1I8VA

Crystal structure of rnase sa y80f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDFYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Tyrosine hydrogen bonds make a large contribution to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i8vA00
1IYYA 2F4YA 1RGHA 1FUSA 1BSAA 4GHOA 1A2PA 1RGGA 1BNSA 1PY3A 4RNTA 1T2HA 1LRAA 3KCHA 1TTOA 1MGRA 2F5WA 3D5GA 1RGFA 3AGOA 1MGWA 1RMSA 1X1UA 1YVSA 4HOHA 3HOHA 1BSBA 1AQZA 2F5MA 1B2SA 1BNEA 1FUTA 2KF3A 1I3IA 1TRPA 1I70A 1I3FA 3A5EA 1RNBA 3WR2A 3AHSA 1UCIA 1X1WA 1BAOA 5RNTA 1BANA 1G02A 1LNIA 1RHLA 3DGYA 1PYLA 3WHOA 1C54A 1BUJA 7RNTA 1RCLA 1BNIA 1BRJA 1BRIA 2RBIA 4GSPA 1RN1A 1I2GA 1TRQA 1BU4A 1BRGA 5HOHA 5BU4A 3URPA 1BRSA 1SARA 1BSCA 1LOYA 1CH0A 1GMPA 1BOXA 1I2FA 1GMRA 1AY7A 1UCKA 2HOHA 1RCKA 3BU4A 1BVIA 9RNTA 1B27A 6GSPA 1B2UA 1B3SA 1RGAA 1BNRA 1BSEA 1DE3A 1RTUA 1RGLA 1RGKA 1BNJA 1B2XA 1I0VA 1ZGXA 2KAAA 1BGSA 1BRKA 1FZUA 1GOUA 6RNTA 1RGEA 3GSPA 1GMQA 1YGWA 3AHWA 2SARA 1X1YA 1GOYA 3RNTA 1B21A 1BRNL 3D4AA 1JBTA 2KF6A 8RNTA 2RNTA 1B2ZA 2C4BA 1DETA 1HZ1A 1B20A 1R4YA 1HYFA 1BNFA 2F56A 2ZA4A 1YNVX 1JBSA 1RGCA 3AGNA 1B2MA 2KF4A 1I8VA 2BU4A 2AAEA 3Q3FA 1BNGA 1BIRA 7GSPA 1LOVA 1FYSA 1RN4A 4J5GA 4HAAA 1I0XA 2BIRA 1RNTA 1BSDA 1GSPA 1GOVA 1Q9EA 1UCLA 2AADA 1JBRA 1RLSA 1T2IA 2KF5A 3BIRA 1FW7A 1RSNA 4J5KA 3SYUA 5BIRA 4BU4A 4BIRA 1LOWA 2GSPA 1I2EA 3D5IA 1RDSA 1X1XA 1UCJA 1BRHA 3DH2A 5GSPA
chains in the Genus database with same CATH superfamily
1RGHA 5AIFA 3X3XA 1WMNA 1BSAA 1Q7HA 1TFKA 4HM0B 3MG3A 1RGGA 4CDLA 3WDGB 1BNSA 4KFFA 3DY5A 1T2HA 3KCHA 3KIIA 1TTOA 1MGRA 3ZG0A 2R41A 1V58A 3K5TA 5AEWB 3KZTA 1KD14 3S28A 1MGWA 1RMSA 2YFIB 3CCJ3 2H0HA 1YVSA 2CIUA 1AQZA 3PZWA 3G6E3 3F14A 1MWUA 3BLZA 4KZ1A 1Q40A 1I3FA 3A5EA 5CF1A 3ZFZA 1ROVA 1AVLA 3V99A 3IJEB 2GU1A 2P38A 1AR0A 3MG2A 2P0XA 1FGOA 4EBGA 1BAOA 5EVHA 2MC8A 5RNTA 1BANA 1LNIA 1EA2A 3D79A 4GL6A 1NU3A 2CG1A 1PYLA 3GZXB 1JNQA 1OH0A 1UW1A 3LYGA 1VQ93 3CPOA 2LQVA 2CFWA 1C7HA 3HX8A 1FGMA 3JUQA 1UUWB 3K63A 3LOYA 2RFRA 2XGLA 3F7SA 2HMOB 2CWUA 2E2VA 1UDII 1OGZA 1V74A 4WP5A 1MWRA 3BNBA 1LOYA 5AIGA 4EYCA 4O3VA 1T5YA 5IW9A 2XFTA 1I2FA 2D1WA 4L7KA 1Y4KA 2E2UA 3NXJA 3G713 3BNEA 5BVBA 1ZO2A 4HM5B 1KQS2 1US1A 3KN4A 1IV9A 1MWSA 9RNTA 1B27A 4I5QA 3MKIA 2OQEA 1N5PA 4DKIA 1RTUA 2V1LA 4HZBB 4BTWA 5JPPA 1DE3A 4HM6B 4R9LA 2STDA 1YJN3 1RGKA 4IIAA 1BNJA 2CKFB 3B8LA 3KSED 3I563 1F8NA 3D9RA 1BGSA 1GOUA 1KC84 4IPBA 5CF2A 1RGEA 3GSPA 5EEOA 3AHWA 3K0ZA 5IG4A 2SARA 3LTAA 1D6YA 3IPTA 4HM4B 4H3UA 3RNTA 5IEPA 1K28A 2KF6A 5STDA 8RNTA 3I553 4N6MA 1TIJA 1IU7A 2WOFA 3SVAA 1D6UA 2C4BA 1ZX2A 3CCQ3 2XFSA 1B20A 3JVCA 3SOAA 3NBJA 3SLUA 2ZA4A 1JBSA 1DVDA 3AGNA 1DMQA 2WGQA 5LC6A 4BL2A 1Q42A 3EJVA 1OCVA 3JUMA 2QA43 5AYSC 1CYVA 1YJW3 3L0RA 1BNGA 3OW22 5IEOA 3NM7A 3WOFB 