1ROAA

Structure of human cystatin d
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
GGIHATDLNDKSVQRALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin D
publication title Crystal structure of human cystatin D, a cysteine peptidase inhibitor with restricted inhibition profile.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1roaA00
4EYCA 3KSED 5LC7A 3UL6A 1N9JA 4TX4A 3MWZA 1MNLA 1FA3A 4N6V0 1DVDA 2BO9B 5ELUA 4N6LA 4N6NB 4IT7A 4CCVA 1CYUA 3GAXA 1LXEA 1N5HA 1WNHA 2W9QA 5EQLA 1GD4A 4N6MA 3SVAA 1NB3I 3UL5A 1TIJA 1N5PA 4LZIA 1M9GA 1MOLA 1STFI 1ROAA 1NB5I 1A67A 1GD3A 1CYVA 1FUWA 1YVBI 1A90A 2CH9A 1G96A 3Q2PA 1IV9A 4N6OB 1DVCA 3NX0A 4ZM8A 1R4CA 2OCTA 3KFQC 3PS8A 3QRDA 2O9UX 3PYJA 4N6UA 1EQKA 3L0RA 3PXMA 5LC6A 1IV7A 3K9MC 4N6TA 5A0OB 5ELJA 2W9PA 3LH4A 3S67A 1CEWI 1PFPA 2KXGA 1RN7A 3IMAB 1KWIA
chains in the Genus database with same CATH superfamily
1DETA 1QJGA 1SJWA 4EYCA 4RZMA 4XBXA 1BNRA 1VQ73 1N9JA 3WR2A 4NHFA 4O2HA 1BNGA 3JUPA 1HU9A 1T2IA 1D6YA 3FLJA 1BUJA 4HKVB 4R9KA 3K63A 3NM2A 3NV0A 5AIGA 4R9LA 1MNLA 2FXTA 2HMOB 5DRVA 1LVNA 4FR9A 2E2TA 1IVUA 4FMDA 3NBJA 3HX8A 2W6JH 5AYRB 1GMRA 2BO9B 3LYGA 5ELUA 4EV5A 2YFLB 2IUJA 1BSBA 4HJLB 1QAFA 3WA3A 3KE7A 2H0IA 3MG2A 4L7KA 1QVG2 1BRJA 3G16A 6STDA 4HM0B 4IT7A 2RNTA 3GAXA 1Z1SA 5EQLA 4HM8B 1B20A 1Q7Y4 1I3FA 1B2SA 1FGTA 2XF3A 2B1XB 1OF5B 3BB9A 3SVAA 1NB3I 2K54A 3Q3FA 1ASKA 1G0TA 3D5GA 2A15A 2E2VA 3FH1A 5IEOA 2P0XA 2OOVA 2CX1A 3CD63 3EX9A 2GXFA 4KFDA 1F8NA 3WHOA 7STDA 1AY7A 2WGOA 2GEXA 2W04A 1O7GB 1STFI 2F99A 2RBIA 3AMOB 1AQZA 2F86B 1E3RA 2F98A 1ROAA 1SQWA 1X1YA 3LXUX 3NXJA 2XFTA 1ZGXA 4WWUC 5IERA 1RLSA 1V74A 3O8YA 1BRSA 3EJVA 3RGRA 3K7CA 1RGLA 3WODG 5CF2A 4IIAA 1NWWA 3JUQA 3EBYA 3URPA 4H61A 1L5GB 3D9RA 1RJOA 1K8A4 4GSPA 1GS3A 3AHSA 1FUWA 2GEYA 1GOUA 1VQ43 1BNEA 2CH9A 3FG1A 1G96A 2F5MA 3EE1A 5AIFA 1NDOB 2E2UA 1LOWA 2XEPA 4X2HA 1IQ8A 3CCE3 3Q2PA 1IV9A 3B8LA 1I0VA 3PZWA 3GWRA 2GBWB 3EB8A 4AKZA 5BIRA 3GZXB 1SPUA 1OF5A 1E97A 3EQQB 3M8CA 4FCZA 1R4CA 2OCTA 3KFQC 1U8CB 3PS8A 3LT9A 3QRDA 8CHOA 3DXOA 9RNTA 1EA2A 1ISKA 3PYJA 2INXA 3JUOA 2RGQA 4ORLA 4CJNA 1JKGB 4K1UA 2RCDA 3V98A 4BTYA 1YJW3 3MYTA 4WHAA 1JB4A 3L0RA 2OTJ3 1N8QA 1Y4KA 1HKXA 1WQLB 3N9HA 3AMOA 2QEX3 2AAEA 3H51A 1JN5B 4GL6A 4J5GA 3OV4A 1W7CA 2Q07A 3I553 2W56A 3GRDA 4XDVA 3U1WA 1V57A 4XBYA 1VQK3 3DUKA 2C11A 3NHXA 1O7HB 4H3UA 2ZA4A 4BU4A 1OHSA 1IVXA 4GHOA 1VQM3 4LMIA 1I2EA 3S67A 3NBRA 1BIRA 4HM3B 2CWUA 1O7WB 4KVHA 1Q9EA 1K734 5IEPA 3D3LA 3NV0B 5IG0A 4HM7B 3KSED 3DY5A 2SARA 5LC7A 4HM6B 3U97A 3UL6A 3K5TA 4HYZA 4EV2A 2KF3A 3NBBA 1UDII 4LSOA 1YVSA 3SX1A 3GZYB 2OOVC 1BAOA 1EKMA 3STDA 3X3XA 1C54A 1N9EA 4AKYA 1YNVX 2P0MA 3MWZA 3UJMA 1JNQA 3CME3 3ZFZA 1FYSA 1I3IA 1YGEA 4HM2B 4XBTA 3CXC2 1D6UA 3J7Yd 1CH0A 1VQO3 4N6V0 1RGGA 1DVDA 3V92A 3VSYA 1SIIA 6RNTA 1B2UA 4LGQA 3CMA3 3DZLA 4GB5A 2OWPA 4MEIA 4N6LA 1LNIA 1S723 1MWRA 1RSNA 2CKFB 2CFKA 3D5IA 3SOYA 1WMNA 2R4IA 4BTXA 2WOFA 1SIHA 2BNGA 1DE3A 1RTUA 2I9WA 1CYUA 3KSPA 1N5HA 2MF7A 4J9AA 2GBXB 2IUKA 3DGYA 2Z7AA 3K0ZA 2XSOB 1S5AA 1K28A 4N6MA 1G02A 1FUSA 2ZL8A 1IT7A 1OHOA 4JF8A 3UL5A 4RNZA 5STDA 1FGRA 1B21A 2STDA 3G6E3 2P05A 1N5PA 4FMCA 1STDA 1OPYA 1UGIA 4K1VA 1IQYA 3G0KA 5TGNA 1GYBA 1EG9B 4MMZB 3EHCA 1BOXA 1M9GA 3KN4A 3SEDA 4XM4A 5JPPA 1BRIA 3G4S3 1YHQ3 1W6GA 4R1KA 5RNTA 5IENA 1A2KA 1DMNA 3E99A 1N8R4 5DREA 2Z77A 1BRNL 3LTBA 1UCIA 1PU4A 3OW22 3PGBA 1GD3A 5JBSA 2CG0A 1CYVA 4O8SA 3CC73 1BNFA 2F56A 3T0UA 1JJ22 1RDSA 2CHCA 5EEOA 1IYYA 3NQYA 1W2ZA 2IYJA 3VGNA 1VZZA 1BANA 5BXQA 4EBGA 3EN8A 3FKAA 2RSXA 5FGOA 2H0HA 3DM8A 5BU4A 3GSPA 1UGHI 4K61A 1QAKA 1LQMB 2P38A 1DVCA 2YFJB 3BNBA 3GZRA 3CCQ3 4XB5A 1JZOA 1TFOA 4BTWA 1UI8A 3NX0A 4ZM8A 8RNTA 4BL2A 5IG3A 3X3ZA 2QIYA 1IK3A 3FF2A 1UCJA 4CPKA 1Q814 1BNIA 