1I8VA

Crystal structure of rnase sa y80f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDFYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Tyrosine hydrogen bonds make a large contribution to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i8vA00
3DH2A 1FW7A 1B27A 1BRSA 7RNTA 1LOYA 2BIRA 4BU4A 1B20A 1DETA 1RGCA 1IYYA 1A2PA 1B2MA 1GMRA 1X1UA 4GHOA 3AHSA 1B21A 1RNBA 3HOHA 1BIRA 1RMSA 6GSPA 5RNTA 1BVIA 1FYSA 4HAAA 4RNTA 4GSPA 1MGRA 1RGGA 5HOHA 1LRAA 1TTOA 1I3FA 1X1XA 1BNSA 1ZGXA 1RTUA 1LOWA 1RHLA 1BRKA 1HZ1A 2F4YA 3A5EA 2ZA4A 1Q9EA 2F56A 1RGFA 2AADA 1BNJA 1UCIA 1BAOA 1BSBA 3GSPA 8RNTA 1BNGA 1FZUA 1RLSA 1PY3A 1GMQA 1RGKA 1BNFA 1MGWA 1BUJA 1YNVX 1RCKA 1UCKA 6RNTA 3D5GA 1PYLA 3AGNA 1JBSA 1YGWA 1B2SA 1I2FA 5GSPA 2KF6A 3BU4A 9RNTA 1GSPA 3WHOA 1BOXA 1RGAA 2KF3A 1X1WA 1GOYA 3BIRA 3D5IA 1SARA 2HOHA 1FUTA 4J5KA 7GSPA 1BRIA 2KAAA 1AQZA 1I3IA 5BIRA 2BU4A 1X1YA 1RCLA 1JBTA 1DE3A 1I70A 1BRGA 1BANA 2AAEA 3SYUA 1RGHA 1RN1A 1I0VA 1BSCA 1LNIA 3D4AA 1GOUA 1C54A 1B2ZA 1BRNL 1G02A 4HOHA 1BNIA 1I2GA 2KF4A 1RN4A 1B3SA 1YVSA 2SARA 1BU4A 3WR2A 2F5MA 1UCJA 5BU4A 1AY7A 1RNTA 1R4YA 3URPA 1UCLA 1BSDA 4BIRA 2KF5A 1RGEA 1LOVA 1GMPA 1GOVA 1I2EA 1BSAA 1HYFA 3Q3FA 3KCHA 1BNRA 1BRHA 1JBRA 1CH0A 1TRQA 2GSPA 1B2UA 3AHWA 1I8VA 2C4BA 1BRJA 1RGLA 1FUSA 1I0XA 4J5GA 1BSEA 1RDSA 2F5WA 1BGSA 1T2IA 2RBIA 3DGYA 1B2XA 3AGOA 3RNTA 1BNEA 1RSNA 1TRPA 2RNTA 1T2HA
chains in the Genus database with same CATH superfamily
1B27A 3KKGA 3IMAB 2BNGA 2P05A 7RNTA 2GU1A 2BIRA 1SIHA 4Q53A 1OPYA 1HU9A 3F14A 4EBGA 4I5QA 1AVLA 1X1UA 4LZIA 1LQGC 2XR8B 5AIHA 3S28A 1VQO3 1OHOA 4HZBB 1LVNA 1B21A 1S723 1RNBA 4BTWA 4K1UA 3HI7A 1N8QA 3DGMA 1EG9B 1SPUA 2XF3A 1JN5A 3CCJ3 2WGOA 3G6E3 3F40A 1RTUA 1GY6A 3HK4A 3S5CA 3JUOA 1TUHA 4N6LA 4KVHA 3V92A 1NB3I 1JZOA 4HKVB 3FKAA 3NM2A 1FUWA 1HZ1A 1Q40B 1SIIA 2GEXA 1JJ22 3GZXB 1V58A 2F56A 2CIUA 1OACA 4TX4A 2QA43 1A2VA 1VQL3 1US1A 1BNJA 1UCIA 1BNGA 1KSIA 4RNZA 1RLSA 1PY3A 2GBWB 4WP5A 3H3HA 4L8OA 1BNFA 1IT7A 5LC6A 1KQS2 1RCKA 2L1SA 5IG3A 3S29A 1E3VA 1QAFA 1VQ53 1ZX2A 5M1AA 1JRQA 2OCTA 1QJGA 1K9M4 2OTJ3 2KF6A 3FG1A 3CCR3 3D9RA 1FGMA 1BOXA 2CFWA 3BIRA 5CF2A 1GOYA 2UGIA 1A2KA 3WOFB 1PU4A 3HZPA 2P09A 3I563 3LXUX 1KD14 2XSOB 1FUTA 4XM4A 1V57A 3JUQA 1IVUA 1OGXA 1I3IA 1TFOA 3KIIA 2BU4A 2HMLB 1RCLA 3D79A 3OW22 1K28A 1I70A 3STDA 1VQK3 2PZVA 4O3VA 1QVF2 3CU3A 3UL6A 4ZM8A 3EBTA 6STDA 2ZHXB 3SVAA 5IEPA 1W2B2 2JDIH 3LT8A 1A90A 1ZO2A 4CDLA 1LOXA 1N5HA 2IUKA 3BNEA 3MKIA 4HM2B 4MMXB 4AEQA 3EE1A 2E2TA 3K7CA 2OQEA 4HZ9B 2OOVA 3UJMA 2H0GA 2P0MA 1AY7A 1CYUA 2XSHB 3LTDA 1TJDA 3NQYA 3OX9A 4RBNA 4X2OA 2KF5A 2Y74A 3BNCA 1SQWA 3DUKA 2LYXA 3EJVA 1F8NA 1DMQA 3F8XA 3MSOA 3ZG0A 1AR0A 3LH4A 3FG4A 1GOVA 1I2EA 1PFPA 1LQMB 1NB5I 3DGNA 1NWWA 2H0IA 2KRTA 3MG3A 1RRLA 