3D9RA

Crystal structure of ketosteroid isomerase-like protein (yp_049581.1) from erwinia carotovora atroseptica scri1043 at 2.40 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
KIFNEELAVIEAAAIAYLTAFNRADIPAVIATYTDDGVLMGPGRPAAVGKDELAEVYLSVFETVGFDMAYEIKEVVQTSADWAFVRSATEGTETNKATGVVTPAAYQELFLLRKSATGSWQTARYCTSKISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords ketosteroid isomerase-like protein
publication title Crystal structure of ketosteroid isomerase-like protein (YP_049581.1) from ERWINIA CAROTOVORA ATROSEPTICA SCRI1043 at 2.40 A resolution
rcsb
source organism Pectobacterium atrosepticum
total genus 38
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3d9rA00
3FKAA 5IG5A 3GZRA 4FCJA 4I4KA 5AIGA 3ER7A 4ORLA 1GY7A 3ROBA 3NHXA 5KP4A 5AIIA 3KZTA 3HX8A 3K0ZA 3MYTA 1DMQA 3LYGA 3VGNA 1AR0A 1A2KA 3NUVA 5D82A 1U5OA 1K41A 2PZVA 3STDA 5STDA 3F40A 1JKGA 3DUKA 4XBXA 1SJWA 3DXOA 3JUOA 1OGZA 3FF0A 3MG1A 2Z7AA 3CU3A 3OWUA 3DMCA 2QGUA 3SEDA 1ZX2A 2YFLB 4HM5B 4XBYA 2BNGA 2A15A 5IG0A 3EN8A 5BVBA 1OPYA 2HMJB 2RCDA 1QMAA 3LZAA 1UUVB 3JUPA 3S5CA 3K7CA 1W00A 3B8LA 5AIFA 4LEHA 5D83A 5IF6A 3B4PA 1TUHA 1E97A 1S5AA 3JUNA 3NXJA 3KSPA 2BMOB 4PEJA 1Q40B 1IDPA 2BMRB 1JN5A 1BUQA 3EBYA 1O7GB 5AEUB 4RZMA 2CKFB 3FZWA 3CNMA 3MKIA 5HGRA 1UUWB 2B24B 1E3RA 3EC9A 2F98A 1JB5A 2UX0A 3EF8A 1OHPA 3H3HA 4XB5A 2F99A 3OX9A 1ISKA 3HZPA 3GRDA 5CLKA 2HMKB 2R4IA 3KE7A 5IEOA 5IERA 1W02A 4R1KA 1OUNA 4WYKA 3OWSA 4MJDA 5IG3A 3SOAA 3B7CA 2GBXB 1GY6A 3RGAA 3EN1B 1O7MB 2STDA 4KVHA 2W2CA 3F7SA 3F9SA 4N3VA 3KKGA 5CF2A 4J9AA 5AIHA 2YFJB 3MG3A 4HJLB 2QIYA 3JUQA 3CNXA 4X2OA 4OUQA 1WQLB 1OH0A 3RGRA 1CQSA 3MG2A 4R9KA 2YFIB 5EVHA 1DMNA 3NV0B 5IG4A 4GB5A 4R9LA 3OWYA 3WMDA 1E3VA 4WP5A 3OXAA 3M8CA 1OF5B 4H3UA 1NDOB 2GEXA 1HKXA 2K54A 5IENA 4L7KA 2OWPA 3NBRA 1JB4A 4HVNA 2XRXB 2XR8B 1GY5A 3G8ZA 4HZBB 1GS3A 4K1UA 2INXA 4HM8B 3ECFA 3EHCA 4HM0B 2GEYA 2JQ5A 3GZBA 3MHEA 2XSHB 5FW5A 3FSDA 3H51A 4L8OA 1Q40A 1W6YA 3BLZA 3HK4A 2Z77A 5DREA 2HMNB 1ASKA 3EX9A 4U13A 1NWWA 1VZZA 3EQQB 3G0KA 4LMIA 6STDA 3G16A 5AEWB 3EJVA 1ZO2A 1OCVA 3I0YA 5KP3A 3MSOA 1GYBA 2HMMB 3FH1A 3A76A 1O7NB 5KP1A 7STDA 5JPUA 2RFRA 2XSOB 2F86B 2I9WA 4HKVB 1STDA 2RGQA 1TP6A 4LGQA 2Z76A 3E99A 1JKGB 1NU3A 3UJMA 3B4OA 1EA2A 5CXOA 4X2HA 3BB9A 1JB2A 3F8XA 3F7XA 4XDVA 1Z1SA 8CHOA 1O7HB 2IMJA 3Q90A 2B1XB 5AI1A 2GXFA 1OGXA 2GBWB 5BXQA 1Q42A 3EBTA 4XDWA 3SOYA 4CDLA 4XM4A 1DMMA 4HM7B 3NM2A 1ULJB 3T8UA 3D9RA 1O7PB 3T8NA 4IIAA 4FCMA 1EG9B 5D81A 3DZLA 4HM4B 4XBTA 3VSYA 3JUMA 4L8PA 4Q53A 3F14A 3GZYB 5TGNA 1JN5B 3GZXB 3NV0A 1OHSA 5CF1A 1O7WB 2HMOB 5G2GA 4HM1B 1W01A 4STDA 1ULIB 1OHOA 1OF5A 4OVMA 5JPPA 3OV4A 2HMLB 3UNLA 4K1VA 3F8HA 1C7HA 4HM6B 4HM2B 2CHCA 5CK6A 2BMQB 3FLJA 1QJGA 3FF2A 3IPTA 4WWUC 4HZ9B 4WYKB 3GWRA 3CPOA 4J8TA 4HM3B 3FGYA 5IEPA 5DRVA 3DM8A
chains in the Genus database with same CATH superfamily
1RGFA 1N5HA 1M1XB 1B20A 2AADA 3KIIA 2E2VA 3FKAA 5M1AA 5IG5A 1TIJA 1MWUA 1JJ22 3UB1A 2JDIH 3SXXA 1IVWA 1BSBA 3GZRA 3X41A 2IY2A 1IT7A 1IU7A 1LOYA 3X3ZA 1YVBI 4FCJA 4I4KA 1Q864 5AIGA 1FZUA 1KQS2 2Y74A 3ER7A 3RDEA 4ORLA 1GY7A 3V92A 3OW22 4EYCA 3ROBA 1RHLA 3ZG5A 5AYRB 3NHXA 5KP4A 2KF6A 1US1A 3FG4A 1FUWA 3Q2PA 2RNTA 1G0TA 5AIIA 2F4YA 3KZTA 4KFEA 2OCTA 3GAXA 2ML5A 3HX8A 3K0ZA 3MYTA 3LTDA 3QRDA 1DMQA 3LYGA 1W2ZA 5AYSC 3VGNA 1UI7A 2H0HA 3DGMA 1IVVA 1AR0A 2XH9A 7RNTA 1A2KA 1GMRA 3NUVA 2ZDJA 3LTAA 4BTWA 1JV2B 1WMNA 1OACA 1W2B2 5D82A 1U5OA 1K41A 2PZVA 