1I8VA

Crystal structure of rnase sa y80f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDFYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Tyrosine hydrogen bonds make a large contribution to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i8vA00
4HOHA 1GSPA 1BNSA 1JBRA 1BRNL 1BNGA 4J5KA 1RMSA 1BRSA 1YVSA 1B27A 1I0XA 1TRPA 2GSPA 3D5GA 1B2XA 1YGWA 1RGHA 1BUJA 1LNIA 3URPA 1BVIA 1I8VA 1MGRA 2KF3A 1GOVA 2RNTA 3GSPA 5GSPA 1RN4A 4BU4A 6GSPA 1B2MA 1FW7A 3AGOA 1GMPA 1RHLA 2AADA 1RGFA 1ZGXA 2KF5A 3RNTA 1FZUA 2AAEA 1FYSA 1I0VA 1I3IA 1GMRA 1I2EA 1RNTA 1RSNA 5BIRA 3D5IA 1BANA 1RCKA 1I70A 4GSPA 3AHSA 1I2FA 4BIRA 1RLSA 1BOXA 1R4YA 1LOWA 1CH0A 1I2GA 1RGGA 6RNTA 1C54A 1AY7A 3DH2A 1UCIA 1RDSA 1RCLA 1BIRA 9RNTA 1IYYA 1FUSA 1T2HA 3SYUA 1HYFA 1BRJA 1G02A 1T2IA 1RGAA 1RGEA 2RBIA 1BNRA 5HOHA 1BRHA 2HOHA 3AHWA 2KF6A 3BU4A 3DGYA 4GHOA 1LOYA 1X1UA 1LRAA 1TTOA 2ZA4A 1PYLA 1BSEA 2F4YA 2F5MA 1BNIA 1BAOA 1BRIA 3D4AA 1JBTA 1BGSA 1BSBA 1RTUA 3HOHA 1BNFA 1GMQA 1RGCA 2SARA 1BRGA 3KCHA 3Q3FA 4J5GA 8RNTA 1BRKA 1UCKA 4HAAA 1PY3A 1B2ZA 2KF4A 2KAAA 1X1WA 3BIRA 1GOUA 1I3FA 4RNTA 2BU4A 1JBSA 5BU4A 1B20A 1B3SA 1YNVX 1LOVA 1X1XA 7GSPA 1MGWA 1A2PA 1BSAA 1BSDA 1DE3A 1TRQA 1RNBA 1BNEA 1HZ1A 2BIRA 1Q9EA 1B2SA 2F56A 1SARA 3A5EA 1GOYA 7RNTA 3AGNA 1UCJA 2C4BA 3WR2A 3WHOA 1RN1A 1B21A 1X1YA 1AQZA 1FUTA 1BSCA 1BU4A 1B2UA 2F5WA 1BNJA 5RNTA 1RGLA 1DETA 1RGKA 1UCLA
chains in the Genus database with same CATH superfamily
3M8CA 3EBTA 3NX0A 5D82A 3FLJA 3CCM3 1GSPA 2ML6A 1VQQA 2YFLB 3B4PA 1BNGA 4N6V0 3WDGB 1JN5B 1AV4A 4N6NB 3NUVA 4CPKA 4J9AA 1YVBI 3X3ZA 1QVF2 1IK3A 1QALA 3X42A 2GSPA 2B1XB 3WA2X 3ER7A 3SOAA 1BUJA 4R9KA 3NM2A 1TUHA 4Q53A 5DREA 5I97A 3CCV3 1WQLB 2IY2A 1AR0A 5JPPA 2OTJ3 3WOFB 1RN4A 2ML5A 3LOYA 3AGOA 1RHLA 3OW22 1RGFA 1ZGXA 2GBWB 3WMDA 1PFPA 1VQ73 1OGXA 1YI23 1FYSA 3N9HA 5IEOA 4FMCA 5IEPA 1I2EA 4I5QA 4AKZA 1JZOA 2HMMB 3I0YA 2F86B 1MNLA 1VQP3 1JB4A 3AHSA 5M19A 3G6E3 1T3BA 3QRDA 4R1KA 1CH0A 1RGGA 2YFJB 2HMLB 1G96A 4L7KA 1YIJ3 1C54A 2H0GA 1QAFA 2LQVA 1FGRA 1UCIA 2Q07A 1WMPA 1DMQA 1JB2A 4CCVA 9RNTA 1RJOA 1IYYA 1T2HA 3DZLA 1ROVA 2STDA 3OV4A 1YHQ3 1BRJA 1RRHA 2D42A 4GB5A 4O3VA 1MWTA 2RBIA 3KN4A 4X2HA 1NDOB 1SPUA 2KF6A 3AHWA 3BU4A 3MYTA 4WFOA 3T8NA 4NHFA 1X1UA 1LRAA 2O9UX 2UUGC 2WO0A 3DM8A 1BSEA 2RCDA 2W56A 1OHPA 4HM2B 1BNIA 3JUOA 2QEX3 1GD3A 4K1UA 2W6JH 1ULJB 3J7Yd 3D79A 3HIIA 4MJDA 4WYKA 2IMJA 3U1WA 1K8A4 1GMQA 2SARA 5JBSA 1W2B2 2W9PA 4BTYA 3H51A 1BRGA 4OUQA 5CK6A 1M1K4 1F8NA 1MOLA 3Q3FA 1E3VA 1JKGB 4HM3B 1TP6A 5DRVA 1DMNA 1UCKA 3CNXA 4HM7B 5G1LA 1JJ22 5TGNA 1OHSA 4L8OA 2W03A 4RNZA 3BNBA 3F7XA 1GOUA 1LNHA 3K9MC 4KFFA 2CK3H 3ZG0A 1FGQA 3H3HA 3CU3A 3CCL3 1KD14 4EYCA 2W2CA 1LOVA 3GZBA 3SX1A 3K63A 3DGNA 4N6MA 2CX0A 7GSPA 2A15A 1A2PA 3FSDA 1WMOA 