1O7GB 3T8UA 1NJI4 1YJW3 2ML5A 3CME3 1TIJA 3GRDA 3HIGA 5IEOA 4JF8A 1DVDA 1VQ83 5DRVA 1EUIC 3PCSA 2XEPA 3DGYA 5TGNA 5M18A 2HMNB 1IQXA 3UL5A 2CG0A 4FCZA 4QWTA 1E97A 2I9WA 2K0MA 1BRSA 3LYGA 1LOYA 1QMAA 4MJDA 3SOYA 1DETA 1GY5A 4GB5A 3PS8A 1IYYA 2Z76A 3G713 1B2MA 2H0HA 1GMRA 4GHOA 3CPW2 4OUQA 3UB1A 3PCRA 3QK9A 1OUNA 2WOFA 3LTCA 1BIRA 1LXEA 6GSPA 5RNTA 1BVIA 1OGZA 4GSPA 3DMCA 1UUGB 1MGRA 5EVHA 1EKMA 4NHFA 4HM0B 3NQZA 4LEHA 4XB5A 2D42A 1OF5B 1WMNA 1DVCA 1VQ43 3A76A 2YFLB 4R80A 3X3YA 3LMLA 1IU7A 1BRKA 1HKXA 4LSOA 1RGFA 2E2VA 2C11A 5A0OB 3EX9A 1RN7A 4ILFA 3IPTA 1BSBA 3BNDA 1FZUA 3WA2X 1GMQA 1RGKA 4CJNA 3FSDA 3GWRA 5JPUA 1BUJA 4IPBA 3SX1A 1VQN3 4PEJA 4XBXA 5AYSC 5IENA 1SJWA 4HJLB 3J7Yd 1V74A 4AKZA 2BO9B 1Q7Y4 5GSPA 4H3UA 2YX9A 5G1LA 3BU4A 3WODG 1TU5A 9RNTA 1GSPA 4N6UA 3D5IA 1RGAA 1SARA 3DZLA 3OV4A 4G1MB 4BL2A 2XGLA 3CC23 2GU3A 1VQQA 4N6NB 2F86B 3CC73 1VQP3 2Z6BA 1ISKA 4EXRA 4KFFA 3Q2PA 2KAAA 4WWUC 2IUJA 3NM7A 1WQLB 1JBTA 3NXJA 3CNMA 5CF1A 5FGOA 2WOHA 1NO3A 2K3DA 1S5AA 1RGHA 1I0VA 1BSCA 1LNIA 1OCVA 1YVBI 3D4AA 4K1VA 1ZS7A 3S27A 5STDA 2F99A 3KSPA 3N9HA 3KSED 3EB8A 4HOHA 3PGBA 1BNIA 3F9SA 1DMMA 2IYJA 2ZL8A 5AEUB 7STDA 1RN4A 5ELJA 1VQ73 1B3SA 3CCV3 2SARA 3PZWA 1J2BA 3GZYB 3N8BA 1IK3A 4HVNA 3FLJA 2QIYA 2CFKA 4GL6A 3GZBA 1W01A 4IT7A 5FW5A 1RNTA 4FCMA 1GD3A 1GYBA 1R4YA 1UCLA 3NBJA 2W2CA 5AIIA 5G1KA 1RGEA 2KCDA 2UUGC 3B4PA 4FMDA 4N6MA 1T5YA 1YIJ3 1NDOB 3RDEA 3ROBA 1JN5B 4N6OB 1WTHA 2YFIB 5AI1A 3U1WA 2CC3A 1BNRA 1BRHA 1VQ93 3AHWA 1IVVA 4AKYA 1BRJA 1MWUA 5KP4A 1OHPA 1BSEA 2XGNA 1QALA 4J8TA 4R9KA 3EN1B 3NX0A 1YHQ3 1AV4A 1BGSA 1T2IA 4WFOA 1G96A 4O02B 1UI8A 3ZFZA 1K8A4 1VQ63 1TRPA 2CKFB 3OWYA 3CCM3 1Q864 1W6CA 2GXFA 2RNTA 1T2HA 1IVWA 3DH2A 2B1XB 2W9PA 1BUQA 1FW7A 5G2GA 3G16A 4DKIA 3F7XA 5KP3A 3VSYA 1KWIA 5DREA 5HGRA 2STDA 3O8YA 1W2ZA 4BU4A 2O3OA 1O7PB 2XFTA 2W03A 3FCSB 2OTL3 3V98A 4EW5A 3X42A 1D6ZA 3LTAA 3NBRA 4NREA 4XDWA 3AHSA 2CG1A 3E99A 3FF0A 4R1KA 1M904 3HOHA 3K63A 1FYSA 1IVXA 4HAAA 2CK3H 5D82A 3RGAA 3LT9A 1RGGA 3UNLA 5M19A 1LRAA 1TTOA 2BMOB 1IQYA 1I3FA 1ULIB 3I0YA 3G4S3 1X1XA 2R41A 1ZGXA 2SBLA 1N8R4 1JKGA 1W7CA 4X2HA 3ER7A 2W56A 3AMOA 2P38A 2BT3A 2QGUA 2F4YA 3BNBA 4L7KA 3T0UA 1GS3A 1UDII 3EN8A 3ALAA 3G8ZA 1L5GB 4BTYA 3LZAA 4MMZB 4EV5A 5IF6A 3FGYA 3Q1CA 4EV2A 2V1LA 2K54A 3K9MC 2RGQA 1BAOA 3TDGA 3GSPA 2FGTA 3WA3A 4XDVA 1U8CB 1MGWA 4K61A 3EC9A 4N3VA 1C7HA 1YNVX 4OVMA 3FZWA 1N9EA 5D83A 3DXOA 3DGOA 3D5GA 3MPHA 3N54B 4KZ1A 4LGQA 5AIFA 2ML6A 3AGNA 3EF8A 4N6TA 1JBSA 3OWUA 1K41A 4STDA 3L0RA 3DM8A 1I2FA 1W6YA 1UW1A 4H61A 3U97A 5AIGA 2IY2A 4KT3B 3WHOA 2KF3A 1X1WA 5IERA 2CHCA 2OQEC 2W9QA 2OOVC 1FGOA 4J5KA 7GSPA 2BHMA 3CC43 5CLKA 4J9AA 3CCQ3 5BIRA 8CHOA 1YIT3 4HM1B 5ELUA 5BVBA 1T3BA 1MWRA 1STDA 3T8NA 2A15A 1K734 1YJN3 2AAEA 1ROVA 1WMPA 