3STDA 5STDA 1FGTA 1EQKA 2IA7A 3PS8A 1BSCA 3F40A 1JKGA 3DUKA 3N8BA 4FCZA 1VQN3 4XBXA 3AHSA 2KF5A 1SJWA 3DXOA 3CCE3 4O3VA 4LZIA 2UGIA 3JUOA 4FR9A 1BU4A 1OGZA 5EEOA 4R4KA 2UUGC 3FF0A 1AQZA 2Z7AA 3MG1A 1WMOA 2P0MA 2P09A 3WODG 3QK9A 1GD3A 3NQYA 3ALAA 3CU3A 3OWUA 3DMCA 1UW1A 1I3FA 1A2PA 2WOFA 2QGUA 4CCVA 3SEDA 1ZX2A 3J7Yd 1UI8A 2YFLB 4HM5B 4XBYA 1EEJA 2BNGA 1RNTA 1I0VA 3LTBA 2ML6A 2Z6BA 1AV4A 2A15A 2OOVA 1RGLA 2CX0A 3EN8A 3AMOB 4HBRA 5IG0A 1DVDA 4BTYA 1A67A 1RN7A 3V98A 1TU5A 5I97A 4ILFA 3D3LA 3BU4A 5BVBA 1VQQA 3CCM3 1IT8A 2K0MA 1OPYA 2HMJB 2RCDA 1BSEA 1QMAA 4R80A 4NHFA 3FG3A 2H0GA 2XFSA 3LZAA 1UUVB 3JUPA 3S5CA 1BNIA 2KF3A 2LQVA 3K7CA 1I3IA 1W00A 1W6CA 3B8LA 5AIFA 1KWIA 2BT3A 1V57A 3CXC2 4LEHA 5D83A 1QVF2 1RGCA 1HYFA 4MEIA 5IF6A 3B4PA 3I563 1TUHA 4N6OB 1LOXA 1E97A 1RKYA 1S5AA 4I5QA 3JUNA 1IQYA 3BNBA 3NXJA 2CH9A 4GSPA 2R41A 1G96A 1QAKA 7GSPA 3KSPA 2BMOB 4ZM8A 4PEJA 4BL3A 1WMPA 1PU4A 1Q40B 2BU4A 3S27A 1IDPA 3ZFZA 1LNIA 3CD63 2BMRB 1JN5A 1BRIA 1BUQA 2CW9A 1N8R4 2CFKA 3SX1A 8RNTA 3EBYA 2D1WA 2BHMA 1B2SA 1O7GB 3IJEB 5AEUB 1LXEA 4RZMA 1TTOA 4RNTA 1T2IA 2CKFB 4QWTA 3FZWA 3X3XA 1BAOA 2FGTA 1BNJA 1SQWA 1FGQA 3CNMA 2ZL8A 1BRJA 3MKIA 1BRKA 5HGRA 1UUWB 1SARA 4FMBA 4KT3B 1W6GA 2W56A 2B24B 1HU9A 1MGWA 1A2VA 1E3RA 4TX4A 4N6UA 3X40A 1R4YA 3EC9A 1JZOA 2WOHA 2F98A 1VQP3 1JB5A 3K63A 3LT9A 2IUKA 2UX0A 3EF8A 1VQL3 4RBNA 1OHPA 4HAAA 1FUTA 3H3HA 2QA43 4XB5A 2KRTA 3I553 1ZGXA 2F99A 1NB3I 2KXGA 1YGWA 4AKZA 2PNCA 3OX9A 2K3DA 3HZPA 1ISKA 3GRDA 5CLKA 2HMKB 1FYSA 2R4IA 3HI7A 3KE7A 5IEOA 5IERA 3V99A 1W02A 2L4VA 3NX0A 1BNGA 4G1MB 2F5WA 4WFOA 4R1KA 1OUNA 2OQEA 4WYKA 2F5MA 3S67A 4LYLB 1X1XA 4J5GA 1MWRA 3VF1A 1K9M4 3OWSA 4MJDA 5IG3A 4GL6A 1VQ43 3SOAA 3B7CA 3G4S3 2CC3A 3DH2A 1IYYA 1FA3A 1IQXA 2GBXB 1CYUA 1GY6A 4KZ1A 1JRQA 3RGAA 1AVKA 1RLSA 3EN1B 4N6NB 1O7MB 1R4CA 3WA2X 1UCLA 2STDA 4KVHA 1Q7HA 2W2CA 2XFTA 3BNDA 3F7SA 3F9SA 4NREA 1WTHA 4N3VA 1LQMB 3LT8A 3FCSB 3KKGA 5CF2A 1JZDA 3CPW2 2Q07A 4J9AA 5AIHA 3S29A 2YFJB 3MG3A 4JF8A 3SLUA 9RNTA 4HJLB 1I70A 1G02A 4NPBA 5G1LA 1IVXA 2M7OA 1Q824 1MOLA 2V1LA 1B27A 4EC6A 2QIYA 3JUQA 1VQ93 1BSDA 3CNXA 1TJDA 4OK0A 1W4NA 1VQK3 1YIT3 1GOYA 4X2OA 5IW9A 1A90A 4OUQA 1WQLB 1OH0A 2F56A 3RGRA 2CWVA 1HZ1A 1YNVX 1YHQ3 1RGAA 2CFWA 3CC23 1CQSA 1IQ8A 1K734 3MG2A 1AY7A 4R9KA 3X42A 4O2HA 1D6UA 2P0XA 2YFIB 1BNRA 1SPUA 5EVHA 3CC43 1DMNA 1BNFA 1VQ83 3WA3A 1D6ZA 3BNCA 3O8YA 1D6YA 2O3OA 3NV0B 5IG4A 1T3BA 1B2UA 4GB5A 4R9LA 3OWYA 1VQ53 3WMDA 1U8CB 1NJI4 2XEPA 2AAEA 1QAFA 4EV5A 1K8A4 1GMPA 1I2FA 1UGIA 2RSXA 1E3VA 1CYVA 1UCKA 4WP5A 1Y4KA 2XGNA 3BNEA 3N9HA 1BNEA 3OXAA 3SVAA 1YVSA 3M8CA 1B2MA 1OF5B 1X1YA 4H3UA 1Q9EA 3FG1A 2H0IA 2W04A 1NDOB 3UL6A 2GEXA 2GU1A 1B3SA 1HKXA 4CPKA 1T5YA 1C54A 1GOUA 3MWZA 2K54A 1BRNL 1UGHI 1ROVA 2E2TA 1MNLA 5IENA 2OOVC 2MF7A 1QALA 4L7KA 1IV9A 2OWPA 3AMOA 4LSOA 2LYXA 2W9PA 2W0QA 4HYZA 4MMZB 1ROAA 3NBRA 3KCHA 4H61A 3MPHA 4MMYB 4AEQA 1VQ63 3A5EA 1JB4A 4HVNA 5M19A 2XRXB 3DGYA 2XR8B 1GY5A 3G8ZA 4HZBB 3WOFB 4KFFA 1KSIA 1RGHA 1TFOA 1Q7Y4 1GS3A 3HIGA 4K1UA 4EW5A 2INXA 3LH4A 3LMLA 4HM8B 2IUJA 3ECFA 1RNBA 1K28A 5LC7A 2GU3A 1WNHA 3EHCA 4HM0B 2GEYA 3NQZA 2YX9A 2JQ5A 4DKIA 3GZBA 4HOHA 3MHEA 4RNYA 2XGLA 2XSHB 1BOXA 1NO3A 2CFDA 5FW5A 4MMXB 1FUSA 3FSDA 1I2EA 1X1WA 1VQM3 3H51A 4L8OA 3CC73 1STFI 1TRQA 3LOYA 1Q40A 2IYJA 3DGNA 1W6YA 3BLZA 1EUIC 3BIRA 3HK4A 4N6LA 2Z77A 4K61A 1YJ93 1J2BA 5DREA 2MC8A 1BUJA 6GSPA 1RRLA 2P05A 1IK3A 5RNTA 2HMNB 3Q3FA 4O02B 1ASKA 3EX9A 