1ROAA

Structure of human cystatin d
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
GGIHATDLNDKSVQRALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cystatin D
publication title Crystal structure of human cystatin D, a cysteine peptidase inhibitor with restricted inhibition profile.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1roaA00
1CYVA 1GD3A 5LC7A 4N6UA 1IV7A 5A0OB 1NB3I 3L0RA 1MOLA 4CCVA 4LZIA 5EQLA 3SVAA 1FA3A 5LC6A 3PXMA 1EQKA 1ROAA 1DVDA 5ELJA 4TX4A 1DVCA 2W9QA 3UL6A 2W9PA 1WNHA 1RN7A 3NX0A 3QRDA 4N6V0 3KSED 4EYCA 3LH4A 1TIJA 4N6NB 1GD4A 3S67A 2KXGA 1KWIA 3KFQC 3PYJA 1NB5I 1PFPA 1YVBI 3IMAB 3K9MC 4N6TA 4ZM8A 4N6MA 5ELUA 1N5HA 3PS8A 1CYUA 2OCTA 1A90A 2CH9A 1FUWA 1G96A 4IT7A 1N5PA 1MNLA 3Q2PA 1STFI 1M9GA 2O9UX 3MWZA 2BO9B 1N9JA 3UL5A 4N6LA 1LXEA 1CEWI 1R4CA 3GAXA 1A67A 4N6OB 1IV9A
chains in the Genus database with same CATH superfamily
1OGZA 1QALA 1UDII 4HZ9B 1BNIA 3CCL3 3UNLA 2HMJB 1U8CB 1I3FA 3WA3A 1N8R4 1O7WB 4NREA 1UCLA 3GZYB 2W56B 3OW22 3JUQA 5A0OB 4WYKB 2HOHA 1RKYA 2CW9A 5IERA 3LOYA 3PCRA 2E2VA 1JKGB 1BRGA 1VQP3 3G6E3 2H0HA 7GSPA 4LZIA 1T2HA 3CPW2 3B4PA 5DRVA 4LMIA 6RNTA 3CCR3 2B1XB 1OHOA 4HM4B 4J9AA 4O02B 3SVAA 1DYUA 4HM2B 5HGRA 4ILFA 1EG9B 3NUVA 4CDLA 1O7PB 1RLSA 3KKGA 3S28A 2BU4A 1TJDA 1UGIA 1RMSA 1PU4A 1BNRA 2XGNA 1YJ93 3JUNA 3V99A 1OUNA 1Q814 3N9HA 1RN4A 2XFTA 3D79A 2F86B 4EBGA 1ROAA 2ML5A 4HOHA 5JPPA 1BNGA 1DVDA 1MWSA 1X1YA 1O7NB 3DGMA 4TX4A 5ELJA 3V98A 3EN1B 3SXXA 2W9PA 3WA2X 3CCQ3 1GSPA 3FGYA 2R41A 3F8HA 2K54A 1IYYA 3CCS3 1X1UA 2Z76A 3NHXA 1JZDA 2R4IA 1UUWB 1ROVA 1I2GA 1Z1SA 1I2EA 3LTAA 1YJN3 3GRDA 3TDGA 3FKAA 1TIJA 3AGNA 2OOVC 1EEJA 1MWRA 1UCJA 3VSYA 1LOXA 1NO3A 2QA43 3PZWA 1TUHA 3DGYA 3FH1A 1LVNA 2CHCA 2W2CA 1MWUA 1FUTA 5BU4A 2OQEC 1OACA 6STDA 1W01A 3HX8A 5CXOA 3FLJA 3M8CA 2D42A 1AVKA 2FGTA 3ECFA 4XDVA 4DKIA 3K9MC 4R80A 3EBTA 4ZM8A 4H61A 1OHPA 1GOYA 5IENA 1NDOB 1WTHA 1RGHA 2CFLA 4GL6A 3LTCA 5AEWB 1WMNA 1IDPA 2YFIB 4MMZB 1HU9A 3ER7A 2M7OA 4O8SA 9RNTA 1YIT3 1YVSA 1B21A 2AADA 2CKFB 3AMOB 3BNEA 4U13A 4BU4A 3NV0B 2WO0A 1BRJA 3UJMA 5IEPA 1O7MB 3GZBA 1OF5B 3Q2PA 1IU7A 2RCDA 3D4AA 1VQ93 4Q53A 2BMQB 5I97A 1STDA 4CJNA 4FMAA 3BLZA 5AEUB 3HK4A 1GMRA 3KN4A 1G02A 1GY6A 2BO9B 1N9JA 2BT3A 4R9KA 5AYSC 4N3VA 1WMOA 2F5MA 3RGRA 1JB4A 1RRHA 1SPUA 1NNVA 1RN1A 3DH2A 3I553 1W5ZA 2GU3A 2W04A 3EX9A 2FNQA 3MYTA 2GBWB 4KVHA 3A76A 3MKIA 3BU4A 1RCKA 3F7XA 2MC8A 1VQL3 1IK3A 2HMNB 1BNFA 4XBYA 3S27A 1T2IA 3FG1A 3GZRA 1IV9A 2E2TA 1E3RA 3KCHA 1D6ZA 2GBXB 1AR0A 4HM8B 4WWUC 5CF2A 2F98A 4K1UA 3EHCA 1S5AA 1ZX2A 3V92A 4FMCA 5LC7A 1US1A 3SYUA 4L8OA 3NBJA 4FR9A 5D82A 1IV7A 1BRNL 3WOFB 1YHQ3 2JQ5A 4GB5A 1WMPA 1W00A 4LSOA 1JRQA 1HYFA 4BL2A 1MGRA 5JPUA 1MOLA 3VGNA 3WR2A 1F8NA 2FXTA 3HIGA 3OXAA 3SOYA 1A2KA 2RGQA 3EQQB 5EQLA 1ULJB 4L7KA 2J8XB 2KRTA 2IUJA 1V74A 3X3ZA 2PZVA 1JZOA 2KF5A 1T5YA 2BMRB 2HMOB 3FF2A 1KD14 2CFDA 3K7CA 2HMMB 3A5EA 3SLUA 1BSDA 1W02A 1RGEA 1FGRA 1BRIA 1RGLA 1TRPA 4STDA 4HYZA 1GY7A 3BIRA 1I70A 4EV2A 2CFGA 2ZA4A 1FW7A 1KSIA 1AY7A 3B4OA 3WOEB 2CWTA 1OPYA 3SX1A 3CCE3 3KIIA 3OWSA 4HM6B 1NJI4 4FCZA 1QJGA 1BANA 3NX0A 2D1WA 1VQ63 3OWUA 2GEYA 2KCDA 1VQ73 4EYCA 2WOFA 2IUKA 3HI7A 1BOXA 2IA7A 4ORLA 5IG5A 3PGBA 2CG0A 5CK6A 1K8A4 1K28A 2O3OA 1UUVB 3LMLA 1K734 4K61A 4XM4A 3DGLA 4HAAA 4I4KA 3X40A 4BTWA 3T8NA 3CC73 1KWIA 3FG3A 1GOUA 3RGAA 4BTYA 1B2MA 1JBSA 2ZHXB 1BNEA 1FYSA 4WFOA 3G713 1FGTA 2QIYA 1LOVA 1TRQA 2OWPA 3EBYA 1NB5I 1DMNA 4J8TA 4I5QA 4NPBA 1OCVA 1PYLA 1OHSA 2LQVA 4HBRA 1LNHA 4N6MA 3RNTA 5BXQA 1YIJ3 2XSOB 3B7CA 8RNTA 1M1K4 1BAOA 1RGAA 1LOWA 1SARA 1W6YA 3LT9A 1EA2A 1NU3A 5IG3A 1TU5A 4OVMA 3D9RA 1W6CA 3CME3 3F8XA 1A90A 1RTUA 3B8LA 1D6YA 3JUPA 1VQO3 1DETA 2BIRA 1W2B2 3DGNA 4JF8A 1G96A 1N5PA 1MNLA 1X1XA 2AAEA 