1TRQA 4MMYB 3G8ZA 2L1SA 3V99A 1M1XB 3CXC2 1DYUA 1LQGC 3MG1A 3LTAA 3LYGA 2XFSA 3L0RA 3V98A 4IPBA 1GD4A 1OF5A 2E2UA 1FGTA 5AYSC 1TFOA 2L4VA 2C4BA 1W01A 3HK4A 2XR8B 2XRXB 3PCSA 3PXMA 2BMQB 4WHAA 4AEQA 1RN7A 3CME3 1FUTA 4N3VA 1BU4A 5RNTA 1FGMA 1NWWA 4L8PA 1O7GB 3B8LA 3PZWA 2I9WA 3MSOA 5BXQA 3CCR3 1T5YA 1JBRA 2CX1A 3NQZA 1A90A 1IVXA 1JV2B 4KFEA 3CMA3 1ROAA 2CC3A 3BB9A 3KZTA 3SVAA 5A0OB 1LVNA 2GU3A 1Q814 3CC43 1MWUA 1B27A 1NB3I 1U5OA 1ZX2A 3T0UA 4RNYA 2R41A 3D5GA 3KSPA 1B2XA 3MHEA 4HM5B 1YGWA 1RGHA 1ZS7A 4K90B 1LNIA 4EBGA 1BVIA 3ZFZA 1NU3A 3KFQC 1MGRA 1TIJA 1LXEA 2C10A 2F99A 5FGOA 3GSPA 2RNTA 2D1WA 4BU4A 1JRQA 2KF5A 3CNMA 2AADA 2ZL8A 4EW5A 1QJGA 1ISKA 2XEPA 4EXRA 3ALAA 2PNCA 2GXFA 4QWTA 5BIRA 2PZVA 1BANA 2XF3A 1UGIA 2HMNB 3EF8A 3GAXA 4BTXA 1S5AA 1VQO3 5STDA 1I2FA 4XDWA 3NBJA 1CQSA 1RLSA 3FF0A 1BOXA 4G1MB 1I2GA 3O8YA 3EJVA 1O7NB 3DUKA 3MG3A 3CCU3 3AMOA 1E97A 3DGOA 3LT9A 4LEHA 1RDSA 3KSED 3RGAA 1VQM3 1VQ53 2BHMA 3EX9A 3NQYA 3X3XA 5IG5A 5AEUB 1VQ43 4FCJA 1VQK3 1G02A 1T2IA 1UW1A 1W4NA 1BRHA 4HYZA 3EE1A 2BNGA 2HOHA 5KP1A 1W6CA 1W7CA 2W56B 3DGLA 1CEWI 1QMAA 4GHOA 3BNDA 4EV5A 1K734 4J8TA 3I563 1PYLA 1UUVB 3STDA 1BAOA 1JBTA 1BSBA 5G1KA 3S67A 1RTUA 1RGCA 1GY5A 3SLUA 3LMLA 4PEJA 1YJ93 1N9JA 1SIIA 3GZXB 3F9SA 1Q7HA 3GZRA 2J8XB 5IG3A 3KKGA 1TJDA 3OWSA 1K9M4 1SIHA 2ZHXB 1D6UA 4HZ9B 3CPOA 4HAAA 1M904 2KF4A 2K54A 7STDA 4ORLA 3QK9A 1JB5A 2UX0A 3IMAB 4LSOA 3MG2A 3DGMA 4XDVA 4XBYA 3B4OA 3FZWA 3VSYA 3IPTA 4HBRA 4H61A 5AIFA 1B20A 1SQWA 4O02B 1B3SA 3FCSB 1X1XA 3GRDA 3JUQA 4BL2A 3Q90A 2P05A 2P0XA 1LQMB 4KVHA 3N8BA 5D83A 2H0IA 2HMOB 1DE3A 1EA2A 2M7OA 2MF7A 1RNBA 2CFLA 1KWIA 2BMRB 4O2HA 5D81A 3FG3A 4HVNA 1STFI 1MWRA 2CH9A 4N6TA 4XM4A 3JUMA 1EQKA 1SARA 2BO9B 1AVKA 1UI8A 3Q1CA 3F8HA 4R4KA 4R80A 3S28A 3WHOA 1RN1A 1B21A 2KCDA 3SEDA 1AQZA 3HI7A 1B2UA 1BNJA 1N9EA 2P38A 2RSXA 1DETA 2QIYA 1RGKA 1UCLA 3FG4A 5ELUA 3NM7A 1NO3A 1BNSA 3F8XA 3CPW2 1S723 3HIGA 2CWUA 2E2VA 4KFDA 1BRSA 3DXOA 3RGRA 1GY7A 5AIIA 1BUQA 1YVSA 5KP4A 4N6OB 1I0XA 3F7SA 4JF8A 4NREA 4FR9A 3NBBA 2CIUA 2BT3A 2O3OA 1PU4A 4I4KA 1IQ8A 1I8VA 1DVCA 3D3LA 4JRFA 1GOVA 1GYBA 1Q42A 1Q40A 5GSPA 6GSPA 1B2MA 1FW7A 1ASKA 1GMPA 3ZG5A 3G0KA 1E3RA 2RFRA 3RNTA 1FZUA 3T8UA 2AAEA 3K7CA 1NJI4 4N6UA 1I0VA 2FXTA 1IT8A 1GMRA 3OWYA 2SBLA 5EQLA 1UUWB 1L5GB 2P09A 3EN8A 4ILFA 1V74A 4HZBB 1N8QA 3HZPA 3WA3A 3D5IA 5G2GA 5KP3A 1JZDA 3LTDA 1IV9A 2XSHB 4GSPA 4KT3B 3KIIA 1O7PB 3WOEB 1O7HB 3KE7A 3JVCA 1GS3A 4OVMA 4R9LA 3LZAA 1Q864 1R4YA 1LOWA 1EG9B 3AMOB 3NXJA 3NBRA 4O8SA 6RNTA 3LTCA 5M1AA 1AY7A 1JNQA 3DH2A 3CCS3 2IUJA 5JPUA 3OX9A 4HKVB 4N6LA 1RRLA 2F98A 1BIRA 4GL6A 2XFTA 3SYUA 2OOVC 1IU7A 2YX9A 1M9GA 2WGQA 3UL5A 3FGYA 5HOHA 1UUGB 3LXUX 2GEXA 5CXOA 3D9RA 3PYJA 1W6GA 1OACA 1Q7Y4 1KC84 1Q824 5ELJA 1EEJA 4EV2A 1VQ83 