2FNQA 4EW5A 3CPOA 5CF1A 1NNVA 2W56B 2QGUA 1VQN3 3UNLA 4FMAA 5CK6A 1TFKA 4HZ9B 3JVCA 4O3VA 4OK0A 1W6YA 3WA2X 3CC43 3LZAA 4BL3A 4N6TA 1JRQA 1I70A 1T2HA 1W01A 1YJN3 1BSAA 2Y74A 4I4KA 3ROBA 1VQP3 1UI7A 1EUIC 4L8PA 1RHLA 2CK3H 2L1SA 2CX0A 2W9PA 3LH4A 2XRXB 3IJEB 1BRGA 3OWYA 2XGLA 1E3VA 3NUVA 3FGYA 2W03A 3EC9A 1PFPA 4QWTA 4WYKA 5G1KA 2XGNA 1W2B2 1IQXA 2GSPA 3H3HA 3RDEA 2R41A 3IMAB 3G713 1TJDA 1RCKA 3FCSB 1Q864 2YFIB 5KP3A 2WO0A 3F7SA 5BVBA 4J5KA 2Y73A 1W6CA 2M7OA 3BNDA 1D6ZA 1RRLA 3S28A 3LT8A 1Q7HA 3VF1A 3Q90A 4FMBA 2QA43 5JPUA 3CCV3 2YX9A 3QK9A 1AV4A 2JQ5A 4FCMA 3BU4A 1LOXA 1RGHA 1AVLA 3FG4A 1FA3A 3SXXA 1RMSA 2ML6A 3SYUA 5D83A 1RNTA 3ZG0A 1W02A 3NM7A 1GOVA 3WOFB 1VQ53 1IDPA 4KFFA 1UCKA 1IVVA 2ML5A 3SLUA 1O7NB 3D4AA 4N6NB 1T5YA 3X41A 2KF6A 2JDIH 1LXEA 4J8TA 3JUMA 1YJ93 5AEWB 2B24B 4JRFA 3KIIA 2KCDA 1RN4A 1A2PA 1TRQA 3HK4A 1BSDA 1T3BA 1NO3A 4HVNA 3F14A 7GSPA 1CQSA 3GZBA 5IW9A 1JV2B 4Q53A 2GU1A 3MSOA 1TIJA 3MG1A 1YI23 1VQ63 1MWTA 1WTHA 3UB1A 1JB5A 1Q824 1ROVA 3MPHA 2O3OA 1VQ83 1FZUA 2BIRA 1MOLA 4PEJA 1R4YA 1QALA 2F5WA 2Z6BA 5M18A 4MMXB 4LEHA 4OUQA 1AVKA 5M1AA 3WDGB 1HZ1A 3ECFA 3OWSA 5IG4A 1QVF2 1BRKA 3WOEB 4MJDA 3RNTA 5CLKA 3CPW2 3NQZA 3F9SA 3T8NA 5M19A 1A67A 3KCHA 1IT8A 2D1WA 1NJI4 2GU3A 3LOYA 3PCSA 1ZX2A 1YVBI 1GY5A 1M1XB 7RNTA 3FSDA 1MWSA 3D79A 3DH2A 4N3VA 1YIJ3 1FGMA 3ZG5A 4HAAA 3N54B 2WOHA 3SOAA 3A76A 1FGOA 1K41A 1UUWB 4N6OB 2BT3A 1RGAA 3CCJ3 3ER7A 1MGWA 2BHMA 1MWUA 5AI1A 1VQQA 1BVIA 1RGFA 1B2XA 1BU4A 2CWTA 3EF8A 1BUQA 2HMLB 3MHEA 2XR8B 2L4VA 1IVWA 4N6UA 5CXOA 3I563 1I2FA 2UGIA 3PXMA 2W0QA 3AGNA 2P09A 1UCLA 3V99A 4RNYA 1YGWA 2F4YA 5LC6A 2UX0A 1ULIB 3X42A 3HZPA 4KT3B 3EN1B 3X3YA 1RGEA 1B2MA 4XDWA 3K9MC 1GMQA 4U13A 1J2BA 2C10A 4WYKB 1RCLA 1I0XA 5IF6A 4NPBA 1OACA 2D42A 5G2GA 2H0GA 2PZVA 5ELJA 5KP4A 1BSCA 5D82A 1BRHA 1YIT3 4HOHA 2BU4A 5GSPA 2ZDJA 1RGCA 1BNJA 2CFLA 3CCR3 2C4BA 1CEWI 1W4NA 2KXGA 1OGZA 1UW1A 1FW7A 1O7MB 1LOYA 1RKYA 3CNMA 2CIUA 2HMJB 3KKGA 2KRTA 3LTCA 2IA7A 3DGNA 2Z76A 1Q40A 1B2ZA 3RGAA 1JBTA 4TX4A 1OHPA 4HM4B 3OXAA 4K90B 5EVHA 1TTOA 4L8OA 1LQGC 1TUHA 3S5CA 4O02B 4X2OA 3FZWA 1B3SA 2IY2A 1VQL3 1JBRA 1PY3A 3HOHA 5I97A 3DGMA 3MG3A 4HZBB 4R80A 2WGQA 1BGSA 1DMMA 1GOYA 1LRAA 2J8XB 5AYSC 2CWVA 2HMKB 4NREA 1NU3A 1Q42A 2OQEC 5AIHA 3HIGA 1M1K4 3CCM3 4WP5A 4WFOA 4CCVA 1B27A 2HMNB 1WNHA 1RN1A 2W9QA 2XSHB 3BNCA 3DMCA 4LYLB 4BIRA 1A2VA 1C7HA 3I0YA 4AEQA 5IG5A 1GD4A 3EBTA 1U5OA 2CG1A 3T8UA 1SARA 2KAAA 2LQVA 1V58A 4HM1B 3TDGA 1W5ZA 3DGOA 3KZTA 4HBRA 1OH0A 3CCL3 1OCVA 3S29A 1OUNA 4LZIA 2ZHXB 4MMYB 1FGQA 1O7PB 4STDA 3BIRA 1GSPA 1UUGB 1VQ93 3CU3A 3F40A 1TRPA 5HOHA 2PNCA 1PYLA 1HYFA 1BSEA 3FG3A 1KD14 2KF4A 4DKIA 3CNXA 1MGRA 3ALAA 1X1WA 2RFRA 6GSPA 1AR0A 3X40A 1W00A 2XFSA 1EQKA 1NB5I 2HMMB 3LMLA 2MC8A 1RNBA 1JB2A 1M904 3B4PA 2IMJA 2KF5A 1LNHA 1FUTA 3JUNA 5AEUB 2FGTA 1GY7A 2K3DA 1KSIA 3PCRA 1A90A 5AIIA 3FF0A 5G1LA 3F8XA 3WMDA 1KC84 3A5EA 3LTDA 5FW5A 3CCU3 1K9M4 1JZDA 1DMQA 1ULJB 3G8ZA 1X1XA 3Q1CA 4IPBA 2BMOB 1UUVB 4HM5B 4EC6A 1I2GA 2CFGA 1RGKA 2O9UX 2UUGC 3B7CA 2BMQB 1TU5A 3CC23 1KQS2 2CC3A 3F8HA 2OTL3 1US1A 1WMPA 1GY6A 5D81A 1RRHA 3HIIA 2OQEA 4I5QA 3OWUA 3MKIA 1IU7A 1IV7A 1DYUA 3AHWA 3N8BA 3DGLA 1OGXA 3IPTA 2CW9A 3AGOA 3B4OA 3BNEA 4FCJA 4RBNA 1TP6A 1X1UA 3F7XA 2XH9A 1JKGA 3HI7A 4OVMA 3CCS3 4G1MB 2AADA 5HGRA 4R4KA 3S27A 2CFDA 5A0OB 2V1LA 1QMAA 1ZO2A 1I8VA 1ZS7A 2HOHA 2W2CA 3LTAA 2K0MA 1Q40B 4RNTA 3BLZA 4CDLA 1LOVA 1JN5A 4ILFA 2CFWA 4KZ1A 4EXRA 1WMOA 1EEJA 2BMRB 2SBLA 1RN7A 1BNSA 2LYXA 3OX9A 1GMPA 4KFEA 5KP1A 1JBSA 1KWIA
chains in the Genus database with same CATH topology