1RNBA 1Q7Y4 4BL3A 4MEIA 2LYXA 1K41A 2A15A 1AVLA 2UUGC 4J5KA 4K90B 1BSAA 4R4KA 3U1WA 7RNTA 2IY2A 3DY5A 4KFEA 3DXOA 3CCM3 2RNTA 3FZWA 3CCJ3 2C11A 2IYJA 3BNCA 3I563 3UL5A 3MG2A 1B20A 1RJOA 1VZZA 3CXC2 1IQYA 1IT7A 1RGFA 1Q40A 1IVWA 4NHFA 5M18A 1R4CA 2BNGA 3GAXA 3I0YA 3JUOA 5IG4A 3H3HA 1JBRA 4LYLB 1BRSA 4RBNA 4IPBA 3CCU3 4MMYB 1LQGC 3CU3A 1L5GB 5G2GA 1JN5A 1BUJA 4KFFA 1VQM3 3DUKA 2C4BA 2XF3A 3WODG 2OTL3 3K5TA 5D81A 2F99A 3GZXB 2OTJ3 1RSNA 4AEQA 2KF4A 5G1KA 4XDWA 3T0UA 3EC9A 1ULIB 3T8UA 5HOHA 3DZLA 2RBIA 3CCV3 1B2XA 1U5OA 2WGQA 2XEPA 6GSPA 3ROBA 5IF6A 1QMAA 3MG1A 2STDA 4XB5A 4HKVB 2B24B 1RGKA 4G1MB 4R1KA 1CQSA 4CCVA 1BUQA 1IQXA 4HJLB 3U97A 1IQ8A 1OGXA 5KP3A 1FUSA 4KT3B 2IMJA 3K0ZA 4WP5A 1G0TA 5FGOA 3KSPA 1FA3A 5LC6A 3JUMA 2BHMA 1BRHA 1S723 1C54A 1C7HA 3LZAA 1TFKA 2L1SA 1FGQA 2YFJB 4OK0A 4R9LA 1B2SA 1Q7HA 3O8YA 1BSCA 3NQZA 2W0QA 2BMOB 5TGNA 1V57A 3EB8A 4L8PA 4BIRA 5D83A 1UCIA 1UI7A 4HM1B 1GMQA 1YJW3 2GXFA 3EN8A 3UL6A 1UI8A 5BIRA 1K9M4 1WNHA 2W03A 2H0GA 1TTOA 2CIUA 1JJ22 3FG4A 2XSHB 2GU1A 3QRDA 1WQLB 4FMBA 3Q1CA 1VQ53 1Q824 3CNXA 1IT8A 3CPOA 1DMMA 1Y4KA 7STDA 4KFDA 4AKZA 5RNTA 2CWVA 1NWWA 1M904 1FGOA 1GMPA 1GD4A 1B2ZA 1UCKA 3MG3A 1JNQA 3D5IA 3S67A 2KXGA 4O2HA 3RDEA 1VQN3 2YX9A 3X3YA 1YI23 1GS3A 1ASKA 1GY5A 3N8BA 1MWTA 4H3UA 5AYRB 2XR8B 4JRFA 3STDA 2P05A 1GYBA 3ZG0A 2CX1A 4K1VA 2E2UA 1YVBI 3IMAB 3F40A 4EXRA 3EE1A 5ELUA 1SIIA 5KP4A 1EUIC 2HMLB 3F7SA 2W56A 1VQK3 2K3DA 4WYKA 5G1LA 3G4S3 3ALAA 2F4YA 3KE7A 3D3LA 4IT7A 3N54B 1JKGA 8CHOA 3EF8A 1N8QA 5AIFA 3ZG5A 3MPHA 5M1AA 1W4NA 3VF1A 2XGLA 3CC23 1W6GA 4XBXA 3LYGA 5AIHA 2RSXA 3MSOA 5EVHA 2PNCA 1STFI 1RGCA 1M9GA 2C10A 2O9UX 1I2FA 2RFRA 2L4VA 2WOHA 3OWYA 5GSPA 1I0XA 1B27A 1QAFA 3ZFZA 3SEDA 4AKYA 4X2OA 2V1LA 5IG0A 1RHLA 1A2VA 4FMDA 1QVF2 1AV4A 2ZDJA 1N9EA 3WDGB 3QK9A 1V58A 1JB5A 3AHWA 2P0XA 4N6LA 1J2BA 1FGMA 1BRKA 1A67A 1RCLA 1RRLA 1I3IA 2F5WA 2KAAA 2SBLA 1YNVX 3BNBA 4MMXB 2QEX3 4N6OB 3GWRA 4EW5A 1RNTA 1CYVA 1LOYA 3DM8A 3EJVA 1GD3A 3FCSB 3AHSA 2GSPA 3JVCA 1ZS7A 3X3XA 4EV5A 1RGGA 3G8ZA 3IJEB 2CX0A 3DMCA 2CC3A 4N6UA 2Z6BA 5DREA 2P09A 3G0KA 5AIIA 3UB1A 3LTDA 1NB3I 1PY3A 3DGOA 3X42A 2K0MA 1MGWA 1M1XB 3L0RA 2HMKB 3HIIA 1VQ83 2CG1A 1LQMB 1BU4A 1E3VA 4RNZA 2CWUA 2WGOA 3FF0A 1VQQA 3KZTA 3WMDA 1BSEA 1KC84 1CH0A 1E97A 2I9WA 1TP6A 2UX0A 3LT8A 3CNMA 5BVBA 2CFKA 2GEXA 5IEOA 1SIHA 1UGHI 3NQYA 3PXMA 1O7HB 3CMA3 3HZPA 4KZ1A 2Y73A 4HM7B 3CC43 2Z77A 2XRXB 4PEJA 1SQWA 3NM2A 4WHAA 3AMOA 1EQKA 2H0IA 3NV0A 1BNJA 3NBRA 1Q40B 1R4YA 2KF6A 2F56A 1OF5A 1JB2A 1IVVA 1A2PA 1LNIA 3K63A 1DVCA 3NBBA 2W9QA 1Q9EA 1ZGXA 1AQZA 1EKMA 5FW5A 4RNTA 1FZUA 1RN7A 3URPA 5M19A 4N6V0 1UUGB 1JN5B 3KSED 1VQ43 1BGSA 1HZ1A 2INXA 3J7Yd 3G16A 3LH4A 3PCSA 3HOHA 4QWTA 2CFWA 4N6NB 5CF1A 1ZO2A 2JDIH 1TFOA 3Q90A 1UW1A 2W6JH 1O7GB 3F14A 4FCMA 1YGEA 3CD63 4GHOA 5AIGA 1ISKA 1BNSA 3E99A 1QAKA 3KFQC 1SJWA 3FSDA 3F9SA 4RNYA 1KQS2 4X2HA 1YGWA 3S29A 5IW9A 3IPTA 2ZL8A 3PYJA 1X1WA 1IVXA 1PFPA 3SOAA 1HKXA 4J5GA 1W7CA 4MJDA 1I0VA 4IIAA 4LEHA 4HM5B 4N6TA 5JBSA 4HM0B 1IVUA 2CK3H 1OH0A 3LXUX 1N5HA 1I8VA 3PS8A 5KP1A 1B2UA 3BB9A 3OV4A 2Z7AA 1CYUA 2OCTA 3BNDA 4BTXA 5CLKA 4XBTA 4EC6A 3NM7A 2OOVA 5EEOA 2CH9A 3H51A 1DMQA 4HM3B 1Q42A 1Q864 1FUWA 2ML6A 3GSPA 2QGUA 3D5GA 2KF3A 1JBTA 3X41A 1RDSA 3Q3FA 1BIRA 3AGOA 2UGIA 3WHOA 5AI1A 1BVIA 5STDA 2OQEA 3LTBA 3S5CA 1W2ZA 3MWZA 4FCJA 4RZMA 4OUQA 2P0MA 4CPKA 4HZBB 1GOVA 2Q07A 1D6UA 1DE3A 1QVG2 3MHEA 3OX9A 2Y74A 2SARA 2MF7A 1LXEA 1CEWI 3NXJA 2XFSA 1LRAA 4GSPA 1BSBA 2P38A 2XH9A 4LGQA 1B3SA 1JV2B 4O3VA 2YFLB 4HVNA 1T3BA
chains in the Genus database with same CATH topology