4U13A 1LOYA 4XBTA 1TTOA 2ZA4A 1DVDA 2WOFA 2OQEC 1IT7A 3ECFA 2W0QA 3D4AA 1NNVA 1W02A 2LYXA 3HOHA 1YIT3 1UDII 4FCMA 3X41A 3EHCA 5CF1A 1OHOA 1TU5A 3PCRA 2C11A 4STDA 3GZYB 4J5GA 8RNTA 3X3YA 1CYUA 4IT7A 3S29A 2RGQA 1YJN3 1ULIB 1B2ZA 3FH1A 2B24B 1RKYA 5IF6A 1X1WA 4FCZA 2Z7AA 1I3FA 3G4S3 1A67A 4HM4B 4RNTA 5CLKA 5BU4A 1O7WB 1STDA 2W04A 1MWSA 4BTWA 3CC23 4WYKB 1K28A 5BVBA 1BNEA 1HZ1A 2GEYA 2BIRA 4AKYA 2CFKA 2CW9A 1J2BA 2XGNA 3LH4A 1Q9EA 1B2SA 2F56A 2MC8A 1R4CA 2Y73A 3A5EA 7RNTA 4FMAA 3V92A 3A76A 3WODG 3CCQ3 1QVG2 1UGHI 4H3UA 2CWVA 3FF2A 1X1YA 4X2OA 1OCVA 3S27A 1OUNA 1BSCA 1IV7A 3IJEB 1V57A 1VQ93 1RGLA 4RZMA 4CJNA 1V58A 1IVUA 2Z6BA 1ZO2A 4HOHA 4WWUC 1FUWA 3NV0A 1BRNL 5AIGA 3B7CA 4J5KA 1RMSA 3RDEA 1IVWA 5AYRB 2XH9A 3OXAA 1N5PA 1SJWA 2Y74A 1TRPA 1A2KA 1WMNA 1D6ZA 1JN5A 1OF5B 2Z76A 3EBYA 3S5CA 1Q40B 2GU1A 5AEWB 3JUPA 5AIHA 1IDPA 3MWZA 3URPA 3NHXA 2IA7A 3EQQB 3BLZA 4K1VA 2KF3A 1K41A 2H0HA 3MPHA 4DKIA 2UGIA 1LOXA 3VGNA 2OOVA 2OWPA 2K0MA 1I3IA 2GBXB 1W5ZA 1RNTA 1RSNA 1UI7A 1WTHA 5IG0A 4KZ1A 2W9QA 3PGBA 3UJMA 4HM0B 1Z1SA 2WGOA 1VQL3 5LC7A 1VZZA 3HX8A 5IW9A 1RCKA 1I70A 1N5HA 4IIAA 3SXXA 1IQYA 1W6YA 2E2TA 2XGLA 4HJLB 4BIRA 2R4IA 2OQEA 1QAKA 3CD63 3UB1A 3LT8A 2K3DA 4WP5A 1C7HA 3BNEA 3SOYA 5EVHA 2CHCA 1VQ63 1RCLA 3G16A 2YFIB 5EEOA 1IVVA 3GWRA 1FUSA 1CYVA 2OTL3 1HYFA 1RGAA 1RGEA 1EUIC 2IYJA 3CCJ3 1OPYA 3BNCA 4CDLA 1BNRA 3N54B 3MKIA 2HMKB 3LTBA 4MMXB 1A2VA 2HMJB 5FW5A 2CWTA 2CG0A 3DGYA 3OWUA 1AVLA 4XB5A 1TFKA 4XBXA 3EC9A 5CF2A 3CC73 2F4YA 2F5MA 2JDIH 3CCE3 1BRIA 3K5TA 1BGSA 3EN1B 1BNFA 4RBNA 4HM6B 4BL3A 2INXA 4MMZB 2BMOB 1FA3A 3KCHA 2Z77A 2CKFB 4HM1B 4LYLB 4ZM8A 3FKAA 5AI1A 1NB5I 3PS8A 2KXGA 1BRKA 1EKMA 4FMDA 1PY3A 3ROBA 1OH0A 2KAAA 1OGZA 4EC6A 3BIRA 1JKGA 3K0ZA 1N8R4 3Q2PA 3U97A 3FG1A 1O7MB 1US1A 2BU4A 1KSIA 1JBSA 2IUKA 4FMBA 3X40A 6STDA 2CFGA 1HU9A 5HGRA 4LZIA 1G0TA 4LMIA 1U8CB 1YNVX 3I553 3DMCA 2JQ5A 2FNQA 1MGWA 5IENA 1VQN3 2KRTA 4K61A 1BSAA 1BSDA 5IERA 4OK0A 3VF1A 4NPBA 4MEIA 3UNLA 5IG4A 1D6YA 1WNHA 2CFWA 2P0MA 2V1LA 4TX4A 3TDGA 2XSOB 1DMMA 1HKXA 2FGTA 5LC6A 2CG1A 1GOYA 1KQS2 1GY6A 2WOHA 3AGNA 2QGUA 1FGOA 1UCJA 3G713 1W00A 3EB8A 3JUNA 4LGQA 3WR2A 3DY5A 1W2ZA 3UL6A 5M18A 2CFDA 1IQXA 2QA43 3E99A 4HM8B 2OCTA 8CHOA 1Y4KA 2ZDJA 3F14A 1YJW3 3NV0B 2F5WA 3F40A 1YGEA
chains in the Genus database with same CATH topology
4HOHA 1GSPA 1BNSA 1JBRA 1BRNL 1BNGA 4J5KA 1RMSA 1BRSA 1YVSA 1B27A 1I0XA 1TRPA 2GSPA 3D5GA 1B2XA 1YGWA 1RGHA 1BUJA 1LNIA 3URPA 1BVIA 1I8VA 1MGRA 2KF3A 1GOVA 2RNTA 3GSPA 5GSPA 1RN4A 4BU4A 6GSPA 1B2MA 1FW7A 3AGOA 1GMPA 1RHLA 2AADA 1RGFA 1ZGXA 2KF5A 3RNTA 1FZUA 2AAEA 1FYSA 1I0VA 1I3IA 1GMRA 1I2EA 1RNTA 1RSNA 5BIRA 3D5IA 1BANA 1RCKA 1I70A 4GSPA 3AHSA 1I2FA 4BIRA 1RLSA 1BOXA 1R4YA 1LOWA 1CH0A 1I2GA 1RGGA 6RNTA 1C54A 