1QJGA 1SJWA 4EYCA 4RZMA 4XBXA 1VQ73 1N9JA 4NHFA 4O2HA 1HU9A 1D6YA 3FLJA 4HKVB 4R9KA 3K63A 3NM2A 3NV0A 5AIGA 4R9LA 1MNLA 2FXTA 2HMOB 5DRVA 1LVNA 4FR9A 2E2TA 1IVUA 4FMDA 3NBJA 3HX8A 2W6JH 5AYRB 2BO9B 3LYGA 5ELUA 4EV5A 2YFLB 2IUJA 4HJLB 1QAFA 3WA3A 3KE7A 3MG2A 4L7KA 1QVG2 3G16A 6STDA 4HM0B 4IT7A 3GAXA 1Z1SA 5EQLA 4HM8B 1Q7Y4 1FGTA 2XF3A 2B1XB 1OF5B 3BB9A 3SVAA 1NB3I 2K54A 1ASKA 2A15A 2E2VA 3FH1A 5IEOA 2P0XA 2OOVA 3CD63 3EX9A 2GXFA 4KFDA 1F8NA 7STDA 2WGOA 2GEXA 2W04A 1O7GB 1STFI 2F99A 3AMOB 2F86B 1E3RA 2F98A 1ROAA 1SQWA 3LXUX 3NXJA 2XFTA 4WWUC 5IERA 1V74A 3O8YA 3RGRA 3EJVA 3K7CA 3WODG 5CF2A 4IIAA 1NWWA 3JUQA 3EBYA 4H61A 1L5GB 3D9RA 1RJOA 1K8A4 1FUWA 1GS3A 2GEYA 1VQ43 2CH9A 3FG1A 1G96A 3EE1A 5AIFA 1NDOB 2E2UA 2XEPA 4X2HA 1IQ8A 3CCE3 3Q2PA 1IV9A 3B8LA 3PZWA 3GWRA 2GBWB 3EB8A 4AKZA 3GZXB 1SPUA 1OF5A 1E97A 3EQQB 3M8CA 4FCZA 1R4CA 2OCTA 3KFQC 1U8CB 3PS8A 3LT9A 3QRDA 8CHOA 3DXOA 1EA2A 1ISKA 3PYJA 2INXA 3JUOA 2RGQA 4ORLA 1YJW3 1JKGB 4K1UA 2RCDA 3V98A 4BTYA 1EQKA 3MYTA 4WHAA 1JB4A 3L0RA 2OTJ3 1N8QA 1Y4KA 1HKXA 1WQLB 3N9HA 3AMOA 2QEX3 3H51A 1JN5B 4GL6A 3OV4A 1W7CA 2Q07A 3I553 2W56A 3GRDA 4XDVA 3U1WA 4XBYA 1VQK3 3DUKA 2C11A 3NHXA 1O7HB 4H3UA 1OHSA 1IVXA 1VQM3 4LMIA 3S67A 3NBRA 4HM3B 2CWUA 1O7WB 4KVHA 1K734 5IEPA 3D3LA 3NV0B 5IG0A 4HM7B 3KSED 3DY5A 5LC7A 4HM6B 3U97A 3UL6A 3K5TA 4HYZA 4EV2A 3NBBA 4LSOA 3SX1A 3GZYB 2OOVC 3STDA 1EKMA 3X3XA 1N9EA 4AKYA 2P0MA 3MWZA 3UJMA 1JNQA 3CME3 1YGEA 4HM2B 4XBTA 3CXC2 1D6UA 3J7Yd 1VQO3 4N6V0 1DVDA 3V92A 3VSYA 1SIIA 4LGQA 3CMA3 3DZLA 4GB5A 2OWPA 4MEIA 4N6LA 1S723 2CKFB 2CFKA 3SOYA 1WMNA 2R4IA 4BTXA 2WOFA 1SIHA 2BNGA 2I9WA 1CYUA 3KSPA 1N5HA 2MF7A 4J9AA 2GBXB 2IUKA 2Z7AA 3K0ZA 2XSOB 1S5AA 1K28A 4N6MA 2ZL8A 1IT7A 1OHOA 4JF8A 3UL5A 4RNZA 5STDA 1FGRA 2STDA 3G6E3 2P05A 1N5PA 4FMCA 1STDA 1OPYA 4K1VA 1IQYA 3G0KA 5TGNA 1GYBA 1EG9B 4MMZB 3EHCA 1M9GA 3SEDA 3KN4A 5JPPA 4XM4A 3G4S3 1YHQ3 1W6GA 4R1KA 5IENA 1A2KA 1DMNA 3E99A 1N8R4 5DREA 2Z77A 3LTBA 1PU4A 3OW22 3PGBA 1GD3A 5JBSA 2CG0A 1CYVA 4O8SA 3CC73 1JJ22 3T0UA 2CHCA 5EEOA 3NQYA 1W2ZA 3VGNA 1VZZA 5BXQA 4EBGA 3EN8A 3FKAA 2RSXA 5FGOA 3DM8A 4K61A 1QAKA 2YFJB 2P38A 1DVCA 3BNBA 3GZRA 3CCQ3 4XB5A 1TFOA 4BTWA 1UI8A 3NX0A 4ZM8A 5IG3A 3X3ZA 2QIYA 1IK3A 3FF2A 1Q814 2FNQA 3CPOA 5CF1A 2W56B 1VQN3 2QGUA 3UNLA 4FMAA 5CK6A 1TFKA 4HZ9B 3JVCA 4O3VA 4OK0A 1W6YA 3WA2X 3CC43 3LZAA 4N6TA 1JRQA 1W01A 1YJN3 2Y74A 4I4KA 3ROBA 1VQP3 1UI7A 4L8PA 2CK3H 2W9PA 3LH4A 2XRXB 3IJEB 3OWYA 2XGLA 1E3VA 3NUVA 3FGYA 2W03A 3EC9A 1PFPA 4QWTA 4WYKA 2XGNA 1W2B2 1IQXA 3H3HA 3RDEA 3G713 3IMAB 3FCSB 1Q864 2YFIB 5KP3A 2WO0A 3F7SA 5BVBA 2Y73A 1W6CA 2M7OA 3BNDA 1D6ZA 1RRLA 3S28A 3LT8A 3VF1A 3Q90A 4FMBA 2QA43 5JPUA 3CCV3 2YX9A 3QK9A 1AV4A 2JQ5A 4FCMA 1LOXA 3FG4A 1AVLA 1FA3A 3SXXA 2ML6A 5D83A 1W02A 3NM7A 1VQ53 3WOFB 1IDPA 4KFFA 1IVVA 2ML5A 3SLUA 1O7NB 4N6NB 1T5YA 3X41A 2JDIH 1LXEA 4J8TA 3JUMA 1YJ93 5AEWB 2B24B 4JRFA 3KIIA 2KCDA 3HK4A 1NO3A 4HVNA 3F14A 1CQSA 3GZBA 5IW9A 1JV2B 4Q53A 2GU1A 3MSOA 1TIJA 3MG1A 1YI23 1VQ63 1WTHA 3UB1A 1JB5A 1Q824 1ROVA 3MPHA 2O3OA 1VQ83 1MOLA 4PEJA 1QALA 2Z6BA 4MMXB 4LEHA 4OUQA 1AVKA 3WDGB 5IG4A 3ECFA 3OWSA 1QVF2 3WOEB 4MJDA 5CLKA 3CPW2 3NQZA 3F9SA 3T8NA 1A67A 1IT8A 2D1WA 1NJI4 2GU3A 3LOYA 3PCSA 1ZX2A 1YVBI 1GY5A 1M1XB 3FSDA 4N3VA 1YIJ3 1FGMA 3N54B 2WOHA 3SOAA 3A76A 1FGOA 1K41A 1UUWB 4N6OB 2BT3A 3CCJ3 3ER7A 2BHMA 5AI1A 2CWTA 3EF8A 1BUQA 2HMLB 3MHEA 2XR8B 2L4VA 1IVWA 4N6UA 5CXOA 3I563 3PXMA 2W0QA 3V99A 2P09A 4RNYA 5LC6A 2UX0A 1ULIB 3X42A 3HZPA 3EN1B 3X3YA 4XDWA 3K9MC 4U13A 1J2BA 2C10A 4WYKB 5IF6A 1OACA 2D42A 5G2GA 2PZVA 5ELJA 5KP4A 5D82A 1YIT3 2ZDJA 2CFLA 3CCR3 1CEWI 1W4NA 2KXGA 1OGZA 1UW1A 1O7MB 1RKYA 3CNMA 2CIUA 2HMJB 3KKGA 2KRTA 3LTCA 2IA7A 3DGNA 2Z76A 1Q40A 3RGAA 4TX4A 1OHPA 4HM4B 3OXAA 4K90B 5EVHA 4L8OA 1TUHA 3S5CA 4O02B 4X2OA 3FZWA 1VQL3 5I97A 3DGMA 3MG3A 4HZBB 4R80A 2WGQA 1DMMA 5AYSC 2CWVA 2HMKB 4NREA 1NU3A 1Q42A 2OQEC 5AIHA 3HIGA 1M1K4 