1OGZA 1QALA 4HZ9B 3CCL3 3UNLA 2HMJB 1U8CB 3WA3A 1N8R4 1O7WB 4NREA 3GZYB 2W56B 3OW22 3JUQA 5A0OB 4WYKB 1RKYA 2CW9A 5IERA 3LOYA 3PCRA 2E2VA 1JKGB 3G6E3 4LZIA 3CPW2 3B4PA 5DRVA 4LMIA 3CCR3 2B1XB 1OHOA 4HM4B 4J9AA 4O02B 3SVAA 1DYUA 4HM2B 5HGRA 1EG9B 3NUVA 4CDLA 1O7PB 3KKGA 3S28A 1PU4A 2XGNA 1YJ93 3JUNA 3V99A 1OUNA 1Q814 3N9HA 2XFTA 2F86B 4EBGA 1ROAA 2ML5A 5JPPA 1DVDA 1O7NB 3DGMA 4TX4A 5ELJA 3V98A 3EN1B 3SXXA 2W9PA 3WA2X 3CCQ3 3FGYA 3F8HA 2K54A 3CCS3 2Z76A 3NHXA 2R4IA 1UUWB 1ROVA 1Z1SA 3LTAA 1YJN3 3GRDA 3TDGA 3FKAA 1TIJA 2OOVC 3VSYA 1LOXA 1NO3A 2QA43 3PZWA 1TUHA 3FH1A 1LVNA 2CHCA 2W2CA 2OQEC 1OACA 6STDA 1W01A 3HX8A 5CXOA 3FLJA 3M8CA 2D42A 1AVKA 2FGTA 3ECFA 4XDVA 3K9MC 4R80A 3EBTA 4ZM8A 4H61A 1OHPA 5IENA 1NDOB 1WTHA 2CFLA 4GL6A 3LTCA 5AEWB 1WMNA 1IDPA 2YFIB 4MMZB 1HU9A 3ER7A 2M7OA 4O8SA 1YIT3 2CKFB 3BNEA 3AMOB 4U13A 3NV0B 2WO0A 3UJMA 5IEPA 1O7MB 3GZBA 1OF5B 3Q2PA 1IU7A 2RCDA 4Q53A 2BMQB 5I97A 1STDA 4FMAA 3BLZA 5AEUB 3HK4A 3KN4A 1GY6A 2BT3A 2BO9B 1N9JA 4R9KA 5AYSC 4N3VA 1WMOA 3RGRA 1JB4A 1RRHA 1SPUA 3I553 1W5ZA 2GU3A 2W04A 3EX9A 2FNQA 3MYTA 2GBWB 4KVHA 3A76A 3MKIA 3F7XA 2MC8A 1VQL3 1IK3A 2HMNB 4XBYA 3S27A 3FG1A 3GZRA 1IV9A 2E2TA 1E3RA 4WWUC 1D6ZA 2GBXB 1AR0A 4HM8B 5CF2A 2F98A 4K1UA 3EHCA 1S5AA 1ZX2A 3V92A 4FMCA 5LC7A 1US1A 4L8OA 3NBJA 4FR9A 5D82A 1IV7A 3WOFB 1YHQ3 2JQ5A 4GB5A 1WMPA 1W00A 4LSOA 1JRQA 5JPUA 1MOLA 3VGNA 1F8NA 2FXTA 3HIGA 3OXAA 3SOYA 1A2KA 2RGQA 3EQQB 5EQLA 1ULJB 4L7KA 2KRTA 2IUJA 3X3ZA 1V74A 2PZVA 3FF2A 1T5YA 2BMRB 2HMOB 1KD14 2CFDA 3K7CA 2HMMB 3SLUA 1W02A 1FGRA 4STDA 4EV2A 4HYZA 1GY7A 2CFGA 1KSIA 3B4OA 3WOEB 2CWTA 1OPYA 3SX1A 3CCE3 3KIIA 3OWSA 4HM6B 1NJI4 4FCZA 1QJGA 3NX0A 2D1WA 1VQ63 3OWUA 2GEYA 2KCDA 1VQ73 4EYCA 2WOFA 2IUKA 3HI7A 2IA7A 4ORLA 5IG5A 3PGBA 2CG0A 5CK6A 1K8A4 1K28A 2O3OA 1UUVB 1K734 4K61A 4XM4A 3DGLA 4I4KA 3X40A 4BTWA 3T8NA 3CC73 1KWIA 3FG3A 3RGAA 4BTYA 4WFOA 3G713 1FGTA 2QIYA 2OWPA 3EBYA 1NB5I 1DMNA 4J8TA 1OCVA 1OHSA 2LQVA 4HBRA 1LNHA 4N6MA 5BXQA 1YIJ3 2XSOB 3B7CA 1M1K4 1W6YA 3LT9A 1EA2A 1NU3A 5IG3A 1TU5A 4OVMA 3D9RA 1W6CA 3CME3 3F8XA 1A90A 3B8LA 1D6YA 3JUPA 1VQO3 1W2B2 3DGNA 4JF8A 1G96A 1N5PA 1MNLA 1Q7Y4 4MEIA 2LYXA 1K41A 2A15A 1AVLA 4R4KA 4K90B 3U1WA 3DY5A 4KFEA 3DXOA 3CCM3 3FZWA 3CCJ3 2C11A 3BNCA 3I563 3UL5A 3MG2A 1VZZA 1RJOA 3CXC2 1IQYA 1IT7A 1Q40A 1IVWA 4NHFA 1R4CA 2BNGA 3GAXA 3I0YA 3JUOA 5IG4A 3H3HA 4RBNA 4IPBA 3CCU3 4MMYB 3CU3A 1L5GB 5G2GA 1JN5A 4KFFA 1VQM3 3DUKA 2XF3A 3WODG 2OTL3 3K5TA 5D81A 2F99A 3GZXB 2OTJ3 4AEQA 4XDWA 3T0UA 3EC9A 1ULIB 3T8UA 3DZLA 3CCV3 1U5OA 2WGQA 2XEPA 3ROBA 5IF6A 1QMAA 3MG1A 2STDA 4XB5A 4HKVB 2B24B 4R1KA 4G1MB 3WMDA 1CQSA 4CCVA 1BUQA 1IQXA 4HJLB 3U97A 1IQ8A 1OGXA 5KP3A 2IMJA 3K0ZA 4WP5A 5FGOA 3KSPA 1FA3A 5LC6A 3JUMA 2BHMA 1S723 1C7HA 3LZAA 1TFKA 2YFJB 1FGQA 4OK0A 4R9LA 3O8YA 3NQZA 2W0QA 2BMOB 5TGNA 3EB8A 4L8PA 5D83A 1UI7A 4HM1B 1YJW3 2GXFA 3EN8A 3UL6A 1UI8A 1K9M4 1WNHA 2W03A 2CIUA 1JJ22 3FG4A 2XSHB 2GU1A 3QRDA 1WQLB 4FMBA 3Q1CA 1VQ53 1Q824 3CNXA 1IT8A 3CPOA 1DMMA 1Y4KA 7STDA 4KFDA 4AKZA 2CWVA 1NWWA 1M904 1FGOA 1GD4A 3MG3A 1JNQA 3S67A 2KXGA 4O2HA 3RDEA 1VQN3 2YX9A 3X3YA 1YI23 1GS3A 1ASKA 1GY5A 3N8BA 4H3UA 5AYRB 2XR8B 4JRFA 3STDA 2P05A 1GYBA 4K1VA 2E2UA 1YVBI 3IMAB 3F40A 4EXRA 3EE1A 5ELUA 1SIIA 5KP4A 2HMLB 3F7SA 2W56A 1VQK3 4WYKA 3G4S3 3ALAA 3KE7A 3D3LA 4IT7A 3N54B 1JKGA 8CHOA 3EF8A 1N8QA 5AIFA 3MPHA 1W4NA 3VF1A 2XGLA 3CC23 1W6GA 4XBXA 3LYGA 5AIHA 2RSXA 3MSOA 5EVHA 2PNCA 1STFI 1VQ93 1M9GA 2C10A 2O9UX 2RFRA 2WOHA 2L4VA 1VQP3 3OWYA 1QAFA 3SEDA 4AKYA 4X2OA 2V1LA 5IG0A 1A2VA 4FMDA 1QVF2 1AV4A 2ZDJA 1N9EA 3WDGB 3QK9A 1JB5A 4N6LA 2P0XA 1J2BA 1FGMA 1A67A 1RRLA 2SBLA 4MMXB 2QEX3 3BNBA 4N6OB 3GWRA 3DM8A 1CYVA 3EJVA 3FCSB 3JVCA 1GD3A 3LMLA 3X3XA 4EV5A 3G8ZA 3IJEB 3DMCA 2CC3A 4N6UA 2Z6BA 5DREA 2P09A 3G0KA 5AIIA 3UB1A 3LTDA 1NB3I 3DGOA 3X42A 2K0MA 1VQ83 1M1XB 3L0RA 2HMKB 3HIIA 2CG1A 1E3VA 4RNZA 2CWUA 2WGOA 3FF0A 3KZTA 1KC84 1E97A 