1I8VA

Crystal structure of rnase sa y80f mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDFYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Tyrosine hydrogen bonds make a large contribution to protein stability.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i8vA00
2ZA4A 1LRAA 3AGOA 1BUJA 1C54A 1SARA 4J5KA 1RN4A 1PYLA 2C4BA 1UCKA 1DE3A 1CH0A 2AAEA 1RGHA 3KCHA 1B2XA 1TRPA 5BIRA 1I2EA 1I0VA 3URPA 1GOUA 2KF3A 1T2HA 2GSPA 4GHOA 1LOWA 2SARA 3AHWA 1BSAA 2F5WA 5GSPA 2KF6A 1BU4A 1RGLA 3AGNA 1RGGA 1RCLA 3D5GA 1FYSA 1B2UA 1FUSA 9RNTA 1BSBA 4HAAA 2KF4A 1GSPA 1MGWA 1RGFA 4GSPA 1AY7A 1BRKA 1RMSA 3WHOA 1PY3A 1I70A 1BNGA 2BIRA 3SYUA 3WR2A 1RLSA 1TTOA 4J5GA 1RGKA 1RHLA 1B20A 1BNSA 2HOHA 1RNTA 1UCLA 1YVSA 3D4AA 1I2FA 1GMQA 3DH2A 1IYYA 3BIRA 6RNTA 1B27A 1ZGXA 1A2PA 1BIRA 1GMRA 1YNVX 5HOHA 1HYFA 1FZUA 8RNTA 1RDSA 3RNTA 2RBIA 1B2ZA 1BAOA 2AADA 1RSNA 2F4YA 1JBRA 1B3SA 1RCKA 2KAAA 1R4YA 1LOYA 1JBSA 1T2IA 1BOXA 7GSPA 2F5MA 1BRNL 1BNIA 1FUTA 3A5EA 1BRSA 1I0XA 3D5IA 1GOVA 7RNTA 1JBTA 1BNFA 1GOYA 3DGYA 4BU4A 1BSCA 1BRHA 4BIRA 1B2MA 1TRQA 1RGEA 1YGWA 1RGAA 3BU4A 1RNBA 1BNRA 1UCIA 1BGSA 3GSPA 1BSEA 1B2SA 3AHSA 1AQZA 1I3IA 2RNTA 1FW7A 1BRGA 1I2GA 1I3FA 1X1YA 5BU4A 2F56A 1BSDA 1RN1A 1RGCA 1I8VA 5RNTA 1LOVA 1X1WA 1BRJA 1GMPA 1BNJA 1B21A 1BNEA 1BRIA 1HZ1A 1RTUA 1LNIA 2KF5A 4RNTA 6GSPA 3Q3FA 1BANA 2BU4A 3HOHA 1Q9EA 1UCJA 1BVIA 1DETA 4HOHA 1G02A 1MGRA 1X1XA 1X1UA
chains in the Genus database with same CATH superfamily
1RRHA 2CC3A 2HMKB 1LRAA 2XGLA 1V74A 4HM5B 1IV7A 2H0IA 2BT3A 4J5KA 1RN4A 1PYLA 4ORLA 3G0KA 1ULJB 1YGEA 3HI7A 4WYKB 3WA2X 4FMCA 3JUOA 2AAEA 2Y73A 2INXA 1IT8A 1OHSA 1B2XA 2IMJA 3S5CA 5BIRA 3ALAA 2LYXA 4EBGA 5DREA 3GAXA 2GSPA 2C11A 3EHCA 1BSAA 4LMIA 4EW5A 4EYCA 1DMQA 1DMNA 1OPYA 1JN5A 1NWWA 1V58A 2K3DA 1OGZA 3LYGA 3Q90A 2CX0A 1RJOA 3BNCA 3SOAA 3N54B 1K734 5BXQA 4N6UA 3JUQA 4XB5A 4N6MA 3B4PA 3DZLA 1VQM3 1UGHI 2KXGA 3FKAA 4HM7B 1WNHA 2WO0A 3E99A 1SPUA 3IJEB 1NU3A 3IMAB 4KFDA 3FSDA 5IG4A 3NHXA 4GSPA 1M9GA 1EUIC 1RGFA 1AVKA 3EBTA 4HM1B 4HVNA 4LSOA 3RGRA 3GZYB 1RMSA 1WTHA 5IW9A 1UUVB 1I70A 4G1MB 5AEUB 3EC9A 5JPUA 3WR2A 1VQO3 4H61A 4J5GA 2CWTA 2HMMB 3CCR3 1GY5A 2XSHB 4KZ1A 1BNSA 1IK3A 1G0TA 2XR8B 2D42A 1OHOA 1VQ73 1N9EA 2FNQA 1US1A 4K1UA 1BUQA 1IYYA 3BIRA 1MWTA 3AMOA 1BIRA 1Q42A 2GXFA 2BO9B 2QIYA 2Y74A 3CNMA 3FF0A 2ML6A 1HYFA 3N8BA 3NXJA 5AIFA 1YIJ3 4N6LA 3V98A 3RNTA 3JUNA 2RBIA 3NM7A 1B2ZA 4L8OA 1VZZA 3PCSA 1JBRA 2F4YA 1LVNA 4R1KA 1UUGB 1D6ZA 1L5GB 1NNVA 1GD3A 4XBXA 2UX0A 2MC8A 3CD63 1JBSA 4HKVB 1BOXA 1D6YA 1OF5B 2CWUA 2F5MA 3LZAA 7GSPA 3A5EA 2OTL3 3CCE3 1K9M4 3STDA 2IUKA 4FCJA 3CCJ3 1VQ53 3D5IA 4WWUC 3VGNA 2P09A 3G4S3 1IVVA 1GOYA 4HM6B 4R9KA 1E3RA 2C10A 3LT8A 4BIRA 4RNYA 1Q864 1ISKA 3KSPA 1Y4KA 1YGWA 1BNRA 1RGAA 4O02B 