3RGAA

Crystal structure of epoxide hydrolase for polyether lasalocid a biosynthesis
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
281
structure length
281
Chain Sequence
b'HMPAETVRKEVALEYCRRVNAGELEGVLQLFAPDARLVDPLGTEPVVGRAALAARLAPALRGAVHEEPGRPYAAHDGTSVVLPATVTVGAPGAPPQRRGRTRVMGVIEVGEDGLIREMRVMWGVTDSSWTARPAPDEERRKELAREHCLRINDGDVDGLLKLYSPRIRFEDPVGSWTRTGLEALRAHATMAVGSNVRETAGLTVAGQDGRHAAVTVSATMDYLPSGPLLARHHLMTLPAPADPHRALIGIEYVMVIGVDADGLIDEMRAYWGATDVSLLDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxide hydrolase
publication title Enzymatic catalysis of anti-Baldwin ring closure in polyether biosynthesis
pubmed doi rcsb
source organism Streptomyces lasaliensis
molecule tags Isomerase
total genus 93
structure length 281
sequence length 281
ec nomenclature ec 3.3.2.-:
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3rgaA01
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3rgaA02
1STDA 4KVHA 4X2OA 3HX8A 3DZLA 2HMLB 1Q40B 2GBWB 4XB5A 8CHOA 1SJWA 3FKAA 3OWSA 1Q42A 3DMCA 4N3VA 4L8PA 3F9SA 3NBRA 3F14A 1OHPA 5D82A 4HM7B 1OPYA 1NU3A 3OWYA 5IERA 3MSOA 3BB9A 3OWUA 3S5CA 1EG9B 3FZWA 3KZTA 3FF0A 3A76A 2RCDA 3MG3A 2YFLB 3GWRA 3EF8A 3GRDA 2F99A 5IF6A 4R9LA 1NWWA 3F7SA 4WYKB 3D9RA 1A2KA 3NM2A 3NHXA 4R1KA 4XBTA 1UUVB 5STDA 2PZVA 1JN5A 1ASKA 4HM4B 1ULJB 3KSPA 4HKVB 1E3RA 4LMIA 2XRXB 7STDA 3EQQB 1OGZA 3VGNA 3JUOA 5CLKA 4I4KA 3E99A 5HGRA 5CF2A 2HMOB 1JB4A 3F8XA 1JB2A 3EN8A 1OUNA 3FGYA 2BMRB 3SOAA 1CQSA 2A15A 3G8ZA 4OVMA 1GY5A 1GY6A 5AIHA 3K0ZA 4HM0B 4XDWA 4HZBB 4HM3B 3OX9A 1IDPA 1U5OA 3M8CA 2F86B 2BNGA 3FLJA 5IENA 3ECFA 2JQ5A 1DMMA 4Q53A 3T8UA 4CDLA 2XR8B 5G2GA 4HZ9B 1ISKA 1JKGA 1O7PB 3KE7A 2HMJB 3H3HA 1JB5A 2GBXB 3HK4A 3NUVA 4XBYA 4FCMA 4FCJA 3EJVA 5AI1A 4J9AA 5TGNA 2XSOB 2YFIB 3UNLA 1OCVA 1O7MB 1ZO2A 3B7CA 3UJMA 2HMKB 3GZBA 4HM5B 4HJLB 1GY7A 3JUNA 1TUHA 4L8OA 3MYTA 3NV0A 3JUPA 1O7NB 1ULIB 3CNXA 3CU3A 3GZRA 5AEWB 3JUQA 3B4PA 5IG5A 1OHSA 3KKGA 3LZAA 2B24B 2GEXA 2CKFB 2INXA 5IEPA 3NXJA 4HM1B 5AIGA 1W02A 3IPTA 5JPPA 4HM6B 5FW5A 2BMOB 2F98A 3CNMA 1ZX2A 4XM4A 3Q90A 2R4IA 2UX0A 3EC9A 3VSYA 4HVNA 3RGAA 4RZMA 4LGQA 3BLZA 3DM8A 2QIYA 1O7WB 5BVBA 3SEDA 1W6YA 3MG2A 1UUWB 1E3VA 5D81A 5JPUA 4XDVA 3B8LA 5IEOA 5KP3A 3ER7A 5IG3A 3DXOA 4WYKA 3I0YA 3FF2A 1VZZA 3GZXB 4STDA 2HMNB 2YFJB 1Z1SA 2HMMB 2RFRA 1O7HB 1QJGA 3LYGA 5BXQA 1HKXA 2Z7AA 4X2HA 1OHOA 4LEHA 1W01A 1K41A 2Z77A 4R9KA 4L7KA 5DRVA 4HM8B 3STDA 1JN5B 1OH0A 3MKIA 5DREA 3EHCA 3K7CA 5AIIA 1GS3A 1GYBA 3CPOA 3DUKA 2BMQB 2IMJA 5CF1A 4MJDA 3G0KA 2GEYA 1OF5A 4WWUC 3EBYA 4ORLA 1TP6A 3B4OA 3F40A 4GB5A 5IG4A 3OXAA 3MG1A 1WQLB 1AR0A 1DMQA 5CXOA 1NDOB 2B1XB 1W00A 2W2CA 3FH1A 2RGQA 1OGXA 3HZPA 3MHEA 1DMNA 1Q40A 1C7HA 3EBTA 5D83A 3ROBA 3GZYB 5AEUB 5KP4A 3OV4A 3FSDA 4WP5A 5IG0A 4PEJA 5CK6A 4K1VA 1JKGB 3H51A 3SOYA 3RGRA 2STDA 4HM2B 4IIAA 6STDA 2Z76A 1E97A 4H3UA 2CHCA 3T8NA 1EA2A 4OUQA 1O7GB 3JUMA 3G16A 3EN1B 3NV0B 3EX9A 5EVHA 2QGUA 2XSHB 2OWPA 4XBXA 1OF5B 4U13A 5AIFA 1S5AA 3F7XA 2GXFA 4J8TA 3F8HA 3WMDA 2K54A 1QMAA 4K1UA 5KP1A 1BUQA 2I9WA
chains in the Genus database with same CATH superfamily
1STDA 1JZDA 4KVHA 5GSPA 3N8BA 4X2OA 4LSOA 3I553 4OK0A 3AMOA 3HX8A 1RRLA 4FMDA 1X1XA 4WHAA 1VQ53 3DZLA 3A5EA 2OTL3 2HMLB 1BIRA 4KFDA 1RN7A 3IJEB 1Q40B 7GSPA 4MMXB 2GBWB 1G02A 4XB5A 3K5TA 2WGQA 3PS8A 8CHOA 1SJWA 3FKAA 3OWSA 2CWTA 1Q42A 3DMCA 1YIJ3 1K734 1G0TA 2UUGC 1DYUA 3BNDA 4L8PA 4N3VA 3F9SA 1RHLA 3NBRA 3F14A 3CCU3 1FGTA 3FG4A 1ROAA 5EEOA 1OHPA 5D82A 1WNHA 1RGHA 4HM7B 1OPYA 2FXTA 3BIRA 1NU3A 1NJI4 3LMLA 3OWYA 1BRGA 5IERA 1TRQA 3DGLA 3MSOA 4LZIA 1UCJA 4KFFA 1B27A 1F8NA 3BNCA 1KC84 3BB9A 3LT9A 1BNEA 3OWUA 1TU5A 3WHOA 1VQL3 1BRNL 2CFDA 2J8XB 3S5CA 1VQ43 3T0UA 1EG9B 3HIIA 3L0RA 3FZWA 4EC6A 1QALA 3HI7A 1I2FA 3KZTA 1YIT3 3D5IA 3FF0A 4O8SA 1GOVA 3X42A 1BRKA 1Q824 3A76A 3CD63 2OQEA 2OOVC 1KWIA 5AYRB 4MEIA 2RCDA 3KIIA 2KF3A 1BSDA 1B2UA 2P09A 3MG3A 3PXMA 4FMBA 1RDSA 2GU3A 2YFLB 2CWUA 1FW7A 1W2ZA 5M1AA 3FG3A 1DE3A 3GWRA 3Q3FA 1RJOA 3EF8A 3GRDA 4KZ1A 2F99A 5IF6A 4R9LA 1NWWA 3LT8A 1D6UA 3F7SA 2XF3A 4BTXA 4G1MB 2W56A 4WYKB 2O3OA 2IUJA 1LQGC 3D9RA 4IPBA 2F4YA 2L4VA 3WODG 1KQS2 1K9M4 1UCLA 1A2KA 3NM2A 1STFI 3NHXA 4R1KA 1FUSA 1N9EA 4XBTA 1VQP3 1UUVB 3U97A 5STDA 2SBLA 1W6GA 3CPW2 1LVNA 2PZVA 1D6ZA 1JN5A 3AHWA 2HOHA 2KF4A 4K90B 1HYFA 1ASKA 4RNZA 4HM4B 4J5KA 1ULJB 