3CCM3 4WP5A 4WFOA 4CCVA 2HMNB 1WNHA 2W9QA 2XSHB 3BNCA 3DMCA 1A2VA 1C7HA 3I0YA 4AEQA 5IG5A 1GD4A 3EBTA 1U5OA 2CG1A 3T8UA 2LQVA 4HM1B 3TDGA 1W5ZA 3DGOA 3KZTA 4HBRA 1OH0A 3CCL3 1OCVA 3S29A 1OUNA 4LZIA 4MMYB 1FGQA 1O7PB 4STDA 1VQ93 3CU3A 3F40A 2PNCA 1KD14 3FG3A 3CNXA 3ALAA 2RFRA 1AR0A 3X40A 1W00A 2XFSA 1NB5I 2HMMB 3LMLA 2MC8A 1JB2A 1M904 3B4PA 2IMJA 1LNHA 3JUNA 5AEUB 2FGTA 1GY7A 3PCRA 1KSIA 1A90A 5AIIA 3FF0A 1KC84 3F8XA 3WMDA 3LTDA 3CCU3 1K9M4 1DMQA 1ULJB 3G8ZA 3Q1CA 4IPBA 2BMOB 1UUVB 4HM5B 4EC6A 2CFGA 2O9UX 1TU5A 3B7CA 2BMQB 3CC23 1KQS2 2CC3A 3F8HA 2OTL3 1US1A 1WMPA 1GY6A 5D81A 1RRHA 3HIIA 2OQEA 3OWUA 3MKIA 1IU7A 1IV7A 1DYUA 3N8BA 5FW5A 3DGLA 1OGXA 3IPTA 2CW9A 4FCJA 3B4OA 3BNEA 4RBNA 1TP6A 3F7XA 2XH9A 1JKGA 3HI7A 4OVMA 3CCS3 4G1MB 5HGRA 4R4KA 3S27A 2CFDA 5A0OB 2V1LA 1QMAA 1ZO2A 3LTAA 2W2CA 2K0MA 1Q40B 3BLZA 4CDLA 4KZ1A 1JN5A 4EXRA 2CFWA 1WMOA 2BMRB 2SBLA 1RN7A 2LYXA 3OX9A 4KFEA 3JUPA 5KP1A 1KWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYC A;  3KSE D;  5LC7 A;  3UL6 A;  1N9J A;  4TX4 A;  3MWZ A;  1MNL A;  1FA3 A;  4N6V 0;  1DVD A;  2BO9 B;  5ELU A;  4N6L A;  4N6N B;  4IT7 A;  4CCV A;  1CYU A;  3GAX A;  1LXE A;  1N5H A;  1WNH A;  2W9Q A;  5EQL A;  1GD4 A;  4N6M A;  3SVA A;  1NB3 I;  3UL5 A;  1TIJ A;  1N5P A;  4LZI A;  1M9G A;  1MOL A;  1STF I;  1ROA A;  1NB5 I;  1A67 A;  1GD3 A;  1CYV A;  1FUW A;  1YVB I;  1A90 A;  2CH9 A;  1G96 A;  3Q2P A;  1IV9 A;  4N6O B;  1DVC A;  3NX0 A;  4ZM8 A;  1R4C A;  2OCT A;  3KFQ C;  3PS8 A;  3QRD A;  2O9U X;  3PYJ A;  4N6U A;  1EQK A;  3L0R A;  3PXM A;  5LC6 A;  1IV7 A;  3K9M C;  4N6T A;  5A0O B;  5ELJ A;  2W9P A;  3LH4 A;  3S67 A;  1CEW I;  1PFP A;  2KXG A;  1RN7 A;  3IMA B;  1KWI A; 
#chains in the Genus database with same CATH topology
 1DET A;  1QJG A;  1SJW A;  4EYC A;  4RZM A;  4XBX A;  1BNR A;  1VQ7 3;  1N9J A;  3WR2 A;  4NHF A;  4O2H A;  1BNG A;  3JUP A;  1HU9 A;  1T2I A;  1D6Y A;  3FLJ A;  1BUJ A;  4HKV B;  4R9K A;  3K63 A;  3NM2 A;  3NV0 A;  5AIG A;  4R9L A;  1MNL A;  2FXT A;  2HMO B;  5DRV A;  1LVN A;  4FR9 A;  2E2T A;  1IVU A;  4FMD A;  3NBJ A;  3HX8 A;  2W6J H;  5AYR B;  1GMR A;  2BO9 B;  3LYG A;  5ELU A;  4EV5 A;  2YFL B;  2IUJ A;  1BSB A;  4HJL B;  1QAF A;  3WA3 A;  3KE7 A;  2H0I A;  3MG2 A;  4L7K A;  1QVG 2;  1BRJ A;  3G16 A;  6STD A;  4HM0 B;  4IT7 A;  2RNT A;  3GAX A;  1Z1S A;  5EQL A;  4HM8 B;  1B20 A;  1Q7Y 4;  1I3F A;  1B2S A;  1FGT A;  2XF3 A;  2B1X B;  1OF5 B;  3BB9 A;  3SVA A;  1NB3 I;  2K54 A;  3Q3F A;  1ASK A;  1G0T A;  3D5G A;  2A15 A;  2E2V A;  3FH1 A;  5IEO A;  2P0X A;  2OOV A;  2CX1 A;  3CD6 3;  3EX9 A;  2GXF A;  4KFD A;  1F8N A;  3WHO A;  7STD A;  1AY7 A;  2WGO A;  2GEX A;  2W04 A;  1O7G B;  1STF I;  2F99 A;  2RBI A;  3AMO B;  1AQZ A;  2F86 B;  1E3R A;  2F98 A;  1ROA A;  1SQW A;  1X1Y A;  3LXU X;  3NXJ A;  2XFT A;  1ZGX A;  4WWU C;  5IER A;  1RLS A;  1V74 A;  3O8Y A;  1BRS A;  3EJV A;  3RGR A;  3K7C A;  1RGL A;  3WOD G;  5CF2 A;  4IIA A;  1NWW A;  3JUQ A;  3EBY A;  3URP A;  4H61 A;  1L5G B;  3D9R A;  1RJO A;  1K8A 4;  4GSP A;  1GS3 A;  3AHS A;  1FUW A;  2GEY A;  1GOU A;  1VQ4 3;  1BNE A;  2CH9 A;  3FG1 A;  1G96 A;  2F5M A;  3EE1 A;  5AIF A;  1NDO B;  2E2U A;  1LOW A;  2XEP A;  4X2H A;  1IQ8 A;  3CCE 3;  3Q2P A;  1IV9 A;  3B8L A;  1I0V A;  3PZW A;  3GWR A;  2GBW B;  3EB8 A;  4AKZ A;  5BIR A;  3GZX B;  1SPU A;  1OF5 A;  1E97 A;  3EQQ B;  3M8C A;  4FCZ A;  1R4C A;  2OCT A;  3KFQ C;  1U8C B;  3PS8 A;  3LT9 A;  3QRD A;  8CHO A;  3DXO A;  9RNT A;  1EA2 A;  1ISK A;  3PYJ A;  2INX A;  3JUO A;  2RGQ A;  4ORL A;  4CJN A;  1JKG B;  4K1U A;  2RCD A;  3V98 A;  4BTY A;  1YJW 3;  3MYT A;  4WHA A;  1JB4 A;  3L0R A;  2OTJ 3;  1N8Q A;  1Y4K A;  1HKX A;  1WQL B;  3N9H