1K8A4 1UCIA 3K5TA 1IDPA 3AHSA 4O2HA 1JNQA 1VQ93 2W9PA 4O3VA 1FW7A 3NQYA 1I2GA 2XFTA 3Q2PA 1ZS7A 3HX8A 2F56A 3F8XA 1NDOB 5HGRA 1BSDA 2CFKA 1I8VA 3KZTA 4H3UA 3G16A 3U97A 3V92A 1ROVA 3DGNA 2CK3H 2WOHA 1WQLB 1HU9A 1YJ93 1RTUA 5IF6A 2KF5A 1IQXA 1JN5B 3FG1A 3VSYA 1BANA 2XGNA 1TFKA 2BMOB 3HOHA 3NBBA 1VQ43 3WDGB 2CWVA 4MJDA 1GY6A 4HOHA 3LT9A 1KWIA 1X1UA 3JUMA 2ZA4A 3AGOA 4NREA 3F40A 1OHPA 1SARA 4CCVA 3CCU3 2OOVA 1IQYA 3KN4A 2QA43 1UCKA 1E97A 2E2VA 2W6JH 3S67A 3V99A 5M1AA 1JZOA 1VQQA 3DM8A 3URPA 1SJWA 3T8NA 3DXOA 1W2ZA 1W6CA 4GHOA 3AHWA 1JKGB 3H51A 1GS3A 2ZHXB 4TX4A 3BNEA 2JQ5A 4K1VA 2MF7A 1UGIA 3PYJA 1RGGA 5AIGA 3LXUX 3WODG 1B2UA 9RNTA 3SLUA 5I97A 5DRVA 1W00A 3ECFA 5TGNA 2Z7AA 1QMAA 2XFSA 4FCMA 5FW5A 4HAAA 3X3ZA 1FA3A 1V57A 1GSPA 5ELJA 5M18A 1QAKA 2GEYA 1AY7A 3LMLA 1VQ63 3X42A 2W04A 1STFI 2CFLA 1PY3A 1M1XB 3G8ZA 4K90B 3MYTA 1TTOA 2CKFB 3O8YA 5CLKA 4EXRA 3CCV3 1RHLA 1B20A 5CK6A 4HM4B 1OACA 1UCLA 3UB1A 1FUWA 4IIAA 1YI23 2Z77A 4HM0B 4O8SA 3SVAA 2E2TA 6RNTA 1B27A 4IPBA 3J7Yd 2WOFA 1FGMA 4XBTA 2F86B 2H0GA 3QRDA 3MHEA 5HOHA 1FZUA 3NBRA 2Z6BA 4I5QA 4STDA 1G96A 2XF3A 5LC7A 2W03A 2CFDA 1VQ83 2F98A 1B3SA 2UUGC 3NM2A 1ZO2A 2W56A 1W01A 1LNHA 3K63A 3GWRA 4N6OB 3OV4A 1M1K4 2CIUA 1FUTA 1N8R4 1W5ZA 4BL2A 1BRSA 3KIIA 3MKIA 1O7HB 3DY5A 4HBRA 1DVDA 1I0XA 1Z1SA 4KT3B 3WOEB 2XRXB 5AYSC 5KP1A 3X3XA 8CHOA 7RNTA 4BTWA 3GZXB 2E2UA 1O7MB 4BU4A 4XBYA 4EV5A 4ZM8A 1OUNA 1WMNA 1M904 5AI1A 1B2MA 3EF8A 2R41A 2CG1A 3BU4A 3EN8A 3NQZA 2CG0A 2LQVA 4FMDA 1EEJA 1AQZA 1TIJA 2RNTA 4OVMA 3BNBA 1BRGA 1I3FA 5IEPA 1SIIA 1QAFA 2GBWB 5D81A 1UW1A 3PZWA 5RNTA 5IERA 1X1WA 5CXOA 1IVXA 3CPOA 1B21A 1O7GB 2A15A 3JUPA 7STDA 1BRIA 1ASKA 1HZ1A 1UDII 1GY7A 4RNTA 5EQLA 6GSPA 1O7PB 2IUJA 3KKGA 5EEOA 2BU4A 2I9WA 3FG4A 1JB5A 2O3OA 3GZBA 3WA3A 5KP4A 4LZIA 3T8UA 1BVIA 5EVHA 1OGXA 1PFPA 1G02A 5AIIA 1KC84 5AEWB 2OQEC 1T5YA 3F7XA 4EC6A 2V1LA 3EN1B 1QVF2 4WYKA 2HMJB 3D3LA 3FH1A 2YFIB 2C4BA 3LTCA 1PU4A 1RGHA 1W2B2 3KCHA 1D6UA 3DGMA 1TRPA 4HZBB 3D79A 4IT7A 1I2EA 1I0VA 3MPHA 1Q7Y4 1GOUA 2RCDA 1DMMA 1QJGA 3OW22 3KFQC 1HKXA 2SARA 4FMBA 3SXXA 1EQKA 2FXTA 3QK9A 1CYVA 3ZG0A 4ILFA 3F9SA 2P05A 1W7CA 3FZWA 3DGOA 3KE7A 3N9HA 4OK0A 1BU4A 1RGLA 1SQWA 1IU7A 3CU3A 3AGNA 1A67A 3GRDA 2QEX3 1IV9A 4R80A 3NBJA 1RCLA 5KP3A 5JBSA 4WFOA 1FYSA 3B7CA 3MSOA 1FUSA 1IVUA 1BSBA 2CHCA 3ZFZA 1R4CA 2KF4A 1Q40A 2SBLA 1MGWA 2PZVA 4AKZA 3FLJA 3PCRA 2F99A 1W4NA 1EG9B 3T0UA 3WHOA 3NV0A 1T3BA 1TP6A 4N6V0 1BNGA 3I553 4XDVA 1AV4A 2YFLB 1JB4A 2BIRA 3WOFB 1RLSA 5FGOA 3CCM3 3OWSA 1RNTA 1U8CB 5D83A 3K9MC 5G2GA 3EJVA 1GYBA 3D4AA 4BTXA 2BHMA 5CF1A 1GMQA 3DH2A 1KSIA 4KFEA 3M8CA 2M7OA 1GMRA 1MWRA 1YNVX 3AMOB 5A0OB 2XH9A 3RGAA 8RNTA 4MMYB 5AIHA 1Q7HA 3WMDA 3MWZA 2B24B 1BAOA 4NHFA 2Q07A 1RCKA 1FGOA 3CC73 2IYJA 3CCS3 3D9RA 3CCL3 