3KSPA 1BUJA 4HKVB 3K63A 3SX1A 1E3RA 4LMIA 2XRXB 3LTBA 1TFKA 7STDA 3EQQB 2CIUA 3D4AA 3S67A 1EQKA 3WR2A 4IT7A 3WOEB 1OGZA 2WGOA 5LC7A 3PGBA 1IT8A 1RGFA 3LXUX 1GOYA 3VGNA 3JUOA 1MOLA 1FYSA 3WA2X 1IK3A 2C4BA 3AGOA 1UI7A 5CLKA 4I4KA 1BSAA 1GOUA 2ZDJA 3E99A 1X1WA 4TX4A 5HGRA 1B2XA 5CF2A 3G4S3 2IY2A 2GSPA 4N6V0 4O02B 4EV2A 2HMOB 1JB4A 3F8XA 1MWRA 3SYUA 1RGLA 3KCHA 1RLSA 2UGIA 1JB2A 3UB1A 1OUNA 1IQYA 3EN8A 3FGYA 5LC6A 3WA3A 1IYYA 2IUKA 1YNVX 4ZM8A 2OOVA 2BMRB 3FCSB 3SOAA 1CQSA 2A15A 3G8ZA 4RBNA 4MMYB 1SIHA 4OVMA 1GY5A 8RNTA 1MGRA 1GY6A 5AIHA 1W6CA 2XH9A 7RNTA 3K0ZA 4HM0B 1IU7A 4XDWA 1UGHI 4HZBB 4HM3B 1NB5I 1BOXA 1Q814 3OX9A 1B2SA 5BU4A 1IDPA 1U5OA 3M8CA 4BL2A 2F86B 1JV2B 2BNGA 3FLJA 1AQZA 2WOHA 2Y74A 5IENA 1IV7A 2CFGA 3ECFA 1A90A 3DGYA 4FCZA 2JQ5A 3G6E3 1DMMA 1L5GB 3DGNA 4O2HA 1RN1A 6GSPA 2RBIA 4Q53A 3SLUA 3T8UA 3WDGB 4CDLA 3CCV3 4HBRA 1FA3A 2E2VA 3NM7A 1UUGB 2XR8B 5G2GA 1MNLA 4HZ9B 4ILFA 1ISKA 4FR9A 1JKGA 1O7PB 1VQ73 3KE7A 1M904 2HMJB 3H3HA 1BRJA 3EB8A 1JB5A 4NPBA 1JZOA 2GBXB 1V57A 1SPUA 2CG0A 2KF5A 2P0XA 2YX9A 4K61A 3HK4A 3DH2A 3NUVA 1JBSA 1US1A 4XBYA 4FCMA 4FCJA 3EJVA 5AI1A 3CCM3 4J9AA 4KT3B 5TGNA 1TIJA 2XSOB 2YFIB 1VQK3 1VQO3 1IT7A 1JNQA 3UNLA 2E2UA 1VQN3 1W7CA 1OCVA 1FZUA 4RNTA 1O7MB 3KN4A 1Q7HA 4R4KA 4HAAA 4EYCA 1ZO2A 3B7CA 3UJMA 1FGOA 3CCQ3 2HMKB 2CK3H 3LH4A 3GZBA 4HM5B 1N8QA 1AV4A 4HJLB 4AKYA 1VQ83 1GY7A 4BIRA 1B21A 3JUNA 3KFQC 1LOVA 1QAKA 1TUHA 4L8OA 3MYTA 2CFKA 3NV0A 2F56A 2KCDA 1CEWI 3JUPA 1NNVA 1O7NB 1NB3I 3NX0A 1BRIA 1IVWA 1ULIB 4RNYA 2KF6A 1KSIA 1FUTA 3CNXA 5RNTA 1QAFA 1LOXA 4BTWA 3CU3A 1I0XA 4N6TA 2OTJ3 3GZRA 5AEWB 5I97A 3MWZA 4HOHA 3CCE3 1WTHA 1WMNA 1VQ93 1BNGA 3JUQA 1CYVA 3B4PA 4AKZA 5A0OB 5IG5A 1T2HA 1I8VA 1OHSA 2BIRA 3KKGA 3LZAA 1UW1A 2R41A 1RTUA 2B24B 2GEXA 4EXRA 5IW9A 3G713 1GSPA 1M9GA 2CKFB 1WMPA 2INXA 5IEPA 3BNEA 3NXJA 3HOHA 2BHMA 1JRQA 4I5QA 9RNTA 1BSEA 4HM1B 5AIGA 1I70A 2M7OA 1RGKA 1IV9A 1RGEA 1W02A 3MPHA 3IPTA 4N6MA 1X1YA 2K0MA 2E2TA 2RNTA 2W03A 2BO9B 3ALAA 4N6OB 5JPPA 4HM6B 5FW5A 3SVAA 2BMOB 1A2PA 1V74A 2F98A 1I2EA 2AADA 3CNMA 5BIRA 1ZX2A 2LQVA 1GMPA 4XM4A 1IQ8A 1GMQA 1YJW3 2P38A 3D5GA 3Q1CA 1JBRA 4NREA 3Q90A 3CCL3 4DKIA 2R4IA 3LTDA 5M19A 2UX0A 2W9QA 3EC9A 3X3XA 2FGTA 3VSYA 1A2VA 4HVNA 1RNBA 1LOYA 1W5ZA 2CX0A 3RGAA 3URPA 3AMOB 4RZMA 1EUIC 4LGQA 3WOFB 4QWTA 2ML6A 1SARA 2XFTA 5ELJA 3BLZA 2MF7A 3DM8A 2QIYA 1JJ22 2CW9A 1CYUA 1O7WB 3Q2PA 4EBGA 5BVBA 1NO3A 4N6LA 3X3YA 1D6YA 3SEDA 1Q864 1W6YA 1UI8A 3X41A 1Q7Y4 4HYZA 3CXC2 2H0IA 1LQMB 3MG2A 1BGSA 3K9MC 1UUWB 4JF8A 3VF1A 2KXGA 1RSNA 1BSCA 1E3VA 2IYJA 3RDEA 1EKMA 5D81A 5JPUA 2XFSA 5G1LA 4XDVA 3GSPA 3B8LA 3N9HA 2ZHXB 4FMCA 3ER7A 5IEOA 5G1KA 5KP3A 1C54A 1R4YA 1RGGA 5IG3A 3DXOA 3X3ZA 3HIGA 4WYKA 1RMSA 3D79A 3N54B 2W0QA 3TDGA 1QVF2 2F5WA 4KFEA 3S29A 4EW5A 3NQYA 1MWUA 3I0YA 3FF2A 3GAXA 3QK9A 1DVDA 1EEJA 1N5HA 1BRHA 1VZZA 3GZXB 1BNIA 1YI23 4STDA 2HMNB 1MGWA 2OQEC 1Z1SA 2YFJB 2HMMB 2MC8A 1DVCA 2QEX3 3CCS3 1IVVA 1LXEA 2V1LA 1VQ63 2RFRA 3ZFZA 1O7HB 2W04A 1SQWA 3JVCA 2JDIH 1QJGA 1YVSA 3LYGA 1BRSA 5BXQA 2AAEA 1QVG2 1HKXA 2W56B 2Z7AA 1TRPA 4X2HA 1I0VA 4N6UA 1OHOA 4LEHA 3SXXA 1YJ93 2CWVA 2D1WA 2QA43 1GMRA 1W01A 3S28A 1K41A 2Z77A 1RGAA 3NBBA 3ZG0A 3ZG5A 1BAOA 1J2BA 1RRHA 3LTCA 4R9KA 2SARA 1K28A 4L7KA 1UCKA 5DRVA 4HM8B 1IVUA 3STDA 1JN5B 1AVLA 1K8A4 2GU1A 1OH0A 2OCTA 3MKIA 1N8R4 5DREA 3EHCA 3K7CA 3RNTA 5AIIA 3AHSA 4FMAA 2F5MA 1GS3A 1GYBA 1T3BA 3CPOA 3DUKA 3IMAB 3KSED 2WO0A 1B2ZA 1T5YA 2BMQB 2BT3A 3CCJ3 2IMJA 1UDII 3QRDA 5CF1A 3DGOA 3NQZA 3D3LA 4MJDA 3G0KA 1A67A 3FG1A 1LRAA 1UGIA 1RCKA 2GEYA 1OF5A 4GSPA 2CH9A 3EBYA 4ORLA 4WWUC 1PY3A 1TP6A 3B4OA 3F40A 3DGMA 1FGQA 5HOHA 1KD14 1I3FA 2XGNA 1M1XB 2XGLA 2IA7A 4GB5A 3S27A 2CFLA 2CFWA 2W9PA 3DY5A 1BU4A 3UL6A 5IG4A 4R80A 1PYLA 3CC23 3OXAA 1BSBA 1HU9A 3MG1A 1WQLB 2W6JH 1VQM3 3CC43 4CPKA 4O3VA 1AR0A 5ELUA 1BNSA 1DMQA 1YGWA 4BL3A 2FNQA 2PNCA 3PZWA 4H61A 1PU4A 1IQXA 5CXOA 1V58A 2C10A 2Q07A 3BU4A 6RNTA 1NDOB 2B1XB 1YVBI 1W00A 1YGEA 2KAAA 2W2CA 2RGQA 1RCLA 3FH1A 3LOYA 1TJDA 1OGXA 1RN4A 1VQQA 2CC3A 2K3DA 2KRTA 3HZPA 5JBSA 1TFOA 3PCRA 4CCVA 3MHEA 1DMNA 1Q40A 1C7HA 4N6NB 3U1WA 1GD3A 3EBTA 5EQLA 5D83A 2Y73A 1LNHA 3ROBA 1R4CA 3GZYB 3X40A 5AEUB 3CC73 1JBTA 4J5GA 5KP4A 1ZGXA 3OV4A 1YJN3 1BANA 2XEPA 3FSDA 4BTYA 2O9UX 4WP5A 5IG0A 4PEJA 3PCSA 5CK6A 4K1VA 3V98A 3OW22 1JKGB 1CH0A 2H0HA 3V92A 