD A;  1OGZ A;  5AIG A;  2QEX 3;  3WOF B;  6STD A;  1OH0 A;  2JDI H;  3G4S 3;  2E2T A;  4J8T A;  2CK3 H;  3CPW 2;  2CIU A;  3BNB A;  2P09 A;  3FCS B;  3PS8 A;  4RNY A;  1L5G B;  3T8N A;  4GL6 A;  3CCE 3;  4HM0 B;  5AYR B;  1QAL A;  1RRH A;  4IIA A;  2W03 A;  4N6V 0;  1CEW I;  3IPT A;  4PEJ A;  4OK0 A;  3X3Y A;  4WP5 A;  3S29 A;  4KVH A;  3JUM A;  2PZV A;  3FG3 A;  5BVB A;  2ZDJ A;  1AVK A;  1WNH A;  3S28 A;  3K7C A;  4HZB B;  1FGO A;  3RGR A;  1IQ8 A;  1D6Z A;  2CC3 A;  2Y74 A;  3LOY A;  2BMO B;  2C11 A;  2HMO B;  4HKV B;  3RGA A;  3MG3 A;  3G8Z A;  2OOV A;  2YFJ B;  1G96 A;  3FSD A;  4X2O A;  3H51 A;  5AIF A;  4BTW A;  3KII A;  3UB1 A;  2Z76 A;  4KFE A;  3LT9 A;  1N8R 4;  2SBL A;  5AEU B;  1DMM A;  5KP3 A;  3EBY A;  4N6N B;  1QMA A;  3NV0 A;  1SQW A;  3CPO A;  1JN5 A;  1O7G B;  3EJV A;  4WWU C;  2XEP A;  4WYK B;  1EQK A;  3LH4 A;  5EEO A;  1HKX A;  2CFW A;  3BND A;  2INX A;  1W00 A;  4MMX B;  3JUP A;  2XFT A;  4MMY B;  3Q90 A;  3B4O A;  3OWU A;  2B24 B;  2QIY A;  1W6Y A;  2C10 A;  1IVX A;  2E2V A;  1OHS A;  1S5A A;  3TDG A;  3JUN A;  1DVC A;  1YVB I;  3CNX A;  3EBT A;  3I0Y A;  1VQ6 3;  2R4I A;  3WA3 A;  3PZW A;  1LNH A;  3EB8 A;  1QAK A;  1QJG A;  3LML A;  2PNC A;  2CHC A;  3G6E 3;  4L8P A;  1NWW A;  1IVW A;  2RSX A;  3UJM A;  1JB5 A;  3GAX A;  3CCM 3;  1LVN A;  2CW9 A;  2RCD A;  3U1W A;  1ROV A;  3NHX A;  3T0U A;  2OWP A;  4HJL B;  1D6U A;  1CYU A;  1YJW 3;  1VZZ A;  3MG1 A;  2Z6B A;  3LYG A;  2CH9 A;  1IQY A;  3GRD A;  2W04 A;  1VQ4 3;  4J9A A;  1OF5 B;  3HK4 A;  1ROA A;  2OTJ 3;  1VQN 3;  3HX8 A;  1JNQ A;  2UX0 A;  1N8Q A;  3CXC 2;  2GU3 A;  1M1X B;  1A2K A;  1YI2 3;  4CCV A;  1JKG A;  5IG3 A;  3FGY A;  3WDG B;  3EHC A;  3CC2 3;  2CWV A;  1W6C A;  5EVH A;  3CCV 3;  3CCS 3;  3V99 A;  2STD A;  3OXA A;  4HM6 B;  1OPY A;  2W2C A;  3FG4 A;  1VQM 3;  5CF1 A;  5CF2 A;  1KSI A;  3FF2 A;  2HMJ B;  5DRE A;  3ECF A;  1W4N A;  1SII A;  3GZB A;  4IT7 A;  4I4K A;  4R80 A;  1CQS A;  3U97 A;  1W02 A;  1A90 A;  1Y4K A;  1J2B A;  5JBS A;  3NBJ A;  2BT3 A;  2IUK A;  2LQV A;  2OCT A;  2HML B;  3SX1 A;  1UI7 A;  4FMA A;  2KRT A;  3PXM A;  3BNE A;  5IG4 A;  2W9P A;  1UW1 