A;  3AMO A;  2QEX 3;  2AAE A;  3H51 A;  1JN5 B;  4GL6 A;  4J5G A;  3OV4 A;  1W7C A;  2Q07 A;  3I55 3;  2W56 A;  3GRD A;  4XDV A;  3U1W A;  1V57 A;  4XBY A;  1VQK 3;  3DUK A;  2C11 A;  3NHX A;  1O7H B;  4H3U A;  2ZA4 A;  4BU4 A;  1OHS A;  1IVX A;  4GHO A;  1VQM 3;  4LMI A;  1I2E A;  3S67 A;  3NBR A;  1BIR A;  4HM3 B;  2CWU A;  1O7W B;  4KVH A;  1Q9E A;  1K73 4;  5IEP A;  3D3L A;  3NV0 B;  5IG0 A;  4HM7 B;  3KSE D;  3DY5 A;  2SAR A;  5LC7 A;  4HM6 B;  3U97 A;  3UL6 A;  3K5T A;  4HYZ A;  4EV2 A;  2KF3 A;  3NBB A;  1UDI I;  4LSO A;  1YVS A;  3SX1 A;  3GZY B;  2OOV C;  1BAO A;  1EKM A;  3STD A;  3X3X A;  1C54 A;  1N9E A;  4AKY A;  1YNV X;  2P0M A;  3MWZ A;  3UJM A;  1JNQ A;  3CME 3;  3ZFZ A;  1FYS A;  1I3I A;  1YGE A;  4HM2 B;  4XBT A;  3CXC 2;  1D6U A;  3J7Y d;  1CH0 A;  1VQO 3;  4N6V 0;  1RGG A;  1DVD A;  3V92 A;  3VSY A;  1SII A;  6RNT A;  1B2U A;  4LGQ A;  3CMA 3;  3DZL A;  4GB5 A;  2OWP A;  4MEI A;  4N6L A;  1LNI A;  1S72 3;  1MWR A;  1RSN A;  2CKF B;  2CFK A;  3D5I A;  3SOY A;  1WMN A;  2R4I A;  4BTX A;  2WOF A;  1SIH A;  2BNG A;  1DE3 A;  1RTU A;  2I9W A;  1CYU A;  3KSP A;  1N5H A;  2MF7 A;  4J9A A;  2GBX B;  2IUK A;  3DGY A;  2Z7A A;  3K0Z A;  2XSO B;  1S5A A;  1K28 A;  4N6M A;  1G02 A;  1FUS A;  2ZL8 A;  1IT7 A;  1OHO A;  4JF8 A;  3UL5 A;  4RNZ A;  5STD A;  1FGR A;  1B21 A;  2STD A;  3G6E 3;  2P05 A;  1N5P A;  4FMC A;  1STD A;  1OPY A;  1UGI A;  4K1V A;  1IQY A;  3G0K A;  5TGN A;  1GYB A;  1EG9 B;  4MMZ B;  3EHC A;  1BOX A;  1M9G A;  3KN4 A;  3SED A;  4XM4 A;  5JPP A;  1BRI A;  3G4S 3;  1YHQ 3;  1W6G A;  4R1K A;  5RNT A;  5IEN A;  1A2K A;  1DMN A;  3E99 A;  1N8R 4;  5DRE A;  2Z77 A;  1BRN L;  3LTB A;  1UCI A;  1PU4 A;  3OW2 2;  3PGB A;  1GD3 A;  5JBS A;  2CG0 A;  1CYV A;  4O8S A;  3CC7 3;  1BNF A;  2F56 A;  3T0U A;  1JJ2 2;  1RDS A;  2CHC A;  5EEO A;  1IYY A;  3NQY A;  1W2Z A;  2IYJ A;  3VGN A;  1VZZ A;  1BAN A;  5BXQ A;  4EBG A;  3EN8 A;  3FKA A;  2RSX A;  5FGO A;  2H0H A;  3DM8 A;  5BU4 A;  3GSP A;  1UGH I;  4K61 A;  1QAK A;  1LQM B;  2P38 A;  1DVC A;  2YFJ B;  3BNB A;  3GZR A;  3CCQ 3;  4XB5 A;  1JZO A;  1TFO A;  4BTW A;  1UI8 A;  3NX0 A;  4ZM8 A;  8RNT A;  4BL2 A;  5IG3 A;  3X3Z A;  2QIY A;  1IK3 A;  3FF2 A;  1UCJ A;  4CPK A;  1Q81 4;  1BNI A;  2FNQ A;  4EW5 A;  3CPO A;  5CF1 A;  1NNV A;  2W56 B;  2QGU A;  1VQN 3;  3UNL A;  4FMA A;  5CK6 A;  1TFK A;  4HZ9 B;  3JVC A;  4O3V A;  4OK0 A;  1W6Y A;  3WA2 X;  3CC4 3;  3LZA A;  4BL3 A;  4N6T A;  1JRQ A;  1I70 A;  1T2H A;  1W01 A;  1YJN 3;  1BSA A;  2Y74 A;  4I4K A;  3ROB A;  1VQP 3;  1UI7 A;  1EUI C;  4L8P A;  1RHL A;  2CK3 H;  2L1S A;  2CX0 A;  2W9P A;  3LH4 A;  2XRX B;  3IJE B;  1BRG A;  3OWY A;  2XGL A;  1E3V A;  3NUV A;  3FGY A;  2W03 A;  3EC9 A;  1PFP A;  4QWT A;  4WYK A;  5G1K A;  2XGN A;  1W2B 2;  1IQX A;  2GSP A;  3H3H A;  3RDE A;  2R41 A;  3IMA B;  3G71 3;  1TJD A;  1RCK A;  3FCS B;  1Q86 4;  2YFI B;  5KP3 A;  2WO0 A;  3F7S A;  5BVB A;  4J5K A;  2Y73 A;  1W6C A;  2M7O A;  3BND A;  1D6Z A;  1RRL A;  3S28 A;  3LT8 A;  1Q7H A;  3VF1 A;  3Q90 A;  4FMB A;  2QA4 3;  5JPU A;  3CCV 3;  2YX9 A;  3QK9 A;  1AV4 A;  2JQ5 A;  4FCM A;  3BU4 A;  1LOX A;  1RGH A;  1AVL A;  3FG4 A;  1FA3 A;  3SXX A;  1RMS A;  2ML6 A;  3SYU A;  5D83 A;  1RNT A;  3ZG0 A;  1W02 A;  3NM7 A;  1GOV A;  3WOF B;  1VQ5 3;  1IDP A;  4KFF A;  1UCK A;  1IVV A;  2ML5 A;  3SLU A;  1O7N B;  3D4A A;  4N6N B;  1T5Y A;  3X41 A;  2KF6 A;  2JDI H;  1LXE A;  4J8T A;  3JUM A;  1YJ9 3;  5AEW B;  2B24 B;  4JRF A;  3KII A;  2KCD A;  1RN4 A;  1A2P A;  1TRQ A;  3HK4 A;  1BSD A;  1T3B A;  1NO3 A;  4HVN A;  3F14 A;  7GSP A;  1CQS A;  3GZB A;  5IW9 A;  1JV2 B;  4Q53 A;  2GU1 A;  3MSO A;  1TIJ A;  3MG1 A;  1YI2 3;  