2ML5A 1W4NA 2Z6BA 2H0GA 4CJNA 3H51A 3SOYA 3RGRA 2STDA 1RKYA 4HM2B 1SIIA 1RNTA 2D42A 1I3IA 1RGCA 1FGRA 2WOFA 4IIAA 1B2MA 6STDA 2RSXA 2Z76A 5M18A 1LOWA 5FGOA 1E97A 1OACA 4H3UA 2CHCA 3T8NA 1BNRA 1EA2A 1X1UA 5AYSC 4GL6A 4NHFA 3EE1A 3PYJA 4OUQA 2BU4A 1ZS7A 1Q9EA 1O7GB 2LYXA 2C11A 3CME3 3BNBA 3JUMA 3G16A 3J7Yd 1N9JA 2CX1A 3EN1B 3CCR3 4GHOA 1S723 3NV0B 2L1SA 1HZ1A 1U8CB 1GD4A 1T2IA 3EX9A 4WFOA 1PFPA 4JRFA 2P05A 2QGUA 2XSHB 1WMOA 2OWPA 4XBXA 1FGMA 5EVHA 1TTOA 1I2GA 1BNFA 2ZA4A 3LTAA 4AEQA 4LYLB 1OF5B 3UL5A 3V99A 1AVKA 4U13A 1G96A 5AIFA 1S5AA 3CMA3 1B20A 3F7XA 1LNIA 2GXFA 4J8TA 1B3SA 1AY7A 1DETA 1Y4KA 3F8HA 3NBJA 3WMDA 1ROVA 1UCIA 1W2B2 2K54A 1YHQ3 1QMAA 4K1UA 1FUWA 4EV5A 1BNJA 3I563 5KP1A 4MMZB 1IVXA 3AGNA 1M1K4 1N5PA 1BUQA 1MWSA 2P0MA 1MWTA 2ZL8A 3O8YA 2I9WA 4BU4A 2CG1A 1BVIA
chains in the Genus database with same CATH topology
1STDA 4KVHA 3N8BA 4X2OA 4LSOA 3I553 4OK0A 3AMOA 3HX8A 1RRLA 4FMDA 4WHAA 1VQ53 3DZLA 2OTL3 2HMLB 4KFDA 1RN7A 3IJEB 1Q40B 4MMXB 2GBWB 4XB5A 3K5TA 2WGQA 3PS8A 8CHOA 1SJWA 3FKAA 3OWSA 2CWTA 1Q42A 3DMCA 1YIJ3 1K734 1DYUA 3BNDA 4L8PA 4N3VA 3F9SA 3NBRA 3F14A 3CCU3 1FGTA 3FG4A 1ROAA 5EEOA 1OHPA 5D82A 1WNHA 4HM7B 1OPYA 2FXTA 1NU3A 1NJI4 3LMLA 3OWYA 5IERA 3DGLA 3MSOA 4LZIA 4KFFA 1KC84 1F8NA 3BNCA 3BB9A 3LT9A 3OWUA 1TU5A 1VQL3 2CFDA 3S5CA 1VQ43 3T0UA 1EG9B 3HIIA 3L0RA 3FZWA 4EC6A 1QALA 3HI7A 3KZTA 1YIT3 3FF0A 4O8SA 3X42A 1Q824 3A76A 3CD63 2OQEA 2OOVC 1KWIA 5AYRB 4MEIA 2RCDA 3KIIA 3MG3A 3PXMA 2P09A 4FMBA 2GU3A 2YFLB 2CWUA 1W2ZA 3FG3A 3GWRA 1RJOA 3EF8A 3GRDA 4KZ1A 2F99A 5IF6A 4R9LA 1NWWA 3LT8A 1D6UA 3F7SA 2XF3A 4BTXA 4G1MB 2W56A 4WYKB 2O3OA 2IUJA 4IPBA 3D9RA 2L4VA 3WODG 1KQS2 1K9M4 1A2KA 3NM2A 1STFI 3NHXA 4R1KA 1N9EA 4XBTA 1VQP3 1UUVB 3U97A 5STDA 2SBLA 1W6GA 3CPW2 1LVNA 2PZVA 1D6ZA 1JN5A 4K90B 1ASKA 4RNZA 4HM4B 1ULJB 3KSPA 4HKVB 3K63A 3SX1A 1E3RA 4LMIA 2XRXB 3LTBA 1TFKA 7STDA 3EQQB 2CIUA 3S67A 1EQKA 4IT7A 3WOEB 1OGZA 2WGOA 5LC7A 3PGBA 1IT8A 3LXUX 3VGNA 3JUOA 1MOLA 3WA2X 1IK3A 1UI7A 5CLKA 4I4KA 2ZDJA 3E99A 4TX4A 5HGRA 5CF2A 3G4S3 4N6V0 4O02B 4EV2A 2HMOB 1JB4A 3F8XA 3UB1A 1JB2A 1OUNA 1IQYA 3EN8A 3FGYA 5LC6A 3WA3A 2IUKA 4ZM8A 2OOVA 2BMRB 3FCSB 3SOAA 1CQSA 2A15A 3G8ZA 4RBNA 4MMYB 1SIHA 4OVMA 1GY5A 1GY6A 5AIHA 1W6CA 2XH9A 3K0ZA 4HM0B 1IU7A 4XDWA 4HZBB 4HM3B 1NB5I 1Q814 3OX9A 1IDPA 1U5OA 3M8CA 2F86B 1JV2B 2BNGA 3FLJA 2WOHA 2Y74A 5IENA 1IV7A 2CFGA 3ECFA 1A90A 4FCZA 2JQ5A 3G6E3 1DMMA 1L5GB 3DGNA 4O2HA 3CCV3 4Q53A 3SLUA 3T8UA 3WDGB 4CDLA 4HBRA 1FA3A 2E2VA 3NM7A 2XR8B 5G2GA 1MNLA 4HZ9B 1ISKA 4FR9A 1JKGA 1O7PB 1VQ73 3KE7A 1M904 2HMJB 3H3HA 3EB8A 1JB5A 2GBXB 2CG0A 1SPUA 2P0XA 2YX9A 4K61A 3HK4A 3NUVA 1US1A 4XBYA 4FCMA 4FCJA 3EJVA 5AI1A 3CCM3 4J9AA 5TGNA 1TIJA 2XSOB 2YFIB 1VQK3 1VQO3 1IT7A 1JNQA 3UNLA 2E2UA 1VQN3 1W7CA 1OCVA 1O7MB 3KN4A 4R4KA 4EYCA 1ZO2A 3B7CA 3UJMA 1FGOA 3CCQ3 2HMKB 2CK3H 3LH4A 3GZBA 4HM5B 1N8QA 1AV4A 4HJLB 4AKYA 1VQ83 1GY7A 3JUNA 3KFQC 1QAKA 1TUHA 4L8OA 3MYTA 2CFKA 3NV0A 2KCDA 1CEWI 3JUPA 1O7NB 1NB3I 3NX0A 1IVWA 1ULIB 4RNYA 1KSIA 3CNXA 1QAFA 1LOXA 4BTWA 3CU3A 4N6TA 2OTJ3 3GZRA 5AEWB 5I97A 3MWZA 3CCE3 1WTHA 1WMNA 1VQ93 3JUQA 1CYVA 3B4PA 4AKZA 5A0OB 5IG5A 1OHSA 3KKGA 3LZAA 1UW1A 2B24B 2GEXA 4EXRA 5IW9A 3G713 1M9GA 2CKFB 1WMPA 2INXA 5IEPA 3BNEA 3NXJA 2BHMA 1JRQA 4HM1B 5AIGA 2M7OA 1IV9A 1W02A 3MPHA 3IPTA 4N6MA 2K0MA 2E2TA 2W03A 2BO9B 3ALAA 4N6OB 5JPPA 4HM6B 5FW5A 3SVAA 2BMOB 1V74A 2F98A 3CNMA 1ZX2A 2LQVA 4XM4A 1IQ8A 1YJW3 2P38A 3Q1CA 4NREA 3Q90A 3CCL3 2R4IA 3LTDA 2UX0A 2W9QA 3EC9A 3X3XA 2FGTA 3VSYA 1A2VA 4HVNA 1W5ZA 3RGAA 3AMOB 4RZMA 4LGQA 3WOFB 4QWTA 2ML6A 2XFTA 5ELJA 3BLZA 2MF7A 3DM8A 2QIYA 1JJ22 2CW9A 1CYUA 1O7WB 3Q2PA 4EBGA 5BVBA 1NO3A 4N6LA 3X3YA 1D6YA 3SEDA 1Q864 1W6YA 1UI8A 3X41A 1Q7Y4 4HYZA 3CXC2 3MG2A 3K9MC 1UUWB 4JF8A 3VF1A 2KXGA 1E3VA 3RDEA 1EKMA 5D81A 5JPUA 2XFSA 4XDVA 3B8LA 3N9HA 4FMCA 5IEOA 3ER7A 5KP3A 5IG3A 3DXOA 3X3ZA 3HIGA 4WYKA 3N54B 2W0QA 3TDGA 1QVF2 3S29A 4KFEA 3NQYA 3I0YA 3FF2A 3GAXA 3QK9A 1DVDA 1N5HA 1VZZA 3GZXB 1YI23 4STDA 2HMNB 2OQEC 1Z1SA 2YFJB 2HMMB 2MC8A 1DVCA 2QEX3 3CCS3 1IVVA 1LXEA 2V1LA 1VQ63 2RFRA 1O7HB 2W04A 1SQWA 3JVCA 2JDIH 1QJGA 3LYGA 5BXQA 1QVG2 1HKXA 2W56B 2Z7AA 4X2HA 4N6UA 1OHOA 4LEHA 3SXXA 1YJ93 2CWVA 2D1WA 2QA43 1W01A 3S28A 1K41A 2Z77A 3NBBA 1J2BA 1RRHA 3LTCA 4R9KA 1K28A 4L7KA 5DRVA 4HM8B 1IVUA 3STDA 1JN5B 