3HIGA 1T2IA 3MG3A 3DUKA 2QGUA 1MOLA 2J8XB 2CX1A 3SX1A 3K7CA 1SIHA 1BRNL 4RZMA 1VQN3 4U13A 5ELUA 5IEOA 3RDEA 3HZPA 1U5OA 4MMXB 3EBYA 1EA2A 3F8HA 2R4IA 3SEDA 3Q1CA 5STDA 1GOVA 1JBTA 3G713 2GU3A 1BSCA 1LXEA 1FGRA 3CCQ3 1TRQA 4XDWA 2RGQA 1VQL3 1QALA 1RGEA 1RRLA 2CFGA 3OX9A 4N3VA 1B2SA 1I3IA 3X41A 1GD4A 3S27A 1X1YA 3UL5A 3LTBA 4HZ9B 4CJNA 5BU4A 1IVWA 2W2CA 1J2BA 1AR0A 1RGCA 2HMOB 1BRJA 1MNLA 4JF8A 3S29A 4CPKA 3CPW2 1K41A 1LQGC 3B8LA 4FCZA 4GL6A 4RBNA 3BLZA 4BL3A 2CW9A 4J8TA 3NUVA 4FMAA 4DKIA 2HMNB 1N9JA 3NX0A 1TJDA 2D1WA 1K28A 1DYUA 1NB3I 1NB5I 3IPTA 1UCJA 1A2KA 1TUHA 1CEWI 4WHAA 3I563 1UI8A 1X1XA 2CH9A 4HJLB 1C54A 1A2VA 1BUJA 1Q40B 1STDA 2RFRA 2W0QA 1FGQA 3UJMA 3EX9A 4J9AA 1JB2A 1DE3A 1C7HA 1CH0A 3NV0B 3LOYA 2UGIA 3CXC2 1IT7A 4LEHA 5G1LA 2KF3A 1JKGA 1T2HA 1WMPA 1LOWA 2BMRB 3UNLA 1YJW3 5JPPA 4MEIA 3X3YA 2F5WA 2GU1A 5GSPA 2P38A 2K0MA 2KF6A 3MG1A 4HM2B 1YIT3 2FGTA 2CFWA 2P0MA 2PNCA 3D5GA 5AYRB 1E3VA 3L0RA 1YHQ3 1A90A 4R9LA 3A76A 1CYUA 3EB8A 3EQQB 3H3HA 4N6NB 2XEPA 3LH4A 3VF1A 3CC43 1BRKA 5M19A 1W6GA 2W9QA 1UUWB 3CC23 6STDA 2WGOA 1JZDA 3SYUA 2GBXB 3S28A 4N6TA 4KFFA 3ZG5A 4K61A 1RGKA 4L7KA 4CDLA 1N5HA 2HOHA 1ZX2A 2K54A 4BTYA 2B1XB 2OQEA 5IG5A 1YVSA 3F14A 1I2FA 4WP5A 1ZGXA 1A2PA 1LQMB 1WMOA 2O9UX 1N5PA 2RSXA 1RDSA 1W6YA 1OCVA 3U1WA 1UI7A 1OH0A 1RSNA 2AADA 2JDIH 3ROBA 2BNGA 2KAAA 2KCDA 3FG3A 3SOYA 1FGTA 1R4YA 1F8NA 1JJ22 2XSOB 2KRTA 3PS8A 2P0XA 1LOYA 2W56B 2IY2A 4HM8B 4KVHA 3TDGA 5BVBA 5CF2A 4X2HA 1KQS2 1BNIA 1ROAA 1Q824 1N8QA 1VQP3 1MWSA 2GEXA 1RKYA 1JV2B 2BMQB 4QWTA 4I4KA 4EV2A 2OOVC 2STDA 3FCSB 3KSED 3I0YA 3OXAA 5D82A 2WGQA 1RN7A 3DMCA 1BNFA 2IA7A 2YFJB 1LOXA 4LGQA 3DGYA 3JVCA 1DVCA 2YX9A 2OCTA 4NPBA 4AKYA 5IENA 1IQ8A 4JRFA 5G1KA 1BRHA 2OTJ3 4X2OA 1O7NB 1KD14 2ZDJA 4LYLB 1RNBA 1EKMA 2HMLB 1TU5A 1BGSA 3GSPA 3PXMA 4RNZA 1BSEA 4Q53A 2Z76A 1NO3A 5LC6A 4AEQA 1O7WB 2L1SA 3BB9A 4R4KA 5IG0A 2OWPA 3FGYA 1S5AA 1YVBI 3F7SA 1VQK3 3LTDA 1YJN3 1ULIB 2L4VA 1AVLA 1RN1A 3CMA3 1OF5A 3BNDA 4FR9A 1LOVA 1JRQA 1GMPA 1BNJA 3MG2A 1QVG2 2ZL8A 3HIIA 1W02A 3K0ZA 5IG3A 3CME3 1NJI4 3OWUA 3GZRA 4MMZB 1BNEA 1Q814 1TFOA 1S723 1LNIA 1CQSA 3ER7A 3OWYA 4HM3B 3CNXA 3FF2A 4XM4A 3Q3FA 3X40A 3UL6A 2ML5A 3G6E3 3HK4A 4GB5A 3PGBA 4HYZA 2H0HA 1Q9EA 4PEJA 4OUQA 3B4OA 3LTAA 4L8PA 1MWUA 3DGLA 1DETA 1MGRA 3EE1A
chains in the Genus database with same CATH topology
2ZA4A 1LRAA 3AGOA 1BUJA 1C54A 1SARA 4J5KA 1RN4A 1PYLA 2C4BA 1UCKA 1DE3A 1CH0A 2AAEA 1RGHA 3KCHA 1B2XA 1TRPA 5BIRA 1I2EA 1I0VA 3URPA 1GOUA 2KF3A 1T2HA 2GSPA 4GHOA 1LOWA 2SARA 3AHWA 1BSAA 2F5WA 5GSPA 2KF6A 1BU4A 1RGLA 3AGNA 1RGGA 1RCLA 3D5GA 1FYSA 1B2UA 1FUSA 9RNTA 1BSBA 4HAAA 2KF4A 1GSPA 1MGWA 1RGFA 4GSPA 1AY7A 1BRKA 1RMSA 3WHOA 1PY3A 1I70A 1BNGA 2BIRA 3SYUA 3WR2A 1RLSA 1TTOA 4J5GA 1RGKA 1RHLA 1B20A 