1JKGB 1W02A 4HYZA 2XFSA 1Q7HA 2IA7A 2W56B 2C10A 4HM4B 1M1K4 1Q824 2CX0A 3LTBA 1IV9A 1WMOA 1OH0A 2KF4A 2CFLA 4KFDA 3CMA3 1YVSA 2BMQB 1BU4A 3KE7A 4WHAA 1JB5A 1TP6A 2XH9A 5AEWB 1EQKA 3V99A 2BMRB 2F5MA 1UCJA 3X3XA 2JQ5A 3JVCA 3I553 1IDPA 1NU3A 2HMOB 2W0QA 2GBXB 5EEOA 1JB2A 1W5ZA 2HMJB 2CFGA 4NPBA 1BSDA 4BIRA 3VF1A 2Z7AA 3NBBA 4EC6A 1LOVA 1FA3A 4FMBA 2J8XB 3ECFA 4BL3A 3SEDA 5IG0A 1MWTA 1M1XB 3Q3FA 4WYKA 5IW9A 4LMIA 2W04A 4MMYB 4L8PA 1CH0A 2FNQA 1ROAA 2GSPA 3Q90A 1JV2B 3B4OA 4CCVA 1Q814 1I8VA 2CWUA 1UGHI 5CXOA 2P0XA 2RSXA 1I0XA 1QAKA 2F98A 3FH1A 4J5GA 4O2HA 2MF7A 1KC84 1O7MB 3DY5A 2YFJB 1QVG2 1AVKA 2D1WA 2F5WA 3CD63 3MHEA 3NV0A 3B7CA 3HIIA 4IIAA 1B2XA 2L4VA 3AGOA 1YI23 3S67A 1FGRA 1D6UA 3RNTA 3KFQC 2HMKB 1BNEA 1RSNA 3F7SA 3WMDA 1N9JA 3GZRA 3X41A 4HM5B 1LNHA 4BTXA 1YGEA 3EQQB 1Z1SA 1CQSA 3MG1A 2E2UA 1UUVB 2IMJA 3SLUA 4R9LA 1B20A 1RGCA 1Y4KA 1CEWI 2CFDA 4FR9A 1A2PA 1IV7A 1UUWB 2O9UX 2LQVA 3CCL3 3PXMA 1RMSA 2RCDA 2FXTA 4O8SA 4RNTA 2Q07A 3WOEB 1UGIA 5D81A 4HM6B 3RGRA 5HOHA 3DGLA 1BNSA 1LOWA 4WYKB 3K5TA 1N5PA 1RRHA 1RHLA 5JPPA 3ZG5A 1CYVA 1MNLA 1O7HB 2W6JH 3G0KA 2RFRA 2ZA4A 3A5EA 1E3RA 4RZMA 1JB4A 1Q9EA 2CX1A 2AADA 3D3LA 5LC7A 3M8CA 4K90B 4MEIA 2OWPA 1IQ8A 8RNTA 2GEYA 4ORLA 3FG3A 1MWSA 1TFKA 4LYLB 3NV0B 2WGQA 1M9GA 1UCKA 3B8LA 6RNTA 4FMCA 4N6V0 3KZTA 1STFI 2KXGA 3SOAA 1PYLA 4HBRA 1D6YA 4EYCA 1EA2A 1NNVA 4XBYA 4KFEA 1A67A 5IG5A 1YGWA 1B2SA 1G0TA 3MWZA 1UI7A 4FCJA 4R4KA 4HM3B 3HX8A 5AYRB 3OWSA 2ZDJA 4CPKA 1JZDA 2HOHA 1OHSA 4I4KA 3CXC2 2R4IA 3CCU3 5IG4A 1BRIA 3X3ZA 1IT8A 1AQZA 1FGTA 1X1YA 2M7OA 1FGQA 1OF5A 1EEJA 1W4NA 2PNCA 5EQLA 1YJ93 3NHXA 1JNQA 1DE3A 5BXQA 3VGNA 1BRGA 1BANA 3EBYA 3WDGB 3FF2A 3SYUA 1RN1A 1C54A 3CCS3 1GOUA 1W6GA 1B2ZA 3CPOA 1BRNL 1G02A 3MYTA 2HMMB 3NUVA 3CCE3 4HM7B 5I97A 2CWTA 1I2GA 5CK6A 3JUMA 5KP1A 1ASKA 2QEX3 2WO0A 1WNHA 1W00A 3GAXA 3WR2A 3PYJA 2B24B 5BU4A 3BLZA 4XBTA 2Y73A 4U13A 2CH9A 3KN4A 3F8HA 3IJEB 2MC8A 3URPA 3X40A 5JBSA 1GMPA 1VQM3 3K0ZA 4OK0A 1BSAA 1HYFA 3LOYA 1MOLA 3KCHA 3OXAA 4HM8B 1GY7A 1GD4A 1RJOA 4JRFA 1RKYA 1Q42A 1Q40A 1ULJB 3SXXA 2UX0A 2CWVA 1TRQA 1JBRA 2XRXB 3BB9A 1B2UA 3AMOB 2C4BA 3CNXA 1RGLA 1FUSA 3EHCA 4FMAA 2INXA 3H51A 4RNYA 1RDSA 2Z77A 2RBIA 3JUNA 1DMNA 1O7WB 1R4CA 1U5OA 3QRDA 1O7NB 1VZZA 2CW9A 3MG2A 3JUPA 1DYUA
chains in the Genus database with same CATH topology
3DH2A 1FW7A 1B27A 1BRSA 7RNTA 1LOYA 2BIRA 4BU4A 1B20A 1DETA 1RGCA 1IYYA 1A2PA 1B2MA 1GMRA 1X1UA 4GHOA 3AHSA 1B21A 1RNBA 3HOHA 1BIRA 1RMSA 6GSPA 5RNTA 1BVIA 1FYSA 4HAAA 4RNTA 4GSPA 1MGRA 1RGGA 5HOHA 1LRAA 1TTOA 1I3FA 1X1XA 1BNSA 1ZGXA 1RTUA 1LOWA 1RHLA 1BRKA 1HZ1A 2F4YA 3A5EA 2ZA4A 1Q9EA 2F56A 1RGFA 2AADA 1BNJA 1UCIA 1BAOA 1BSBA 3GSPA 8RNTA 1BNGA 1FZUA 1RLSA 1PY3A 1GMQA 1RGKA 1BNFA 1MGWA 1BUJA 1YNVX 1RCKA 1UCKA 