1AVLA 1K8A4 2GU1A 1OH0A 2OCTA 3MKIA 1N8R4 5DREA 3EHCA 3K7CA 5AIIA 4FMAA 1GS3A 1GYBA 3CPOA 3DUKA 3IMAB 3KSED 2WO0A 1T5YA 2BMQB 2BT3A 3CCJ3 2IMJA 3QRDA 5CF1A 3DGOA 3NQZA 3D3LA 4MJDA 3G0KA 1A67A 3FG1A 2GEYA 1OF5A 2CH9A 3EBYA 4ORLA 4WWUC 1TP6A 3B4OA 3F40A 3DGMA 1FGQA 1KD14 2XGNA 1M1XB 2XGLA 2IA7A 4GB5A 3S27A 2CFLA 2CFWA 2W9PA 3DY5A 3UL6A 5IG4A 4R80A 3CC23 3OXAA 1HU9A 3MG1A 1WQLB 2W6JH 1VQM3 3CC43 4O3VA 1AR0A 5ELUA 1DMQA 2FNQA 2PNCA 3PZWA 4H61A 1PU4A 1IQXA 5CXOA 2Q07A 2C10A 1NDOB 2B1XB 1YVBI 2W2CA 1W00A 1YGEA 3FH1A 2RGQA 3LOYA 1OGXA 2CC3A 2KRTA 3HZPA 5JBSA 1TFOA 3PCRA 4CCVA 3MHEA 1DMNA 1Q40A 1C7HA 4N6NB 3U1WA 1GD3A 3EBTA 5EQLA 5D83A 2Y73A 1LNHA 3ROBA 1R4CA 3GZYB 3X40A 5AEUB 3CC73 5KP4A 3OV4A 1YJN3 2XEPA 3FSDA 4BTYA 2O9UX 4WP5A 5IG0A 4PEJA 3PCSA 5CK6A 4K1VA 3V98A 3OW22 1JKGB 3V92A 2ML5A 1W4NA 2Z6BA 3H51A 3SOYA 3RGRA 2STDA 1RKYA 4HM2B 1SIIA 2D42A 1FGRA 2WOFA 4IIAA 6STDA 2RSXA 2Z76A 5FGOA 1E97A 1OACA 4H3UA 2CHCA 3T8NA 1EA2A 5AYSC 4GL6A 4NHFA 3EE1A 3PYJA 4OUQA 1O7GB 2LYXA 2C11A 3CME3 3BNBA 3JUMA 3G16A 3J7Yd 1N9JA 3EN1B 3CCR3 1S723 3NV0B 1U8CB 1GD4A 3EX9A 4WFOA 1PFPA 4JRFA 2P05A 2QGUA 2XSHB 1WMOA 2OWPA 4XBXA 1FGMA 5EVHA 4AEQA 3LTAA 1OF5B 3UL5A 3V99A 1AVKA 4U13A 1G96A 5AIFA 1S5AA 3CMA3 3F7XA 2GXFA 4J8TA 1Y4KA 3F8HA 3NBJA 3WMDA 1ROVA 1FUWA 1W2B2 2K54A 1YHQ3 1QMAA 4K1UA 4EV5A 3I563 5KP1A 4MMZB 1IVXA 1M1K4 1N5PA 1BUQA 2P0MA 2ZL8A 3O8YA 2I9WA 2CG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STD A;  4KVH A;  4X2O A;  3HX8 A;  3DZL A;  2HML B;  1Q40 B;  2GBW B;  4XB5 A;  8CHO A;  1SJW A;  3FKA A;  3OWS A;  1Q42 A;  3DMC A;  4N3V A;  4L8P A;  3F9S A;  3NBR A;  3F14 A;  1OHP A;  5D82 A;  4HM7 B;  1OPY A;  1NU3 A;  3OWY A;  5IER A;  3MSO A;  3BB9 A;  3OWU A;  3S5C A;  1EG9 B;  3FZW A;  3KZT A;  3FF0 A;  3A76 A;  2RCD A;  3MG3 A;  2YFL B;  3GWR A;  3EF8 A;  3GRD A;  2F99 A;  5IF6 A;  4R9L A;  1NWW A;  3F7S A;  4WYK B;  3D9R A;  1A2K A;  3NM2 A;  3NHX A;  4R1K A;  4XBT A;  1UUV B;  5STD A;  2PZV A;  1JN5 A;  1ASK A;  4HM4 B;  1ULJ B;  3KSP A;  4HKV B;  1E3R A;  4LMI A;  2XRX B;  7STD A;  3EQQ B;  1OGZ A;  3VGN A;  3JUO A;  5CLK A;  4I4K A;  3E99 A;  5HGR A;  5CF2 A;  2HMO B;  1JB4 A;  3F8X A;  1JB2 A;  3EN8 A;  1OUN A;  3FGY A;  2BMR B;  3SOA A;  1CQS A;  2A15 A;  3G8Z A;  4OVM A;  1GY5 A;  1GY6 A;  5AIH A;  3K0Z A;  4HM0 B;  4XDW A;  4HZB B;  4HM3 B;  3OX9 A;  1IDP A;  1U5O A;  3M8C A;  2F86 B;  2BNG A;  3FLJ A;  5IEN A;  3ECF A;  2JQ5 A;  1DMM A;  4Q53 A;  3T8U A;  4CDL A;  2XR8 B;  5G2G A;  4HZ9 B;  1ISK A;  1JKG A;  1O7P B;  3KE7 A;  2HMJ B;  3H3H A;  1JB5 A;  2GBX B;  3HK4 A;  3NUV A;  4XBY A;  4FCM A;  4FCJ A;  3EJV A;  5AI1 A;  4J9A A;  5TGN A;  2XSO B;  2YFI B;  3UNL A;  1OCV A;  1O7M B;  1ZO2 A;  3B7C A;  3UJM A;  2HMK B;  3GZB A;  4HM5 B;  4HJL B;  1GY7 A;  3JUN A;  1TUH A;  4L8O A;  3MYT A;  3NV0 A;  3JUP A;  1O7N B;  1ULI B;  3CNX A;  3CU3 A;  3GZR A;  5AEW B;  3JUQ A;  3B4P A;  5IG5 A;  1OHS A;  3KKG A;  3LZA A;  2B24 B;  2GEX A;  2CKF B;  2INX A;  5IEP A;  3NXJ A;  4HM1 B;  5AIG A;  1W02 A;  3IPT A;  5JPP A;  4HM6 B;  5FW5 A;  2BMO B;  2F98 A;  3CNM A;  1ZX2 A;  4XM4 A;  3Q90 A;  2R4I A;  2UX0 A;  3EC9 A;  3VSY A;  4HVN A;  3RGA A;  4RZM A;  4LGQ A;  3BLZ A;  3DM8 A;  2QIY A;  1O7W B;  5BVB A;  3SED A;  1W6Y A;  3MG2 A;  1UUW B;  1E3V A;  5D81 A;  5JPU A;  4XDV A;  3B8L A;  5IEO A;  5KP3 A;  3ER7 A;  5IG3 A;  3DXO A;  4WYK A;  3I0Y A;  3FF2 A;  1VZZ A;  3GZX B;  4STD A;  2HMN B;  2YFJ B;  1Z1S A;  2HMM B;  2RFR A;  1O7H B;  1QJG A;  3LYG A;  5BXQ A;  1HKX A;  2Z7A A;  4X2H A;  1OHO A;  4LEH A;  1W01 A;  1K41 A;  2Z77 A;  4R9K A;  4L7K A;  5DRV A;  4HM8 B;  3STD A;  1JN5 B;  1OH0 A;  3MKI A;  5DRE A;  3EHC A;  3K7C A;  5AII A;  1GS3 A;  1GYB A;  3CPO A;  3DUK A;  2BMQ B;  2IMJ A;  5CF1 A;  4MJD A;  3G0K A;  2GEY A;  1OF5 A;  4WWU C;  3EBY A;  4ORL A;  1TP6 A;  3B4O A;  3F40 A;  4GB5 A;  5IG4 A;  3OXA A;  3MG1 A;  1WQL B;  1AR0 A;  1DMQ A;  5CXO A;  1NDO B;  2B1X B;  1W00 A;  2W2C A;  3FH1 A;  2RGQ A;  1OGX A;  3HZP A;  3MHE A;  1DMN A;  1Q40 A;  1C7H A;  3EBT A;  5D83 A;  3ROB A;  3GZY B;  5AEU B;  5KP4 A;  3OV4 A;  3FSD A;  4WP5 A;  5IG0 A;  4PEJ A;  5CK6 A;  4K1V A;  1JKG B;  3H51 A;  3SOY A;  3RGR A;  2STD A;  4HM2 B;  4IIA A;  6STD A;  2Z76 A;  1E97 A;  4H3U A;  2CHC A;  3T8N A;  1EA2 A;  4OUQ A;  1O7G B;  3JUM A;  3G16 A;  3EN1 B;  3NV0 B;  3EX9 A;  5EVH A;  2QGU A;  2XSH B;  2OWP A;  4XBX A;  1OF5 B;  4U13 A;  5AIF A;  1S5A A;  3F7X A;  2GXF A;  4J8T A;  3F8H A;  3WMD A;  2K54 A;  1QMA A;  4K1U A;  5KP1 A;  1BUQ A;  2I9W A; 