4U13A 1NWWA 1VZZA 3EQQB 1N9JA 1UCJA 3G0KA 4LMIA 1N8QA 3AGOA 4AKYA 5BIRA 1KC84 2KCDA 6STDA 1RJOA 2WGQA 4K90B 3G16A 5GSPA 5AEWB 3EJVA 2W6JH 1TFKA 2QEX3 1ZO2A 1MWTA 4FMDA 1OCVA 1RN4A 1SIIA 3I0YA 5KP3A 3MSOA 1GYBA 2HMMB 2WO0A 3FH1A 3A76A 3PCRA 1O7NB 1NB5I 3D79A 1MWSA 5G1KA 5KP1A 2O9UX 3IMAB 7STDA 3HIIA 2CFLA 1DVCA 6RNTA 1B2XA 2SBLA 2RFRA 5JPUA 1V74A 3N54B 2XSOB 2F86B 2W03A 2W9QA 2I9WA 4HKVB 3U1WA 4EV2A 1DYUA 1STDA 2ZHXB 3KN4A 3NBJA 1BRGA 4N6MA 4JRFA 5A0OB 2RGQA 1JNQA 3PCSA 1PYLA 1TP6A 1FGMA 3D5IA 4LGQA 2Z76A 1GMQA 2GSPA 3E99A 1JKGB 1RTUA 3K5TA 3PZWA 1RSNA 1NU3A 1B2ZA 1RMSA 1LVNA 2OQEC 1EKMA 1LRAA 3B4OA 3UJMA 4BIRA 1EA2A 3NBBA 3PXMA 1YGEA 1TRPA 5CXOA 4X2HA 1RCLA 2CK3H 1RDSA 2CWUA 3BB9A 1GOVA 5M18A 1KD14 1JB2A 1T2HA 1UCIA 3F8XA 3KSED 4N6V0 1BRHA 3F7XA 3CCR3 1QVG2 3GSPA 3WDGB 4XDVA 2CIUA 1YIJ3 1Z1SA 2OTL3 1M904 8CHOA 1O7HB 2IMJA 3AGNA 1RCKA 3DGLA 1JBSA 3CMA3 1IVUA 1RGKA 2BIRA 2B1XB 3Q90A 3LTCA 3X3YA 5AI1A 2GXFA 1OGXA 1NNVA 1N5PA 4RNZA 4FMCA 2GBWB 5BXQA 1Q42A 3CME3 3EBTA 3LXUX 4XDWA 3SOYA 4BTXA 3CCJ3 2KF4A 1DE3A 3U97A 4CDLA 2RBIA 4XM4A 1DMMA 1MGRA 4HM7B 2CG0A 3NM2A 2BO9B 1ULJB 3Q1CA 3T8UA 1BIRA 3WR2A 3CCU3 3D9RA 4IT7A 1O7PB 2FXTA 3KFQC 3T8NA 1X1UA 4IIAA 4FCMA 1EG9B 2WGOA 1UDII 1CEWI 5D81A 3ZG0A 1BNSA 1GD4A 3D5GA 2HOHA 3DZLA 4HM4B 4XBTA 3VSYA 2CWTA 4IPBA 3JUMA 4L8PA 1M1K4 3NM7A 4CJNA 1I8VA 3WHOA 2E2UA 4BL2A 1B21A 1F8NA 1W5ZA 2P38A 4Q53A 4EBGA 3F14A 3GZYB 5EQLA 5LC6A 2J8XB 2C10A 4EXRA 2OTJ3 3TDGA 1BVIA 1DETA 2XF3A 5TGNA 1JN5B 3GZXB 3NV0A 1BANA 4J5KA 1N9EA 1IV7A 1OHSA 3DGOA 5CF1A 3K9MC 1O7WB 4WHAA 3CCV3 1V58A 2HMOB 3DY5A 2ZA4A 5G2GA 4N6TA 1LQGC 4HM1B 1W01A 1LOWA 1YI23 1CH0A 4STDA 3G713 1ULIB 2Y73A 3G6E3 1OHOA 2CG1A 4BU4A 1W7CA 1FGRA 3HOHA 2C4BA 1I0XA 1FW7A 1FGOA 1OF5A 1RN1A 4OVMA 5FGOA 5JPPA 1JBTA 1S723 3OV4A 2W56B 1LOVA 4FMAA 1I2GA 1PY3A 1GSPA 5ELUA 2HMLB 3UNLA 3JVCA 4K1VA 3CCL3 3SYUA 3EE1A 5BU4A 3F8HA 1C7HA 1PFPA 1RGEA 2CFGA 3EB8A 3URPA 1VQO3 1VQ73 4HM6B 2KAAA 4HM2B 2CHCA 3S28A 1UUGB 3PGBA 1Q814 4GHOA 2FNQA 1ZS7A 5CK6A 3CCQ3 1RGGA 3RNTA 1YJN3 2BMQB 3FLJA 1QJGA 1RRHA 3D4AA 3FF2A 1YJW3 5HOHA 1LNHA 3T0UA 1AVLA 3IPTA 4WWUC 4HZ9B 3AHWA 4WYKB 3UL5A 3GWRA 1L5GB 4O8SA 1BGSA 1JBRA 2CX1A 3PYJA 1BSAA 3CPOA 3L0RA 3WOEB 4KFDA 4J8TA 1M9GA 1BRSA 5ELJA 4HM3B 3FGYA 5JBSA 1SIHA 5IEPA 5DRVA 2L1SA 2C11A 2SARA 2D42A 3DM8A 3CCS3
chains in the Genus database with same CATH topology
1N5HA 1M1XB 3KIIA 2E2VA 3FKAA 5IG5A 1TIJA 1JJ22 3UB1A 2JDIH 3SXXA 1IVWA 3GZRA 3X41A 1IT7A 1IU7A 3X3ZA 1YVBI 4FCJA 4I4KA 1Q864 5AIGA 1KQS2 2Y74A 3ER7A 3RDEA 4ORLA 1GY7A 3V92A 3OW22 4EYCA 3ROBA 5AYRB 3NHXA 5KP4A 1US1A 3FG4A 1FUWA 3Q2PA 5AIIA 4KFEA 3KZTA 2OCTA 3GAXA 2ML5A 3HX8A 3K0ZA 3MYTA 3LTDA 3QRDA 1DMQA 3LYGA 1W2ZA 5AYSC 3VGNA 1UI7A 3DGMA 1IVVA 1AR0A 2XH9A 1A2KA 3NUVA 2ZDJA 3LTAA 4BTWA 1JV2B 1WMNA 1OACA 1W2B2 5D82A 1U5OA 1K41A 2PZVA 3STDA 5STDA 1FGTA 1EQKA 2IA7A 3PS8A 3F40A 1JKGA 3DUKA 3N8BA 4FCZA 1VQN3 4XBXA 1SJWA 3DXOA 3CCE3 4O3VA 4LZIA 3JUOA 4FR9A 1OGZA 5EEOA 4R4KA 3FF0A 3MG1A 2Z7AA 1WMOA 2P0MA 2P09A 3WODG 3QK9A 1GD3A 3NQYA 3ALAA 3CU3A 3OWUA 3DMCA 1UW1A 2WOFA 4CCVA 2QGUA 3SEDA 1ZX2A 3J7Yd 1UI8A 2YFLB 4HM5B 4XBYA 2BNGA 3LTBA 2ML6A 2Z6BA 1AV4A 2A15A 2OOVA 5IG0A 3EN8A 4HBRA 3AMOB 1DVDA 4BTYA 1A67A 1RN7A 3V98A 1TU5A 5I97A 3D3LA 5BVBA 3CCM3 1IT8A 2K0MA 1OPYA 2HMJB 2RCDA 1QMAA 4R80A 4NHFA 3FG3A 2XFSA 3LZAA 1UUVB 3JUPA 3S5CA 2LQVA 3K7CA 1W00A 1W6CA 3B8LA 5AIFA 1KWIA 2BT3A 3CXC2 4LEHA 5D83A 