2I9WA 1TP6A 2UX0A 3LT8A 3CNMA 5BVBA 2CFKA 2GEXA 5IEOA 1SIHA 3NQYA 3PXMA 1O7HB 3CMA3 3HZPA 4KZ1A 2Y73A 4HM7B 3CC43 2Z77A 2XRXB 4PEJA 1SQWA 3NM2A 4WHAA 3AMOA 1EQKA 3NV0A 3NBRA 1Q40B 1OF5A 1JB2A 1IVVA 3K63A 1DVCA 3NBBA 2W9QA 5FW5A 1EKMA 1RN7A 4N6V0 1JN5B 3KSED 1VQ43 2INXA 3J7Yd 3G16A 3LH4A 3PCSA 4QWTA 2CFWA 4N6NB 5CF1A 1ZO2A 2JDIH 1TFOA 3Q90A 1UW1A 2W6JH 1O7GB 3F14A 4FCMA 1YGEA 3CD63 1ISKA 5AIGA 3E99A 1QAKA 3KFQC 1SJWA 3FSDA 3F9SA 4RNYA 1KQS2 4X2HA 3S29A 5IW9A 3IPTA 2ZL8A 3PYJA 1IVXA 1PFPA 3SOAA 1HKXA 1W7CA 4MJDA 5JBSA 4IIAA 4LEHA 4HM5B 4N6TA 4HM0B 1IVUA 2CK3H 1OH0A 3LXUX 1N5HA 3PS8A 5KP1A 3BB9A 3OV4A 2Z7AA 1CYUA 2OCTA 3BNDA 4BTXA 5CLKA 4XBTA 4EC6A 3NM7A 2OOVA 5EEOA 2CH9A 3H51A 1DMQA 4HM3B 1Q42A 1Q864 1FUWA 2ML6A 2QGUA 3X41A 5AI1A 5STDA 2OQEA 3LTBA 3S5CA 1W2ZA 3MWZA 4FCJA 4RZMA 4OUQA 2P0MA 4HZBB 2Q07A 1D6UA 1QVG2 3MHEA 3OX9A 2Y74A 2MF7A 1LXEA 1CEWI 3NXJA 2XFSA 2P38A 2XH9A 4LGQA 1JV2B 4O3VA 2YFLB 4HVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CYV A;  1GD3 A;  5LC7 A;  4N6U A;  1IV7 A;  5A0O B;  1NB3 I;  3L0R A;  1MOL A;  4CCV A;  4LZI A;  5EQL A;  3SVA A;  1FA3 A;  5LC6 A;  3PXM A;  1EQK A;  1ROA A;  1DVD A;  5ELJ A;  4TX4 A;  1DVC A;  2W9Q A;  3UL6 A;  2W9P A;  1WNH A;  1RN7 A;  3NX0 A;  3QRD A;  4N6V 0;  3KSE D;  4EYC A;  3LH4 A;  1TIJ A;  4N6N B;  1GD4 A;  3S67 A;  2KXG A;  1KWI A;  3KFQ C;  3PYJ A;  1NB5 I;  1PFP A;  1YVB I;  3IMA B;  3K9M C;  4N6T A;  4ZM8 A;  4N6M A;  5ELU A;  1N5H A;  3PS8 A;  1CYU A;  2OCT A;  1A90 A;  2CH9 A;  1FUW A;  1G96 A;  4IT7 A;  1N5P A;  1MNL A;  3Q2P A;  1STF I;  1M9G A;  2O9U X;  3MWZ A;  2BO9 B;  1N9J A;  3UL5 A;  4N6L A;  1LXE A;  1CEW I;  1R4C A;  3GAX A;  1A67 A;  4N6O B;  1IV9 A; 
#chains in the Genus database with same CATH topology
 1OGZ A;  1QAL A;  1UDI I;  4HZ9 B;  1BNI A;  3CCL 3;  3UNL A;  2HMJ B;  1U8C B;  1I3F A;  3WA3 A;  1N8R 4;  1O7W B;  4NRE A;  1UCL A;  3GZY B;  2W56 B;  3OW2 2;  3JUQ A;  5A0O B;  4WYK B;  2HOH A;  1RKY A;  2CW9 A;  5IER A;  3LOY A;  3PCR A;  2E2V A;  1JKG B;  1BRG A;  1VQP 3;  3G6E 3;  2H0H A;  7GSP A;  4LZI A;  1T2H A;  3CPW 2;  3B4P A;  5DRV A;  4LMI A;  6RNT A;  3CCR 3;  2B1X B;  1OHO A;  4HM4 B;  4J9A A;  4O02 B;  3SVA A;  1DYU A;  4HM2 B;  5HGR A;  4ILF A;  1EG9 B;  3NUV A;  4CDL A;  1O7P B;  1RLS A;  3KKG A;  3S28 A;  2BU4 A;  1TJD A;  1UGI A;  1RMS A;  1PU4 A;  1BNR A;  2XGN A;  1YJ9 3;  3JUN A;  3V99 A;  1OUN A;  1Q81 4;  3N9H A;  1RN4 A;  2XFT A;  3D79 A;  2F86 B;  4EBG A;  1ROA A;  2ML5 A;  4HOH A;  5JPP A;  1BNG A;  1DVD A;  1MWS A;  1X1Y A;  1O7N B;  3DGM A;  4TX4 A;  5ELJ A;  3V98 A;  3EN1 B;  3SXX A;  2W9P A;  3WA2 X;  3CCQ 3;  1GSP A;  3FGY A;  2R41 A;  3F8H A;  2K54 A;  1IYY A;  3CCS 3;  1X1U A;  2Z76 A;  3NHX A;  1JZD A;  2R4I A;  1UUW B;  1ROV A;  1I2G A;  1Z1S A;  1I2E A;  3LTA A;  1YJN 3;  3GRD A;  3TDG A;  3FKA A;  1TIJ A;  3AGN A;  2OOV C;  1EEJ A;  1MWR A;  1UCJ A;  3VSY A;  1LOX A;  1NO3 A;  2QA4 3;  3PZW A;  1TUH A;  3DGY A;  3FH1 A;  1LVN A;  2CHC A;  2W2C A;  1MWU A;  1FUT A;  5BU4 A;  2OQE C;  1OAC A;  6STD A;  1W01 A;  3HX8 A;  5CXO A;  3FLJ A;  3M8C A;  2D42 A;  1AVK A;  2FGT A;  3ECF A;  4XDV A;  4DKI A;  3K9M C;  4R80 A;  3EBT A;  4ZM8 A;  4H61 A;  1OHP A;  1GOY A;  5IEN A;  1NDO B;  1WTH A;  1RGH A;  2CFL A;  4GL6 A;  3LTC A;  5AEW B;  1WMN A;  1IDP A;  2YFI B;  4MMZ B;  1HU9 A;  3ER7 A;  2M7O A;  4O8S A;  9RNT A;  1YIT 3;  1YVS A;  1B21 A;  2AAD A;  2CKF B;  3AMO B;  3BNE A;  4U13 A;  4BU4 A;  3NV0 B;  2WO0 A;  1BRJ A;  3UJM A;  5IEP A;  1O7M B;  3GZB A;  1OF5 B;  3Q2P A;  1IU7 A;  2RCD A;  3D4A A;  1VQ9 3;  4Q53 A;  2BMQ B;  5I97 A;  1STD A;  4CJN A;  4FMA A;  3BLZ A;  5AEU B;  3HK4 A;  1GMR A;  3KN4 A;  