1GY5A 3PXMA 3CCV3 1QAFA 1QMAA 1KSIA 1W4NA 1BSDA 1RNTA 4PEJA 1JZDA 1LQMB 2FNQA 3QK9A 1K9M4 1VQQA 2IY2A 2M7OA 5IG5A 1TU5A 3BIRA 4HM2B 2OTL3 3F8XA 2CK3H 3DXOA 3SYUA 1FW7A 4BIRA 1GYBA 1JV2B 2GSPA 3OWYA 1I2EA 4L8PA 3EQQB 1OHOA 1RDSA 1OUNA 3JUNA 1UCJA 1W01A 5D82A 3DH2A 5AIHA 1A2KA 4NHFA 5HGRA 1DMNA 3LMLA 3SOYA 2F4YA 3FF0A 3VGNA 1J2BA 1VQN3 2W04A 1JN5A 1K41A 4LEHA 2P05A 4KVHA 1N9JA 2CX0A 3DMCA 1PY3A 3MWZA 4CJNA 3EBTA 1LRAA 3HI7A 1IK3A 2UGIA 3X40A 4N6LA 1W6CA 3D5GA 4K90B 1OF5A 2OCTA 3NV0A 3K9MC 3HOHA 1BSBA 2KF3A 2BHMA 1BNEA 5DREA 1TRPA 4AKZA 4HZ9B 4LMIA 3CCE3 1M1XB 1RNBA 3EX9A 4J9AA 1N8R4 2CC3A 4N6NB 2BMQB 3AHSA 3G16A 3U97A 3CCM3 1TFOA 1UCIA 3FZWA 4TX4A 1PU4A 3ECFA 3LTBA 1V57A 3FG4A 1NB5I 1W6YA 1E97A 3BB9A 1EEJA 1G02A 5EQLA 1WMOA 1U8CB 3DGYA 3PGBA 1O7GB 2J8XB 3B7CA 4H61A 4R4KA 3AMOB 1PFPA 3DM8A 2D42A 3WHOA 1W00A 1SPUA 1TJDA 3DGMA 3PCRA 3CXC2 5ELUA 7RNTA 1BNIA 1N8QA 4HBRA 1LNHA 3NQYA 3MG1A 1TRQA 3MPHA 3T8NA 3B4OA 1EKMA 1VQK3 1O7WB 3HK4A 4JF8A 4KFDA 4BTYA 4EV5A 5IERA 2BT3A 3CMA3 2OTJ3 1IT8A 1N9EA 1BSCA 1O7HB 1SARA 4LZIA 3NUVA 1CH0A 4FMDA 3WA3A 3LT9A 5AEUB 1NO3A 3I0YA 4EW5A 1Q824 1AY7A 4HJLB 3SXXA 4XB5A 3CCS3 1RCKA 3H3HA 4OK0A 2F86B 1BVIA 3IMAB 5FGOA 1W2B2 1O7MB 5AI1A 2IUKA 1BSEA 1JKGA 3FLJA 4FR9A 5DRVA 1RGLA 3GZBA 4HM7B 4XDWA 1ISKA 1ZGXA 1I0VA 1O7PB 4NPBA 3UL6A 1BRKA 1IVUA 4IT7A 3WMDA 3UNLA 3LTCA 2L4VA 1GMQA 1OHPA 1YGWA 2HMKB 3Q90A 1IQXA 1X1YA 2ML6A 2Q07A 2Y73A 1SJWA 1BRNL 2BMOB 4HM8B 1O7NB 2W0QA 3HZPA 4ILFA 4LYLB 1EQKA 1B2ZA 2WGOA 3LH4A 3HIIA 2W9QA 4X2HA 4XBYA 2E2TA 5IF6A 1R4YA 2BMRB 3NHXA 3CNMA 4WYKB 1HYFA 3CU3A 1S5AA 3KKGA 2OQEC 1RGCA 1LOXA 1L5GB 4CCVA 3J7Yd 1B2MA 1JB2A 3FCSB 2CFLA 1GY6A 2SBLA 2W6JH 1BIRA 5CLKA 3WODG 2B24B 1FYSA 1RN4A 3QRDA 3RDEA 5KP3A 2BIRA 1UCLA 1YIT3 1K8A4 2AADA 1TUHA 3N54B 1VQL3 3BNCA 2RCDA 1NJI4 3Q1CA 3S29A 5BIRA 1ZS7A 3KE7A 3LZAA 1SIIA 5CXOA 2Z7AA 4MEIA 3LTDA 3M8CA 3T0UA 2W03A 3WOEB 2W56B 5TGNA 3D5IA 1NB3I 1VQ43 1UUGB 4BTXA 2XH9A 1X1XA 2ZHXB 3TDGA 3F7XA 2QGUA 4N6UA 4NREA 5GSPA 2L1SA 5A0OB 3UL5A 1IYYA 3X41A 4GHOA 3A76A 1M9GA 2CWVA 5I97A 1JZOA 4BL3A 4N6OB 4R1KA 1RKYA 3S67A 3CCU3 4FMBA 3D3LA 2P09A 1IV7A 1RGFA 4RNYA 8CHOA 1X1UA 4J8TA 4R9KA 2Z6BA 1M904 3VSYA 1FUTA 1RJOA 1I3IA 3GWRA 1I70A 4O2HA 5FW5A 2GU3A 1IT7A 3WR2A 3G8ZA 3ZG5A 2H0GA 2INXA 1GS3A 3RGAA 1X1WA 2XEPA 2BO9B 1R4CA 3F40A 1WQLB 3EHCA 1RHLA 3NX0A 2IYJA 4HVNA 1DVCA 3PCSA 4MJDA 4ORLA 4JRFA 4FMAA 3N8BA 3X3YA 1VQO3 1BUJA 4R80A 1RCLA 2O9UX 1BRIA 2RBIA 1IVXA 3MYTA 4GSPA 1RN1A 5M19A 1I2GA 3CNXA 3OWSA 1JJ22 2F98A 5AIIA 1BRGA 5HOHA 5M1AA 1ULJB 1MWTA 2XGNA 3DZLA 5BU4A 2GBWB 3X42A 4U13A 1SIHA 2JDIH 4EC6A 3PYJA 1E3RA 1UI7A 1BOXA 1W6GA 2UUGC 1M1K4 1FA3A 2GBXB 3EE1A 2OOVA 1GMRA 1UCKA 2IUJA 3FGYA 1KWIA 1EG9B 3DGNA 4FCJA 3SEDA 2LYXA 1BUQA 7STDA 