6RNTA 3D5GA 1PYLA 3AGNA 1JBSA 1YGWA 1B2SA 1I2FA 5GSPA 2KF6A 3BU4A 9RNTA 1GSPA 3WHOA 1BOXA 1RGAA 2KF3A 1X1WA 1GOYA 3BIRA 3D5IA 1SARA 2HOHA 1FUTA 4J5KA 7GSPA 1BRIA 2KAAA 1AQZA 1I3IA 5BIRA 2BU4A 1X1YA 1RCLA 1JBTA 1DE3A 1I70A 1BRGA 1BANA 2AAEA 3SYUA 1RGHA 1RN1A 1I0VA 1BSCA 1LNIA 3D4AA 1GOUA 1C54A 1B2ZA 1BRNL 1G02A 4HOHA 1BNIA 1I2GA 2KF4A 1RN4A 1B3SA 1YVSA 2SARA 1BU4A 3WR2A 2F5MA 1UCJA 5BU4A 1AY7A 1RNTA 1R4YA 3URPA 1UCLA 1BSDA 4BIRA 2KF5A 1RGEA 1LOVA 1GMPA 1GOVA 1I2EA 1BSAA 1HYFA 3Q3FA 3KCHA 1BNRA 1BRHA 1JBRA 1CH0A 1TRQA 2GSPA 1B2UA 3AHWA 1I8VA 2C4BA 1BRJA 1RGLA 1FUSA 1I0XA 4J5GA 1BSEA 1RDSA 2F5WA 1BGSA 1T2IA 2RBIA 3DGYA 1B2XA 3AGOA 3RNTA 1BNEA 1RSNA 1TRPA 2RNTA 1T2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DH2 A;  1FW7 A;  1B27 A;  1BRS A;  7RNT A;  1LOY A;  2BIR A;  4BU4 A;  1B20 A;  1DET A;  1RGC A;  1IYY A;  1A2P A;  1B2M A;  1GMR A;  1X1U A;  4GHO A;  3AHS A;  1B21 A;  1RNB A;  3HOH A;  1BIR A;  1RMS A;  6GSP A;  5RNT A;  1BVI A;  1FYS A;  4HAA A;  4RNT A;  4GSP A;  1MGR A;  1RGG A;  5HOH A;  1LRA A;  1TTO A;  1I3F A;  1X1X A;  1BNS A;  1ZGX A;  1RTU A;  1LOW A;  1RHL A;  1BRK A;  1HZ1 A;  2F4Y A;  3A5E A;  2ZA4 A;  1Q9E A;  2F56 A;  1RGF A;  2AAD A;  1BNJ A;  1UCI A;  1BAO A;  1BSB A;  3GSP A;  8RNT A;  1BNG A;  1FZU A;  1RLS A;  1PY3 A;  1GMQ A;  1RGK A;  1BNF A;  1MGW A;  1BUJ A;  1YNV X;  1RCK A;  1UCK A;  6RNT A;  3D5G A;  1PYL A;  3AGN A;  1JBS A;  1YGW A;  1B2S A;  1I2F A;  5GSP A;  2KF6 A;  3BU4 A;  9RNT A;  1GSP A;  3WHO A;  1BOX A;  1RGA A;  2KF3 A;  1X1W A;  1GOY A;  3BIR A;  3D5I A;  1SAR A;  2HOH A;  1FUT A;  4J5K A;  7GSP A;  1BRI A;  2KAA A;  1AQZ A;  1I3I A;  5BIR A;  2BU4 A;  1X1Y A;  1RCL A;  1JBT A;  1DE3 A;  1I70 A;  1BRG A;  1BAN A;  2AAE A;  3SYU A;  1RGH A;  1RN1 A;  1I0V A;  1BSC A;  1LNI A;  3D4A A;  1GOU A;  1C54 A;  1B2Z A;  1BRN L;  1G02 A;  4HOH A;  1BNI A;  1I2G A;  2KF4 A;  1RN4 A;  1B3S A;  1YVS A;  2SAR A;  1BU4 A;  3WR2 A;  2F5M A;  1UCJ A;  5BU4 A;  1AY7 A;  1RNT A;  1R4Y A;  3URP A;  1UCL A;  1BSD A;  4BIR A;  2KF5 A;  1RGE A;  1LOV A;  1GMP A;  1GOV A;  1I2E A;  1BSA A;  1HYF A;  3Q3F A;  3KCH A;  1BNR A;  1BRH A;  1JBR A;  1CH0 A;  1TRQ A;  2GSP A;  1B2U A;  3AHW A;  1I8V A;  2C4B A;  1BRJ A;  1RGL A;  1FUS A;  1I0X A;  4J5G A;  1BSE A;  1RDS A;  2F5W A;  1BGS A;  1T2I A;  2RBI A;  3DGY A;  1B2X A;  3AGO A;  3RNT A;  1BNE A;  1RSN A;  1TRP A;  2RNT A;  1T2H A; 
#chains in the Genus database with same CATH topology