#chains in the Genus database with same CATH topology
 1STD A;  1JZD A;  4KVH A;  5GSP A;  3N8B A;  4X2O A;  4LSO A;  3I55 3;  4OK0 A;  3AMO A;  3HX8 A;  1RRL A;  4FMD A;  1X1X A;  4WHA A;  1VQ5 3;  3DZL A;  3A5E A;  2OTL 3;  2HML B;  1BIR A;  4KFD A;  1RN7 A;  3IJE B;  1Q40 B;  7GSP A;  4MMX B;  2GBW B;  1G02 A;  4XB5 A;  3K5T A;  2WGQ A;  3PS8 A;  8CHO A;  1SJW A;  3FKA A;  3OWS A;  2CWT A;  1Q42 A;  3DMC A;  1YIJ 3;  1K73 4;  1G0T A;  2UUG C;  1DYU A;  3BND A;  4L8P A;  4N3V A;  3F9S A;  1RHL A;  3NBR A;  3F14 A;  3CCU 3;  1FGT A;  3FG4 A;  1ROA A;  5EEO A;  1OHP A;  5D82 A;  1WNH A;  1RGH A;  4HM7 B;  1OPY A;  2FXT A;  3BIR A;  1NU3 A;  1NJI 4;  3LML A;  3OWY A;  1BRG A;  5IER A;  1TRQ A;  3DGL A;  3MSO A;  4LZI A;  1UCJ A;  4KFF A;  1B27 A;  1F8N A;  3BNC A;  1KC8 4;  3BB9 A;  3LT9 A;  1BNE A;  3OWU A;  1TU5 A;  3WHO A;  1VQL 3;  1BRN L;  2CFD A;  2J8X B;  3S5C A;  1VQ4 3;  3T0U A;  1EG9 B;  3HII A;  3L0R A;  3FZW A;  4EC6 A;  1QAL A;  3HI7 A;  1I2F A;  3KZT A;  1YIT 3;  3D5I A;  3FF0 A;  4O8S A;  1GOV A;  3X42 A;  1BRK A;  1Q82 4;  3A76 A;  3CD6 3;  2OQE A;  2OOV C;  1KWI A;  5AYR B;  4MEI A;  2RCD A;  3KII A;  2KF3 A;  1BSD A;  1B2U A;  2P09 A;  3MG3 A;  3PXM A;  4FMB A;  1RDS A;  2GU3 A;  2YFL B;  2CWU A;  1FW7 A;  1W2Z A;  5M1A A;  3FG3 A;  1DE3 A;  3GWR A;  3Q3F A;  1RJO A;  3EF8 A;  3GRD A;  4KZ1 A;  2F99 A;  5IF6 A;  4R9L A;  1NWW A;  3LT8 A;  1D6U A;  3F7S A;  2XF3 A;  4BTX A;  4G1M B;  2W56 A;  4WYK B;  2O3O A;  2IUJ A;  1LQG C;  3D9R A;  4IPB A;  2F4Y A;  2L4V A;  3WOD G;  1KQS 2;  1K9M 4;  1UCL A;  1A2K A;  3NM2 A;  1STF I;  3NHX A;  4R1K A;  1FUS A;  1N9E A;  4XBT A;  1VQP 3;  1UUV B;  3U97 A;  5STD A;  2SBL A;  1W6G A;  3CPW 2;  1LVN A;  2PZV A;  1D6Z A;  1JN5 A;  3AHW A;  2HOH A;  2KF4 A;  4K90 B;  1HYF A;  1ASK A;  4RNZ A;  4HM4 B;  4J5K A;  1ULJ B;  3KSP A;  1BUJ A;  4HKV B;  3K63 A;  3SX1 A;  1E3R A;  4LMI A;  2XRX B;  3LTB A;  1TFK A;  7STD A;  3EQQ B;  2CIU A;  3D4A A;  3S67 A;  1EQK A;  3WR2 A;  4IT7 A;  3WOE B;  1OGZ A;  2WGO A;  5LC7 A;  3PGB A;  1IT8 A;  1RGF A;  3LXU X;  1GOY A;  3VGN A;  3JUO A;  1MOL A;  1FYS A;  3WA2 X;  1IK3 A;  2C4B A;  3AGO A;  1UI7 A;  5CLK A;  4I4K A;  1BSA A;  1GOU A;  2ZDJ A;  3E99 A;  1X1W A;  4TX4 A;  5HGR A;  1B2X A;  5CF2 A;  3G4S 3;  2IY2 A;  2GSP A;  4N6V 0;  4O02 B;  4EV2 A;  2HMO B;  1JB4 A;  3F8X A;  1MWR A;  3SYU A;  1RGL A;  3KCH A;  1RLS A;  2UGI A;  1JB2 A;  3UB1 A;  1OUN A;  1IQY A;  3EN8 A;  3FGY A;  5LC6 A;  3WA3 A;  1IYY A;  2IUK A;  1YNV X;  4ZM8 A;  2OOV A;  2BMR B;  3FCS B;  3SOA A;  1CQS A;  2A15 A;  3G8Z A;  4RBN A;  4MMY B;  1SIH A;  4OVM A;  1GY5 A;  8RNT A;  1MGR A;  1GY6 A;  5AIH A;  1W6C A;  2XH9 A;  7RNT A;  3K0Z A;  4HM0 B;  1IU7 A;  4XDW A;  1UGH I;  4HZB B;  4HM3 B;  1NB5 I;  1BOX A;  1Q81 4;  3OX9 A;  1B2S A;  5BU4 A;  1IDP A;  1U5O A;  3M8C A;  4BL2 A;  2F86 B;  1JV2 B;  2BNG A;  3FLJ A;  1AQZ A;  2WOH A;  2Y74 A;  5IEN A;  1IV7 A;  2CFG A;  3ECF A;  1A90 A;  3DGY A;  4FCZ A;  2JQ5 A;  3G6E 3;  1DMM A;  1L5G B;  3DGN A;  4O2H A;  1RN1 A;  6GSP A;  2RBI A;  4Q53 A;  3SLU A;  3T8U A;  3WDG B;  4CDL A;  3CCV 3;  4HBR A;  1FA3 A;  2E2V A;  3NM7 A;  1UUG B;  2XR8 B;  5G2G A;  1MNL A;  4HZ9 B;  4ILF A;  1ISK A;  4FR9 A;  1JKG A;  1O7P B;  1VQ7 3;  3KE7 A;  1M90 4;  2HMJ B;  3H3H A;  1BRJ A;  3EB8 A;  1JB5 A;  4NPB A;  1JZO A;  2GBX B;  1V57 A;  1SPU A;  2CG0 A;  2KF5 A;  2P0X A;  2YX9 A;  4K61 A;  3HK4 A;  3DH2 A;  3NUV A;  1JBS A;  1US1 A;  4XBY A;  4FCM A;  4FCJ A;  3EJV A;  5AI1 A;  3CCM 3;  4J9A A;  4KT3 B;  5TGN A;  1TIJ A;  2XSO B;  2YFI B;  1VQK 3;  1VQO 3;  1IT7 A;  1JNQ A;  3UNL A;  2E2U A;  1VQN 3;  1W7C A;  1OCV A;  1FZU A;  4RNT A;  1O7M B;  3KN4 A;  1Q7H A;  4R4K A;  4HAA A;  4EYC A;  1ZO2 A;  3B7C A;  3UJM A;  1FGO A;  3CCQ 3;  2HMK B;  2CK3 H;  3LH4 A;  3GZB A;  4HM5 B;  1N8Q A;  1AV4 A;  4HJL B;  4AKY A;  1VQ8 3;  1GY7 A;  4BIR A;  1B21 A;  3JUN A;  3KFQ C;  1LOV A;  1QAK A;  1TUH A;  4L8O