1BNSA 2HOHA 1RNTA 1UCLA 1YVSA 3D4AA 1I2FA 1GMQA 3DH2A 1IYYA 3BIRA 6RNTA 1B27A 1ZGXA 1A2PA 1BIRA 1GMRA 1YNVX 5HOHA 1HYFA 1FZUA 8RNTA 1RDSA 3RNTA 2RBIA 1B2ZA 1BAOA 2AADA 1RSNA 2F4YA 1JBRA 1B3SA 1RCKA 2KAAA 1R4YA 1LOYA 1JBSA 1T2IA 1BOXA 7GSPA 2F5MA 1BRNL 1BNIA 1FUTA 3A5EA 1BRSA 1I0XA 3D5IA 1GOVA 7RNTA 1JBTA 1BNFA 1GOYA 3DGYA 4BU4A 1BSCA 1BRHA 4BIRA 1B2MA 1TRQA 1RGEA 1YGWA 1RGAA 3BU4A 1RNBA 1BNRA 1UCIA 1BGSA 3GSPA 1BSEA 1B2SA 3AHSA 1AQZA 1I3IA 2RNTA 1FW7A 1BRGA 1I2GA 1I3FA 1X1YA 5BU4A 2F56A 1BSDA 1RN1A 1RGCA 1I8VA 5RNTA 1LOVA 1X1WA 1BRJA 1GMPA 1BNJA 1B21A 1BNEA 1BRIA 1HZ1A 1RTUA 1LNIA 2KF5A 4RNTA 6GSPA 3Q3FA 1BANA 2BU4A 3HOHA 1Q9EA 1UCJA 1BVIA 1DETA 4HOHA 1G02A 1MGRA 1X1XA 1X1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZA4 A;  1LRA A;  3AGO A;  1BUJ A;  1C54 A;  1SAR A;  4J5K A;  1RN4 A;  1PYL A;  2C4B A;  1UCK A;  1DE3 A;  1CH0 A;  2AAE A;  1RGH A;  3KCH A;  1B2X A;  1TRP A;  5BIR A;  1I2E A;  1I0V A;  3URP A;  1GOU A;  2KF3 A;  1T2H A;  2GSP A;  4GHO A;  1LOW A;  2SAR A;  3AHW A;  1BSA A;  2F5W A;  5GSP A;  2KF6 A;  1BU4 A;  1RGL A;  3AGN A;  1RGG A;  1RCL A;  3D5G A;  1FYS A;  1B2U A;  1FUS A;  9RNT A;  1BSB A;  4HAA A;  2KF4 A;  1GSP A;  1MGW A;  1RGF A;  4GSP A;  1AY7 A;  1BRK A;  1RMS A;  3WHO A;  1PY3 A;  1I70 A;  1BNG A;  2BIR A;  3SYU A;  3WR2 A;  1RLS A;  1TTO A;  4J5G A;  1RGK A;  1RHL A;  1B20 A;  1BNS A;  2HOH A;  1RNT A;  1UCL A;  1YVS A;  3D4A A;  1I2F A;  1GMQ A;  3DH2 A;  1IYY A;  3BIR A;  6RNT A;  1B27 A;  1ZGX A;  1A2P A;  1BIR A;  1GMR A;  1YNV X;  5HOH A;  1HYF A;  1FZU A;  8RNT A;  1RDS A;  3RNT A;  2RBI A;  1B2Z A;  1BAO A;  2AAD A;  1RSN A;  2F4Y A;  1JBR A;  1B3S A;  1RCK A;  2KAA A;  1R4Y A;  1LOY A;  1JBS A;  1T2I A;  1BOX A;  7GSP A;  2F5M A;  1BRN L;  1BNI A;  1FUT A;  3A5E A;  1BRS A;  1I0X A;  3D5I A;  1GOV A;  7RNT A;  1JBT A;  1BNF A;  1GOY A;  3DGY A;  4BU4 A;  1BSC A;  1BRH A;  4BIR A;  1B2M A;  1TRQ A;  1RGE A;  1YGW A;  1RGA A;  3BU4 A;  1RNB A;  1BNR A;  1UCI A;  1BGS A;  3GSP A;  1BSE A;  1B2S A;  3AHS A;  1AQZ A;  1I3I A;  2RNT A;  1FW7 A;  1BRG A;  1I2G A;  1I3F A;  1X1Y A;  5BU4 A;  2F56 A;  1BSD A;  1RN1 A;  1RGC A;  1I8V A;  5RNT A;  1LOV A;  1X1W A;  1BRJ A;  1GMP A;  1BNJ A;  1B21 A;  1BNE A;  1BRI A;  1HZ1 A;  1RTU A;  1LNI A;  2KF5 A;  4RNT A;  6GSP A;  3Q3F A;  1BAN A;  2BU4 A;  3HOH A;  1Q9E A;  1UCJ A;  1BVI A;  1DET A;  4HOH A;  1G02 A;  1MGR A;  1X1X A;  1X1U A; 
#chains in the Genus database with same CATH topology