1AY7A 3DH2A 1UCIA 1RDSA 1RCLA 1BIRA 9RNTA 1IYYA 1FUSA 1T2HA 3SYUA 1HYFA 1BRJA 1G02A 1T2IA 1RGAA 1RGEA 2RBIA 1BNRA 5HOHA 1BRHA 2HOHA 3AHWA 2KF6A 3BU4A 3DGYA 4GHOA 1LOYA 1X1UA 1LRAA 1TTOA 2ZA4A 1PYLA 1BSEA 2F4YA 2F5MA 1BNIA 1BAOA 1BRIA 3D4AA 1JBTA 1BGSA 1BSBA 1RTUA 3HOHA 1BNFA 1GMQA 1RGCA 2SARA 1BRGA 3KCHA 3Q3FA 4J5GA 8RNTA 1BRKA 1UCKA 4HAAA 1PY3A 1B2ZA 2KF4A 2KAAA 1X1WA 3BIRA 1GOUA 1I3FA 4RNTA 2BU4A 1JBSA 5BU4A 1B20A 1B3SA 1YNVX 1LOVA 1X1XA 7GSPA 1MGWA 1A2PA 1BSAA 1BSDA 1DE3A 1TRQA 1RNBA 1BNEA 1HZ1A 2BIRA 1Q9EA 1B2SA 2F56A 1SARA 3A5EA 1GOYA 7RNTA 3AGNA 1UCJA 2C4BA 3WR2A 3WHOA 1RN1A 1B21A 1X1YA 1AQZA 1FUTA 1BSCA 1BU4A 1B2UA 2F5WA 1BNJA 5RNTA 1RGLA 1DETA 1RGKA 1UCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HOH A;  1GSP A;  1BNS A;  1JBR A;  1BRN L;  1BNG A;  4J5K A;  1RMS A;  1BRS A;  1YVS A;  1B27 A;  1I0X A;  1TRP A;  2GSP A;  3D5G A;  1B2X A;  1YGW A;  1RGH A;  1BUJ A;  1LNI A;  3URP A;  1BVI A;  1I8V A;  1MGR A;  2KF3 A;  1GOV A;  2RNT A;  3GSP A;  5GSP A;  1RN4 A;  4BU4 A;  6GSP A;  1B2M A;  1FW7 A;  3AGO A;  1GMP A;  1RHL A;  2AAD A;  1RGF A;  1ZGX A;  2KF5 A;  3RNT A;  1FZU A;  2AAE A;  1FYS A;  1I0V A;  1I3I A;  1GMR A;  1I2E A;  1RNT A;  1RSN A;  5BIR A;  3D5I A;  1BAN A;  1RCK A;  1I70 A;  4GSP A;  3AHS A;  1I2F A;  4BIR A;  1RLS A;  1BOX A;  1R4Y A;  1LOW A;  1CH0 A;  1I2G A;  1RGG A;  6RNT A;  1C54 A;  1AY7 A;  3DH2 A;  1UCI A;  1RDS A;  1RCL A;  1BIR A;  9RNT A;  1IYY A;  1FUS A;  1T2H A;  3SYU A;  1HYF A;  1BRJ A;  1G02 A;  1T2I A;  1RGA A;  1RGE A;  2RBI A;  1BNR A;  5HOH A;  1BRH A;  2HOH A;  3AHW A;  2KF6 A;  3BU4 A;  3DGY A;  4GHO A;  1LOY A;  1X1U A;  1LRA A;  1TTO A;  2ZA4 A;  1PYL A;  1BSE A;  2F4Y A;  2F5M A;  1BNI A;  1BAO A;  1BRI A;  3D4A A;  1JBT A;  1BGS A;  1BSB A;  1RTU A;  3HOH A;  1BNF A;  1GMQ A;  1RGC A;  2SAR A;  1BRG A;  3KCH A;  3Q3F A;  4J5G A;  8RNT A;  1BRK A;  1UCK A;  4HAA A;  1PY3 A;  1B2Z A;  2KF4 A;  2KAA A;  1X1W A;  3BIR A;  1GOU A;  1I3F A;  4RNT A;  2BU4 A;  1JBS A;  5BU4 A;  1B20 A;  1B3S A;  1YNV X;  1LOV A;  1X1X A;  7GSP A;  1MGW A;  1A2P A;  1BSA A;  1BSD A;  1DE3 A;  1TRQ A;  1RNB A;  1BNE A;  1HZ1 A;  2BIR A;  1Q9E A;  1B2S A;  2F56 A;  1SAR A;  3A5E A;  1GOY A;  7RNT A;  3AGN A;  1UCJ A;  2C4B A;  3WR2 A;  3WHO A;  1RN1 A;  1B21 A;  1X1Y A;  1AQZ A;  1FUT A;  1BSC A;  1BU4 A;  1B2U A;  2F5W A;  1BNJ A;  5RNT A;  1RGL A;  1DET A;  1RGK A;  1UCL A; 
#chains in the Genus database with same CATH topology