1G02 A;  1GY6 A;  2BO9 B;  1N9J A;  2BT3 A;  4R9K A;  5AYS C;  4N3V A;  1WMO A;  2F5M A;  3RGR A;  1JB4 A;  1RRH A;  1SPU A;  1NNV A;  1RN1 A;  3DH2 A;  3I55 3;  1W5Z A;  2GU3 A;  2W04 A;  3EX9 A;  2FNQ A;  3MYT A;  2GBW B;  4KVH A;  3A76 A;  3MKI A;  3BU4 A;  1RCK A;  3F7X A;  2MC8 A;  1VQL 3;  1IK3 A;  2HMN B;  1BNF A;  4XBY A;  3S27 A;  1T2I A;  3FG1 A;  3GZR A;  1IV9 A;  2E2T A;  1E3R A;  3KCH A;  1D6Z A;  2GBX B;  1AR0 A;  4HM8 B;  4WWU C;  5CF2 A;  2F98 A;  4K1U A;  3EHC A;  1S5A A;  1ZX2 A;  3V92 A;  4FMC A;  5LC7 A;  1US1 A;  3SYU A;  4L8O A;  3NBJ A;  4FR9 A;  5D82 A;  1IV7 A;  1BRN L;  3WOF B;  1YHQ 3;  2JQ5 A;  4GB5 A;  1WMP A;  1W00 A;  4LSO A;  1JRQ A;  1HYF A;  4BL2 A;  1MGR A;  5JPU A;  1MOL A;  3VGN A;  3WR2 A;  1F8N A;  2FXT A;  3HIG A;  3OXA A;  3SOY A;  1A2K A;  2RGQ A;  3EQQ B;  5EQL A;  1ULJ B;  4L7K A;  2J8X B;  2KRT A;  2IUJ A;  1V74 A;  3X3Z A;  2PZV A;  1JZO A;  2KF5 A;  1T5Y A;  2BMR B;  2HMO B;  3FF2 A;  1KD1 4;  2CFD A;  3K7C A;  2HMM B;  3A5E A;  3SLU A;  1BSD A;  1W02 A;  1RGE A;  1FGR A;  1BRI A;  1RGL A;  1TRP A;  4STD A;  4HYZ A;  1GY7 A;  3BIR A;  1I70 A;  4EV2 A;  2CFG A;  2ZA4 A;  1FW7 A;  1KSI A;  1AY7 A;  3B4O A;  3WOE B;  2CWT A;  1OPY A;  3SX1 A;  3CCE 3;  3KII A;  3OWS A;  4HM6 B;  1NJI 4;  4FCZ A;  1QJG A;  1BAN A;  3NX0 A;  2D1W A;  1VQ6 3;  3OWU A;  2GEY A;  2KCD A;  1VQ7 3;  4EYC A;  2WOF A;  2IUK A;  3HI7 A;  1BOX A;  2IA7 A;  4ORL A;  5IG5 A;  3PGB A;  2CG0 A;  5CK6 A;  1K8A 4;  1K28 A;  2O3O A;  1UUV B;  3LML A;  1K73 4;  4K61 A;  4XM4 A;  3DGL A;  4HAA A;  4I4K A;  3X40 A;  4BTW A;  3T8N A;  3CC7 3;  1KWI A;  3FG3 A;  1GOU A;  3RGA A;  4BTY A;  1B2M A;  1JBS A;  2ZHX B;  1BNE A;  1FYS A;  4WFO A;  3G71 3;  1FGT A;  2QIY A;  1LOV A;  1TRQ A;  2OWP A;  3EBY A;  1NB5 I;  1DMN A;  4J8T A;  4I5Q A;  4NPB A;  1OCV A;  1PYL A;  1OHS A;  2LQV A;  4HBR A;  1LNH A;  4N6M A;  3RNT A;  5BXQ A;  1YIJ 3;  2XSO B;  3B7C A;  8RNT A;  1M1K 4;  1BAO A;  1RGA A;  1LOW A;  1SAR A;  1W6Y A;  3LT9 A;  1EA2 A;  1NU3 A;  5IG3 A;  1TU5 A;  4OVM A;  3D9R A;  1W6C A;  3CME 3;  3F8X A;  1A90 A;  1RTU A;  3B8L A;  1D6Y A;  3JUP A;  1VQO 3;  1DET A;  2BIR A;  1W2B 2;  3DGN A;  4JF8 A;  1G96 A;  1N5P A;  1MNL A;  1X1X A;  2AAE A;  1RNB A;  1Q7Y 4;  4BL3 A;  4MEI A;  2LYX A;  1K41 A;  2A15 A;  1AVL A;  2UUG C;  4J5K A;  4K90 B;  1BSA A;  4R4K A;  3U1W A;  7RNT A;  2IY2 A;  3DY5 A;  4KFE A;  3DXO A;  3CCM 3;  2RNT A;  3FZW A;  3CCJ 3;  2C11 A;  2IYJ A;  3BNC A;  3I56 3;  3UL5 A;  3MG2 A;  1B20 A;  1RJO A;  1VZZ A;  3CXC 2;  1IQY A;  1IT7 A;  1RGF A;  1Q40 A;  1IVW A;  4NHF A;  5M18 A;  1R4C A;  2BNG A;  3GAX A;  3I0Y A;  3JUO A;  5IG4 A;  3H3H A;  1JBR A;  4LYL B;  1BRS A;  4RBN A;  4IPB A;  3CCU 3;  4MMY B;  1LQG C;  3CU3 A;  1L5G B;  5G2G A;  1JN5 A;  1BUJ A;  4KFF A;  1VQM 3;  3DUK A;  2C4B A;  2XF3 A;  3WOD G;  2OTL 3;  3K5T A;  5D81 A;  2F99 A;  3GZX B;  2OTJ 3;  1RSN A;  4AEQ A;  2KF4 A;  5G1K A;  4XDW A;  3T0U A;  3EC9 A;  1ULI B;  3T8U A;  5HOH A;  3DZL A;  2RBI A;  3CCV 3;  1B2X A;  1U5O A;  2WGQ A;  2XEP A;  6GSP A;  3ROB A;  5IF6 A;  1QMA A;  3MG1 A;  2STD A;  4XB5 A;  4HKV B;  2B24 B;  1RGK A;  4G1M B;  4R1K A;  1CQS A;  4CCV A;  1BUQ A;  1IQX A;  4HJL B;  3U97 A;  1IQ8 A;  1OGX A;  5KP3 A;  1FUS A;  4KT3 B;  2IMJ A;  3K0Z A;  4WP5 A;  1G0T A;  5FGO A;  3KSP A;  1FA3 A;  5LC6 A;  3JUM A;  2BHM A;  1BRH A;  1S72 3;  1C54 A;  1C7H A;  3LZA A;  1TFK A;  2L1S A;  1FGQ A;  2YFJ B;  4OK0 A;  4R9L A;  1B2S A;  1Q7H A;  3O8Y A;  1BSC A;  3NQZ A;  2W0Q A;  2BMO B;  5TGN A;  1V57 A;  3EB8 A;  4L8P A;  4BIR A;  5D83 A;  1UCI A;  1UI7 A;  4HM1 B;  1GMQ A;  1YJW 3;  2GXF A;  3EN8 A;  3UL6 A;  1UI8 A;  