1VQ6 3;  1MWT A;  1WTH A;  3UB1 A;  1JB5 A;  1Q82 4;  1ROV A;  3MPH A;  2O3O A;  1VQ8 3;  1FZU A;  2BIR A;  1MOL A;  4PEJ A;  1R4Y A;  1QAL A;  2F5W A;  2Z6B A;  5M18 A;  4MMX B;  4LEH A;  4OUQ A;  1AVK A;  5M1A A;  3WDG B;  1HZ1 A;  3ECF A;  3OWS A;  5IG4 A;  1QVF 2;  1BRK A;  3WOE B;  4MJD A;  3RNT A;  5CLK A;  3CPW 2;  3NQZ A;  3F9S A;  3T8N A;  5M19 A;  1A67 A;  3KCH A;  1IT8 A;  2D1W A;  1NJI 4;  2GU3 A;  3LOY A;  3PCS A;  1ZX2 A;  1YVB I;  1GY5 A;  1M1X B;  7RNT A;  3FSD A;  1MWS A;  3D79 A;  3DH2 A;  4N3V A;  1YIJ 3;  1FGM A;  3ZG5 A;  4HAA A;  3N54 B;  2WOH A;  3SOA A;  3A76 A;  1FGO A;  1K41 A;  1UUW B;  4N6O B;  2BT3 A;  1RGA A;  3CCJ 3;  3ER7 A;  1MGW A;  2BHM A;  1MWU A;  5AI1 A;  1VQQ A;  1BVI A;  1RGF A;  1B2X A;  1BU4 A;  2CWT A;  3EF8 A;  1BUQ A;  2HML B;  3MHE A;  2XR8 B;  2L4V A;  1IVW A;  4N6U A;  5CXO A;  3I56 3;  1I2F A;  2UGI A;  3PXM A;  2W0Q A;  3AGN A;  2P09 A;  1UCL A;  3V99 A;  4RNY A;  1YGW A;  2F4Y A;  5LC6 A;  2UX0 A;  1ULI B;  3X42 A;  3HZP A;  4KT3 B;  3EN1 B;  3X3Y A;  1RGE A;  1B2M A;  4XDW A;  3K9M C;  1GMQ A;  4U13 A;  1J2B A;  2C10 A;  4WYK B;  1RCL A;  1I0X A;  5IF6 A;  4NPB A;  1OAC A;  2D42 A;  5G2G A;  2H0G A;  2PZV A;  5ELJ A;  5KP4 A;  1BSC A;  5D82 A;  1BRH A;  1YIT 3;  4HOH A;  2BU4 A;  5GSP A;  2ZDJ A;  1RGC A;  1BNJ A;  2CFL A;  3CCR 3;  2C4B A;  1CEW I;  1W4N A;  2KXG A;  1OGZ A;  1UW1 A;  1FW7 A;  1O7M B;  1LOY A;  1RKY A;  3CNM A;  2CIU A;  2HMJ B;  3KKG A;  2KRT A;  3LTC A;  2IA7 A;  3DGN A;  2Z76 A;  1Q40 A;  1B2Z A;  3RGA A;  1JBT A;  4TX4 A;  1OHP A;  4HM4 B;  3OXA A;  4K90 B;  5EVH A;  1TTO A;  4L8O A;  1LQG C;  1TUH A;  3S5C A;  4O02 B;  4X2O A;  3FZW A;  1B3S A;  2IY2 A;  1VQL 3;  1JBR A;  1PY3 A;  3HOH A;  5I97 A;  3DGM A;  3MG3 A;  4HZB B;  4R80 A;  2WGQ A;  1BGS A;  1DMM A;  1GOY A;  1LRA A;  2J8X B;  5AYS C;  2CWV A;  2HMK B;  4NRE A;  1NU3 A;  1Q42 A;  2OQE C;  5AIH A;  3HIG A;  1M1K 4;  3CCM 3;  4WP5 A;  4WFO A;  4CCV A;  1B27 A;  2HMN B;  1WNH A;  1RN1 A;  2W9Q A;  2XSH B;  3BNC A;  3DMC A;  4LYL B;  4BIR A;  1A2V A;  1C7H A;  3I0Y A;  4AEQ A;  5IG5 A;  1GD4 A;  3EBT A;  1U5O A;  2CG1 A;  3T8U A;  1SAR A;  2KAA A;  2LQV A;  1V58 A;  4HM1 B;  3TDG A;  1W5Z A;  3DGO A;  3KZT A;  4HBR A;  1OH0 A;  3CCL 3;  1OCV A;  3S29 A;  1OUN A;  4LZI A;  2ZHX B;  4MMY B;  1FGQ A;  1O7P B;  4STD A;  3BIR A;  1GSP A;  1UUG B;  1VQ9 3;  3CU3 A;  3F40 A;  1TRP A;  5HOH A;  2PNC A;  1PYL A;  1HYF A;  1BSE A;  3FG3 A;  1KD1 4;  2KF4 A;  4DKI A;  3CNX A;  1MGR A;  3ALA A;  1X1W A;  2RFR A;  6GSP A;  1AR0 A;  3X40 A;  1W00 A;  2XFS A;  1EQK A;  1NB5 I;  2HMM B;  3LML A;  2MC8 A;  1RNB A;  1JB2 A;  1M90 4;  3B4P A;  2IMJ A;  2KF5 A;  1LNH A;  1FUT A;  3JUN A;  5AEU B;  2FGT A;  1GY7 A;  2K3D A;  1KSI A;  3PCR A;  1A90 A;  5AII A;  3FF0 A;  5G1L A;  3F8X A;  3WMD A;  1KC8 4;  3A5E A;  3LTD A;  5FW5 A;  3CCU 3;  1K9M 4;  1JZD A;  1DMQ A;  1ULJ B;  3G8Z A;  1X1X A;  3Q1C A;  4IPB A;  2BMO B;  1UUV B;  4HM5 B;  4EC6 A;  1I2G A;  2CFG A;  1RGK A;  2O9U X;  2UUG C;  3B7C A;  2BMQ B;  1TU5 A;  3CC2 3;  1KQS 2;  2CC3 A;  3F8H A;  2OTL 3;  1US1 A;  1WMP A;  1GY6 A;  5D81 A;  1RRH A;  3HII A;  2OQE A;  4I5Q A;  3OWU A;  3MKI A;  1IU7 A;  1IV7 A;  1DYU A;  3AHW A;  3N8B A;  3DGL A;  1OGX A;  3IPT A;  2CW9 A;  3AGO A;  3B4O A;  3BNE A;  4FCJ A;  4RBN A;  1TP6 A;  1X1U A;  3F7X A;  2XH9 A;  1JKG A;  3HI7 A;  4OVM A;  3CCS 3;  4G1M B;  2AAD A;  5HGR A;  4R4K A;  3S27 A;  2CFD A;  5A0O B;  2V1L A;  1QMA A;  1ZO2 A;  1I8V A;  1ZS7 A;  2HOH A;  2W2C A;  3LTA A;  2K0M A;  1Q40 B;  4RNT A;  3BLZ A;  4CDL A;  1LOV A;  1JN5 A;  4ILF A;  2CFW A;  4KZ1 A;  4EXR A;  1WMO A;  1EEJ A;  2BMR B;  2SBL A;  1RN7 A;  1BNS A;  2LYX A;  3OX9 A;  1GMP A;  4KFE A;  5KP1 A;  1JBS A;  1KWI A; 