2KRTA 1B2UA 1B3SA 1MOLA 1RGAA 3GRDA 1YI23 3GAXA 2GXFA 2GEYA 1AV4A 1W5ZA 3OWUA 5JPUA 1B2XA 2KAAA 3F8HA 4XDVA 2ZDJA 2IA7A 1VQM3 6RNTA 5ELJA 2F99A 1YHQ3 2A15A 3U1WA 1JB5A 1B21A 3D4AA 1QAKA 5G1KA 1Z1SA 1GY7A 1IVWA 2RNTA 1VQ73 2QIYA 1LXEA 3LT8A 1RRHA 4XBXA 1RN7A 3AMOA 3FKAA 2JQ5A 3F9SA 3OX9A 4Q53A 1BNFA 1Q40B 1T3BA 1YNVX 2F56A 4WHAA 5IG3A 2QEX3 4HYZA 2O3OA 3NM2A 2CX1A 2I9WA 2AAEA 3Q3FA 2UX0A 7GSPA 1LOVA 3VF1A 2GEXA 3FF2A 1JKGB 4HAAA 4J5GA 2HMJB 3O8YA 2B1XB 1YJ93 1U5OA 1GD3A 3FG3A 1GOVA 1Q9EA 1OHSA 1UGIA 4OUQA 1EUIC 5G1LA 2CHCA 2YX9A 1NWWA 1JBRA 1E3VA 3LXUX 1WMPA 3CPW2 1RRLA 3S27A 1T2IA 2KF5A 2HMLB 3JUOA 2BNGA 4BU4A 2KXGA 1G0TA 1QJGA 3GZRA 4HKVB 4I4KA 4AEQA 1FGRA 4OVMA 1W02A 2R4IA 4K1UA 3BNDA 3SX1A 1NDOB 1IVVA 2XRXB 3H51A 5M18A 1JRQA 2XSOB 1VQ53 2OWPA 4KT3B 2K3DA 4RBNA 1IQ8A 3G4S3 3KFQC 1FUSA 1ROAA 1A2PA 2P0MA 1QALA 4RNTA 4N6V0 5AYRB 1AVKA 5LC7A 3MSOA 1QVG2 2XSHB 4ZM8A 2F5WA 3HIGA 3T8UA 3AGOA 1FUWA 1IQYA 2W2CA 1STFI 1VQ63 5JBSA 4HOHA 2K54A 2XR8B 4WFOA 1QVF2 1Q814 2F5MA 1B2SA 1N5HA 4WYKA 2XF3A 3DUKA 2FXTA 3PS8A 3EN8A 4O02B 1HU9A 4FMCA 5D83A 5IG0A 1YIJ3 3EC9A 3CD63 2PNCA 3RGRA 2HMNB 1JB4A 3FH1A 1UUVB 1WTHA 3STDA 2ZL8A 4XBTA 2ML5A 4MMXB 1OPYA 1SQWA 1A90A 1C54A 4HM1B 4O8SA 4K1VA 3CME3 1BRJA 2CFDA 4K61A 1Q7Y4 3JUPA 1A67A 1WNHA 1FGQA 1BU4A 4CPKA 4EV2A 4QWTA 5KP4A 1YVBI 2YFJB 4HM3B 3G0KA 2CG0A 4RZMA 3NBBA 4L8OA 1ULIB 2W56A 1BRSA 3URPA 3CC73 5BXQA 3DGLA 1GMPA 2RGQA 3EF8A 1LQGC 4FCMA 1OACA 1DMMA 3MHEA 4N6TA 2CH9A 1DYUA 2K0MA 1VQ83 2KCDA 2HOHA 3V92A 3BU4A 3WA2X 2CFKA 6GSPA 3KSPA 1VQP3 1BNRA 2WO0A 2H0IA 2Z76A 3CCR3 4AKYA 3S5CA 3K7CA 1GD4A 1LVNA 1UGHI 2PZVA 1MNLA 3B4PA 3NQZA 1FZUA 4EXRA 4G1MB 1W2ZA 1G96A 2FGTA 1JN5B 4X2OA 1W7CA 4WWUC 3ER7A 1GOYA 2W9PA 4KFEA 1A2VA 1UI8A 3ROBA 1JBTA 1Q864 3DGOA 5CK6A 2HMMB 2OOVC 1OF5B 3EBYA 1VZZA 2RSXA 3NV0B 1CEWI 3V98A 6STDA 1S723 4STDA 1DETA 1HZ1A 1D6ZA 4RNZA 5G2GA 4MMYB 2WOHA 5KP1A 3CC43 3OV4A 2KF4A 1I8VA 2MF7A 3EB8A 2IMJA 3NBRA 2BU4A 3FG1A 4GB5A 3Q2PA 5IENA 2CFGA 3FSDA 3CCL3 2CWTA 3UB1A 3EN1B 3CC23 1IDPA 1I0XA 3OXAA 4MMZB 1HKXA 1YGEA 1GSPA 3N9HA 1CYUA 1OGXA 1K734 1TP6A 3GZYB 2C10A 1RLSA 2Y74A 4LGQA 1RSNA 4J5KA 4XM4A 1FGTA 3E99A 1CQSA 1LOWA 3ALAA 2C11A 5D81A 4N3VA 2CW9A 1ASKA 3UJMA 4LSOA 1NNVA 3X3ZA 4FCZA 1BRHA 2Z77A 1STDA 2YFLB
chains in the Genus database with same CATH topology
1IYYA 2F4YA 1RGHA 1FUSA 1BSAA 4GHOA 1A2PA 1RGGA 1BNSA 1PY3A 4RNTA 1T2HA 1LRAA 3KCHA 1TTOA 1MGRA 2F5WA 3D5GA 1RGFA 3AGOA 1MGWA 1RMSA 1X1UA 1YVSA 4HOHA 3HOHA 1BSBA 1AQZA 2F5MA 1B2SA 1BNEA 1FUTA 2KF3A 1I3IA 1TRPA 1I70A 1I3FA 3A5EA 1RNBA 3WR2A 3AHSA 1UCIA 1X1WA 1BAOA 5RNTA 1BANA 1G02A 1LNIA 1RHLA 3DGYA 1PYLA 3WHOA 1C54A 1BUJA 7RNTA 1RCLA 1BNIA 1BRJA 1BRIA 2RBIA 4GSPA 1RN1A 1I2GA 1TRQA 1BU4A 1BRGA 5HOHA 5BU4A 3URPA 