 1B27 A;  3KKG A;  3IMA B;  2BNG A;  2P05 A;  7RNT A;  2GU1 A;  2BIR A;  1SIH A;  4Q53 A;  1OPY A;  1HU9 A;  3F14 A;  4EBG A;  4I5Q A;  1AVL A;  1X1U A;  4LZI A;  1LQG C;  2XR8 B;  5AIH A;  3S28 A;  1VQO 3;  1OHO A;  4HZB B;  1LVN A;  1B21 A;  1S72 3;  1RNB A;  4BTW A;  4K1U A;  3HI7 A;  1N8Q A;  3DGM A;  1EG9 B;  1SPU A;  2XF3 A;  1JN5 A;  3CCJ 3;  2WGO A;  3G6E 3;  3F40 A;  1RTU A;  1GY6 A;  3HK4 A;  3S5C A;  3JUO A;  1TUH A;  4N6L A;  4KVH A;  3V92 A;  1NB3 I;  1JZO A;  4HKV B;  3FKA A;  3NM2 A;  1FUW A;  1HZ1 A;  1Q40 B;  1SII A;  2GEX A;  1JJ2 2;  3GZX B;  1V58 A;  2F56 A;  2CIU A;  1OAC A;  4TX4 A;  2QA4 3;  1A2V A;  1VQL 3;  1US1 A;  1BNJ A;  1UCI A;  1BNG A;  1KSI A;  4RNZ A;  1RLS A;  1PY3 A;  2GBW B;  4WP5 A;  3H3H A;  4L8O A;  1BNF A;  1IT7 A;  5LC6 A;  1KQS 2;  1RCK A;  2L1S A;  5IG3 A;  3S29 A;  1E3V A;  1QAF A;  1VQ5 3;  1ZX2 A;  5M1A A;  1JRQ A;  2OCT A;  1QJG A;  1K9M 4;  2OTJ 3;  2KF6 A;  3FG1 A;  3CCR 3;  3D9R A;  1FGM A;  1BOX A;  2CFW A;  3BIR A;  5CF2 A;  1GOY A;  2UGI A;  1A2K A;  3WOF B;  1PU4 A;  3HZP A;  2P09 A;  3I56 3;  3LXU X;  1KD1 4;  2XSO B;  1FUT A;  4XM4 A;  1V57 A;  3JUQ A;  1IVU A;  1OGX A;  1I3I A;  1TFO A;  3KII A;  2BU4 A;  2HML B;  1RCL A;  3D79 A;  3OW2 2;  1K28 A;  1I70 A;  3STD A;  1VQK 3;  2PZV A;  4O3V A;  1QVF 2;  3CU3 A;  3UL6 A;  4ZM8 A;  3EBT A;  6STD A;  2ZHX B;  3SVA A;  5IEP A;  1W2B 2;  2JDI H;  3LT8 A;  1A90 A;  1ZO2 A;  4CDL A;  1LOX A;  1N5H A;  2IUK A;  3BNE A;  3MKI A;  4HM2 B;  4MMX B;  4AEQ A;  3EE1 A;  2E2T A;  3K7C A;  2OQE A;  4HZ9 B;  2OOV A;  3UJM A;  2H0G A;  2P0M A;  1AY7 A;  1CYU A;  2XSH B;  3LTD A;  1TJD A;  3NQY A;  3OX9 A;  4RBN A;  4X2O A;  2KF5 A;  2Y74 A;  3BNC A;  1SQW A;  3DUK A;  2LYX A;  3EJV A;  1F8N A;  1DMQ A;  3F8X A;  3MSO A;  3ZG0 A;  1AR0 A;  3LH4 A;  3FG4 A;  1GOV A;  1I2E A;  1PFP A;  1LQM B;  1NB5 I;  3DGN A;  1NWW A;  2H0I A;  2KRT A;  3MG3 A;  1RRL A;  1O7G B;  3T8U A;  1NJI 4;  1YJW 3;  2ML5 A;  3CME 3;  1TIJ A;  3GRD A;  3HIG A;  5IEO A;  4JF8 A;  1DVD A;  1VQ8 3;  5DRV A;  1EUI C;  3PCS A;  2XEP A;  3DGY A;  5TGN A;  5M18 A;  2HMN B;  1IQX A;  3UL5 A;  2CG0 A;  4FCZ A;  4QWT A;  1E97 A;  2I9W A;  2K0M A;  1BRS A;  3LYG A;  1LOY A;  1QMA A;  4MJD A;  3SOY A;  1DET A;  1GY5 A;  4GB5 A;  3PS8 A;  1IYY A;  2Z76 A;  3G71 3;  1B2M A;  2H0H A;  1GMR A;  4GHO A;  3CPW 2;  4OUQ A;  3UB1 A;  3PCR A;  3QK9 A;  1OUN A;  2WOF A;  3LTC A;  1BIR A;  1LXE A;  6GSP A;  5RNT A;  1BVI A;  1OGZ A;  4GSP A;  3DMC A;  1UUG B;  1MGR A;  5EVH A;  1EKM A;  4NHF A;  4HM0 B;  3NQZ A;  4LEH A;  4XB5 A;  2D42 A;  1OF5 B;  1WMN A;  1DVC A;  1VQ4 3;  3A76 A;  2YFL B;  4R80 A;  3X3Y A;  3LML A;  1IU7 A;  1BRK A;  1HKX A;  4LSO A;  1RGF A;  2E2V A;  2C11 A;  5A0O B;  3EX9 A;  1RN7 A;  4ILF A;  3IPT A;  1BSB A;  3BND A;  1FZU A;  3WA2 X;  1GMQ A;  1RGK A;  4CJN A;  3FSD A;  3GWR A;  5JPU A;  1BUJ A;  4IPB A;  3SX1 A;  1VQN 3;  4PEJ A;  4XBX A;  5AYS C;  5IEN A;  1SJW A;  4HJL B;  3J7Y d;  