#chains in the Genus database with same CATH homology
 1QJG A;  1SJW A;  4EYC A;  4RZM A;  4XBX A;  1VQ7 3;  1N9J A;  4NHF A;  4O2H A;  1HU9 A;  1D6Y A;  3FLJ A;  4HKV B;  4R9K A;  3K63 A;  3NM2 A;  3NV0 A;  5AIG A;  4R9L A;  1MNL A;  2FXT A;  2HMO B;  5DRV A;  1LVN A;  4FR9 A;  2E2T A;  1IVU A;  4FMD A;  3NBJ A;  3HX8 A;  2W6J H;  5AYR B;  2BO9 B;  3LYG A;  5ELU A;  4EV5 A;  2YFL B;  2IUJ A;  4HJL B;  1QAF A;  3WA3 A;  3KE7 A;  3MG2 A;  4L7K A;  1QVG 2;  3G16 A;  6STD A;  4HM0 B;  4IT7 A;  3GAX A;  1Z1S A;  5EQL A;  4HM8 B;  1Q7Y 4;  1FGT A;  2XF3 A;  2B1X B;  1OF5 B;  3BB9 A;  3SVA A;  1NB3 I;  2K54 A;  1ASK A;  2A15 A;  2E2V A;  3FH1 A;  5IEO A;  2P0X A;  2OOV A;  3CD6 3;  3EX9 A;  2GXF A;  4KFD A;  1F8N A;  7STD A;  2WGO A;  2GEX A;  2W04 A;  1O7G B;  1STF I;  2F99 A;  3AMO B;  2F86 B;  1E3R A;  2F98 A;  1ROA A;  1SQW A;  3LXU X;  3NXJ A;  2XFT A;  4WWU C;  5IER A;  1V74 A;  3O8Y A;  3RGR A;  3EJV A;  3K7C A;  3WOD G;  5CF2 A;  4IIA A;  1NWW A;  3JUQ A;  3EBY A;  4H61 A;  1L5G B;  3D9R A;  1RJO A;  1K8A 4;  1FUW A;  1GS3 A;  2GEY A;  1VQ4 3;  2CH9 A;  3FG1 A;  1G96 A;  3EE1 A;  5AIF A;  1NDO B;  2E2U A;  2XEP A;  4X2H A;  1IQ8 A;  3CCE 3;  3Q2P A;  1IV9 A;  3B8L A;  3PZW A;  3GWR A;  2GBW B;  3EB8 A;  4AKZ A;  3GZX B;  1SPU A;  1OF5 A;  1E97 A;  3EQQ B;  3M8C A;  4FCZ A;  1R4C A;  2OCT A;  3KFQ C;  1U8C B;  3PS8 A;  3LT9 A;  3QRD A;  8CHO A;  3DXO A;  1EA2 A;  1ISK A;  3PYJ A;  2INX A;  3JUO A;  2RGQ A;  4ORL A;  1YJW 3;  1JKG B;  4K1U A;  2RCD A;  3V98 A;  4BTY A;  1EQK A;  3MYT A;  4WHA A;  1JB4 A;  3L0R A;  2OTJ 3;  1N8Q A;  1Y4K A;  1HKX A;  1WQL B;  3N9H A;  3AMO A;  2QEX 3;  3H51 A;  1JN5 B;  4GL6 A;  3OV4 A;  1W7C A;  2Q07 A;  3I55 3;  2W56 A;  3GRD A;  4XDV A;  3U1W A;  4XBY A;  1VQK 3;  3DUK A;  2C11 A;  3NHX A;  1O7H B;  4H3U A;  1OHS A;  1IVX A;  1VQM 3;  4LMI A;  3S67 A;  3NBR A;  4HM3 B;  2CWU A;  1O7W B;  4KVH A;  1K73 4;  5IEP A;  3D3L A;  3NV0 B;  5IG0 A;  4HM7 B;  3KSE D;  3DY5 A;  5LC7 A;  4HM6 B;  3U97 A;  3UL6 A;  3K5T A;  4HYZ A;  4EV2 A;  3NBB A;  4LSO A;  3SX1 A;  3GZY B;  2OOV C;  3STD A;  1EKM A;  3X3X A;  1N9E A;  4AKY A;  2P0M A;  3MWZ A;  3UJM A;  1JNQ A;  3CME 3;  1YGE A;  4HM2 B;  4XBT A;  3CXC 2;  1D6U A;  3J7Y d;  1VQO 3;  4N6V 0;  1DVD A;  3V92 A;  3VSY A;  1SII A;  4LGQ A;  3CMA 3;  3DZL A;  4GB5 A;  2OWP A;  4MEI A;  4N6L A;  1S72 3;  2CKF B;  2CFK A;  3SOY A;  1WMN A;  2R4I A;  4BTX A;  2WOF A;  1SIH A;  2BNG A;  2I9W A;  1CYU A;  3KSP A;  1N5H A;  2MF7 A;  4J9A A;  2GBX B;  2IUK A;  2Z7A A;  3K0Z A;  2XSO B;  1S5A A;  1K28 A;  4N6M A;  2ZL8 A;  1IT7 A;  1OHO A;  4JF8 A;  3UL5 A;  4RNZ A;  5STD A;  1FGR A;  2STD A;  3G6E 3;  2P05 A;  1N5P A;  4FMC A;  1STD A;  1OPY A;  4K1V A;  1IQY A;  3G0K A;  5TGN A;  1GYB A;  1EG9 B;  4MMZ B;  3EHC A;  1M9G A;  3SED A;  3KN4 A;  5JPP A;  4XM4 A;  3G4S 3;  1YHQ 3;  1W6G A;  4R1K A;  5IEN A;  1A2K A;  1DMN A;  3E99 A;  1N8R 4;  5DRE A;  2Z77 A;  3LTB A;  1PU4 A;  3OW2 2;  3PGB A;  1GD3 A;  5JBS A;  2CG0 A;  1CYV A;  4O8S A;  3CC7 3;  1JJ2 2;  3T0U A;  2CHC A;  5EEO A;  3NQY A;  1W2Z A;  3VGN A;  1VZZ A;  5BXQ A;  4EBG A;  3EN8 A;  3FKA A;  2RSX A;  5FGO A;  3DM8 A;  4K61 A;  1QAK A;  2YFJ B;  2P38 A;  1DVC A;  3BNB A;  3GZR A;  3CCQ 3;  4XB5 A;  1TFO A;  4BTW A;  1UI8 A;  3NX0 A;  4ZM8 A;  5IG3 A;  3X3Z A;  2QIY A;  1IK3 A;  3FF2 A;  1Q81 4;  2FNQ A;  3CPO A;  5CF1 A;  2W56 B;  1VQN 3;  2QGU A;  3UNL A;  4FMA A;  5CK6 A;  1TFK A;  4HZ9 B;  3JVC A;  4O3V A;  4OK0 A;  1W6Y A;  3WA2 X;  3CC4 3;  3LZA A;  4N6T A;  1JRQ A;  1W01 A;  1YJN 3;  2Y74 A;  4I4K A;  3ROB