1BRSA 1SARA 1BSCA 1LOYA 1CH0A 1GMPA 1BOXA 1I2FA 1GMRA 1AY7A 1UCKA 2HOHA 1RCKA 3BU4A 1BVIA 9RNTA 1B27A 6GSPA 1B2UA 1B3SA 1RGAA 1BNRA 1BSEA 1DE3A 1RTUA 1RGLA 1RGKA 1BNJA 1B2XA 1I0VA 1ZGXA 2KAAA 1BGSA 1BRKA 1FZUA 1GOUA 6RNTA 1RGEA 3GSPA 1GMQA 1YGWA 3AHWA 2SARA 1X1YA 1GOYA 3RNTA 1B21A 1BRNL 3D4AA 1JBTA 2KF6A 8RNTA 2RNTA 1B2ZA 2C4BA 1DETA 1HZ1A 1B20A 1R4YA 1HYFA 1BNFA 2F56A 2ZA4A 1YNVX 1JBSA 1RGCA 3AGNA 1B2MA 2KF4A 1I8VA 2BU4A 2AAEA 3Q3FA 1BNGA 1BIRA 7GSPA 1LOVA 1FYSA 1RN4A 4J5GA 4HAAA 1I0XA 2BIRA 1RNTA 1BSDA 1GSPA 1GOVA 1Q9EA 1UCLA 2AADA 1JBRA 1RLSA 1T2IA 2KF5A 3BIRA 1FW7A 1RSNA 4J5KA 3SYUA 5BIRA 4BU4A 4BIRA 1LOWA 2GSPA 1I2EA 3D5IA 1RDSA 1X1XA 1UCJA 1BRHA 3DH2A 5GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYY A;  2F4Y A;  1RGH A;  1FUS A;  1BSA A;  4GHO A;  1A2P A;  1RGG A;  1BNS A;  1PY3 A;  4RNT A;  1T2H A;  1LRA A;  3KCH A;  1TTO A;  1MGR A;  2F5W A;  3D5G A;  1RGF A;  3AGO A;  1MGW A;  1RMS A;  1X1U A;  1YVS A;  4HOH A;  3HOH A;  1BSB A;  1AQZ A;  2F5M A;  1B2S A;  1BNE A;  1FUT A;  2KF3 A;  1I3I A;  1TRP A;  1I70 A;  1I3F A;  3A5E A;  1RNB A;  3WR2 A;  3AHS A;  1UCI A;  1X1W A;  1BAO A;  5RNT A;  1BAN A;  1G02 A;  1LNI A;  1RHL A;  3DGY A;  1PYL A;  3WHO A;  1C54 A;  1BUJ A;  7RNT A;  1RCL A;  1BNI A;  1BRJ A;  1BRI A;  2RBI A;  4GSP A;  1RN1 A;  1I2G A;  1TRQ A;  1BU4 A;  1BRG A;  5HOH A;  5BU4 A;  3URP A;  1BRS A;  1SAR A;  1BSC A;  1LOY A;  1CH0 A;  1GMP A;  1BOX A;  1I2F A;  1GMR A;  1AY7 A;  1UCK A;  2HOH A;  1RCK A;  3BU4 A;  1BVI A;  9RNT A;  1B27 A;  6GSP A;  1B2U A;  1B3S A;  1RGA A;  1BNR A;  1BSE A;  1DE3 A;  1RTU A;  1RGL A;  1RGK A;  1BNJ A;  1B2X A;  1I0V A;  1ZGX A;  2KAA A;  1BGS A;  1BRK A;  1FZU A;  1GOU A;  6RNT A;  1RGE A;  3GSP A;  1GMQ A;  1YGW A;  3AHW A;  2SAR A;  1X1Y A;  1GOY A;  3RNT A;  1B21 A;  1BRN L;  3D4A A;  1JBT A;  2KF6 A;  8RNT A;  2RNT A;  1B2Z A;  2C4B A;  1DET A;  1HZ1 A;  1B20 A;  1R4Y A;  1HYF A;  1BNF A;  2F56 A;  2ZA4 A;  1YNV X;  1JBS A;  1RGC A;  3AGN A;  1B2M A;  2KF4 A;  1I8V A;  2BU4 A;  2AAE A;  3Q3F A;  1BNG A;  1BIR A;  7GSP A;  1LOV A;  1FYS A;  1RN4 A;  4J5G A;  4HAA A;  1I0X A;  2BIR A;  1RNT A;  1BSD A;  1GSP A;  1GOV A;  1Q9E A;  1UCL A;  2AAD A;  1JBR A;  1RLS A;  1T2I A;  2KF5 A;  3BIR A;  1FW7 A;  1RSN A;  4J5K A;  3SYU A;  5BIR A;  4BU4 A;  4BIR A;  1LOW A;  2GSP A;  1I2E A;  3D5I A;  1RDS A;  1X1X A;  1UCJ A;  1BRH A;  3DH2 A;  5GSP A; 
#chains in the Genus database with same CATH topology
 1RGH A;  5AIF A;  3X3X A;  1WMN A;  1BSA A;  1Q7H A;  1TFK A;  4HM0 B;  3MG3 A;  1RGG A;  4CDL A;  3WDG B;  1BNS A;  4KFF A;  3DY5 A;  1T2H A;  3KCH A;  3KII A;  1TTO A;  1MGR A;  3ZG0 A;  2R41 A;  1V58 A;  3K5T A;  5AEW B;  3KZT A;  1KD1 4;  3S28 A;  1MGW A;  1RMS A;  2YFI B;  3CCJ 3;  2H0H A;  1YVS A;  2CIU A;  1AQZ A;  3PZW A;  3G6E 3;  3F14 A;  1MWU A;  3BLZ A;  4KZ1 A;  1Q40 A;  1I3F A;  3A5E A;  5CF1 A;  3ZFZ A;  1ROV A;  1AVL A;  3V99 A;  3IJE B;  2GU1 A;  2P38 A;  1AR0 A;  3MG2 A;  2P0X A;  1FGO A;  4EBG A;  1BAO A;  5EVH A;  2MC8 A;  5RNT A;  1BAN A;  1LNI A;  1EA2 A;  3D79 A;  4GL6 A;  1NU3 A;  2CG1 A;  1PYL A;  3GZX B;  1JNQ A;  1OH0 A;  1UW1 A;  3LYG A;  1VQ9 3;  3CPO A;  2LQV A;  2CFW A;  1C7H A;  3HX8 A;  1FGM A;  3JUQ A;  1UUW B;  3K63 A;  3LOY A;  2RFR A;  2XGL A;  3F7S A;  2HMO B;  2CWU A;  2E2V A;  1UDI I;  1OGZ A;  1V74 A;  4WP5 A;  1MWR A;  3BNB A;  1LOY A;  5AIG A;  4EYC A;  4O3V A;  1T5Y A;  5IW9 A;  2XFT A;  1I2F A;  2D1W A;  4L7K A;  1Y4K A;  2E2U A;  3NXJ A;  3G71 3;  3BNE A;  5BVB A;  1ZO2 A;  4HM5 B;  1KQS 2;  1US1 A;  3KN4 A;  1IV9 A;  1MWS A;  9RNT A;  1B27 A;  4I5Q A;  3MKI A;  2OQE A;  1N5P A;  4DKI A;  1RTU A;  2V1L A;  4HZB B;  4BTW A;  5JPP A;  1DE3 A;  4HM6 B;  4R9L A;  2STD A;  1YJN 3;  1RGK A;  4IIA A;  1BNJ A;  2CKF B;  3B8L A;  3KSE D;  3I56 3;  1F8N A;  3D9R A;  1BGS A;  1GOU A;  1KC8 4;  4IPB A;  5CF2 A;  1RGE A;  3GSP A;  5EEO A;  3AHW A;  3K0Z A;  5IG4 A;  2SAR A;  3LTA A;  1D6Y A;  3IPT A;  4HM4 B;  4H3U A;  3RNT A;  5IEP A;  1K28 A;  2KF6 A;  5STD A;  8RNT A;  3I55 3;  4N6M A;  1TIJ A;  1IU7 A;  2WOF A;  3SVA A;  1D6U A;  2C4B A;  1ZX2 A;  3CCQ 3;  2XFS A;  1B20 A;  3JVC A;  3SOA A;  3NBJ A;  3SLU A;  2ZA4 A;  1JBS A;  1DVD A;  3AGN A;  1DMQ A;  2WGQ A;  5LC6 A;  4BL2 A;  1Q42 A;  3EJV A;  1OCV A;  3JUM A;  2QA4 3;  5AYS C;  1CYV A;  1YJW 3;  3L0R A;  1BNG A;  3OW2 2;  5IEO A;  3NM7 A;  3WOF B;  1GY5 A;  3PXM A;  3CCV 3;  1QAF A;  1QMA A;  1KSI A;  1W4N A;  1BSD A;  1RNT A;  4PEJ A;  1JZD A;  1LQM B;  2FNQ A;  3QK9 A;  1K9M 4;  1VQQ A;  2IY2 A;  2M7O A;  5IG5 A;  1TU5 A;  3BIR A;  4HM2 B;  2OTL 3;  3F8X A;  2CK3 H;  3DXO A;  3SYU A;  1FW7 A;  4BIR A;  1GYB A;  1JV2 B;  2GSP A;  3OWY A;  1I2E A;  4L8P A;  3EQQ B;  1OHO A;  1RDS A;  1OUN A;  3JUN A;  1UCJ A;  1W01 A;  5D82 A;  3DH2 A;  5AIH A;  1A2K A;  4NHF A;  5HGR A;  1DMN A;  3LML A;  3SOY A;  2F4Y A;  3FF0 A;  3VGN A;  1J2B A;  1VQN 3;  2W04 A;  1JN5 A;  1K41 A;  4LEH A;  2P05 A;  4KVH A;  1N9J A;  2CX0 A;  3DMC A;  1PY3 A;  3MWZ A;  4CJN A;  3EBT A;  1LRA A;  3HI7 A;  1IK3 A;  2UGI A;  3X40 A;  4N6L A;  1W6C A;  3D5G A;  4K90 B;  1OF5 A;  2OCT A;  3NV0 A;  3K9M C;  3HOH A;  1BSB A;  2KF3 A;  2BHM A;  1BNE A;  5DRE A;  1TRP A;  4AKZ A;  4HZ9 B;  4LMI A;  3CCE 3;  1M1X B;  1RNB A;  3EX9 A;  4J9A A;  1N8R 4;  2CC3 A;  4N6N B;  2BMQ B;  3AHS A;  3G16 A;  3U97 A;  3CCM 3;  1TFO A;  1UCI A;  3FZW A;  4TX4 A;  1PU4 A;  3ECF A;  3LTB A;  1V57 A;  3FG4 A;  