1QVF2 4MEIA 5IF6A 3B4PA 3I563 1TUHA 4N6OB 1LOXA 1E97A 1RKYA 1S5AA 3JUNA 1IQYA 3BNBA 3NXJA 2CH9A 1G96A 1QAKA 3KSPA 2BMOB 4ZM8A 4PEJA 1WMPA 1PU4A 1Q40B 3S27A 1IDPA 3CD63 2BMRB 1JN5A 1BUQA 2CW9A 1N8R4 2CFKA 3SX1A 3EBYA 2D1WA 2BHMA 1O7GB 3IJEB 5AEUB 1LXEA 4RZMA 2CKFB 4QWTA 3FZWA 3X3XA 2FGTA 1SQWA 1FGQA 3CNMA 2ZL8A 3MKIA 5HGRA 1UUWB 4FMBA 1W6GA 2W56A 2B24B 1HU9A 3X40A 1A2VA 1E3RA 4TX4A 4N6UA 1VQM3 3EC9A 2WOHA 1VQP3 2F98A 1JB5A 3K63A 3LT9A 2IUKA 2UX0A 3EF8A 1VQL3 4RBNA 1OHPA 2QA43 3H3HA 4XB5A 2KRTA 3I553 2F99A 1NB3I 2KXGA 4AKZA 2PNCA 3OX9A 1ISKA 3HZPA 3GRDA 5CLKA 2HMKB 2R4IA 3HI7A 3KE7A 5IEOA 5IERA 3V99A 1W02A 2L4VA 3NX0A 4G1MB 4WFOA 4R1KA 1OUNA 2OQEA 4WYKA 3S67A 3VF1A 1K9M4 3OWSA 4MJDA 5IG3A 4GL6A 1VQ43 3SOAA 3B7CA 3G4S3 2CC3A 1FA3A 1IQXA 2GBXB 1CYUA 1GY6A 4KZ1A 1JRQA 3RGAA 1AVKA 3EN1B 4N6NB 1O7MB 1R4CA 3WA2X 2STDA 4KVHA 2W2CA 2XFTA 3BNDA 3F7SA 3F9SA 4NREA 1WTHA 4N3VA 3LT8A 3FCSB 3KKGA 5CF2A 3CPW2 2Q07A 4J9AA 5AIHA 3S29A 2YFJB 3MG3A 4JF8A 3SLUA 4HJLB 1IVXA 2M7OA 1Q824 1MOLA 2V1LA 4EC6A 2QIYA 3JUQA 1VQ93 3CNXA 1YIT3 4OK0A 1W4NA 1VQK3 4X2OA 5IW9A 1A90A 4OUQA 1WQLB 1OH0A 3RGRA 2CWVA 1YHQ3 2CFWA 3CC23 1CQSA 1IQ8A 1K734 3MG2A 4R9KA 3X42A 4O2HA 1D6UA 2P0XA 2YFIB 1SPUA 5EVHA 3CC43 1DMNA 1VQ83 3WA3A 1D6ZA 3BNCA 3O8YA 1D6YA 2O3OA 3NV0B 5IG4A 4GB5A 4R9LA 3OWYA 1VQ53 3WMDA 1U8CB 1NJI4 2XEPA 1QAFA 4EV5A 1K8A4 2RSXA 1CYVA 1E3VA 4WP5A 2XGNA 1Y4KA 3BNEA 3N9HA 3OXAA 3SVAA 3M8CA 1OF5B 4H3UA 3FG1A 2W04A 1NDOB 3UL6A 2GEXA 2GU1A 1HKXA 1T5YA 3MWZA 2K54A 1ROVA 2E2TA 1MNLA 5IENA 2OOVC 2MF7A 1QALA 4L7KA 1IV9A 2OWPA 3AMOA 4LSOA 2LYXA 2W9PA 2W0QA 4HYZA 4MMZB 1ROAA 3NBRA 4H61A 3MPHA 4MMYB 4AEQA 1VQ63 1JB4A 4HVNA 2XRXB 2XR8B 1GY5A 3G8ZA 4HZBB 3WOFB 4KFFA 1KSIA 1TFOA 1Q7Y4 1GS3A 3HIGA 4K1UA 2INXA 3LH4A 3LMLA 4HM8B 2IUJA 3ECFA 1K28A 5LC7A 2GU3A 1WNHA 3EHCA 4HM0B 2GEYA 3NQZA 2YX9A 2JQ5A 3GZBA 4RNYA 3MHEA 2XGLA 2XSHB 1NO3A 2CFDA 5FW5A 4MMXB 3FSDA 3H51A 4L8OA 3CC73 1STFI 3LOYA 1Q40A 3DGNA 1W6YA 3BLZA 3HK4A 4N6LA 1YJ93 1J2BA 2Z77A 4K61A 5DREA 2MC8A 1RRLA 2P05A 1IK3A 2HMNB 4O02B 1ASKA 3EX9A 4U13A 1NWWA 1VZZA 3EQQB 1N9JA 3G0KA 4LMIA 1N8QA 4AKYA 1KC84 2KCDA 6STDA 1RJOA 2WGQA 4K90B 3G16A 5AEWB 3EJVA 2W6JH 1TFKA 2QEX3 1ZO2A 4FMDA 1OCVA 1SIIA 3I0YA 5KP3A 3MSOA 1GYBA 2HMMB 2WO0A 3FH1A 3A76A 3PCRA 1O7NB 1NB5I 5KP1A 2O9UX 3IMAB 7STDA 3HIIA 2CFLA 1DVCA 5JPUA 2SBLA 2RFRA 1V74A 3N54B 2XSOB 2W9QA 2F86B 2W03A 2I9WA 4HKVB 3U1WA 4EV2A 1DYUA 1STDA 3KN4A 3NBJA 5A0OB 4N6MA 4JRFA 2RGQA 1JNQA 3PCSA 1TP6A 1FGMA 4LGQA 2Z76A 3E99A 1JKGB 3K5TA 3PZWA 1NU3A 1LVNA 2OQEC 1EKMA 3UJMA 3B4OA 1EA2A 3NBBA 3PXMA 1YGEA 5CXOA 4X2HA 2CK3H 2CWUA 3BB9A 1KD14 1JB2A 3F8XA 3KSED 3CCR3 1QVG2 4N6V0 3F7XA 3WDGB 4XDVA 2CIUA 1YIJ3 1Z1SA 2OTL3 1M904 8CHOA 1O7HB 2IMJA 3DGLA 3CMA3 1IVUA 3X3YA 3Q90A 2B1XB 3LTCA 5AI1A 2GXFA 1OGXA 4RNZA 1N5PA 4FMCA 2GBWB 5BXQA 1Q42A 3CME3 3EBTA 3LXUX 4XDWA 3SOYA 4BTXA 3CCJ3 3U97A 4CDLA 4XM4A 1DMMA 4HM7B 2CG0A 3NM2A 2BO9B 1ULJB 3Q1CA 3T8UA 3CCU3 3D9RA 4IT7A 1O7PB 2FXTA 3KFQC 3T8NA 4IIAA 4FCMA 1EG9B 2WGOA 1CEWI 5D81A 1GD4A 3DZLA 4HM4B 4XBTA 3VSYA 2CWTA 4IPBA 3JUMA 4L8PA 1M1K4 3NM7A 2E2UA 1F8NA 1W5ZA 2P38A 4Q53A 4EBGA 3F14A 3GZYB 5EQLA 5LC6A 2C10A 4EXRA 2OTJ3 3TDGA 2XF3A 5TGNA 1JN5B 3GZXB 3NV0A 1N9EA 1IV7A 1OHSA 3DGOA 5CF1A 3K9MC 1O7WB 4WHAA 3CCV3 2HMOB 3DY5A 5G2GA 4N6TA 4HM1B 1W01A 1YI23 3G713 4STDA 1ULIB 2Y73A 3G6E3 1OHOA 2CG1A 1W7CA 1FGRA 1FGOA 1OF5A 4OVMA 5FGOA 5JPPA 1S723 3OV4A 2W56B 4FMAA 