 3M8C A;  3EBT A;  3NX0 A;  5D82 A;  3FLJ A;  3CCM 3;  1GSP A;  2ML6 A;  1VQQ A;  2YFL B;  3B4P A;  1BNG A;  4N6V 0;  3WDG B;  1JN5 B;  1AV4 A;  4N6N B;  3NUV A;  4CPK A;  4J9A A;  1YVB I;  3X3Z A;  1QVF 2;  1IK3 A;  1QAL A;  3X42 A;  2GSP A;  2B1X B;  3WA2 X;  3ER7 A;  3SOA A;  1BUJ A;  4R9K A;  3NM2 A;  1TUH A;  4Q53 A;  5DRE A;  5I97 A;  3CCV 3;  1WQL B;  2IY2 A;  1AR0 A;  5JPP A;  2OTJ 3;  3WOF B;  1RN4 A;  2ML5 A;  3LOY A;  3AGO A;  1RHL A;  3OW2 2;  1RGF A;  1ZGX A;  2GBW B;  3WMD A;  1PFP A;  1VQ7 3;  1OGX A;  1YI2 3;  1FYS A;  3N9H A;  5IEO A;  4FMC A;  5IEP A;  1I2E A;  4I5Q A;  4AKZ A;  1JZO A;  2HMM B;  3I0Y A;  2F86 B;  1MNL A;  1VQP 3;  1JB4 A;  3AHS A;  5M19 A;  3G6E 3;  1T3B A;  3QRD A;  4R1K A;  1CH0 A;  1RGG A;  2YFJ B;  2HML B;  1G96 A;  4L7K A;  1YIJ 3;  1C54 A;  2H0G A;  1QAF A;  2LQV A;  1FGR A;  1UCI A;  2Q07 A;  1WMP A;  1DMQ A;  1JB2 A;  4CCV A;  9RNT A;  1RJO A;  1IYY A;  1T2H A;  3DZL A;  1ROV A;  2STD A;  3OV4 A;  1YHQ 3;  1BRJ A;  1RRH A;  2D42 A;  4GB5 A;  4O3V A;  1MWT A;  2RBI A;  3KN4 A;  4X2H A;  1NDO B;  1SPU A;  2KF6 A;  3AHW A;  3BU4 A;  3MYT A;  4WFO A;  3T8N A;  4NHF A;  1X1U A;  1LRA A;  2O9U X;  2UUG C;  2WO0 A;  3DM8 A;  1BSE A;  2RCD A;  2W56 A;  1OHP A;  4HM2 B;  1BNI A;  3JUO A;  2QEX 3;  1GD3 A;  4K1U A;  2W6J H;  1ULJ B;  3J7Y d;  3D79 A;  3HII A;  4MJD A;  4WYK A;  2IMJ A;  3U1W A;  1K8A 4;  1GMQ A;  2SAR A;  5JBS A;  1W2B 2;  2W9P A;  4BTY A;  3H51 A;  1BRG A;  4OUQ A;  5CK6 A;  1M1K 4;  1F8N A;  1MOL A;  3Q3F A;  1E3V A;  1JKG B;  4HM3 B;  1TP6 A;  5DRV A;  1DMN A;  1UCK A;  3CNX A;  4HM7 B;  5G1L A;  1JJ2 2;  5TGN A;  1OHS A;  4L8O A;  2W03 A;  4RNZ A;  3BNB A;  3F7X A;  1GOU A;  1LNH A;  3K9M C;  4KFF A;  2CK3 H;  3ZG0 A;  1FGQ A;  3H3H A;  3CU3 A;  3CCL 3;  1KD1 4;  4EYC A;  2W2C A;  1LOV A;  3GZB A;  3SX1 A;  3K63 A;  3DGN A;  4N6M A;  2CX0 A;  7GSP A;  2A15 A;  1A2P A;  3FSD A;  1WMO A;  1TRQ A;  4MMY B;  3G8Z A;  2L1S A;  3V99 A;  1M1X B;  3CXC 2;  1DYU A;  1LQG C;  3MG1 A;  3LTA A;  3LYG A;  2XFS A;  3L0R A;  3V98 A;  4IPB A;  1GD4 A;  1OF5 A;  2E2U A;  1FGT A;  5AYS C;  1TFO A;  2L4V A;  2C4B A;  1W01 A;  3HK4 A;  2XR8 B;  2XRX B;  3PCS A;  3PXM A;  2BMQ B;  4WHA A;  4AEQ A;  1RN7 A;  3CME 3;  1FUT A;  4N3V A;  1BU4 A;  5RNT A;  1FGM A;  1NWW A;  4L8P A;  1O7G B;  3B8L A;  3PZW A;  2I9W A;  3MSO A;  5BXQ A;  3CCR 3;  1T5Y A;  1JBR A;  2CX1 A;  3NQZ A;  1A90 A;  1IVX A;  1JV2 B;  4KFE A;  3CMA 3;  1ROA A;  2CC3 A;  3BB9 A;  3KZT A;  3SVA A;  5A0O B;  1LVN A;  2GU3 A;  1Q81 4;  3CC4 3;  1MWU A;  1B27 A;  1NB3 I;  1U5O A;  1ZX2 A;  3T0U A;  4RNY A;  2R41 A;  3D5G A;  3KSP A;  1B2X A;  3MHE A;  4HM5 B;  1YGW A;  1RGH A;  1ZS7 A;  4K90 B;  1LNI A;  4EBG A;  1BVI A;  3ZFZ A;  1NU3 A;  3KFQ C;  1MGR A;  1TIJ A;  1LXE A;  2C10 A;  2F99 A;  5FGO A;  3GSP A;  2RNT A;  2D1W A;  4BU4 A;  1JRQ A;  2KF5 A;  3CNM A;  2AAD A;  2ZL8 A;  4EW5 A;  1QJG A;  1ISK A;  2XEP A;  4EXR A;  3ALA A;  2PNC A;  2GXF A;  