1NB5 I;  1W6Y A;  1E97 A;  3BB9 A;  1EEJ A;  1G02 A;  5EQL A;  1WMO A;  1U8C B;  3DGY A;  3PGB A;  1O7G B;  2J8X B;  3B7C A;  4H61 A;  4R4K A;  3AMO B;  1PFP A;  3DM8 A;  2D42 A;  3WHO A;  1W00 A;  1SPU A;  1TJD A;  3DGM A;  3PCR A;  3CXC 2;  5ELU A;  7RNT A;  1BNI A;  1N8Q A;  4HBR A;  1LNH A;  3NQY A;  3MG1 A;  1TRQ A;  3MPH A;  3T8N A;  3B4O A;  1EKM A;  1VQK 3;  1O7W B;  3HK4 A;  4JF8 A;  4KFD A;  4BTY A;  4EV5 A;  5IER A;  2BT3 A;  3CMA 3;  2OTJ 3;  1IT8 A;  1N9E A;  1BSC A;  1O7H B;  1SAR A;  4LZI A;  3NUV A;  1CH0 A;  4FMD A;  3WA3 A;  3LT9 A;  5AEU B;  1NO3 A;  3I0Y A;  4EW5 A;  1Q82 4;  1AY7 A;  4HJL B;  3SXX A;  4XB5 A;  3CCS 3;  1RCK A;  3H3H A;  4OK0 A;  2F86 B;  1BVI A;  3IMA B;  5FGO A;  1W2B 2;  1O7M B;  5AI1 A;  2IUK A;  1BSE A;  1JKG A;  3FLJ A;  4FR9 A;  5DRV A;  1RGL A;  3GZB A;  4HM7 B;  4XDW A;  1ISK A;  1ZGX A;  1I0V A;  1O7P B;  4NPB A;  3UL6 A;  1BRK A;  1IVU A;  4IT7 A;  3WMD A;  3UNL A;  3LTC A;  2L4V A;  1GMQ A;  1OHP A;  1YGW A;  2HMK B;  3Q90 A;  1IQX A;  1X1Y A;  2ML6 A;  2Q07 A;  2Y73 A;  1SJW A;  1BRN L;  2BMO B;  4HM8 B;  1O7N B;  2W0Q A;  3HZP A;  4ILF A;  4LYL B;  1EQK A;  1B2Z A;  2WGO A;  3LH4 A;  3HII A;  2W9Q A;  4X2H A;  4XBY A;  2E2T A;  5IF6 A;  1R4Y A;  2BMR B;  3NHX A;  3CNM A;  4WYK B;  1HYF A;  3CU3 A;  1S5A A;  3KKG A;  2OQE C;  1RGC A;  1LOX A;  1L5G B;  4CCV A;  3J7Y d;  1B2M A;  1JB2 A;  3FCS B;  2CFL A;  1GY6 A;  2SBL A;  2W6J H;  1BIR A;  5CLK A;  3WOD G;  2B24 B;  1FYS A;  1RN4 A;  3QRD A;  3RDE A;  5KP3 A;  2BIR A;  1UCL A;  1YIT 3;  1K8A 4;  2AAD A;  1TUH A;  3N54 B;  1VQL 3;  3BNC A;  2RCD A;  1NJI 4;  3Q1C A;  3S29 A;  5BIR A;  1ZS7 A;  3KE7 A;  3LZA A;  1SII A;  5CXO A;  2Z7A A;  4MEI A;  3LTD A;  3M8C A;  3T0U A;  2W03 A;  3WOE B;  2W56 B;  5TGN A;  3D5I A;  1NB3 I;  1VQ4 3;  1UUG B;  4BTX A;  2XH9 A;  1X1X A;  2ZHX B;  3TDG A;  3F7X A;  2QGU A;  4N6U A;  4NRE A;  5GSP A;  2L1S A;  5A0O B;  3UL5 A;  1IYY A;  3X41 A;  4GHO A;  3A76 A;  1M9G A;  2CWV A;  5I97 A;  1JZO A;  4BL3 A;  4N6O B;  4R1K A;  1RKY A;  3S67 A;  3CCU 3;  4FMB A;  3D3L A;  2P09 A;  1IV7 A;  1RGF A;  4RNY A;  8CHO A;  1X1U A;  4J8T A;  4R9K A;  2Z6B A;  1M90 4;  3VSY A;  1FUT A;  1RJO A;  1I3I A;  3GWR A;  1I70 A;  4O2H A;  5FW5 A;  2GU3 A;  1IT7 A;  3WR2 A;  3G8Z A;  3ZG5 A;  2H0G A;  2INX A;  1GS3 A;  3RGA A;  1X1W A;  2XEP A;  2BO9 B;  1R4C A;  3F40 A;  1WQL B;  3EHC A;  1RHL A;  3NX0 A;  2IYJ A;  4HVN A;  1DVC A;  3PCS A;  4MJD A;  4ORL A;  4JRF A;  4FMA A;  3N8B A;  3X3Y A;  1VQO 3;  1BUJ A;  4R80 A;  1RCL A;  2O9U X;  1BRI A;  2RBI A;  1IVX A;  3MYT A;  4GSP A;  1RN1 A;  5M19 A;  1I2G A;  3CNX A;  3OWS A;  1JJ2 2;  2F98 A;  5AII A;  1BRG A;  5HOH A;  5M1A A;  1ULJ B;  1MWT