5BIR A;  1K9M 4;  1WNH A;  2W03 A;  2H0G A;  1TTO A;  2CIU A;  1JJ2 2;  3FG4 A;  2XSH B;  2GU1 A;  3QRD A;  1WQL B;  4FMB A;  3Q1C A;  1VQ5 3;  1Q82 4;  3CNX A;  1IT8 A;  3CPO A;  1DMM A;  1Y4K A;  7STD A;  4KFD A;  4AKZ A;  5RNT A;  2CWV A;  1NWW A;  1M90 4;  1FGO A;  1GMP A;  1GD4 A;  1B2Z A;  1UCK A;  3MG3 A;  1JNQ A;  3D5I A;  3S67 A;  2KXG A;  4O2H A;  3RDE A;  1VQN 3;  2YX9 A;  3X3Y A;  1YI2 3;  1GS3 A;  1ASK A;  1GY5 A;  3N8B A;  1MWT A;  4H3U A;  5AYR B;  2XR8 B;  4JRF A;  3STD A;  2P05 A;  1GYB A;  3ZG0 A;  2CX1 A;  4K1V A;  2E2U A;  1YVB I;  3IMA B;  3F40 A;  4EXR A;  3EE1 A;  5ELU A;  1SII A;  5KP4 A;  1EUI C;  2HML B;  3F7S A;  2W56 A;  1VQK 3;  2K3D A;  4WYK A;  5G1L A;  3G4S 3;  3ALA A;  2F4Y A;  3KE7 A;  3D3L A;  4IT7 A;  3N54 B;  1JKG A;  8CHO A;  3EF8 A;  1N8Q A;  5AIF A;  3ZG5 A;  3MPH A;  5M1A A;  1W4N A;  3VF1 A;  2XGL A;  3CC2 3;  1W6G A;  4XBX A;  3LYG A;  5AIH A;  2RSX A;  3MSO A;  5EVH A;  2PNC A;  1STF I;  1RGC A;  1M9G A;  2C10 A;  2O9U X;  1I2F A;  2RFR A;  2L4V A;  2WOH A;  3OWY A;  5GSP A;  1I0X A;  1B27 A;  1QAF A;  3ZFZ A;  3SED A;  4AKY A;  4X2O A;  2V1L A;  5IG0 A;  1RHL A;  1A2V A;  4FMD A;  1QVF 2;  1AV4 A;  2ZDJ A;  1N9E A;  3WDG B;  3QK9 A;  1V58 A;  1JB5 A;  3AHW A;  2P0X A;  4N6L A;  1J2B A;  1FGM A;  1BRK A;  1A67 A;  1RCL A;  1RRL A;  1I3I A;  2F5W A;  2KAA A;  2SBL A;  1YNV X;  3BNB A;  4MMX B;  2QEX 3;  4N6O B;  3GWR A;  4EW5 A;  1RNT A;  1CYV A;  1LOY A;  3DM8 A;  3EJV A;  1GD3 A;  3FCS B;  3AHS A;  2GSP A;  3JVC A;  1ZS7 A;  3X3X A;  4EV5 A;  1RGG A;  3G8Z A;  3IJE B;  2CX0 A;  3DMC A;  2CC3 A;  4N6U A;  2Z6B A;  5DRE A;  2P09 A;  3G0K A;  5AII A;  3UB1 A;  3LTD A;  1NB3 I;  1PY3 A;  3DGO A;  3X42 A;  2K0M A;  1MGW A;  1M1X B;  3L0R A;  2HMK B;  3HII A;  1VQ8 3;  2CG1 A;  1LQM B;  1BU4 A;  1E3V A;  4RNZ A;  2CWU A;  2WGO A;  3FF0 A;  1VQQ A;  3KZT A;  3WMD A;  1BSE A;  1KC8 4;  1CH0 A;  1E97 A;  2I9W A;  1TP6 A;  2UX0 A;  3LT8 A;  3CNM A;  5BVB A;  2CFK A;  2GEX A;  5IEO A;  1SIH A;  1UGH I;  3NQY A;  3PXM A;  1O7H B;  3CMA 3;  3HZP A;  4KZ1 A;  2Y73 A;  4HM7 B;  3CC4 3;  2Z77 A;  2XRX B;  4PEJ A;  1SQW A;  3NM2 A;  4WHA A;  3AMO A;  1EQK A;  2H0I A;  3NV0 A;  1BNJ A;  3NBR A;  1Q40 B;  1R4Y A;  2KF6 A;  2F56 A;  1OF5 A;  1JB2 A;  1IVV A;  1A2P A;  1LNI A;  3K63 A;  1DVC A;  3NBB A;  2W9Q A;  1Q9E A;  1ZGX A;  1AQZ A;  1EKM A;  5FW5 A;  4RNT A;  1FZU A;  1RN7 A;  3URP A;  5M19 A;  4N6V 0;  1UUG B;  1JN5 B;  3KSE D;  1VQ4 3;  1BGS A;  1HZ1 A;  2INX A;  3J7Y d;  3G16 A;  3LH4 A;  3PCS A;  3HOH A;  4QWT A;  2CFW A;  4N6N B;  5CF1 A;  1ZO2 A;  2JDI H;  1TFO A;  3Q90 A;  1UW1 A;  2W6J H;  1O7G B;  3F14 A;  4FCM A;  1YGE A;  3CD6 3;  4GHO A;  5AIG A;  1ISK A;  1BNS A;  3E99 A;  1QAK A;  3KFQ C;  1SJW A;  3FSD A;  3F9S A;  4RNY A;  1KQS 2;  4X2H A;  1YGW A;  3S29 A;  5IW9 A;  3IPT A;  2ZL8 A;  3PYJ A;  1X1W A;  1IVX A;  1PFP A;  3SOA A;  1HKX A;  4J5G A;  1W7C A;  4MJD A;  1I0V A;  4IIA A;  4LEH A;  4HM5 B;  4N6T A;  5JBS A;  4HM0 B;  1IVU A;  2CK3 H;  1OH0 A;  3LXU X;  1N5H A;  1I8V A;  3PS8 A;  5KP1 A;  1B2U A;  3BB9 A;  3OV4 A;  2Z7A A;  1CYU A;  2OCT A;  3BND A;  4BTX A;  5CLK A;  4XBT A;  4EC6 A;  3NM7 A;  2OOV A;  5EEO A;  2CH9 A;  3H51 A;  1DMQ A;  4HM3 B;  1Q42 A;  1Q86 4;  1FUW A;  2ML6 A;  3GSP A;  2QGU A;  3D5G A;  2KF3 A;  1JBT A;  3X41 A;  1RDS A;  3Q3F A;  1BIR A;  3AGO A;  2UGI A;  3WHO A;  5AI1 A;  1BVI A;  5STD A;  2OQE A;  3LTB A;  3S5C A;  1W2Z A;  3MWZ A;  4FCJ A;  4RZM A;  4OUQ A;  2P0M A;  4CPK A;  4HZB B;  1GOV A;  2Q07 A;  1D6U A;  1DE3 A;  1QVG 2;  3MHE A;  3OX9 A;  2Y74 A;  2SAR A;  2MF7 A;  1LXE A;  1CEW I;  3NXJ A;  2XFS A;  1LRA A;  4GSP A;  1BSB A;  2P38 A;  2XH9 A;  4LGQ A;  1B3S A;  1JV2 B;  4O3V A;  2YFL B;  4HVN A;  1T3B A; 