5ELUA 2HMLB 3UNLA 3JVCA 4K1VA 3CCL3 3EE1A 3F8HA 1C7HA 1PFPA 2CFGA 3EB8A 1VQO3 1VQ73 4HM6B 4HM2B 2CHCA 3S28A 3PGBA 1Q814 2FNQA 5CK6A 3CCQ3 1YJN3 2BMQB 3FLJA 1QJGA 1RRHA 3FF2A 1YJW3 1LNHA 3T0UA 1AVLA 3IPTA 4WWUC 4HZ9B 3UL5A 4WYKB 3GWRA 1L5GB 4O8SA 3PYJA 3CPOA 3L0RA 3WOEB 4KFDA 4J8TA 1M9GA 5ELJA 4HM3B 3FGYA 5JBSA 1SIHA 5IEPA 5DRVA 2C11A 2D42A 3DM8A 3CCS3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKA A;  5IG5 A;  3GZR A;  4FCJ A;  4I4K A;  5AIG A;  3ER7 A;  4ORL A;  1GY7 A;  3ROB A;  3NHX A;  5KP4 A;  5AII A;  3KZT A;  3HX8 A;  3K0Z A;  3MYT A;  1DMQ A;  3LYG A;  3VGN A;  1AR0 A;  1A2K A;  3NUV A;  5D82 A;  1U5O A;  1K41 A;  2PZV A;  3STD A;  5STD A;  3F40 A;  1JKG A;  3DUK A;  4XBX A;  1SJW A;  3DXO A;  3JUO A;  1OGZ A;  3FF0 A;  3MG1 A;  2Z7A A;  3CU3 A;  3OWU A;  3DMC A;  2QGU A;  3SED A;  1ZX2 A;  2YFL B;  4HM5 B;  4XBY A;  2BNG A;  2A15 A;  5IG0 A;  3EN8 A;  5BVB A;  1OPY A;  2HMJ B;  2RCD A;  1QMA A;  3LZA A;  1UUV B;  3JUP A;  3S5C A;  3K7C A;  1W00 A;  3B8L A;  5AIF A;  4LEH A;  5D83 A;  5IF6 A;  3B4P A;  1TUH A;  1E97 A;  1S5A A;  3JUN A;  3NXJ A;  3KSP A;  2BMO B;  4PEJ A;  1Q40 B;  1IDP A;  2BMR B;  1JN5 A;  1BUQ A;  3EBY A;  1O7G B;  5AEU B;  4RZM A;  2CKF B;  3FZW A;  3CNM A;  3MKI A;  5HGR A;  1UUW B;  2B24 B;  1E3R A;  3EC9 A;  2F98 A;  1JB5 A;  2UX0 A;  3EF8 A;  1OHP A;  3H3H A;  4XB5 A;  2F99 A;  3OX9 A;  1ISK A;  3HZP A;  3GRD A;  5CLK A;  2HMK B;  2R4I A;  3KE7 A;  5IEO A;  5IER A;  1W02 A;  4R1K A;  1OUN A;  4WYK A;  3OWS A;  4MJD A;  5IG3 A;  3SOA A;  3B7C A;  2GBX B;  1GY6 A;  3RGA A;  3EN1 B;  1O7M B;  2STD A;  4KVH A;  2W2C A;  3F7S A;  3F9S A;  4N3V A;  3KKG A;  5CF2 A;  4J9A A;  5AIH A;  2YFJ B;  3MG3 A;  4HJL B;  2QIY A;  3JUQ A;  3CNX A;  4X2O A;  4OUQ A;  1WQL B;  1OH0 A;  3RGR A;  1CQS A;  3MG2 A;  4R9K A;  2YFI B;  5EVH A;  1DMN A;  3NV0 B;  5IG4 A;  4GB5 A;  4R9L A;  3OWY A;  3WMD A;  1E3V A;  4WP5 A;  3OXA A;  3M8C A;  1OF5 B;  4H3U A;  1NDO B;  2GEX A;  1HKX A;  2K54 A;  5IEN A;  4L7K A;  2OWP A;  3NBR A;  1JB4 A;  4HVN A;  2XRX B;  2XR8 B;  1GY5 A;  3G8Z A;  4HZB B;  1GS3 A;  4K1U A;  2INX A;  4HM8 B;  3ECF A;  3EHC A;  4HM0 B;  2GEY A;  2JQ5 A;  3GZB A;  3MHE A;  2XSH B;  5FW5 A;  3FSD A;  3H51 A;  4L8O A;  1Q40 A;  1W6Y A;  3BLZ A;  3HK4 A;  2Z77 A;  5DRE A;  2HMN B;  1ASK A;  3EX9 A;  4U13 A;  1NWW A;  1VZZ A;  3EQQ B;  3G0K A;  4LMI A;  6STD A;  3G16 A;  5AEW B;  3EJV A;  1ZO2 A;  1OCV A;  3I0Y A;  5KP3 A;  3MSO A;  1GYB A;  2HMM B;  3FH1 A;  3A76 A;  1O7N B;  5KP1 A;  7STD A;  5JPU A;  2RFR A;  2XSO B;  2F86 B;  2I9W A;  4HKV B;  1STD A;  2RGQ A;  1TP6 A;  4LGQ A;  2Z76 A;  3E99 A;  1JKG B;  1NU3 A;  3UJM A;  3B4O A;  1EA2 A;  5CXO A;  4X2H A;  3BB9 A;  1JB2 A;  3F8X A;  3F7X A;  4XDV A;  1Z1S A;  8CHO A;  1O7H B;  2IMJ A;  3Q90 A;  2B1X B;  5AI1 A;  2GXF A;  1OGX A;  2GBW B;  5BXQ A;  1Q42 A;  3EBT A;  4XDW A;  3SOY A;  4CDL A;  4XM4 A;  1DMM A;  4HM7 B;  3NM2 A;  1ULJ B;  3T8U A;  3D9R A;  1O7P B;  3T8N A;  4IIA A;  4FCM A;  1EG9 B;  5D81 A;  3DZL A;  4HM4 B;  4XBT A;  3VSY A;  3JUM A;  4L8P A;  4Q53 A;  3F14 A;  3GZY B;  5TGN A;  1JN5 B;  3GZX B;  3NV0 A;  1OHS A;  5CF1 A;  1O7W B;  2HMO B;  5G2G A;  4HM1 B;  1W01 A;  4STD A;  1ULI B;  1OHO A;  1OF5 A;  4OVM A;  5JPP A;  3OV4 A;  2HML B;  3UNL A;  4K1V A;  3F8H A;  1C7H A;  4HM6 B;  4HM2 B;  2CHC A;  5CK6 A;  2BMQ B;  3FLJ A;  1QJG A;  3FF2 A;  3IPT A;  4WWU C;  4HZ9 B;  4WYK B;  3GWR A;  3CPO A;  4J8T A;  4HM3 B;  3FGY A;  5IEP A;  5DRV A;  3DM8 A; 