A;  2XGN A;  3DZL A;  5BU4 A;  2GBW B;  3X42 A;  4U13 A;  1SIH A;  2JDI H;  4EC6 A;  3PYJ A;  1E3R A;  1UI7 A;  1BOX A;  1W6G A;  2UUG C;  1M1K 4;  1FA3 A;  2GBX B;  3EE1 A;  2OOV A;  1GMR A;  1UCK A;  2IUJ A;  3FGY A;  1KWI A;  1EG9 B;  3DGN A;  4FCJ A;  3SED A;  2LYX A;  1BUQ A;  7STD A;  2KRT A;  1B2U A;  1B3S A;  1MOL A;  1RGA A;  3GRD A;  1YI2 3;  3GAX A;  2GXF A;  2GEY A;  1AV4 A;  1W5Z A;  3OWU A;  5JPU A;  1B2X A;  2KAA A;  3F8H A;  4XDV A;  2ZDJ A;  2IA7 A;  1VQM 3;  6RNT A;  5ELJ A;  2F99 A;  1YHQ 3;  2A15 A;  3U1W A;  1JB5 A;  1B21 A;  3D4A A;  1QAK A;  5G1K A;  1Z1S A;  1GY7 A;  1IVW A;  2RNT A;  1VQ7 3;  2QIY A;  1LXE A;  3LT8 A;  1RRH A;  4XBX A;  1RN7 A;  3AMO A;  3FKA A;  2JQ5 A;  3F9S A;  3OX9 A;  4Q53 A;  1BNF A;  1Q40 B;  1T3B A;  1YNV X;  2F56 A;  4WHA A;  5IG3 A;  2QEX 3;  4HYZ A;  2O3O A;  3NM2 A;  2CX1 A;  2I9W A;  2AAE A;  3Q3F A;  2UX0 A;  7GSP A;  1LOV A;  3VF1 A;  2GEX A;  3FF2 A;  1JKG B;  4HAA A;  4J5G A;  2HMJ B;  3O8Y A;  2B1X B;  1YJ9 3;  1U5O A;  1GD3 A;  3FG3 A;  1GOV A;  1Q9E A;  1OHS A;  1UGI A;  4OUQ A;  1EUI C;  5G1L A;  2CHC A;  2YX9 A;  1NWW A;  1JBR A;  1E3V A;  3LXU X;  1WMP A;  3CPW 2;  1RRL A;  3S27 A;  1T2I A;  2KF5 A;  2HML B;  3JUO A;  2BNG A;  4BU4 A;  2KXG A;  1G0T A;  1QJG A;  3GZR A;  4HKV B;  4I4K A;  4AEQ A;  1FGR A;  4OVM A;  1W02 A;  2R4I A;  4K1U A;  3BND A;  3SX1 A;  1NDO B;  1IVV A;  2XRX B;  3H51 A;  5M18 A;  1JRQ A;  2XSO B;  1VQ5 3;  2OWP A;  4KT3 B;  2K3D A;  4RBN A;  1IQ8 A;  3G4S 3;  3KFQ C;  1FUS A;  1ROA A;  1A2P A;  2P0M A;  1QAL A;  4RNT A;  4N6V 0;  5AYR B;  1AVK A;  5LC7 A;  3MSO A;  1QVG 2;  2XSH B;  4ZM8 A;  2F5W A;  3HIG A;  3T8U A;  3AGO A;  1FUW A;  1IQY A;  2W2C A;  1STF I;  1VQ6 3;  5JBS A;  4HOH A;  2K54 A;  2XR8 B;  4WFO A;  1QVF 2;  1Q81 4;  2F5M A;  1B2S A;  1N5H A;  4WYK A;  2XF3 A;  3DUK A;  2FXT A;  3PS8 A;  3EN8 A;  4O02 B;  1HU9 A;  4FMC A;  5D83 A;  5IG0 A;  1YIJ 3;  3EC9 A;  3CD6 3;  2PNC A;  3RGR A;  2HMN B;  1JB4 A;  3FH1 A;  1UUV B;  1WTH A;  3STD A;  2ZL8 A;  4XBT A;  2ML5 A;  4MMX B;  1OPY A;  1SQW A;  1A90 A;  1C54 A;  4HM1 B;  4O8S A;  4K1V A;  3CME 3;  1BRJ A;  2CFD A;  4K61 A;  1Q7Y 4;  3JUP A;  1A67 A;  1WNH A;  1FGQ A;  1BU4 A;  4CPK A;  4EV2 A;  4QWT A;  5KP4 A;  1YVB I;  2YFJ B;  4HM3 B;  3G0K A;  2CG0 A;  4RZM A;  3NBB A;  4L8O A;  1ULI B;  2W56 A;  1BRS A;  3URP A;  3CC7 3;  5BXQ A;  3DGL A;  1GMP A;  2RGQ A;  3EF8 A;  1LQG C;  4FCM A;  1OAC A;  1DMM A;  3MHE A;  4N6T A;  2CH9 A;  1DYU A;  2K0M A;  1VQ8 3;  2KCD A;  2HOH A;  3V92 A;  3BU4 A;  3WA2 X;  2CFK A;  6GSP A;  3KSP A;  1VQP 3;  1BNR A;  2WO0 A;  2H0I A;  2Z76 A;  3CCR 3;  4AKY A;  3S5C A;  3K7C A;  1GD4 A;  1LVN A;  1UGH I;  2PZV A;  1MNL A;  