4QWT A;  5BIR A;  2PZV A;  1BAN A;  2XF3 A;  1UGI A;  2HMN B;  3EF8 A;  3GAX A;  4BTX A;  1S5A A;  1VQO 3;  5STD A;  1I2F A;  4XDW A;  3NBJ A;  1CQS A;  1RLS A;  3FF0 A;  1BOX A;  4G1M B;  1I2G A;  3O8Y A;  3EJV A;  1O7N B;  3DUK A;  3MG3 A;  3CCU 3;  3AMO A;  1E97 A;  3DGO A;  3LT9 A;  4LEH A;  1RDS A;  3KSE D;  3RGA A;  1VQM 3;  1VQ5 3;  2BHM A;  3EX9 A;  3NQY A;  3X3X A;  5IG5 A;  5AEU B;  1VQ4 3;  4FCJ A;  1VQK 3;  1G02 A;  1T2I A;  1UW1 A;  1W4N A;  1BRH A;  4HYZ A;  3EE1 A;  2BNG A;  2HOH A;  5KP1 A;  1W6C A;  1W7C A;  2W56 B;  3DGL A;  1CEW I;  1QMA A;  4GHO A;  3BND A;  4EV5 A;  1K73 4;  4J8T A;  3I56 3;  1PYL A;  1UUV B;  3STD A;  1BAO A;  1JBT A;  1BSB A;  5G1K A;  3S67 A;  1RTU A;  1RGC A;  1GY5 A;  3SLU A;  3LML A;  4PEJ A;  1YJ9 3;  1N9J A;  1SII A;  3GZX B;  3F9S A;  1Q7H A;  3GZR A;  2J8X B;  5IG3 A;  3KKG A;  1TJD A;  3OWS A;  1K9M 4;  1SIH A;  2ZHX B;  1D6U A;  4HZ9 B;  3CPO A;  4HAA A;  1M90 4;  2KF4 A;  2K54 A;  7STD A;  4ORL A;  3QK9 A;  1JB5 A;  2UX0 A;  3IMA B;  4LSO A;  3MG2 A;  3DGM A;  4XDV A;  4XBY A;  3B4O A;  3FZW A;  3VSY A;  3IPT A;  4HBR A;  4H61 A;  5AIF A;  1B20 A;  1SQW A;  4O02 B;  1B3S A;  3FCS B;  1X1X A;  3GRD A;  3JUQ A;  4BL2 A;  3Q90 A;  2P05 A;  2P0X A;  1LQM B;  4KVH A;  3N8B A;  5D83 A;  2H0I A;  2HMO B;  1DE3 A;  1EA2 A;  2M7O A;  2MF7 A;  1RNB A;  2CFL A;  1KWI A;  2BMR B;  4O2H A;  5D81 A;  3FG3 A;  4HVN A;  1STF I;  1MWR A;  2CH9 A;  4N6T A;  4XM4 A;  3JUM A;  1EQK A;  1SAR A;  2BO9 B;  1AVK A;  1UI8 A;  3Q1C A;  3F8H A;  4R4K A;  4R80 A;  3S28 A;  3WHO A;  1RN1 A;  1B21 A;  2KCD A;  3SED A;  1AQZ A;  3HI7 A;  1B2U A;  1BNJ A;  1N9E A;  2P38 A;  2RSX A;  1DET A;  2QIY A;  1RGK A;  1UCL A;  3FG4 A;  5ELU A;  3NM7 A;  1NO3 A;  1BNS A;  3F8X A;  3CPW 2;  1S72 3;  3HIG A;  2CWU A;  2E2V A;  4KFD A;  1BRS A;  3DXO A;  3RGR A;  1GY7 A;  5AII A;  1BUQ A;  1YVS A;  5KP4 A;  4N6O B;  1I0X A;  3F7S A;  4JF8 A;  4NRE A;  4FR9 A;  3NBB A;  2CIU A;  2BT3 A;  2O3O A;  1PU4 A;  4I4K A;  1IQ8 A;  1I8V A;  1DVC A;  3D3L A;  4JRF A;  1GOV A;  1GYB A;  1Q42 A;  1Q40 A;  5GSP A;  6GSP A;  1B2M A;  1FW7 A;  1ASK A;  1GMP A;  3ZG5 A;  3G0K A;  1E3R A;  2RFR A;  3RNT A;  1FZU A;  3T8U A;  2AAE A;  3K7C A;  1NJI 4;  4N6U A;  1I0V A;  2FXT A;  1IT8 A;  1GMR A;  3OWY A;  2SBL A;  5EQL A;  1UUW B;  1L5G B;  2P09 A;  3EN8 A;  4ILF A;  1V74 A;  4HZB B;  1N8Q A;  3HZP A;  3WA3 A;  3D5I A;  5G2G A;  5KP3 A;  1JZD A;  3LTD A;  1IV9 A;  2XSH B;  4GSP A;  4KT3 B;  3KII A;  1O7P B;  3WOE B;  1O7H B;  3KE7 A;  3JVC A;  1GS3 A;  4OVM A;  4R9L A;  3LZA A;  1Q86 4;  1R4Y A;  1LOW A;  1EG9 B;  3AMO B;  3NXJ A;  3NBR A;  4O8S A;  6RNT A;  3LTC A;  5M1A A;  1AY7 A;  1JNQ A;  3DH2 A;  3CCS 3;  2IUJ A;  5JPU A;  3OX9 A;  4HKV B;  4N6L A;  1RRL A;  2F98 A;  1BIR A;  4GL6 A;  2XFT A;  3SYU A;  2OOV C;  1IU7 A;  2YX9 A;  1M9G A;  2WGQ A;  3UL5 A;  3FGY A;  5HOH A;  1UUG B;  3LXU X;  2GEX A;  5CXO A;  3D9R A;  3PYJ A;  1W6G A;  1OAC A;  1Q7Y 4;  1KC8 4;  1Q82 4;  5ELJ A;  1EEJ A;  4EV2 A;  1VQ8 3;  4U13 A;  1LOY A;  4XBT A;  1TTO A;  2ZA4 A;  1DVD A;  2WOF A;  2OQE C;  1IT7 A;  3ECF A;  2W0Q A;  3D4A A;  1NNV A;  1W02 A;  2LYX A;  3HOH A;  1YIT 3;  1UDI I;  4FCM A;  3X41 A;  3EHC A;  5CF1 A;  1OHO A;  1TU5 A;  3PCR A;  2C11 A;  4STD A;  3GZY B;  4J5G A;  8RNT A;  3X3Y A;  1CYU A;  4IT7 A;  3S29 A;  2RGQ A;  1YJN 3;  1ULI B;  1B2Z A;  3FH1 A;  2B24 B;  1RKY A;  5IF6 A;  1X1W A;  4FCZ A;  2Z7A A;  1I3F A;  3G4S 3;  1A67 A;  4HM4 B;  4RNT A;  5CLK A;  5BU4 A;  1O7W B;  1STD A;  2W04 A;  1MWS A;  4BTW A;  3CC2 3;  4WYK B;  1K28 A;  5BVB A;  1BNE A;  1HZ1 A;  2GEY A;  2BIR A;  4AKY A;  2CFK A;  2CW9 A;  1J2B A;  2XGN A;  3LH4 A;  1Q9E A;  1B2S A;  2F56 A;  2MC8 A;  1R4C A;  2Y73 A;  3A5E A;  7RNT A;  4FMA A;  3V92 A;  3A76 A;  3WOD G;  3CCQ 3;  1QVG 2;  1UGH I;  4H3U A;  2CWV A;  3FF2 A;  1X1Y A;  4X2O A;  1OCV A;  3S27 A;  1OUN A;  1BSC A;  1IV7 A;  3IJE B;  1V57 A;  1VQ9 3;  1RGL A;  4RZM A;  4CJN A;  1V58 A;  1IVU A;  2Z6B A;  1ZO2 A;  4HOH A;  4WWU C;  1FUW A;  3NV0 A;  1BRN L;  5AIG A;  3B7C A;  4J5K A;  1RMS A;  3RDE A;  1IVW A;  5AYR B;  2XH9 A;  3OXA A;  1N5P A;  1SJW A;  2Y74 A;  1TRP A;  1A2K A;  1WMN A;  1D6Z A;  1JN5 A;  1OF5 B;  2Z76 A;  3EBY A;  3S5C A;  1Q40 B;  2GU1 A;  5AEW B;  3JUP A;  5AIH A;  1IDP A;  3MWZ A;  3URP A;  3NHX A;  2IA7 A;  3EQQ B;  3BLZ A;  4K1V A;  2KF3 A;  1K41 A;  2H0H A;  3MPH A;  4DKI A;  2UGI A;  1LOX A;  3VGN A;  2OOV A;  2OWP A;  2K0M A;  1I3I A;  2GBX B;  1W5Z A;  1RNT A;  1RSN A;  1UI7 A;  1WTH A;  5IG0 A;  4KZ1 A;  2W9Q A;  3PGB A;  3UJM A;  4HM0 B;  1Z1S A;  2WGO A;  1VQL 3;  5LC7 A;  1VZZ A;  3HX8 A;  5IW9 A;  1RCK A;  1I70 A;  1N5H A;  4IIA A;  3SXX A;  1IQY A;  1W6Y A;  2E2T A;  2XGL A;  4HJL B;  4BIR A;  2R4I A;  2OQE A;  1QAK A;  3CD6 3;  3UB1 A;  3LT8 A;  2K3D A;  4WP5 A;  1C7H A;  3BNE A;  3SOY A;  5EVH A;  2CHC A;  1VQ6 3;  1RCL A;  3G16 A;  2YFI B;  5EEO A;  1IVV A;  3GWR A;  1FUS A;  1CYV A;  2OTL 3;  1HYF A;  1RGA A;  1RGE A;  1EUI C;  2IYJ A;  3CCJ 3;  1OPY A;  3BNC A;  4CDL A;  1BNR A;  3N54 B;  3MKI A;  2HMK B;  3LTB A;  4MMX B;  1A2V A;  2HMJ B;  5FW5 A;  2CWT A;  2CG0 A;  3DGY A;  3OWU A;  1AVL A;  4XB5 A;  1TFK A;  4XBX A;  3EC9 A;  5CF2 A;  3CC7 3;  2F4Y A;  2F5M A;  2JDI H;  3CCE 3;  1BRI A;  3K5T A;  1BGS A;  3EN1 B;  1BNF A;  4RBN A;  4HM6 B;  4BL3 A;  2INX A;  4MMZ B;  2BMO B;  1FA3 A;  3KCH A;  2Z77 A;  2CKF B;  4HM1 B;  4LYL B;  4ZM8 A;  