#chains in the Genus database with same CATH topology
 1RGF A;  1N5H A;  1M1X B;  1B20 A;  2AAD A;  3KII A;  2E2V A;  3FKA A;  5M1A A;  5IG5 A;  1TIJ A;  1MWU A;  1JJ2 2;  3UB1 A;  2JDI H;  3SXX A;  1IVW A;  1BSB A;  3GZR A;  3X41 A;  2IY2 A;  1IT7 A;  1IU7 A;  1LOY A;  3X3Z A;  1YVB I;  4FCJ A;  4I4K A;  1Q86 4;  5AIG A;  1FZU A;  1KQS 2;  2Y74 A;  3ER7 A;  3RDE A;  4ORL A;  1GY7 A;  3V92 A;  3OW2 2;  4EYC A;  3ROB A;  1RHL A;  3ZG5 A;  5AYR B;  3NHX A;  5KP4 A;  2KF6 A;  1US1 A;  3FG4 A;  1FUW A;  3Q2P A;  2RNT A;  1G0T A;  5AII A;  2F4Y A;  3KZT A;  4KFE A;  2OCT A;  3GAX A;  2ML5 A;  3HX8 A;  3K0Z A;  3MYT A;  3LTD A;  3QRD A;  1DMQ A;  3LYG A;  1W2Z A;  5AYS C;  3VGN A;  1UI7 A;  2H0H A;  3DGM A;  1IVV A;  1AR0 A;  2XH9 A;  7RNT A;  1A2K A;  1GMR A;  3NUV A;  2ZDJ A;  3LTA A;  4BTW A;  1JV2 B;  1WMN A;  1OAC A;  1W2B 2;  5D82 A;  1U5O A;  1K41 A;  2PZV A;  3STD A;  5STD A;  1FGT A;  1EQK A;  2IA7 A;  3PS8 A;  1BSC A;  3F40 A;  1JKG A;  3DUK A;  3N8B A;  4FCZ A;  1VQN 3;  4XBX A;  3AHS A;  2KF5 A;  1SJW A;  3DXO A;  3CCE 3;  4O3V A;  4LZI A;  2UGI A;  3JUO A;  4FR9 A;  1BU4 A;  1OGZ A;  5EEO A;  4R4K A;  2UUG C;  3FF0 A;  1AQZ A;  2Z7A A;  3MG1 A;  1WMO A;  2P0M A;  2P09 A;  3WOD G;  3QK9 A;  1GD3 A;  3NQY A;  3ALA A;  3CU3 A;  3OWU A;  3DMC A;  1UW1 A;  1I3F A;  1A2P A;  2WOF A;  2QGU A;  4CCV A;  3SED A;  1ZX2 A;  3J7Y d;  1UI8 A;  2YFL B;  4HM5 B;  4XBY A;  1EEJ A;  2BNG A;  1RNT A;  1I0V A;  3LTB A;  2ML6 A;  2Z6B A;  1AV4 A;  2A15 A;  2OOV A;  1RGL A;  2CX0 A;  3EN8 A;  3AMO B;  4HBR A;  5IG0 A;  1DVD A;  4BTY A;  1A67 A;  1RN7 A;  3V98 A;  1TU5 A;  5I97 A;  4ILF A;  3D3L A;  3BU4 A;  5BVB A;  1VQQ A;  3CCM 3;  1IT8 A;  2K0M A;  1OPY A;  2HMJ B;  2RCD A;  1BSE A;  1QMA A;  4R80 A;  4NHF A;  3FG3 A;  2H0G A;  2XFS A;  3LZA A;  1UUV B;  3JUP A;  3S5C A;  1BNI A;  2KF3 A;  2LQV A;  3K7C A;  1I3I A;  1W00 A;  1W6C A;  3B8L A;  5AIF A;  1KWI A;  2BT3 A;  1V57 A;  3CXC 2;  4LEH A;  5D83 A;  1QVF 2;  1RGC A;  1HYF A;  4MEI A;  5IF6 A;  3B4P A;  3I56 3;  1TUH A;  4N6O B;  1LOX A;  1E97 A;  1RKY A;  1S5A A;  4I5Q A;  3JUN A;  1IQY A;  3BNB A;  3NXJ A;  2CH9 A;  4GSP A;  2R41 A;  1G96 A;  1QAK A;  7GSP A;  3KSP A;  2BMO B;  4ZM8 A;  4PEJ A;  4BL3 A;  1WMP A;  1PU4 A;  1Q40 B;  2BU4 A;  3S27 A;  1IDP A;  3ZFZ A;  1LNI A;  3CD6 3;  2BMR B;  1JN5 A;  1BRI A;  1BUQ A;  2CW9 A;  1N8R 4;  2CFK A;  3SX1 A;  8RNT A;  3EBY A;  2D1W A;  2BHM A;  1B2S A;  1O7G B;  3IJE B;  5AEU B;  1LXE A;  4RZM A;  1TTO A;  4RNT A;  1T2I A;  2CKF B;  4QWT A;  3FZW A;  3X3X A;  1BAO A;  2FGT A;  1BNJ A;  1SQW A;  1FGQ A;  3CNM A;  2ZL8 A;  1BRJ A;  3MKI A;  1BRK A;  5HGR A;  1UUW B;  1SAR A;  4FMB A;  4KT3 B;  1W6G A;  2W56 A;  2B24 B;  1HU9 A;  1MGW A;  1A2V A;  1E3R A;  4TX4 A;  4N6U A;  3X40 A;  1R4Y A;  3EC9 A;  1JZO A;  2WOH A;  2F98 A;  1VQP 3;  1JB5 A;  3K63 A;  3LT9 A;  2IUK A;  2UX0 A;  3EF8 A;  1VQL 3;  4RBN A;  1OHP A;  4HAA A;  1FUT A;  3H3H A;  2QA4 3;  4XB5 A;  2KRT A;  3I55 3;  1ZGX A;  2F99 A;  1NB3 I;  2KXG A;  1YGW A;  4AKZ A;  2PNC A;  3OX9 A;  2K3D A;  3HZP A;  1ISK A;  3GRD A;  5CLK A;  2HMK B;  1FYS A;  2R4I A;  3HI7 A;  3KE7 A;  5IEO A;  5IER A;  3V99 A;  1W02 A;  2L4V A;  3NX0 A;  1BNG A;  4G1M B;  2F5W A;  4WFO A;  4R1K A;  