 1RRH A;  2CC3 A;  2HMK B;  1LRA A;  2XGL A;  1V74 A;  4HM5 B;  1IV7 A;  2H0I A;  2BT3 A;  4J5K A;  1RN4 A;  1PYL A;  4ORL A;  3G0K A;  1ULJ B;  1YGE A;  3HI7 A;  4WYK B;  3WA2 X;  4FMC A;  3JUO A;  2AAE A;  2Y73 A;  2INX A;  1IT8 A;  1OHS A;  1B2X A;  2IMJ A;  3S5C A;  5BIR A;  3ALA A;  2LYX A;  4EBG A;  5DRE A;  3GAX A;  2GSP A;  2C11 A;  3EHC A;  1BSA A;  4LMI A;  4EW5 A;  4EYC A;  1DMQ A;  1DMN A;  1OPY A;  1JN5 A;  1NWW A;  1V58 A;  2K3D A;  1OGZ A;  3LYG A;  3Q90 A;  2CX0 A;  1RJO A;  3BNC A;  3SOA A;  3N54 B;  1K73 4;  5BXQ A;  4N6U A;  3JUQ A;  4XB5 A;  4N6M A;  3B4P A;  3DZL A;  1VQM 3;  1UGH I;  2KXG A;  3FKA A;  4HM7 B;  1WNH A;  2WO0 A;  3E99 A;  1SPU A;  3IJE B;  1NU3 A;  3IMA B;  4KFD A;  3FSD A;  5IG4 A;  3NHX A;  4GSP A;  1M9G A;  1EUI C;  1RGF A;  1AVK A;  3EBT A;  4HM1 B;  4HVN A;  4LSO A;  3RGR A;  3GZY B;  1RMS A;  1WTH A;  5IW9 A;  1UUV B;  1I70 A;  4G1M B;  5AEU B;  3EC9 A;  5JPU A;  3WR2 A;  1VQO 3;  4H61 A;  4J5G A;  2CWT A;  2HMM B;  3CCR 3;  1GY5 A;  2XSH B;  4KZ1 A;  1BNS A;  1IK3 A;  1G0T A;  2XR8 B;  2D42 A;  1OHO A;  1VQ7 3;  1N9E A;  2FNQ A;  1US1 A;  4K1U A;  1BUQ A;  1IYY A;  3BIR A;  1MWT A;  3AMO A;  1BIR A;  1Q42 A;  2GXF A;  2BO9 B;  2QIY A;  2Y74 A;  3CNM A;  3FF0 A;  2ML6 A;  1HYF A;  3N8B A;  3NXJ A;  5AIF A;  1YIJ 3;  4N6L A;  3V98 A;  3RNT A;  3JUN A;  2RBI A;  3NM7 A;  1B2Z A;  4L8O A;  1VZZ A;  3PCS A;  1JBR A;  2F4Y A;  1LVN A;  4R1K A;  1UUG B;  1D6Z A;  1L5G B;  1NNV A;  1GD3 A;  4XBX A;  2UX0 A;  2MC8 A;  3CD6 3;  1JBS A;  4HKV B;  1BOX A;  1D6Y A;  1OF5 B;  2CWU A;  2F5M A;  3LZA A;  7GSP A;  3A5E A;  2OTL 3;  3CCE 3;  1K9M 4;  3STD A;  2IUK A;  4FCJ A;  3CCJ 3;  1VQ5 3;  3D5I A;  4WWU C;  3VGN A;  2P09 A;  3G4S 3;  1IVV A;  1GOY A;  4HM6 B;  4R9K A;  1E3R A;  2C10 A;  3LT8 A;  4BIR A;  4RNY A;  1Q86 4;  1ISK A;  3KSP A;  1Y4K A;  1YGW A;  1BNR A;  1RGA A;  4O02 B;  1K8A 4;  1UCI A;  3K5T A;  1IDP A;  3AHS A;  4O2H A;  1JNQ A;  1VQ9 3;  2W9P A;  4O3V A;  1FW7 A;  3NQY A;  1I2G A;  2XFT A;  3Q2P A;  1ZS7 A;  3HX8 A;  2F56 A;  3F8X A;  1NDO B;  5HGR A;  1BSD A;  2CFK A;  1I8V A;  3KZT A;  4H3U A;  3G16 A;  3U97 A;  3V92 A;  1ROV A;  3DGN A;  2CK3 H;  2WOH A;  1WQL B;  1HU9 A;  1YJ9 3;  1RTU A;  5IF6 A;  2KF5 A;  1IQX A;  1JN5 B;  3FG1 A;  3VSY A;  1BAN A;  2XGN A;  1TFK A;  2BMO B;  3HOH A;  3NBB A;  1VQ4 3;  3WDG B;  2CWV A;  4MJD A;  1GY6 A;  4HOH A;  3LT9 A;  1KWI A;  1X1U A;  3JUM A;  2ZA4 A;  3AGO A;  4NRE A;  3F40 A;  1OHP A;  1SAR A;  4CCV A;  3CCU 3;  2OOV A;  1IQY A;  3KN4 A;  2QA4 3;  1UCK A;  1E97 A;  2E2V A;  2W6J H;  3S67 A;  3V99 A;  5M1A A;  1JZO A;  1VQQ A;  3DM8 A;  3URP A;  1SJW A;  3T8N A;  3DXO A;  1W2Z A;  1W6C A;  4GHO A;  3AHW A;  1JKG B;  3H51 A;  1GS3 A;  2ZHX B;  4TX4 A;  3BNE A;  2JQ5 A;  4K1V A;  2MF7 A;  1UGI A;  3PYJ A;  1RGG A;  5AIG A;  3LXU X;  3WOD G;  1B2U A;  9RNT A;  3SLU A;  5I97 A;  5DRV A;  1W00 A;  3ECF A;  5TGN A;  2Z7A A;  1QMA A;  2XFS A;  4FCM A;  