3FKA A;  5AI1 A;  1NB5 I;  3PS8 A;  2KXG A;  1BRK A;  1EKM A;  4FMD A;  1PY3 A;  3ROB A;  1OH0 A;  2KAA A;  1OGZ A;  4EC6 A;  3BIR A;  1JKG A;  3K0Z A;  1N8R 4;  3Q2P A;  3U97 A;  3FG1 A;  1O7M B;  1US1 A;  2BU4 A;  1KSI A;  1JBS A;  2IUK A;  4FMB A;  3X40 A;  6STD A;  2CFG A;  1HU9 A;  5HGR A;  4LZI A;  1G0T A;  4LMI A;  1U8C B;  1YNV X;  3I55 3;  3DMC A;  2JQ5 A;  2FNQ A;  1MGW A;  5IEN A;  1VQN 3;  2KRT A;  4K61 A;  1BSA A;  1BSD A;  5IER A;  4OK0 A;  3VF1 A;  4NPB A;  4MEI A;  3UNL A;  5IG4 A;  1D6Y A;  1WNH A;  2CFW A;  2P0M A;  2V1L A;  4TX4 A;  3TDG A;  2XSO B;  1DMM A;  1HKX A;  2FGT A;  5LC6 A;  2CG1 A;  1GOY A;  1KQS 2;  1GY6 A;  2WOH A;  3AGN A;  2QGU A;  1FGO A;  1UCJ A;  3G71 3;  1W00 A;  3EB8 A;  3JUN A;  4LGQ A;  3WR2 A;  3DY5 A;  1W2Z A;  3UL6 A;  5M18 A;  2CFD A;  1IQX A;  2QA4 3;  3E99 A;  4HM8 B;  2OCT A;  8CHO A;  1Y4K A;  2ZDJ A;  3F14 A;  1YJW 3;  3NV0 B;  2F5W A;  3F40 A;  1YGE A; 
#chains in the Genus database with same CATH homology
 4HOH A;  1GSP A;  1BNS A;  1JBR A;  1BRN L;  1BNG A;  4J5K A;  1RMS A;  1BRS A;  1YVS A;  1B27 A;  1I0X A;  1TRP A;  2GSP A;  3D5G A;  1B2X A;  1YGW A;  1RGH A;  1BUJ A;  1LNI A;  3URP A;  1BVI A;  1I8V A;  1MGR A;  2KF3 A;  1GOV A;  2RNT A;  3GSP A;  5GSP A;  1RN4 A;  4BU4 A;  6GSP A;  1B2M A;  1FW7 A;  3AGO A;  1GMP A;  1RHL A;  2AAD A;  1RGF A;  1ZGX A;  2KF5 A;  3RNT A;  1FZU A;  2AAE A;  1FYS A;  1I0V A;  1I3I A;  1GMR A;  1I2E A;  1RNT A;  1RSN A;  5BIR A;  3D5I A;  1BAN A;  1RCK A;  1I70 A;  4GSP A;  3AHS A;  1I2F A;  4BIR A;  1RLS A;  1BOX A;  1R4Y A;  1LOW A;  1CH0 A;  1I2G A;  1RGG A;  6RNT A;  1C54 A;  1AY7 A;  3DH2 A;  1UCI A;  1RDS A;  1RCL A;  1BIR A;  9RNT A;  1IYY A;  1FUS A;  1T2H A;  3SYU A;  1HYF A;  1BRJ A;  1G02 A;  1T2I A;  1RGA A;  1RGE A;  2RBI A;  1BNR A;  5HOH A;  1BRH A;  2HOH A;  3AHW A;  2KF6 A;  3BU4 A;  3DGY A;  4GHO A;  1LOY A;  1X1U A;  1LRA A;  1TTO A;  2ZA4 A;  1PYL A;  1BSE A;  2F4Y A;  2F5M A;  1BNI A;  1BAO A;  1BRI A;  3D4A A;  1JBT A;  1BGS A;  1BSB A;  1RTU A;  3HOH A;  1BNF A;  1GMQ A;  1RGC A;  2SAR A;  1BRG A;  3KCH A;  3Q3F A;  4J5G A;  8RNT A;  1BRK A;  1UCK A;  4HAA A;  1PY3 A;  1B2Z A;  2KF4 A;  2KAA A;  1X1W A;  3BIR A;  1GOU A;  1I3F A;  4RNT A;  2BU4 A;  1JBS A;  5BU4 A;  1B20 A;  1B3S A;  1YNV X;  1LOV A;  1X1X A;  7GSP A;  1MGW A;  1A2P A;  1BSA A;  1BSD A;  1DE3 A;  1TRQ A;  1RNB A;  1BNE A;  1HZ1 A;  2BIR A;  1Q9E A;  1B2S A;  2F56 A;  1SAR A;  3A5E A;  1GOY A;  7RNT A;  3AGN A;  1UCJ A;  2C4B A;  3WR2 A;  3WHO A;  1RN1 A;  1B21 A;  1X1Y A;  1AQZ A;  1FUT A;  1BSC A;  1BU4 A;  1B2U A;  2F5W A;  1BNJ A;  5RNT A;  1RGL A;  1DET A;  1RGK A;  1UCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...