3B4P A;  3NQZ A;  1FZU A;  4EXR A;  4G1M B;  1W2Z A;  1G96 A;  2FGT A;  1JN5 B;  4X2O A;  1W7C A;  4WWU C;  3ER7 A;  1GOY A;  2W9P A;  4KFE A;  1A2V A;  1UI8 A;  3ROB A;  1JBT A;  1Q86 4;  3DGO A;  5CK6 A;  2HMM B;  2OOV C;  1OF5 B;  3EBY A;  1VZZ A;  2RSX A;  3NV0 B;  1CEW I;  3V98 A;  6STD A;  1S72 3;  4STD A;  1DET A;  1HZ1 A;  1D6Z A;  4RNZ A;  5G2G A;  4MMY B;  2WOH A;  5KP1 A;  3CC4 3;  3OV4 A;  2KF4 A;  1I8V A;  2MF7 A;  3EB8 A;  2IMJ A;  3NBR A;  2BU4 A;  3FG1 A;  4GB5 A;  3Q2P A;  5IEN A;  2CFG A;  3FSD A;  3CCL 3;  2CWT A;  3UB1 A;  3EN1 B;  3CC2 3;  1IDP A;  1I0X A;  3OXA A;  4MMZ B;  1HKX A;  1YGE A;  1GSP A;  3N9H A;  1CYU A;  1OGX A;  1K73 4;  1TP6 A;  3GZY B;  2C10 A;  1RLS A;  2Y74 A;  4LGQ A;  1RSN A;  4J5K A;  4XM4 A;  1FGT A;  3E99 A;  1CQS A;  1LOW A;  3ALA A;  2C11 A;  5D81 A;  4N3V A;  2CW9 A;  1ASK A;  3UJM A;  4LSO A;  1NNV A;  3X3Z A;  4FCZ A;  1BRH A;  2Z77 A;  1STD A;  2YFL B; 
#chains in the Genus database with same CATH homology
 1IYY A;  2F4Y A;  1RGH A;  1FUS A;  1BSA A;  4GHO A;  1A2P A;  1RGG A;  1BNS A;  1PY3 A;  4RNT A;  1T2H A;  1LRA A;  3KCH A;  1TTO A;  1MGR A;  2F5W A;  3D5G A;  1RGF A;  3AGO A;  1MGW A;  1RMS A;  1X1U A;  1YVS A;  4HOH A;  3HOH A;  1BSB A;  1AQZ A;  2F5M A;  1B2S A;  1BNE A;  1FUT A;  2KF3 A;  1I3I A;  1TRP A;  1I70 A;  1I3F A;  3A5E A;  1RNB A;  3WR2 A;  3AHS A;  1UCI A;  1X1W A;  1BAO A;  5RNT A;  1BAN A;  1G02 A;  1LNI A;  1RHL A;  3DGY A;  1PYL A;  3WHO A;  1C54 A;  1BUJ A;  7RNT A;  1RCL A;  1BNI A;  1BRJ A;  1BRI A;  2RBI A;  4GSP A;  1RN1 A;  1I2G A;  1TRQ A;  1BU4 A;  1BRG A;  5HOH A;  5BU4 A;  3URP A;  1BRS A;  1SAR A;  1BSC A;  1LOY A;  1CH0 A;  1GMP A;  1BOX A;  1I2F A;  1GMR A;  1AY7 A;  1UCK A;  2HOH A;  1RCK A;  3BU4 A;  1BVI A;  9RNT A;  1B27 A;  6GSP A;  1B2U A;  1B3S A;  1RGA A;  1BNR A;  1BSE A;  1DE3 A;  1RTU A;  1RGL A;  1RGK A;  1BNJ A;  1B2X A;  1I0V A;  1ZGX A;  2KAA A;  1BGS A;  1BRK A;  1FZU A;  1GOU A;  6RNT A;  1RGE A;  3GSP A;  1GMQ A;  1YGW A;  3AHW A;  2SAR A;  1X1Y A;  1GOY A;  3RNT A;  1B21 A;  1BRN L;  3D4A A;  1JBT A;  2KF6 A;  8RNT A;  2RNT A;  1B2Z A;  2C4B A;  1DET A;  1HZ1 A;  1B20 A;  1R4Y A;  1HYF A;  1BNF A;  2F56 A;  2ZA4 A;  1YNV X;  1JBS A;  1RGC A;  3AGN A;  1B2M A;  2KF4 A;  1I8V A;  2BU4 A;  2AAE A;  3Q3F A;  1BNG A;  1BIR A;  7GSP A;  1LOV A;  1FYS A;  1RN4 A;  4J5G A;  4HAA A;  1I0X A;  2BIR A;  1RNT A;  1BSD A;  1GSP A;  1GOV A;  1Q9E A;  1UCL A;  2AAD A;  1JBR A;  1RLS A;  1T2I A;  2KF5 A;  3BIR A;  1FW7 A;  1RSN A;  4J5K A;  3SYU A;  5BIR A;  4BU4 A;  4BIR A;  1LOW A;  2GSP A;  1I2E A;  3D5I A;  1RDS A;  1X1X A;  1UCJ A;  1BRH A;  3DH2 A;  5GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...