1OUN A;  2OQE A;  4WYK A;  2F5M A;  3S67 A;  4LYL B;  1X1X A;  4J5G A;  1MWR A;  3VF1 A;  1K9M 4;  3OWS A;  4MJD A;  5IG3 A;  4GL6 A;  1VQ4 3;  3SOA A;  3B7C A;  3G4S 3;  2CC3 A;  3DH2 A;  1IYY A;  1FA3 A;  1IQX A;  2GBX B;  1CYU A;  1GY6 A;  4KZ1 A;  1JRQ A;  3RGA A;  1AVK A;  1RLS A;  3EN1 B;  4N6N B;  1O7M B;  1R4C A;  3WA2 X;  1UCL A;  2STD A;  4KVH A;  1Q7H A;  2W2C A;  2XFT A;  3BND A;  3F7S A;  3F9S A;  4NRE A;  1WTH A;  4N3V A;  1LQM B;  3LT8 A;  3FCS B;  3KKG A;  5CF2 A;  1JZD A;  3CPW 2;  2Q07 A;  4J9A A;  5AIH A;  3S29 A;  2YFJ B;  3MG3 A;  4JF8 A;  3SLU A;  9RNT A;  4HJL B;  1I70 A;  1G02 A;  4NPB A;  5G1L A;  1IVX A;  2M7O A;  1Q82 4;  1MOL A;  2V1L A;  1B27 A;  4EC6 A;  2QIY A;  3JUQ A;  1VQ9 3;  1BSD A;  3CNX A;  1TJD A;  4OK0 A;  1W4N A;  1VQK 3;  1YIT 3;  1GOY A;  4X2O A;  5IW9 A;  1A90 A;  4OUQ A;  1WQL B;  1OH0 A;  2F56 A;  3RGR A;  2CWV A;  1HZ1 A;  1YNV X;  1YHQ 3;  1RGA A;  2CFW A;  3CC2 3;  1CQS A;  1IQ8 A;  1K73 4;  3MG2 A;  1AY7 A;  4R9K A;  3X42 A;  4O2H A;  1D6U A;  2P0X A;  2YFI B;  1BNR A;  1SPU A;  5EVH A;  3CC4 3;  1DMN A;  1BNF A;  1VQ8 3;  3WA3 A;  1D6Z A;  3BNC A;  3O8Y A;  1D6Y A;  2O3O A;  3NV0 B;  5IG4 A;  1T3B A;  1B2U A;  4GB5 A;  4R9L A;  3OWY A;  1VQ5 3;  3WMD A;  1U8C B;  1NJI 4;  2XEP A;  2AAE A;  1QAF A;  4EV5 A;  1K8A 4;  1GMP A;  1I2F A;  1UGI A;  2RSX A;  1E3V A;  1CYV A;  1UCK A;  4WP5 A;  1Y4K A;  2XGN A;  3BNE A;  3N9H A;  1BNE A;  3OXA A;  3SVA A;  1YVS A;  3M8C A;  1B2M A;  1OF5 B;  1X1Y A;  4H3U A;  1Q9E A;  3FG1 A;  2H0I A;  2W04 A;  1NDO B;  3UL6 A;  2GEX A;  2GU1 A;  1B3S A;  1HKX A;  4CPK A;  1T5Y A;  1C54 A;  1GOU A;  3MWZ A;  2K54 A;  1BRN L;  1UGH I;  1ROV A;  2E2T A;  1MNL A;  5IEN A;  2OOV C;  2MF7 A;  1QAL A;  4L7K A;  1IV9 A;  2OWP A;  3AMO A;  4LSO A;  2LYX A;  2W9P A;  2W0Q A;  4HYZ A;  4MMZ B;  1ROA A;  3NBR A;  3KCH A;  4H61 A;  3MPH A;  4MMY B;  4AEQ A;  1VQ6 3;  3A5E A;  1JB4 A;  4HVN A;  5M19 A;  2XRX B;  3DGY A;  2XR8 B;  1GY5 A;  3G8Z A;  4HZB B;  3WOF B;  4KFF A;  1KSI A;  1RGH A;  1TFO A;  1Q7Y 4;  1GS3 A;  3HIG A;  4K1U A;  4EW5 A;  2INX A;  3LH4 A;  3LML A;  4HM8 B;  2IUJ A;  3ECF A;  1RNB A;  1K28 A;  5LC7 A;  2GU3 A;  1WNH A;  3EHC A;  4HM0 B;  2GEY A;  3NQZ A;  2YX9 A;  2JQ5 A;  4DKI A;  3GZB A;  4HOH A;  3MHE A;  4RNY A;  2XGL A;  2XSH B;  1BOX A;  1NO3 A;  2CFD A;  5FW5 A;  4MMX B;  1FUS A;  3FSD A;  1I2E A;  1X1W A;  1VQM 3;  3H51 A;  4L8O A;  3CC7 3;  1STF I;  1TRQ A;  3LOY A;  1Q40 A;  2IYJ A;  3DGN A;  1W6Y A;  3BLZ A;  1EUI C;  3BIR A;  3HK4 A;  4N6L A;  2Z77 A;  4K61 A;  1YJ9 3;  1J2B A;  5DRE A;  2MC8 A;  1BUJ A;  6GSP A;  1RRL A;  2P05 A;  1IK3 A;  5RNT A;  2HMN B;  3Q3F A;  4O02 B;  1ASK A;  3EX9 A;  4U13 A;  1NWW A;  1VZZ A;  3EQQ B;  1N9J A;  1UCJ A;  3G0K A;  4LMI A;  1N8Q A;  3AGO A;  4AKY A;  5BIR A;  1KC8 4;  2KCD A;  6STD A;  1RJO A;  2WGQ A;  4K90 B;  3G16 A;  5GSP A;  5AEW B;  3EJV A;  2W6J H;  1TFK A;  2QEX 3;  1ZO2 A;  1MWT A;  4FMD A;  1OCV A;  1RN4 A;  1SII A;  3I0Y A;  5KP3 A;  3MSO A;  1GYB A;  2HMM B;  2WO0 A;  3FH1 A;  3A76 A;  3PCR A;  1O7N B;  1NB5 I;  3D79 A;  1MWS A;  5G1K A;  5KP1 A;  2O9U X;  3IMA B;  7STD A;  3HII A;  2CFL A;  1DVC A;  6RNT A;  1B2X A;  2SBL A;  2RFR A;  5JPU A;  1V74 A;  3N54 B;  2XSO B;  2F86 B;  2W03 A;  2W9Q A;  2I9W A;  4HKV B;  3U1W A;  4EV2 A;  1DYU A;  1STD A;  2ZHX B;  3KN4 A;  3NBJ A;  1BRG A;  