5FW5 A;  4HAA A;  3X3Z A;  1FA3 A;  1V57 A;  1GSP A;  5ELJ A;  5M18 A;  1QAK A;  2GEY A;  1AY7 A;  3LML A;  1VQ6 3;  3X42 A;  2W04 A;  1STF I;  2CFL A;  1PY3 A;  1M1X B;  3G8Z A;  4K90 B;  3MYT A;  1TTO A;  2CKF B;  3O8Y A;  5CLK A;  4EXR A;  3CCV 3;  1RHL A;  1B20 A;  5CK6 A;  4HM4 B;  1OAC A;  1UCL A;  3UB1 A;  1FUW A;  4IIA A;  1YI2 3;  2Z77 A;  4HM0 B;  4O8S A;  3SVA A;  2E2T A;  6RNT A;  1B27 A;  4IPB A;  3J7Y d;  2WOF A;  1FGM A;  4XBT A;  2F86 B;  2H0G A;  3QRD A;  3MHE A;  5HOH A;  1FZU A;  3NBR A;  2Z6B A;  4I5Q A;  4STD A;  1G96 A;  2XF3 A;  5LC7 A;  2W03 A;  2CFD A;  1VQ8 3;  2F98 A;  1B3S A;  2UUG C;  3NM2 A;  1ZO2 A;  2W56 A;  1W01 A;  1LNH A;  3K63 A;  3GWR A;  4N6O B;  3OV4 A;  1M1K 4;  2CIU A;  1FUT A;  1N8R 4;  1W5Z A;  4BL2 A;  1BRS A;  3KII A;  3MKI A;  1O7H B;  3DY5 A;  4HBR A;  1DVD A;  1I0X A;  1Z1S A;  4KT3 B;  3WOE B;  2XRX B;  5AYS C;  5KP1 A;  3X3X A;  8CHO A;  7RNT A;  4BTW A;  3GZX B;  2E2U A;  1O7M B;  4BU4 A;  4XBY A;  4EV5 A;  4ZM8 A;  1OUN A;  1WMN A;  1M90 4;  5AI1 A;  1B2M A;  3EF8 A;  2R41 A;  2CG1 A;  3BU4 A;  3EN8 A;  3NQZ A;  2CG0 A;  2LQV A;  4FMD A;  1EEJ A;  1AQZ A;  1TIJ A;  2RNT A;  4OVM A;  3BNB A;  1BRG A;  1I3F A;  5IEP A;  1SII A;  1QAF A;  2GBW B;  5D81 A;  1UW1 A;  3PZW A;  5RNT A;  5IER A;  1X1W A;  5CXO A;  1IVX A;  3CPO A;  1B21 A;  1O7G B;  2A15 A;  3JUP A;  7STD A;  1BRI A;  1ASK A;  1HZ1 A;  1UDI I;  1GY7 A;  4RNT A;  5EQL A;  6GSP A;  1O7P B;  2IUJ A;  3KKG A;  5EEO A;  2BU4 A;  2I9W A;  3FG4 A;  1JB5 A;  2O3O A;  3GZB A;  3WA3 A;  5KP4 A;  4LZI A;  3T8U A;  1BVI A;  5EVH A;  1OGX A;  1PFP A;  1G02 A;  5AII A;  1KC8 4;  5AEW B;  2OQE C;  1T5Y A;  3F7X A;  4EC6 A;  2V1L A;  3EN1 B;  1QVF 2;  4WYK A;  2HMJ B;  3D3L A;  3FH1 A;  2YFI B;  2C4B A;  3LTC A;  1PU4 A;  1RGH A;  1W2B 2;  3KCH A;  1D6U A;  3DGM A;  1TRP A;  4HZB B;  3D79 A;  4IT7 A;  1I2E A;  1I0V A;  3MPH A;  1Q7Y 4;  1GOU A;  2RCD A;  1DMM A;  1QJG A;  3OW2 2;  3KFQ C;  1HKX A;  2SAR A;  4FMB A;  3SXX A;  1EQK A;  2FXT A;  3QK9 A;  1CYV A;  3ZG0 A;  4ILF A;  3F9S A;  2P05 A;  1W7C A;  3FZW A;  3DGO A;  3KE7 A;  3N9H A;  4OK0 A;  1BU4 A;  1RGL A;  1SQW A;  1IU7 A;  3CU3 A;  3AGN A;  1A67 A;  3GRD A;  2QEX 3;  1IV9 A;  4R80 A;  3NBJ A;  1RCL A;  5KP3 A;  5JBS A;  4WFO A;  1FYS A;  3B7C A;  3MSO A;  1FUS A;  1IVU A;  1BSB A;  2CHC A;  3ZFZ A;  1R4C A;  2KF4 A;  1Q40 A;  2SBL A;  1MGW A;  2PZV A;  4AKZ A;  3FLJ A;  3PCR A;  2F99 A;  1W4N A;  1EG9 B;  3T0U A;  3WHO A;  3NV0 A;  1T3B A;  1TP6 A;  4N6V 0;  1BNG A;  3I55 3;  4XDV A;  1AV4 A;  2YFL B;  1JB4 A;  2BIR A;  3WOF B;  1RLS A;  5FGO A;  3CCM 3;  3OWS A;  1RNT A;  1U8C B;  5D83 A;  3K9M C;  5G2G A;  3EJV A;  1GYB A;  3D4A A;  4BTX A;  2BHM A;  