A;  1VQP 3;  1UI7 A;  4L8P A;  2CK3 H;  2W9P A;  3LH4 A;  2XRX B;  3IJE B;  3OWY A;  2XGL A;  1E3V A;  3NUV A;  3FGY A;  2W03 A;  3EC9 A;  1PFP A;  4QWT A;  4WYK A;  2XGN A;  1W2B 2;  1IQX A;  3H3H A;  3RDE A;  3G71 3;  3IMA B;  3FCS B;  1Q86 4;  2YFI B;  5KP3 A;  2WO0 A;  3F7S A;  5BVB A;  2Y73 A;  1W6C A;  2M7O A;  3BND A;  1D6Z A;  1RRL A;  3S28 A;  3LT8 A;  3VF1 A;  3Q90 A;  4FMB A;  2QA4 3;  5JPU A;  3CCV 3;  2YX9 A;  3QK9 A;  1AV4 A;  2JQ5 A;  4FCM A;  1LOX A;  3FG4 A;  1AVL A;  1FA3 A;  3SXX A;  2ML6 A;  5D83 A;  1W02 A;  3NM7 A;  1VQ5 3;  3WOF B;  1IDP A;  4KFF A;  1IVV A;  2ML5 A;  3SLU A;  1O7N B;  4N6N B;  1T5Y A;  3X41 A;  2JDI H;  1LXE A;  4J8T A;  3JUM A;  1YJ9 3;  5AEW B;  2B24 B;  4JRF A;  3KII A;  2KCD A;  3HK4 A;  1NO3 A;  4HVN A;  3F14 A;  1CQS A;  3GZB A;  5IW9 A;  1JV2 B;  4Q53 A;  2GU1 A;  3MSO A;  1TIJ A;  3MG1 A;  1YI2 3;  1VQ6 3;  1WTH A;  3UB1 A;  1JB5 A;  1Q82 4;  1ROV A;  3MPH A;  2O3O A;  1VQ8 3;  1MOL A;  4PEJ A;  1QAL A;  2Z6B A;  4MMX B;  4LEH A;  4OUQ A;  1AVK A;  3WDG B;  5IG4 A;  3ECF A;  3OWS A;  1QVF 2;  3WOE B;  4MJD A;  5CLK A;  3CPW 2;  3NQZ A;  3F9S A;  3T8N A;  1A67 A;  1IT8 A;  2D1W A;  1NJI 4;  2GU3 A;  3LOY A;  3PCS A;  1ZX2 A;  1YVB I;  1GY5 A;  1M1X B;  3FSD A;  4N3V A;  1YIJ 3;  1FGM A;  3N54 B;  2WOH A;  3SOA A;  3A76 A;  1FGO A;  1K41 A;  1UUW B;  4N6O B;  2BT3 A;  3CCJ 3;  3ER7 A;  2BHM A;  5AI1 A;  2CWT A;  3EF8 A;  1BUQ A;  2HML B;  3MHE A;  2XR8 B;  2L4V A;  1IVW A;  4N6U A;  5CXO A;  3I56 3;  3PXM A;  2W0Q A;  3V99 A;  2P09 A;  4RNY A;  5LC6 A;  2UX0 A;  1ULI B;  3X42 A;  3HZP A;  3EN1 B;  3X3Y A;  4XDW A;  3K9M C;  4U13 A;  1J2B A;  2C10 A;  4WYK B;  5IF6 A;  1OAC A;  2D42 A;  5G2G A;  2PZV A;  5ELJ A;  5KP4 A;  5D82 A;  1YIT 3;  2ZDJ A;  2CFL A;  3CCR 3;  1CEW I;  1W4N A;  2KXG A;  1OGZ A;  1UW1 A;  1O7M B;  1RKY A;  3CNM A;  2CIU A;  2HMJ B;  3KKG A;  2KRT A;  3LTC A;  2IA7 A;  3DGN A;  2Z76 A;  1Q40 A;  3RGA A;  4TX4 A;  1OHP A;  4HM4 B;  3OXA A;  4K90 B;  5EVH A;  4L8O A;  1TUH A;  3S5C A;  4O02 B;  4X2O A;  3FZW A;  1VQL 3;  5I97 A;  3DGM A;  3MG3 A;  4HZB B;  4R80 A;  2WGQ A;  1DMM A;  5AYS C;  2CWV A;  2HMK B;  4NRE A;  1NU3 A;  1Q42 A;  2OQE C;  5AIH A;  3HIG A;  1M1K 4;  3CCM 3;  4WP5 A;  4WFO A;  4CCV A;  2HMN B;  1WNH A;  2W9Q A;  2XSH B;  3BNC A;  3DMC A;  1A2V A;  1C7H A;  3I0Y A;  4AEQ A;  5IG5 A;  1GD4 A;  3EBT A;  1U5O A;  2CG1 A;  3T8U A;  2LQV A;  4HM1 B;  3TDG A;  1W5Z A;  3DGO A;  3KZT A;  4HBR A;  1OH0 A;  3CCL 3;  1OCV A;  3S29 A;  1OUN A;  4LZI A;  4MMY B;  1FGQ A;  1O7P B;  4STD A;  1VQ9 3;  3CU3 A;  3F40 A;  2PNC A;  1KD1 4;  3FG3 A;  3CNX A;  3ALA A;  2RFR A;  1AR0 A;  3X40 A;  1W00 A;  2XFS A;  1NB5 I;  2HMM B;  3LML A;  2MC8 A;  1JB2 A;  1M90 4;  3B4P A;  2IMJ A;  1LNH A;  3JUN A;  5AEU B;  2FGT A;  1GY7 A;  3PCR A;  1KSI A;  1A90 A;  5AII A;  3FF0 A;  1KC8 4;  3F8X A;  3WMD A;  3LTD A;  3CCU 3;  1K9M 4;  1DMQ A;  1ULJ B;  3G8Z A;  3Q1C A;  4IPB A;  2BMO B;  1UUV B;  4HM5 B;  4EC6 A;  2CFG A;  2O9U X;  1TU5 A;  3B7C A;  2BMQ B;  3CC2 3;  1KQS 2;  2CC3 A;  3F8H A;  2OTL 3;  1US1 A;  1WMP A;  1GY6 A;  5D81 A;  1RRH A;  3HII A;  2OQE A;  3OWU A;  3MKI A;  1IU7 A;  1IV7 A;  1DYU A;  3N8B A;  5FW5 A;  3DGL A;  1OGX A;  3IPT A;  2CW9 A;  4FCJ A;  3B4O A;  3BNE A;  4RBN A;  1TP6 A;  3F7X A;  2XH9 A;  1JKG A;  3HI7 A;  4OVM A;  3CCS 3;  4G1M B;  5HGR A;  4R4K A;  3S27 A;  2CFD A;  5A0O B;  2V1L A;  1QMA A;  1ZO2 A;  3LTA A;  2W2C A;  2K0M A;  1Q40 B;  3BLZ A;  4CDL A;  4KZ1 A;  1JN5 A;  4EXR A;  2CFW A;  1WMO A;  2BMR B;  2SBL A;  1RN7 A;  2LYX A;  3OX9 A;  4KFE A;  3JUP A;  5KP1 A;  1KWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...