A;  3MYT A;  2CFK A;  3NV0 A;  2F56 A;  2KCD A;  1CEW I;  3JUP A;  1NNV A;  1O7N B;  1NB3 I;  3NX0 A;  1BRI A;  1IVW A;  1ULI B;  4RNY A;  2KF6 A;  1KSI A;  1FUT A;  3CNX A;  5RNT A;  1QAF A;  1LOX A;  4BTW A;  3CU3 A;  1I0X A;  4N6T A;  2OTJ 3;  3GZR A;  5AEW B;  5I97 A;  3MWZ A;  4HOH A;  3CCE 3;  1WTH A;  1WMN A;  1VQ9 3;  1BNG A;  3JUQ A;  1CYV A;  3B4P A;  4AKZ A;  5A0O B;  5IG5 A;  1T2H A;  1I8V A;  1OHS A;  2BIR A;  3KKG A;  3LZA A;  1UW1 A;  2R41 A;  1RTU A;  2B24 B;  2GEX A;  4EXR A;  5IW9 A;  3G71 3;  1GSP A;  1M9G A;  2CKF B;  1WMP A;  2INX A;  5IEP A;  3BNE A;  3NXJ A;  3HOH A;  2BHM A;  1JRQ A;  4I5Q A;  9RNT A;  1BSE A;  4HM1 B;  5AIG A;  1I70 A;  2M7O A;  1RGK A;  1IV9 A;  1RGE A;  1W02 A;  3MPH A;  3IPT A;  4N6M A;  1X1Y A;  2K0M A;  2E2T A;  2RNT A;  2W03 A;  2BO9 B;  3ALA A;  4N6O B;  5JPP A;  4HM6 B;  5FW5 A;  3SVA A;  2BMO B;  1A2P A;  1V74 A;  2F98 A;  1I2E A;  2AAD A;  3CNM A;  5BIR A;  1ZX2 A;  2LQV A;  1GMP A;  4XM4 A;  1IQ8 A;  1GMQ A;  1YJW 3;  2P38 A;  3D5G A;  3Q1C A;  1JBR A;  4NRE A;  3Q90 A;  3CCL 3;  4DKI A;  2R4I A;  3LTD A;  5M19 A;  2UX0 A;  2W9Q A;  3EC9 A;  3X3X A;  2FGT A;  3VSY A;  1A2V A;  4HVN A;  1RNB A;  1LOY A;  1W5Z A;  2CX0 A;  3RGA A;  3URP A;  3AMO B;  4RZM A;  1EUI C;  4LGQ A;  3WOF B;  4QWT A;  2ML6 A;  1SAR A;  2XFT A;  5ELJ A;  3BLZ A;  2MF7 A;  3DM8 A;  2QIY A;  1JJ2 2;  2CW9 A;  1CYU A;  1O7W B;  3Q2P A;  4EBG A;  5BVB A;  1NO3 A;  4N6L A;  3X3Y A;  1D6Y A;  3SED A;  1Q86 4;  1W6Y A;  1UI8 A;  3X41 A;  1Q7Y 4;  4HYZ A;  3CXC 2;  2H0I A;  1LQM B;  3MG2 A;  1BGS A;  3K9M C;  1UUW B;  4JF8 A;  3VF1 A;  2KXG A;  1RSN A;  1BSC A;  1E3V A;  2IYJ A;  3RDE A;  1EKM A;  5D81 A;  5JPU A;  2XFS A;  5G1L A;  4XDV A;  3GSP A;  3B8L A;  3N9H A;  2ZHX B;  4FMC A;  3ER7 A;  5IEO A;  5G1K A;  5KP3 A;  1C54 A;  1R4Y A;  1RGG A;  5IG3 A;  3DXO A;  3X3Z A;  3HIG A;  4WYK A;  1RMS A;  3D79 A;  3N54 B;  2W0Q A;  3TDG A;  1QVF 2;  2F5W A;  4KFE A;  3S29 A;  4EW5 A;  3NQY A;  1MWU A;  3I0Y A;  3FF2 A;  3GAX A;  3QK9 A;  1DVD A;  1EEJ A;  1N5H A;  1BRH A;  1VZZ A;  3GZX B;  1BNI A;  1YI2 3;  4STD A;  2HMN B;  1MGW A;  2OQE C;  1Z1S A;  2YFJ B;  2HMM B;  2MC8 A;  1DVC A;  2QEX 3;  3CCS 3;  1IVV A;  1LXE A;  2V1L A;  1VQ6 3;  2RFR A;  3ZFZ A;  1O7H B;  2W04 A;  1SQW A;  3JVC A;  2JDI H;  1QJG A;  1YVS A;  3LYG A;  1BRS A;  5BXQ A;  2AAE A;  1QVG 2;  1HKX A;  2W56 B;  2Z7A A;  1TRP A;  4X2H A;  1I0V A;  4N6U A;  1OHO A;  4LEH A;  3SXX A;  1YJ9 3;  2CWV A;  2D1W A;  2QA4 3;  1GMR A;  1W01 A;  3S28 A;  1K41 A;  2Z77 A;  1RGA A;  3NBB A;  3ZG0 A;  3ZG5 A;  1BAO A;  1J2B A;  1RRH A;  3LTC A;  4R9K A;  2SAR A;  1K28 A;  4L7K A;  1UCK A;  5DRV A;  4HM8 B;  1IVU A;  3STD A;  1JN5 B;  1AVL A;  1K8A 4;  2GU1 A;  1OH0 A;  2OCT A;  3MKI A;  1N8R 4;  5DRE A;  3EHC A;  3K7C A;  3RNT A;  5AII A;  3AHS A;  4FMA A;  2F5M A;  1GS3 A;  1GYB A;  1T3B A;  3CPO A;  3DUK A;  3IMA B;  3KSE D;  2WO0 A;  1B2Z A;  1T5Y A;  2BMQ B;  2BT3 A;  3CCJ 3;  2IMJ A;  1UDI I;  3QRD A;  5CF1 A;  3DGO A;  3NQZ A;  3D3L A;  4MJD A;  3G0K A;  1A67 A;  3FG1 A;  1LRA A;  1UGI A;  1RCK A;  2GEY A;  1OF5 A;  4GSP A;  2CH9 A;  3EBY A;  4ORL A;  4WWU C;  1PY3 A;  1TP6 A;  3B4O A;  3F40 A;  3DGM A;  1FGQ A;  5HOH A;  1KD1 4;  1I3F A;  2XGN A;  1M1X B;  2XGL A;  2IA7 A;  4GB5 A;  3S27 A;  2CFL A;  2CFW A;  2W9P A;  3DY5 A;  1BU4 A;  3UL6 A;  5IG4 A;  4R80 A;  1PYL A;  3CC2 3;  3OXA A;  1BSB A;  1HU9 A;  3MG1 A;  1WQL B;  2W6J H;  1VQM 3;  3CC4 3;  4CPK A;  4O3V A;  1AR0 A;  5ELU A;  1BNS A;  1DMQ A;  1YGW A;  4BL3 A;  2FNQ A;  2PNC A;  3PZW A;  4H61 A;  1PU4 A;  1IQX A;  5CXO A;  1V58 A;  2C10 A;  2Q07 A;  3BU4 A;  6RNT A;  1NDO B;  2B1X B;  1YVB I;  1W00 A;  1YGE A;  2KAA A;  2W2C A;  2RGQ A;  1RCL A;  3FH1 A;  3LOY A;  1TJD A;  1OGX A;  1RN4 A;  1VQQ A;  2CC3 A;  2K3D A;  2KRT A;  3HZP A;  5JBS A;  1TFO A;  3PCR A;  4CCV A;  3MHE A;  1DMN A;  1Q40 A;  1C7H A;  4N6N B;  3U1W A;  1GD3 A;  3EBT A;  5EQL A;  5D83 A;  2Y73 A;  1LNH A;  3ROB A;  1R4C A;  3GZY B;  3X40 A;  5AEU B;  3CC7 3;  1JBT A;  4J5G A;  5KP4 A;  1ZGX A;  3OV4 A;  1YJN 3;  1BAN A;  2XEP A;  3FSD A;  4BTY A;  2O9U X;  4WP5 A;  5IG0 A;  4PEJ A;  3PCS A;  5CK6 A;  4K1V A;  3V98 A;  3OW2 2;  1JKG B;  1CH0 A;  2H0H