5CF1 A;  1GMQ A;  3DH2 A;  1KSI A;  4KFE A;  3M8C A;  2M7O A;  1GMR A;  1MWR A;  1YNV X;  3AMO B;  5A0O B;  2XH9 A;  3RGA A;  8RNT A;  4MMY B;  5AIH A;  1Q7H A;  3WMD A;  3MWZ A;  2B24 B;  1BAO A;  4NHF A;  2Q07 A;  1RCK A;  1FGO A;  3CC7 3;  2IYJ A;  3CCS 3;  3D9R A;  3CCL 3;  3HIG A;  1T2I A;  3MG3 A;  3DUK A;  2QGU A;  1MOL A;  2J8X B;  2CX1 A;  3SX1 A;  3K7C A;  1SIH A;  1BRN L;  4RZM A;  1VQN 3;  4U13 A;  5ELU A;  5IEO A;  3RDE A;  3HZP A;  1U5O A;  4MMX B;  3EBY A;  1EA2 A;  3F8H A;  2R4I A;  3SED A;  3Q1C A;  5STD A;  1GOV A;  1JBT A;  3G71 3;  2GU3 A;  1BSC A;  1LXE A;  1FGR A;  3CCQ 3;  1TRQ A;  4XDW A;  2RGQ A;  1VQL 3;  1QAL A;  1RGE A;  1RRL A;  2CFG A;  3OX9 A;  4N3V A;  1B2S A;  1I3I A;  3X41 A;  1GD4 A;  3S27 A;  1X1Y A;  3UL5 A;  3LTB A;  4HZ9 B;  4CJN A;  5BU4 A;  1IVW A;  2W2C A;  1J2B A;  1AR0 A;  1RGC A;  2HMO B;  1BRJ A;  1MNL A;  4JF8 A;  3S29 A;  4CPK A;  3CPW 2;  1K41 A;  1LQG C;  3B8L A;  4FCZ A;  4GL6 A;  4RBN A;  3BLZ A;  4BL3 A;  2CW9 A;  4J8T A;  3NUV A;  4FMA A;  4DKI A;  2HMN B;  1N9J A;  3NX0 A;  1TJD A;  2D1W A;  1K28 A;  1DYU A;  1NB3 I;  1NB5 I;  3IPT A;  1UCJ A;  1A2K A;  1TUH A;  1CEW I;  4WHA A;  3I56 3;  1UI8 A;  1X1X A;  2CH9 A;  4HJL B;  1C54 A;  1A2V A;  1BUJ A;  1Q40 B;  1STD A;  2RFR A;  2W0Q A;  1FGQ A;  3UJM A;  3EX9 A;  4J9A A;  1JB2 A;  1DE3 A;  1C7H A;  1CH0 A;  3NV0 B;  3LOY A;  2UGI A;  3CXC 2;  1IT7 A;  4LEH A;  5G1L A;  2KF3 A;  1JKG A;  1T2H A;  1WMP A;  1LOW A;  2BMR B;  3UNL A;  1YJW 3;  5JPP A;  4MEI A;  3X3Y A;  2F5W A;  2GU1 A;  5GSP A;  2P38 A;  2K0M A;  2KF6 A;  3MG1 A;  4HM2 B;  1YIT 3;  2FGT A;  2CFW A;  2P0M A;  2PNC A;  3D5G A;  5AYR B;  1E3V A;  3L0R A;  1YHQ 3;  1A90 A;  4R9L A;  3A76 A;  1CYU A;  3EB8 A;  3EQQ B;  3H3H A;  4N6N B;  2XEP A;  3LH4 A;  3VF1 A;  3CC4 3;  1BRK A;  5M19 A;  1W6G A;  2W9Q A;  1UUW B;  3CC2 3;  6STD A;  2WGO A;  1JZD A;  3SYU A;  2GBX B;  3S28 A;  4N6T A;  4KFF A;  3ZG5 A;  4K61 A;  1RGK A;  4L7K A;  4CDL A;  1N5H A;  2HOH A;  1ZX2 A;  2K54 A;  4BTY A;  2B1X B;  2OQE A;  5IG5 A;  1YVS A;  3F14 A;  1I2F A;  4WP5 A;  1ZGX A;  1A2P A;  1LQM B;  1WMO A;  2O9U X;  1N5P A;  2RSX A;  1RDS A;  1W6Y A;  1OCV A;  3U1W A;  1UI7 A;  1OH0 A;  1RSN A;  2AAD A;  2JDI H;  3ROB A;  2BNG A;  2KAA A;  2KCD A;  3FG3 A;  3SOY A;  1FGT A;  1R4Y A;  1F8N A;  1JJ2 2;  2XSO B;  2KRT A;  3PS8 A;  2P0X A;  1LOY A;  2W56 B;  2IY2 A;  4HM8 B;  4KVH A;  3TDG A;  5BVB A;  5CF2 A;  4X2H A;  1KQS 2;  1BNI A;  1ROA A;  1Q82 4;  1N8Q A;  1VQP 3;  1MWS A;  2GEX A;  1RKY A;  1JV2 B;  2BMQ B;  4QWT A;  4I4K A;  4EV2 A;  2OOV C;  2STD A;  3FCS B;  3KSE D;  3I0Y A;  3OXA A;  5D82 A;  2WGQ A;  1RN7 A;  3DMC A;  1BNF A;  2IA7 A;  2YFJ B;  1LOX A;  4LGQ A;  