1V74 A;  4AKZ A;  2BO9 B;  1Q7Y 4;  5GSP A;  4H3U A;  2YX9 A;  5G1L A;  3BU4 A;  3WOD G;  1TU5 A;  9RNT A;  1GSP A;  4N6U A;  3D5I A;  1RGA A;  1SAR A;  3DZL A;  3OV4 A;  4G1M B;  4BL2 A;  2XGL A;  3CC2 3;  2GU3 A;  1VQQ A;  4N6N B;  2F86 B;  3CC7 3;  1VQP 3;  2Z6B A;  1ISK A;  4EXR A;  4KFF A;  3Q2P A;  2KAA A;  4WWU C;  2IUJ A;  3NM7 A;  1WQL B;  1JBT A;  3NXJ A;  3CNM A;  5CF1 A;  5FGO A;  2WOH A;  1NO3 A;  2K3D A;  1S5A A;  1RGH A;  1I0V A;  1BSC A;  1LNI A;  1OCV A;  1YVB I;  3D4A A;  4K1V A;  1ZS7 A;  3S27 A;  5STD A;  2F99 A;  3KSP A;  3N9H A;  3KSE D;  3EB8 A;  4HOH A;  3PGB A;  1BNI A;  3F9S A;  1DMM A;  2IYJ A;  2ZL8 A;  5AEU B;  7STD A;  1RN4 A;  5ELJ A;  1VQ7 3;  1B3S A;  3CCV 3;  2SAR A;  3PZW A;  1J2B A;  3GZY B;  3N8B A;  1IK3 A;  4HVN A;  3FLJ A;  2QIY A;  2CFK A;  4GL6 A;  3GZB A;  1W01 A;  4IT7 A;  5FW5 A;  1RNT A;  4FCM A;  1GD3 A;  1GYB A;  1R4Y A;  1UCL A;  3NBJ A;  2W2C A;  5AII A;  5G1K A;  1RGE A;  2KCD A;  2UUG C;  3B4P A;  4FMD A;  4N6M A;  1T5Y A;  1YIJ 3;  1NDO B;  3RDE A;  3ROB A;  1JN5 B;  4N6O B;  1WTH A;  2YFI B;  5AI1 A;  3U1W A;  2CC3 A;  1BNR A;  1BRH A;  1VQ9 3;  3AHW A;  1IVV A;  4AKY A;  1BRJ A;  1MWU A;  5KP4 A;  1OHP A;  1BSE A;  2XGN A;  1QAL A;  4J8T A;  4R9K A;  3EN1 B;  3NX0 A;  1YHQ 3;  1AV4 A;  1BGS A;  1T2I A;  4WFO A;  1G96 A;  4O02 B;  1UI8 A;  3ZFZ A;  1K8A 4;  1VQ6 3;  1TRP A;  2CKF B;  3OWY A;  3CCM 3;  1Q86 4;  1W6C A;  2GXF A;  2RNT A;  1T2H A;  1IVW A;  3DH2 A;  2B1X B;  2W9P A;  1BUQ A;  1FW7 A;  5G2G A;  3G16 A;  4DKI A;  3F7X A;  5KP3 A;  3VSY A;  1KWI A;  5DRE A;  5HGR A;  2STD A;  3O8Y A;  1W2Z A;  4BU4 A;  2O3O A;  1O7P B;  2XFT A;  2W03 A;  3FCS B;  2OTL 3;  3V98 A;  4EW5 A;  3X42 A;  1D6Z A;  3LTA A;  3NBR A;  4NRE A;  4XDW A;  3AHS A;  2CG1 A;  3E99 A;  3FF0 A;  4R1K A;  1M90 4;  3HOH A;  3K63 A;  1FYS A;  1IVX A;  4HAA A;  2CK3 H;  5D82 A;  3RGA A;  3LT9 A;  1RGG A;  3UNL A;  5M19 A;  1LRA A;  1TTO A;  2BMO B;  1IQY A;  1I3F A;  1ULI B;  3I0Y A;  3G4S 3;  1X1X A;  2R41 A;  1ZGX A;  2SBL A;  1N8R 4;  1JKG A;  1W7C A;  4X2H A;  3ER7 A;  2W56 A;  3AMO A;  2P38 A;  2BT3 A;  2QGU A;  2F4Y A;  3BNB A;  4L7K A;  3T0U A;  1GS3 A;  1UDI I;  3EN8 A;  3ALA A;  3G8Z A;  1L5G B;  4BTY A;  3LZA A;  4MMZ B;  4EV5 A;  5IF6 A;  3FGY A;  3Q1C A;  4EV2 A;  2V1L A;  2K54 A;  3K9M C;  2RGQ A;  1BAO A;  3TDG A;  3GSP A;  2FGT A;  3WA3 A;  4XDV A;  1U8C B;  1MGW A;  4K61 A;  3EC9 A;  4N3V A;  1C7H A;  1YNV X;  4OVM A;  3FZW A;  1N9E A;  5D83 A;  3DXO A;  3DGO A;  3D5G A;  3MPH A;  3N54 B;  4KZ1 A;  4LGQ A;  5AIF A;  2ML6 A;  3AGN A;  3EF8 A;  4N6T A;  1JBS A;  3OWU A;  1K41 A;  4STD A;  3L0R A;  3DM8 A;  1I2F A;  1W6Y A;  1UW1 A;  4H61 A;  3U97 A;  5AIG A;  2IY2 