A;  3V92 A;  2ML5 A;  1W4N A;  2Z6B A;  2H0G A;  4CJN A;  3H51 A;  3SOY A;  3RGR A;  2STD A;  1RKY A;  4HM2 B;  1SII A;  1RNT A;  2D42 A;  1I3I A;  1RGC A;  1FGR A;  2WOF A;  4IIA A;  1B2M A;  6STD A;  2RSX A;  2Z76 A;  5M18 A;  1LOW A;  5FGO A;  1E97 A;  1OAC A;  4H3U A;  2CHC A;  3T8N A;  1BNR A;  1EA2 A;  1X1U A;  5AYS C;  4GL6 A;  4NHF A;  3EE1 A;  3PYJ A;  4OUQ A;  2BU4 A;  1ZS7 A;  1Q9E A;  1O7G B;  2LYX A;  2C11 A;  3CME 3;  3BNB A;  3JUM A;  3G16 A;  3J7Y d;  1N9J A;  2CX1 A;  3EN1 B;  3CCR 3;  4GHO A;  1S72 3;  3NV0 B;  2L1S A;  1HZ1 A;  1U8C B;  1GD4 A;  1T2I A;  3EX9 A;  4WFO A;  1PFP A;  4JRF A;  2P05 A;  2QGU A;  2XSH B;  1WMO A;  2OWP A;  4XBX A;  1FGM A;  5EVH A;  1TTO A;  1I2G A;  1BNF A;  2ZA4 A;  3LTA A;  4AEQ A;  4LYL B;  1OF5 B;  3UL5 A;  3V99 A;  1AVK A;  4U13 A;  1G96 A;  5AIF A;  1S5A A;  3CMA 3;  1B20 A;  3F7X A;  1LNI A;  2GXF A;  4J8T A;  1B3S A;  1AY7 A;  1DET A;  1Y4K A;  3F8H A;  3NBJ A;  3WMD A;  1ROV A;  1UCI A;  1W2B 2;  2K54 A;  1YHQ 3;  1QMA A;  4K1U A;  1FUW A;  4EV5 A;  1BNJ A;  3I56 3;  5KP1 A;  4MMZ B;  1IVX A;  3AGN A;  1M1K 4;  1N5P A;  1BUQ A;  1MWS A;  2P0M A;  1MWT A;  2ZL8 A;  3O8Y A;  2I9W A;  4BU4 A;  2CG1 A;  1BVI A; 
#chains in the Genus database with same CATH homology
 1STD A;  4KVH A;  3N8B A;  4X2O A;  4LSO A;  3I55 3;  4OK0 A;  3AMO A;  3HX8 A;  1RRL A;  4FMD A;  4WHA A;  1VQ5 3;  3DZL A;  2OTL 3;  2HML B;  4KFD A;  1RN7 A;  3IJE B;  1Q40 B;  4MMX B;  2GBW B;  4XB5 A;  3K5T A;  2WGQ A;  3PS8 A;  8CHO A;  1SJW A;  3FKA A;  3OWS A;  2CWT A;  1Q42 A;  3DMC A;  1YIJ 3;  1K73 4;  1DYU A;  3BND A;  4L8P A;  4N3V A;  3F9S A;  3NBR A;  3F14 A;  3CCU 3;  1FGT A;  3FG4 A;  1ROA A;  5EEO A;  1OHP A;  5D82 A;  1WNH A;  4HM7 B;  1OPY A;  2FXT A;  1NU3 A;  1NJI 4;  3LML A;  3OWY A;  5IER A;  3DGL A;  3MSO A;  4LZI A;  4KFF A;  1KC8 4;  1F8N A;  3BNC A;  3BB9 A;  3LT9 A;  3OWU A;  1TU5 A;  1VQL 3;  2CFD A;  3S5C A;  1VQ4 3;  3T0U A;  1EG9 B;  3HII A;  3L0R A;  3FZW A;  4EC6 A;  1QAL A;  3HI7 A;  3KZT A;  1YIT 3;  3FF0 A;  4O8S A;  3X42 A;  1Q82 4;  3A76 A;  3CD6 3;  2OQE A;  2OOV C;  1KWI A;  5AYR B;  4MEI A;  2RCD A;  3KII A;  3MG3 A;  3PXM A;  2P09 A;  4FMB A;  2GU3 A;  2YFL B;  2CWU A;  1W2Z A;  3FG3 A;  3GWR A;  1RJO A;  3EF8 A;  3GRD A;  4KZ1 A;  2F99 A;  5IF6 A;  4R9L A;  1NWW A;  3LT8 A;  1D6U A;  3F7S A;  2XF3 A;  4BTX A;  4G1M B;  2W56 A;  4WYK B;  2O3O A;  2IUJ A;  4IPB A;  3D9R A;  2L4V A;  3WOD G;  1KQS 2;  1K9M 4;  1A2K A;  3NM2 A;  1STF I;  3NHX A;  4R1K A;  1N9E A;  4XBT A;  1VQP 3;  1UUV B;  3U97 A;  5STD A;  2SBL A;  1W6G A;  3CPW 2;  1LVN A;  2PZV A;  1D6Z A;  1JN5 A;  4K90 B;  1ASK A;  4RNZ A;  4HM4 B;  1ULJ B;  3KSP A;  4HKV B;  3K63 A;  3SX1 A;  1E3R A;  4LMI A;  2XRX B;  3LTB A;  1TFK A;  7STD A;  3EQQ B;  2CIU A;  3S67 A;  1EQK A;  4IT7 A;  3WOE B;  1OGZ A;  2WGO A;  5LC7 A;  3PGB A;  1IT8 A;  3LXU X;  3VGN A;  3JUO A;  1MOL A;  3WA2 X;  1IK3 A;  1UI7 A;  5CLK A;  4I4K A;  2ZDJ A;  3E99 A;  4TX4 A;  5HGR A;  5CF2 A;  3G4S 3;  4N6V 0;  4O02 B;  4EV2 A;  2HMO B;  1JB4 A;  3F8X A;  3UB1 A;  1JB2 A;  1OUN A;  1IQY A;  3EN8 A;  3FGY A;  5LC6 A;  3WA3 A;  2IUK A;  4ZM8 A;  2OOV A;  2BMR B;  3FCS B;  3SOA A;  1CQS A;  2A15 A;  3G8Z A;  4RBN A;  4MMY B;  1SIH A;  4OVM A;  1GY5 A;  1GY6 A;  5AIH A;  1W6C A;  2XH9 A;  3K0Z A;  4HM0 B;  1IU7 A;  4XDW A;  4HZB B;  4HM3 B;  1NB5 I;  1Q81 4;  3OX9 A;  1IDP A;  1U5O A;  3M8C A;  2F86 B;  1JV2 B;  2BNG A;  3FLJ A;  2WOH A;  2Y74 A;  5IEN A;  1IV7 A;  2CFG A;  3ECF A;  1A90 A;  4FCZ A;  2JQ5 A;  3G6E 3;  1DMM A;  1L5G B;  3DGN A;  4O2H A;  3CCV 3;  4Q53 A;  3SLU A;  3T8U A;  3WDG B;  4CDL A;  4HBR A;  1FA3 A;  2E2V A;  3NM7 A;  2XR8 B;  5G2G A;  1MNL A;  4HZ9 B;  1ISK A;  4FR9 A;  1JKG A;  1O7P B;  1VQ7 3;  3KE7 A;  1M90 4;  2HMJ B;  3H3H A;  3EB8 A;  1JB5 A;  2GBX B;  2CG0 A;  1SPU A;  2P0X A;  2YX9 A;  4K61 A;  3HK4 A;  3NUV A;  1US1 A;  4XBY A;  4FCM A;  4FCJ A;  3EJV A;  5AI1 A;  3CCM 3;  4J9A A;  5TGN A;  1TIJ A;  2XSO B;  2YFI B;  1VQK 3;  1VQO 3;  1IT7 A;  1JNQ A;  3UNL A;  2E2U A;  1VQN 3;  1W7C A;  1OCV A;  1O7M B;  3KN4 A;  4R4K A;  4EYC A;  1ZO2 A;  3B7C A;  3UJM A;  1FGO A;  3CCQ 3;  2HMK B;  2CK3 H;  3LH4 A;  3GZB A;  4HM5 B;  1N8Q A;  1AV4 A;  4HJL