3DGY A;  3JVC A;  1DVC A;  2YX9 A;  2OCT A;  4NPB A;  4AKY A;  5IEN A;  1IQ8 A;  4JRF A;  5G1K A;  1BRH A;  2OTJ 3;  4X2O A;  1O7N B;  1KD1 4;  2ZDJ A;  4LYL B;  1RNB A;  1EKM A;  2HML B;  1TU5 A;  1BGS A;  3GSP A;  3PXM A;  4RNZ A;  1BSE A;  4Q53 A;  2Z76 A;  1NO3 A;  5LC6 A;  4AEQ A;  1O7W B;  2L1S A;  3BB9 A;  4R4K A;  5IG0 A;  2OWP A;  3FGY A;  1S5A A;  1YVB I;  3F7S A;  1VQK 3;  3LTD A;  1YJN 3;  1ULI B;  2L4V A;  1AVL A;  1RN1 A;  3CMA 3;  1OF5 A;  3BND A;  4FR9 A;  1LOV A;  1JRQ A;  1GMP A;  1BNJ A;  3MG2 A;  1QVG 2;  2ZL8 A;  3HII A;  1W02 A;  3K0Z A;  5IG3 A;  3CME 3;  1NJI 4;  3OWU A;  3GZR A;  4MMZ B;  1BNE A;  1Q81 4;  1TFO A;  1S72 3;  1LNI A;  1CQS A;  3ER7 A;  3OWY A;  4HM3 B;  3CNX A;  3FF2 A;  4XM4 A;  3Q3F A;  3X40 A;  3UL6 A;  2ML5 A;  3G6E 3;  3HK4 A;  4GB5 A;  3PGB A;  4HYZ A;  2H0H A;  1Q9E A;  4PEJ A;  4OUQ A;  3B4O A;  3LTA A;  4L8P A;  1MWU A;  3DGL A;  1DET A;  1MGR A;  3EE1 A; 
#chains in the Genus database with same CATH homology
 2ZA4 A;  1LRA A;  3AGO A;  1BUJ A;  1C54 A;  1SAR A;  4J5K A;  1RN4 A;  1PYL A;  2C4B A;  1UCK A;  1DE3 A;  1CH0 A;  2AAE A;  1RGH A;  3KCH A;  1B2X A;  1TRP A;  5BIR A;  1I2E A;  1I0V A;  3URP A;  1GOU A;  2KF3 A;  1T2H A;  2GSP A;  4GHO A;  1LOW A;  2SAR A;  3AHW A;  1BSA A;  2F5W A;  5GSP A;  2KF6 A;  1BU4 A;  1RGL A;  3AGN A;  1RGG A;  1RCL A;  3D5G A;  1FYS A;  1B2U A;  1FUS A;  9RNT A;  1BSB A;  4HAA A;  2KF4 A;  1GSP A;  1MGW A;  1RGF A;  4GSP A;  1AY7 A;  1BRK A;  1RMS A;  3WHO A;  1PY3 A;  1I70 A;  1BNG A;  2BIR A;  3SYU A;  3WR2 A;  1RLS A;  1TTO A;  4J5G A;  1RGK A;  1RHL A;  1B20 A;  1BNS A;  2HOH A;  1RNT A;  1UCL A;  1YVS A;  3D4A A;  1I2F A;  1GMQ A;  3DH2 A;  1IYY A;  3BIR A;  6RNT A;  1B27 A;  1ZGX A;  1A2P A;  1BIR A;  1GMR A;  1YNV X;  5HOH A;  1HYF A;  1FZU A;  8RNT A;  1RDS A;  3RNT A;  2RBI A;  1B2Z A;  1BAO A;  2AAD A;  1RSN A;  2F4Y A;  1JBR A;  1B3S A;  1RCK A;  2KAA A;  1R4Y A;  1LOY A;  1JBS A;  1T2I A;  1BOX A;  7GSP A;  2F5M A;  1BRN L;  1BNI A;  1FUT A;  3A5E A;  1BRS A;  1I0X A;  3D5I A;  1GOV A;  7RNT A;  1JBT A;  1BNF A;  1GOY A;  3DGY A;  4BU4 A;  1BSC A;  1BRH A;  4BIR A;  1B2M A;  1TRQ A;  1RGE A;  1YGW A;  1RGA A;  3BU4 A;  1RNB A;  1BNR A;  1UCI A;  1BGS A;  3GSP A;  1BSE A;  1B2S A;  3AHS A;  1AQZ A;  1I3I A;  2RNT A;  1FW7 A;  1BRG A;  1I2G A;  1I3F A;  1X1Y A;  5BU4 A;  2F56 A;  1BSD A;  1RN1 A;  1RGC A;  1I8V A;  5RNT A;  1LOV A;  1X1W A;  1BRJ A;  1GMP A;  1BNJ A;  1B21 A;  1BNE A;  1BRI A;  1HZ1 A;  1RTU A;  1LNI A;  2KF5 A;  4RNT A;  6GSP A;  3Q3F A;  1BAN A;  2BU4 A;  3HOH A;  1Q9E A;  1UCJ A;  1BVI A;  1DET A;  4HOH A;  1G02 A;  1MGR A;  1X1X A;  1X1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...