A;  4KT3 B;  3WHO A;  2KF3 A;  1X1W A;  5IER A;  2CHC A;  2OQE C;  2W9Q A;  2OOV C;  1FGO A;  4J5K A;  7GSP A;  2BHM A;  3CC4 3;  5CLK A;  4J9A A;  3CCQ 3;  5BIR A;  8CHO A;  1YIT 3;  4HM1 B;  5ELU A;  5BVB A;  1T3B A;  1MWR A;  1STD A;  3T8N A;  2A15 A;  1K73 4;  1YJN 3;  2AAE A;  1ROV A;  1WMP A;  1JKG B;  1W02 A;  4HYZ A;  2XFS A;  1Q7H A;  2IA7 A;  2W56 B;  2C10 A;  4HM4 B;  1M1K 4;  1Q82 4;  2CX0 A;  3LTB A;  1IV9 A;  1WMO A;  1OH0 A;  2KF4 A;  2CFL A;  4KFD A;  3CMA 3;  1YVS A;  2BMQ B;  1BU4 A;  3KE7 A;  4WHA A;  1JB5 A;  1TP6 A;  2XH9 A;  5AEW B;  1EQK A;  3V99 A;  2BMR B;  2F5M A;  1UCJ A;  3X3X A;  2JQ5 A;  3JVC A;  3I55 3;  1IDP A;  1NU3 A;  2HMO B;  2W0Q A;  2GBX B;  5EEO A;  1JB2 A;  1W5Z A;  2HMJ B;  2CFG A;  4NPB A;  1BSD A;  4BIR A;  3VF1 A;  2Z7A A;  3NBB A;  4EC6 A;  1LOV A;  1FA3 A;  4FMB A;  2J8X B;  3ECF A;  4BL3 A;  3SED A;  5IG0 A;  1MWT A;  1M1X B;  3Q3F A;  4WYK A;  5IW9 A;  4LMI A;  2W04 A;  4MMY B;  4L8P A;  1CH0 A;  2FNQ A;  1ROA A;  2GSP A;  3Q90 A;  1JV2 B;  3B4O A;  4CCV A;  1Q81 4;  1I8V A;  2CWU A;  1UGH I;  5CXO A;  2P0X A;  2RSX A;  1I0X A;  1QAK A;  2F98 A;  3FH1 A;  4J5G A;  4O2H A;  2MF7 A;  1KC8 4;  1O7M B;  3DY5 A;  2YFJ B;  1QVG 2;  1AVK A;  2D1W A;  2F5W A;  3CD6 3;  3MHE A;  3NV0 A;  3B7C A;  3HII A;  4IIA A;  1B2X A;  2L4V A;  3AGO A;  1YI2 3;  3S67 A;  1FGR A;  1D6U A;  3RNT A;  3KFQ C;  2HMK B;  1BNE A;  1RSN A;  3F7S A;  3WMD A;  1N9J A;  3GZR A;  3X41 A;  4HM5 B;  1LNH A;  4BTX A;  1YGE A;  3EQQ B;  1Z1S A;  1CQS A;  3MG1 A;  2E2U A;  1UUV B;  2IMJ A;  3SLU A;  4R9L A;  1B20 A;  1RGC A;  1Y4K A;  1CEW I;  2CFD A;  4FR9 A;  1A2P A;  1IV7 A;  1UUW B;  2O9U X;  2LQV A;  3CCL 3;  3PXM A;  1RMS A;  2RCD A;  2FXT A;  4O8S A;  4RNT A;  2Q07 A;  3WOE B;  1UGI A;  5D81 A;  4HM6 B;  3RGR A;  5HOH A;  3DGL A;  1BNS A;  1LOW A;  4WYK B;  3K5T A;  1N5P A;  1RRH A;  1RHL A;  5JPP A;  3ZG5 A;  1CYV A;  1MNL A;  1O7H B;  2W6J H;  3G0K A;  2RFR A;  2ZA4 A;  3A5E A;  1E3R A;  4RZM A;  1JB4 A;  1Q9E A;  2CX1 A;  2AAD A;  3D3L A;  5LC7 A;  3M8C A;  4K90 B;  4MEI A;  2OWP A;  1IQ8 A;  8RNT A;  2GEY A;  4ORL A;  3FG3 A;  1MWS A;  1TFK A;  4LYL B;  3NV0 B;  2WGQ A;  1M9G A;  1UCK A;  3B8L A;  6RNT A;  4FMC A;  4N6V 0;  3KZT A;  1STF I;  2KXG A;  3SOA A;  1PYL A;  4HBR A;  1D6Y A;  4EYC A;  1EA2 A;  1NNV A;  4XBY A;  4KFE A;  1A67 A;  5IG5 A;  1YGW A;  1B2S A;  1G0T A;  3MWZ A;  1UI7 A;  4FCJ A;  4R4K A;  4HM3 B;  3HX8 A;  5AYR B;  3OWS A;  2ZDJ A;  4CPK A;  1JZD A;  2HOH A;  1OHS A;  4I4K A;  3CXC 2;  2R4I A;  3CCU 3;  5IG4 A;  1BRI A;  3X3Z A;  1IT8 A;  1AQZ A;  1FGT A;  1X1Y A;  2M7O A;  1FGQ A;  1OF5 A;  1EEJ A;  1W4N A;  2PNC A;  5EQL A;  1YJ9 3;  3NHX A;  1JNQ A;  1DE3 A;  