B;  4AKY A;  1VQ8 3;  1GY7 A;  3JUN A;  3KFQ C;  1QAK A;  1TUH A;  4L8O A;  3MYT A;  2CFK A;  3NV0 A;  2KCD A;  1CEW I;  3JUP A;  1O7N B;  1NB3 I;  3NX0 A;  1IVW A;  1ULI B;  4RNY A;  1KSI A;  3CNX A;  1QAF A;  1LOX A;  4BTW A;  3CU3 A;  4N6T A;  2OTJ 3;  3GZR A;  5AEW B;  5I97 A;  3MWZ A;  3CCE 3;  1WTH A;  1WMN A;  1VQ9 3;  3JUQ A;  1CYV A;  3B4P A;  4AKZ A;  5A0O B;  5IG5 A;  1OHS A;  3KKG A;  3LZA A;  1UW1 A;  2B24 B;  2GEX A;  4EXR A;  5IW9 A;  3G71 3;  1M9G A;  2CKF B;  1WMP A;  2INX A;  5IEP A;  3BNE A;  3NXJ A;  2BHM A;  1JRQ A;  4HM1 B;  5AIG A;  2M7O A;  1IV9 A;  1W02 A;  3MPH A;  3IPT A;  4N6M A;  2K0M A;  2E2T A;  2W03 A;  2BO9 B;  3ALA A;  4N6O B;  5JPP A;  4HM6 B;  5FW5 A;  3SVA A;  2BMO B;  1V74 A;  2F98 A;  3CNM A;  1ZX2 A;  2LQV A;  4XM4 A;  1IQ8 A;  1YJW 3;  2P38 A;  3Q1C A;  4NRE A;  3Q90 A;  3CCL 3;  2R4I A;  3LTD A;  2UX0 A;  2W9Q A;  3EC9 A;  3X3X A;  2FGT A;  3VSY A;  1A2V A;  4HVN A;  1W5Z A;  3RGA A;  3AMO B;  4RZM A;  4LGQ A;  3WOF B;  4QWT A;  2ML6 A;  2XFT A;  5ELJ A;  3BLZ A;  2MF7 A;  3DM8 A;  2QIY A;  1JJ2 2;  2CW9 A;  1CYU A;  1O7W B;  3Q2P A;  4EBG A;  5BVB A;  1NO3 A;  4N6L A;  3X3Y A;  1D6Y A;  3SED A;  1Q86 4;  1W6Y A;  1UI8 A;  3X41 A;  1Q7Y 4;  4HYZ A;  3CXC 2;  3MG2 A;  3K9M C;  1UUW B;  4JF8 A;  3VF1 A;  2KXG A;  1E3V A;  3RDE A;  1EKM A;  5D81 A;  5JPU A;  2XFS A;  4XDV A;  3B8L A;  3N9H A;  4FMC A;  5IEO A;  3ER7 A;  5KP3 A;  5IG3 A;  3DXO A;  3X3Z A;  3HIG A;  4WYK A;  3N54 B;  2W0Q A;  3TDG A;  1QVF 2;  3S29 A;  4KFE A;  3NQY A;  3I0Y A;  3FF2 A;  3GAX A;  3QK9 A;  1DVD A;  1N5H A;  1VZZ A;  3GZX B;  1YI2 3;  4STD A;  2HMN B;  2OQE C;  1Z1S A;  2YFJ B;  2HMM B;  2MC8 A;  1DVC A;  2QEX 3;  3CCS 3;  1IVV A;  1LXE A;  2V1L A;  1VQ6 3;  2RFR A;  1O7H B;  2W04 A;  1SQW A;  3JVC A;  2JDI H;  1QJG A;  3LYG A;  5BXQ A;  1QVG 2;  1HKX A;  2W56 B;  2Z7A A;  4X2H A;  4N6U A;  1OHO A;  4LEH A;  3SXX A;  1YJ9 3;  2CWV A;  2D1W A;  2QA4 3;  1W01 A;  3S28 A;  1K41 A;  2Z77 A;  3NBB A;  1J2B A;  1RRH A;  3LTC A;  4R9K A;  1K28 A;  4L7K A;  5DRV A;  4HM8 B;  1IVU A;  3STD A;  1JN5 B;  1AVL A;  1K8A 4;  2GU1 A;  1OH0 A;  2OCT A;  3MKI A;  1N8R 4;  5DRE A;  3EHC A;  3K7C A;  5AII A;  4FMA A;  1GS3 A;  1GYB A;  3CPO A;  3DUK A;  3IMA B;  3KSE D;  2WO0 A;  1T5Y A;  2BMQ B;  2BT3 A;  3CCJ 3;  2IMJ A;  3QRD A;  5CF1 A;  3DGO A;  3NQZ A;  3D3L A;  4MJD A;  3G0K A;  1A67 A;  3FG1 A;  2GEY A;  1OF5 A;  2CH9 A;  3EBY A;  4ORL A;  4WWU C;  1TP6 A;  3B4O A;  3F40 A;  3DGM A;  1FGQ A;  1KD1 4;  2XGN A;  1M1X B;  2XGL A;  2IA7 A;  4GB5 A;  3S27 A;  2CFL A;  2CFW A;  2W9P A;  3DY5 A;  3UL6 A;  5IG4 A;  4R80 A;  3CC2 3;  3OXA A;  1HU9 A;  3MG1 A;  1WQL B;  2W6J H;  1VQM 3;  3CC4 3;  4O3V A;  1AR0 A;  5ELU A;  1DMQ A;  2FNQ A;  2PNC A;  3PZW A;  4H61 A;  1PU4 A;  1IQX A;  5CXO A;  2Q07 A;  2C10 A;  1NDO B;  2B1X B;  1YVB I;  2W2C A;  1W00 A;  1YGE A;  3FH1 A;  2RGQ A;  3LOY A;  1OGX A;  2CC3 A;  2KRT A;  3HZP A;  5JBS A;  1TFO A;  3PCR A;  4CCV A;  3MHE A;  1DMN A;  1Q40 A;  1C7H A;  4N6N B;  3U1W A;  1GD3 A;  3EBT A;  5EQL A;  5D83 A;  2Y73 A;  1LNH A;  3ROB A;  1R4C A;  3GZY B;  3X40 A;  5AEU B;  3CC7 3;  5KP4 A;  3OV4 A;  1YJN 3;  2XEP A;  3FSD A;  4BTY A;  2O9U X;  4WP5 A;  5IG0 A;  4PEJ A;  3PCS A;  5CK6 A;  4K1V A;  3V98 A;  3OW2 2;  1JKG B;  3V92 A;  2ML5 A;  1W4N A;  2Z6B A;  3H51 A;  3SOY A;  3RGR A;  2STD A;  1RKY A;  4HM2 B;  1SII A;  2D42 A;  1FGR A;  2WOF A;  4IIA A;  6STD A;  2RSX A;  2Z76 A;  5FGO A;  1E97 A;  1OAC A;  4H3U A;  2CHC A;  3T8N A;  1EA2 A;  5AYS C;  4GL6 A;  4NHF A;  3EE1 A;  3PYJ A;  4OUQ A;  1O7G B;  2LYX A;  2C11 A;  3CME 3;  3BNB A;  3JUM A;  3G16 A;  3J7Y d;  1N9J A;  3EN1 B;  3CCR 3;  1S72 3;  3NV0 B;  1U8C B;  1GD4 A;  3EX9 A;  4WFO A;  1PFP A;  4JRF A;  2P05 A;  2QGU A;  2XSH B;  1WMO A;  2OWP A;  4XBX A;  1FGM A;  5EVH A;  4AEQ A;  3LTA A;  1OF5 B;  3UL5 A;  3V99 A;  1AVK A;  4U13 A;  1G96 A;  5AIF A;  1S5A A;  3CMA 3;  3F7X A;  2GXF A;  4J8T A;  1Y4K A;  3F8H A;  3NBJ A;  3WMD A;  1ROV A;  1FUW A;  1W2B 2;  2K54 A;  1YHQ 3;  1QMA A;  4K1U A;  4EV5 A;  3I56 3;  5KP1 A;  4MMZ B;  1IVX A;  1M1K 4;  1N5P A;  1BUQ A;  2P0M A;  2ZL8 A;  3O8Y A;  2I9W A;  2CG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...