A;  4HVN A;  4HM3 B;  2BHM A;  4MEI A;  1IT7 A;  3NM2 A;  3V92 A;  3FG1 A;  1O7H B;  3STD A;  4X2H A;  3PGB A;  1Z1S A;  2D42 A;  5DRV A;  1TIJ A;  4KFF A;  5IER A;  3CCR 3;  1YHQ 3;  1RRL A;  4EV2 A;  2OTL 3;  5STD A;  2M7O A;  3FKA A;  4O8S A;  3F8H A;  1CYV A;  5A0O B;  3O8Y A;  2IUJ A;  1O7N B;  2WOH A;  4KZ1 A;  4LMI A;  3SOA A;  3NUV A;  1STF I;  1W01 A;  2CFK A;  4R9K A;  1JB2 A;  3I56 3;  3OX9 A;  5ELJ A;  4XBY A;  5JPU A;  3EC9 A;  3K0Z A;  1IT8 A;  2GEY A;  3H3H A;  2CFG A;  3KZT A;  5IG5 A;  2P38 A;  3HIG A;  1EA2 A;  1E3V A;  1NDO B;  3NQY A;  1OHO A;  1O7P B;  2WOF A;  3K5T A;  4LGQ A;  4BTY A;  2XH9 A;  3FZW A;  3CD6 3;  3NV0 B;  5LC7 A;  1JN5 B;  5AYS C;  1HU9 A;  3AMO A;  3DXO A;  3UL6 A;  4LEH A;  4G1M B;  2F99 A;  1YJN 3;  2BO9 B;  3IMA B;  2K0M A;  3DM8 A;  4NHF A;  5D81 A;  3S5C A;  3FLJ A;  3UL5 A;  4U13 A;  3VF1 A;  1GD4 A;  1KQS 2;  1K28 A;  3NX0 A;  4N6T A;  4HM4 B;  4OVM A;  1GS3 A;  2W9Q A;  1O7W B;  1C7H A;  2F86 B;  1E3R A;  4KFD A;  1SIH A;  5ELU A;  5IW9 A;  1FA3 A;  2W0Q A;  2HMM B;  2O9U X;  2GU1 A;  2QGU A;  2IA7 A;  3MPH A;  4EYC A;  1PU4 A;  1YIT 3;  2JQ5 A;  5G2G A;  1F8N A;  3FH1 A;  3WOD G;  3J7Y d;  2CG0 A;  1R4C A;  3CMA 3;  3GZR A;  3OWY A;  3B7C A;  1GY5 A;  2P0M A;  2K54 A;  2O3O A;  2ML5 A;  3MKI A;  3EQQ B;  3NQZ A;  3DGM A;  4ORL A;  4N6U A;  4XBX A;  2CG1 A;  1NB5 I;  3G16 A;  3DZL A;  5I97 A;  5TGN A;  1N9J A;  2FNQ A;  1FGM A;  1IDP A;  1WMN A;  1M9G A;  3CU3 A;  4Q53 A;  2MC8 A;  1WQL B;  1FGR A;  4OUQ A;  1AV4 A;  1IVU A;  1JKG B;  2GBW B;  3WA2 X;  1VQO 3;  1W2Z A;  3X40 A;  1M1K 4;  1D6Y A;  2W6J H;  1A2V A;  3CC4 3;  3MYT A;  2L4V A;  1TP6 A;  3KN4 A;  2FXT A;  2CWT A;  3QK9 A;  2XF3 A;  4FMC A;  2GBX B;  3T8U A;  3X3Z A;  4RBN A;  2ZL8 A;  4EC6 A;  8CHO A;  2XGL A;  2YFL B;  4HM5 B;  1BUQ A;  3F7X A;  4FMD A;  1N9E A;  2W56 A;  4L7K A;  4N6O B;  4EV5 A;  2F98 A;  3RDE A;  2XSH B;  3SXX A;  3B8L A;  4HYZ A;  1Q42 A;  1UI8 A;  3N8B A;  1MNL A;  1LXE A;  1Q86 4;  3BB9 A;  5EQL A;  1EG9 B;  3SED A;  2Z77 A;  4AKY A;  3DGN A;  4TX4 A;  4FCZ A;  2I9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...