5BXQ A;  3VGN A;  1BRG A;  1BAN A;  3EBY A;  3WDG B;  3FF2 A;  3SYU A;  1RN1 A;  1C54 A;  3CCS 3;  1GOU A;  1W6G A;  1B2Z A;  3CPO A;  1BRN L;  1G02 A;  3MYT A;  2HMM B;  3NUV A;  3CCE 3;  4HM7 B;  5I97 A;  2CWT A;  1I2G A;  5CK6 A;  3JUM A;  5KP1 A;  1ASK A;  2QEX 3;  2WO0 A;  1WNH A;  1W00 A;  3GAX A;  3WR2 A;  3PYJ A;  2B24 B;  5BU4 A;  3BLZ A;  4XBT A;  2Y73 A;  4U13 A;  2CH9 A;  3KN4 A;  3F8H A;  3IJE B;  2MC8 A;  3URP A;  3X40 A;  5JBS A;  1GMP A;  1VQM 3;  3K0Z A;  4OK0 A;  1BSA A;  1HYF A;  3LOY A;  1MOL A;  3KCH A;  3OXA A;  4HM8 B;  1GY7 A;  1GD4 A;  1RJO A;  4JRF A;  1RKY A;  1Q42 A;  1Q40 A;  1ULJ B;  3SXX A;  2UX0 A;  2CWV A;  1TRQ A;  1JBR A;  2XRX B;  3BB9 A;  1B2U A;  3AMO B;  2C4B A;  3CNX A;  1RGL A;  1FUS A;  3EHC A;  4FMA A;  2INX A;  3H51 A;  4RNY A;  1RDS A;  2Z77 A;  2RBI A;  3JUN A;  1DMN A;  1O7W B;  1R4C A;  1U5O A;  3QRD A;  1O7N B;  1VZZ A;  2CW9 A;  3MG2 A;  3JUP A;  1DYU A; 
#chains in the Genus database with same CATH homology
 3DH2 A;  1FW7 A;  1B27 A;  1BRS A;  7RNT A;  1LOY A;  2BIR A;  4BU4 A;  1B20 A;  1DET A;  1RGC A;  1IYY A;  1A2P A;  1B2M A;  1GMR A;  1X1U A;  4GHO A;  3AHS A;  1B21 A;  1RNB A;  3HOH A;  1BIR A;  1RMS A;  6GSP A;  5RNT A;  1BVI A;  1FYS A;  4HAA A;  4RNT A;  4GSP A;  1MGR A;  1RGG A;  5HOH A;  1LRA A;  1TTO A;  1I3F A;  1X1X A;  1BNS A;  1ZGX A;  1RTU A;  1LOW A;  1RHL A;  1BRK A;  1HZ1 A;  2F4Y A;  3A5E A;  2ZA4 A;  1Q9E A;  2F56 A;  1RGF A;  2AAD A;  1BNJ A;  1UCI A;  1BAO A;  1BSB A;  3GSP A;  8RNT A;  1BNG A;  1FZU A;  1RLS A;  1PY3 A;  1GMQ A;  1RGK A;  1BNF A;  1MGW A;  1BUJ A;  1YNV X;  1RCK A;  1UCK A;  6RNT A;  3D5G A;  1PYL A;  3AGN A;  1JBS A;  1YGW A;  1B2S A;  1I2F A;  5GSP A;  2KF6 A;  3BU4 A;  9RNT A;  1GSP A;  3WHO A;  1BOX A;  1RGA A;  2KF3 A;  1X1W A;  1GOY A;  3BIR A;  3D5I A;  1SAR A;  2HOH A;  1FUT A;  4J5K A;  7GSP A;  1BRI A;  2KAA A;  1AQZ A;  1I3I A;  5BIR A;  2BU4 A;  1X1Y A;  1RCL A;  1JBT A;  1DE3 A;  1I70 A;  1BRG A;  1BAN A;  2AAE A;  3SYU A;  1RGH A;  1RN1 A;  1I0V A;  1BSC A;  1LNI A;  3D4A A;  1GOU A;  1C54 A;  1B2Z A;  1BRN L;  1G02 A;  4HOH A;  1BNI A;  1I2G A;  2KF4 A;  1RN4 A;  1B3S A;  1YVS A;  2SAR A;  1BU4 A;  3WR2 A;  2F5M A;  1UCJ A;  5BU4 A;  1AY7 A;  1RNT A;  1R4Y A;  3URP A;  1UCL A;  1BSD A;  4BIR A;  2KF5 A;  1RGE A;  1LOV A;  1GMP A;  1GOV A;  1I2E A;  1BSA A;  1HYF A;  3Q3F A;  3KCH A;  1BNR A;  1BRH A;  1JBR A;  1CH0 A;  1TRQ A;  2GSP A;  1B2U A;  3AHW A;  1I8V A;  2C4B A;  1BRJ A;  1RGL A;  1FUS A;  1I0X A;  4J5G A;  1BSE A;  1RDS A;  2F5W A;  1BGS A;  1T2I A;  2RBI A;  3DGY A;  1B2X A;  3AGO A;  3RNT A;  1BNE A;  1RSN A;  1TRP A;  2RNT A;  1T2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...