#chains in the Genus database with same CATH homology
 1OGZ A;  1QAL A;  4HZ9 B;  3CCL 3;  3UNL A;  2HMJ B;  1U8C B;  3WA3 A;  1N8R 4;  1O7W B;  4NRE A;  3GZY B;  2W56 B;  3OW2 2;  3JUQ A;  5A0O B;  4WYK B;  1RKY A;  2CW9 A;  5IER A;  3LOY A;  3PCR A;  2E2V A;  1JKG B;  3G6E 3;  4LZI A;  3CPW 2;  3B4P A;  5DRV A;  4LMI A;  3CCR 3;  2B1X B;  1OHO A;  4HM4 B;  4J9A A;  4O02 B;  3SVA A;  1DYU A;  4HM2 B;  5HGR A;  1EG9 B;  3NUV A;  4CDL A;  1O7P B;  3KKG A;  3S28 A;  1PU4 A;  2XGN A;  1YJ9 3;  3JUN A;  3V99 A;  1OUN A;  1Q81 4;  3N9H A;  2XFT A;  2F86 B;  4EBG A;  1ROA A;  2ML5 A;  5JPP A;  1DVD A;  1O7N B;  3DGM A;  4TX4 A;  5ELJ A;  3V98 A;  3EN1 B;  3SXX A;  2W9P A;  3WA2 X;  3CCQ 3;  3FGY A;  3F8H A;  2K54 A;  3CCS 3;  2Z76 A;  3NHX A;  2R4I A;  1UUW B;  1ROV A;  1Z1S A;  3LTA A;  1YJN 3;  3GRD A;  3TDG A;  3FKA A;  1TIJ A;  2OOV C;  3VSY A;  1LOX A;  1NO3 A;  2QA4 3;  3PZW A;  1TUH A;  3FH1 A;  1LVN A;  2CHC A;  2W2C A;  2OQE C;  1OAC A;  6STD A;  1W01 A;  3HX8 A;  5CXO A;  3FLJ A;  3M8C A;  2D42 A;  1AVK A;  2FGT A;  3ECF A;  4XDV A;  3K9M C;  4R80 A;  3EBT A;  4ZM8 A;  4H61 A;  1OHP A;  5IEN A;  1NDO B;  1WTH A;  2CFL A;  4GL6 A;  3LTC A;  5AEW B;  1WMN A;  1IDP A;  2YFI B;  4MMZ B;  1HU9 A;  3ER7 A;  2M7O A;  4O8S A;  1YIT 3;  2CKF B;  3BNE A;  3AMO B;  4U13 A;  3NV0 B;  2WO0 A;  3UJM A;  5IEP A;  1O7M B;  3GZB A;  1OF5 B;  3Q2P A;  1IU7 A;  2RCD A;  4Q53 A;  2BMQ B;  5I97 A;  1STD A;  4FMA A;  3BLZ A;  5AEU B;  3HK4 A;  3KN4 A;  1GY6 A;  2BT3 A;  2BO9 B;  1N9J A;  4R9K A;  5AYS C;  4N3V A;  1WMO A;  3RGR A;  1JB4 A;  1RRH A;  1SPU A;  3I55 3;  1W5Z A;  2GU3 A;  2W04 A;  3EX9 A;  2FNQ A;  3MYT A;  2GBW B;  4KVH A;  3A76 A;  3MKI A;  3F7X A;  2MC8 A;  1VQL 3;  1IK3 A;  2HMN B;  4XBY A;  3S27 A;  3FG1 A;  3GZR A;  1IV9 A;  2E2T A;  1E3R A;  4WWU C;  1D6Z A;  2GBX B;  1AR0 A;  4HM8 B;  5CF2 A;  2F98 A;  4K1U A;  3EHC A;  1S5A A;  1ZX2 A;  3V92 A;  4FMC A;  5LC7 A;  1US1 A;  4L8O A;  3NBJ A;  4FR9 A;  5D82 A;  1IV7 A;  3WOF B;  1YHQ 3;  2JQ5 A;  4GB5 A;  1WMP A;  1W00 A;  4LSO A;  1JRQ A;  5JPU A;  1MOL A;  3VGN A;  1F8N A;  2FXT A;  3HIG A;  3OXA A;  3SOY A;  1A2K A;  2RGQ A;  3EQQ B;  5EQL A;  1ULJ B;  4L7K A;  2KRT A;  2IUJ A;  3X3Z A;  1V74 A;  2PZV A;  3FF2 A;  1T5Y A;  2BMR B;  2HMO B;  1KD1 4;  2CFD A;  3K7C A;  2HMM B;  3SLU A;  1W02 A;  1FGR A;  4STD A;  4EV2 A;  4HYZ A;  1GY7 A;  2CFG A;  1KSI A;  3B4O A;  3WOE B;  2CWT A;  1OPY A;  3SX1 A;  3CCE 3;  3KII A;  3OWS A;  4HM6 B;  1NJI 4;  4FCZ A;  1QJG A;  3NX0 A;  2D1W A;  1VQ6 3;  3OWU A;  2GEY A;  2KCD A;  1VQ7 3;  4EYC A;  2WOF A;  2IUK A;  3HI7 A;  2IA7 A;  4ORL A;  5IG5 A;  3PGB A;  2CG0 A;  5CK6 A;  1K8A 4;  1K28 A;  2O3O A;  1UUV B;  1K73 4;  4K61 A;  4XM4 A;  3DGL A;  4I4K A;  3X40 A;  4BTW A;  3T8N A;  3CC7 3;  1KWI A;  3FG3 A;  3RGA A;  4BTY A;  4WFO A;  3G71 3;  1FGT A;  2QIY A;  2OWP A;  3EBY A;  1NB5 I;  1DMN A;  4J8T A;  1OCV A;  1OHS A;  2LQV A;  4HBR A;  1LNH A;  4N6M A;  5BXQ A;  1YIJ 3;  2XSO B;  3B7C A;  1M1K 4;  1W6Y A;  3LT9 A;  1EA2 A;  1NU3 A;  5IG3 A;  1TU5 A;  4OVM A;  3D9R A;  1W6C A;  3CME 3;  3F8X A;  1A90 A;  3B8L A;  1D6Y A;  3JUP A;  1VQO 3;  1W2B 2;  3DGN A;  4JF8 A;  1G96 A;  1N5P A;  1MNL A;  1Q7Y 4;  4MEI A;  2LYX A;  1K41 A;  2A15 A;  1AVL A;  4R4K A;  4K90 B;  3U1W A;  3DY5 A;  4KFE A;  3DXO A;  3CCM 3;  3FZW A;  3CCJ 3;  2C11 A;  3BNC A;  3I56 3;  3UL5 A;  3MG2 A;  1VZZ A;  1RJO A;  3CXC 2;  1IQY A;  1IT7 A;  1Q40 A;  1IVW A;  4NHF A;  1R4C A;  2BNG A;  3GAX A;  3I0Y A;  3JUO A;  5IG4 A;  3H3H A;  4RBN A;  4IPB A;  3CCU 3;  4MMY B;  3CU3 A;  1L5G B;  5G2G A;  1JN5 A;  4KFF A;  1VQM 3;  3DUK A;  2XF3 A;  3WOD G;  2OTL 3;  3K5T A;  5D81 A;  2F99 A;  3GZX B;  2OTJ 3;  4AEQ A;  4XDW A;  3T0U A;  3EC9 A;  1ULI B;  3T8U A;  3DZL A;  3CCV 3;  1U5O A;  2WGQ A;  2XEP A;  3ROB A;  5IF6 A;  1QMA A;  3MG1 A;  2STD A;  4XB5 A;  4HKV B;  2B24 B;  4R1K A;  4G1M B;  3WMD A;  1CQS A;  4CCV A;  1BUQ A;  1IQX A;  4HJL B;  3U97 A;  1IQ8 A;  1OGX A;  5KP3 A;  2IMJ A;  3K0Z A;  4WP5 A;  5FGO A;  3KSP A;  1FA3 A;  5LC6 A;  3JUM A;  2BHM A;  1S72 3;  1C7H A;  3LZA A;  1TFK A;  2YFJ B;  1FGQ A;  4OK0 A;  4R9L A;  3O8Y A;  3NQZ A;  2W0Q A;  2BMO B;  5TGN A;  3EB8 A;  4L8P A;  5D83 A;  1UI7 A;  4HM1 B;  1YJW 3;  2GXF A;  3EN8 A;  3UL6 A;  1UI8 A;  1K9M 4;  1WNH A;  2W03 A;  2CIU A;  1JJ2 2;  3FG4 A;  2XSH B;  2GU1 A;  3QRD A;  1WQL B;  4FMB A;  3Q1C A;  1VQ5 3;  1Q82 4;  3CNX A;  1IT8 A;  3CPO A;  1DMM A;  1Y4K A;  7STD A;  4KFD A;  4AKZ A;  2CWV A;  1NWW A;  1M90 4;  1FGO A;  1GD4 A;  3MG3 A;  1JNQ A;  3S67 A;  2KXG A;  4O2H A;  3RDE A;  1VQN 3;  2YX9 A;  3X3Y A;  1YI2 3;  1GS3 A;  1ASK A;  1GY5 A;  3N8B A;  4H3U A;  5AYR B;  2XR8 B;  4JRF A;  3STD A;  2P05 A;  1GYB A;  4K1V A;  2E2U A;  1YVB I;  3IMA B;  3F40 A;  4EXR A;  3EE1 A;  5ELU A;  1SII A;  5KP4 A;  2HML B;  3F7S A;  2W56 A;  1VQK 3;  4WYK A;  3G4S 3;  3ALA A;  3KE7 A;  3D3L A;  4IT7 A;  3N54 B;  1JKG A;  8CHO A;  3EF8 A;  1N8Q A;  5AIF A;  3MPH A;  1W4N A;  3VF1 A;  2XGL A;  3CC2 3;  1W6G A;  4XBX A;  3LYG A;  5AIH A;  2RSX A;  3MSO A;  5EVH A;  2PNC A;  1STF I;  1VQ9 3;  1M9G A;  2C10 A;  2O9U X;  2RFR A;  2WOH A;  2L4V A;  1VQP 3;  3OWY A;  1QAF A;  3SED A;  4AKY A;  4X2O A;  2V1L A;  5IG0 A;  1A2V A;  4FMD A;  1QVF 2;  1AV4 A;  2ZDJ A;  1N9E A;  3WDG B;  3QK9 A;  1JB5 A;  4N6L A;  2P0X A;  1J2B A;  1FGM A;  1A67 A;  1RRL A;  2SBL A;  4MMX B;  2QEX 3;  3BNB A;  4N6O B;  3GWR A;  3DM8 A;  1CYV A;  3EJV A;  3FCS B;  3JVC A;  1GD3 A;  3LML A;  3X3X A;  4EV5 A;  3G8Z A;  3IJE B;  3DMC A;  2CC3 A;  4N6U A;  2Z6B A;  5DRE A;  2P09 A;  3G0K A;  5AII A;  3UB1 A;  3LTD A;  1NB3 I;  3DGO A;  3X42 A;  2K0M A;  1VQ8 3;  1M1X B;  3L0R A;  2HMK B;  3HII A;  2CG1 A;  1E3V A;  4RNZ A;  2CWU A;  2WGO A;  3FF0 A;  3KZT A;  1KC8 4;  1E97 A;  2I9W A;  1TP6 A;  2UX0 A;  3LT8 A;  3CNM A;  5BVB A;  2CFK A;  2GEX A;  5IEO A;  1SIH A;  3NQY A;  3PXM A;  1O7H B;  3CMA 3;  3HZP A;  4KZ1 A;  2Y73 A;  4HM7 B;  3CC4 3;  2Z77 A;  2XRX B;  4PEJ A;  1SQW A;  3NM2 A;  4WHA A;  3AMO A;  1EQK A;  3NV0 A;  3NBR A;  1Q40 B;  1OF5 A;  1JB2 A;  1IVV A;  3K63 A;  1DVC A;  3NBB A;  2W9Q A;  5FW5 A;  1EKM A;  1RN7 A;  4N6V 0;  1JN5 B;  3KSE D;  1VQ4 3;  2INX A;  3J7Y d;  3G16 A;  3LH4 A;  3PCS A;  4QWT A;  2CFW A;  4N6N B;  5CF1 A;  1ZO2 A;  2JDI H;  1TFO A;  3Q90 A;  1UW1 A;  2W6J H;  1O7G B;  3F14 A;  4FCM A;  1YGE A;  3CD6 3;  1ISK A;  5AIG A;  3E99 A;  1QAK A;  3KFQ C;  1SJW A;  3FSD A;  3F9S A;  4RNY A;  1KQS 2;  4X2H A;  3S29 A;  5IW9 A;  3IPT A;  2ZL8 A;  3PYJ A;  1IVX A;  1PFP A;  3SOA A;  1HKX A;  1W7C A;  4MJD A;  5JBS A;  4IIA A;  4LEH A;  4HM5 B;  4N6T A;  4HM0 B;  1IVU A;  2CK3 H;  1OH0 A;  3LXU X;  1N5H A;  3PS8 A;  5KP1 A;  3BB9 A;  3OV4 A;  2Z7A A;  1CYU A;  2OCT A;  3BND A;  4BTX A;  5CLK A;  4XBT A;  4EC6 A;  3NM7 A;  2OOV A;  5EEO A;  2CH9 A;  3H51 A;  1DMQ A;  4HM3 B;  1Q42 A;  1Q86 4;  1FUW A;  2ML6 A;  2QGU A;  3X41 A;  5AI1 A;  5STD A;  2OQE A;  3LTB A;  3S5C A;  1W2Z A;  3MWZ A;  4FCJ A;  4RZM A;  4OUQ A;  2P0M A;  4HZB B;  2Q07 A;  1D6U A;  1QVG 2;  3MHE A;  3OX9 A;  2Y74 A;  2MF7 A;  1LXE A;  1CEW I;  3NXJ A;  2XFS A;  2P38 A;  2XH9 A;  4LGQ A;  1JV2 B;  4O3V A;  2YFL B;  4HVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...