4N6M A;  4JRF A;  5A0O B;  2RGQ A;  1JNQ A;  3PCS A;  1PYL A;  1TP6 A;  1FGM A;  3D5I A;  4LGQ A;  2Z76 A;  1GMQ A;  2GSP A;  3E99 A;  1JKG B;  1RTU A;  3K5T A;  3PZW A;  1RSN A;  1NU3 A;  1B2Z A;  1RMS A;  1LVN A;  2OQE C;  1EKM A;  1LRA A;  3B4O A;  3UJM A;  4BIR A;  1EA2 A;  3NBB A;  3PXM A;  1YGE A;  1TRP A;  5CXO A;  4X2H A;  1RCL A;  2CK3 H;  1RDS A;  2CWU A;  3BB9 A;  1GOV A;  5M18 A;  1KD1 4;  1JB2 A;  1T2H A;  1UCI A;  3F8X A;  3KSE D;  4N6V 0;  1BRH A;  3F7X A;  3CCR 3;  1QVG 2;  3GSP A;  3WDG B;  4XDV A;  2CIU A;  1YIJ 3;  1Z1S A;  2OTL 3;  1M90 4;  8CHO A;  1O7H B;  2IMJ A;  3AGN A;  1RCK A;  3DGL A;  1JBS A;  3CMA 3;  1IVU A;  1RGK A;  2BIR A;  2B1X B;  3Q90 A;  3LTC A;  3X3Y A;  5AI1 A;  2GXF A;  1OGX A;  1NNV A;  1N5P A;  4RNZ A;  4FMC A;  2GBW B;  5BXQ A;  1Q42 A;  3CME 3;  3EBT A;  3LXU X;  4XDW A;  3SOY A;  4BTX A;  3CCJ 3;  2KF4 A;  1DE3 A;  3U97 A;  4CDL A;  2RBI A;  4XM4 A;  1DMM A;  1MGR A;  4HM7 B;  2CG0 A;  3NM2 A;  2BO9 B;  1ULJ B;  3Q1C A;  3T8U A;  1BIR A;  3WR2 A;  3CCU 3;  3D9R A;  4IT7 A;  1O7P B;  2FXT A;  3KFQ C;  3T8N A;  1X1U A;  4IIA A;  4FCM A;  1EG9 B;  2WGO A;  1UDI I;  1CEW I;  5D81 A;  3ZG0 A;  1BNS A;  1GD4 A;  3D5G A;  2HOH A;  3DZL A;  4HM4 B;  4XBT A;  3VSY A;  2CWT A;  4IPB A;  3JUM A;  4L8P A;  1M1K 4;  3NM7 A;  4CJN A;  1I8V A;  3WHO A;  2E2U A;  4BL2 A;  1B21 A;  1F8N A;  1W5Z A;  2P38 A;  4Q53 A;  4EBG A;  3F14 A;  3GZY B;  5EQL A;  5LC6 A;  2J8X B;  2C10 A;  4EXR A;  2OTJ 3;  3TDG A;  1BVI A;  1DET A;  2XF3 A;  5TGN A;  1JN5 B;  3GZX B;  3NV0 A;  1BAN A;  4J5K A;  1N9E A;  1IV7 A;  1OHS A;  3DGO A;  5CF1 A;  3K9M C;  1O7W B;  4WHA A;  3CCV 3;  1V58 A;  2HMO B;  3DY5 A;  2ZA4 A;  5G2G A;  4N6T A;  1LQG C;  4HM1 B;  1W01 A;  1LOW A;  1YI2 3;  1CH0 A;  4STD A;  3G71 3;  1ULI B;  2Y73 A;  3G6E 3;  1OHO A;  2CG1 A;  4BU4 A;  1W7C A;  1FGR A;  3HOH A;  2C4B A;  1I0X A;  1FW7 A;  1FGO A;  1OF5 A;  1RN1 A;  4OVM A;  5FGO A;  5JPP A;  1JBT A;  1S72 3;  3OV4 A;  2W56 B;  1LOV A;  4FMA A;  1I2G A;  1PY3 A;  1GSP A;  5ELU A;  2HML B;  3UNL A;  3JVC A;  4K1V A;  3CCL 3;  3SYU A;  3EE1 A;  5BU4 A;  3F8H A;  1C7H A;  1PFP A;  1RGE A;  2CFG A;  3EB8 A;  3URP A;  1VQO 3;  1VQ7 3;  4HM6 B;  2KAA A;  4HM2 B;  2CHC A;  3S28 A;  1UUG B;  3PGB A;  1Q81 4;  4GHO A;  2FNQ A;  1ZS7 A;  5CK6 A;  3CCQ 3;  1RGG A;  3RNT A;  1YJN 3;  2BMQ B;  3FLJ A;  1QJG A;  1RRH A;  3D4A A;  3FF2 A;  1YJW 3;  5HOH A;  1LNH A;  3T0U A;  1AVL A;  3IPT A;  4WWU C;  4HZ9 B;  3AHW A;  4WYK B;  3UL5 A;  3GWR A;  1L5G B;  4O8S A;  1BGS A;  1JBR A;  2CX1 A;  3PYJ A;  1BSA A;  3CPO A;  3L0R A;  3WOE B;  4KFD A;  4J8T A;  1M9G A;  1BRS A;  5ELJ A;  4HM3 B;  3FGY A;  5JBS A;  1SIH A;  5IEP A;  5DRV A;  2L1S A;  2C11 A;  2SAR A;  2D42 A;  3DM8 A;  3CCS 3; 
#chains in the Genus database with same CATH homology
 1N5H A;  1M1X B;  3KII A;  2E2V A;  3FKA A;  5IG5 A;  1TIJ A;  1JJ2 2;  3UB1 A;  2JDI H;  3SXX A;  1IVW A;  3GZR A;  3X41 A;  1IT7 A;  1IU7 A;  3X3Z A;  1YVB I;  4FCJ A;  4I4K A;  1Q86 4;  5AIG A;  1KQS 2;  2Y74 A;  3ER7 A;  3RDE A;  4ORL A;  1GY7 A;  3V92 A;  3OW2 2;  4EYC A;  3ROB A;  5AYR B;  3NHX A;  5KP4 A;  1US1 A;  3FG4 A;  1FUW A;  3Q2P A;  5AII A;  4KFE A;  3KZT A;  2OCT A;  3GAX A;  2ML5 A;  3HX8 A;  3K0Z A;  3MYT A;  3LTD A;  3QRD A;  1DMQ A;  3LYG A;  1W2Z A;  5AYS C;  3VGN A;  1UI7 A;  3DGM A;  1IVV A;  1AR0 A;  2XH9 A;  1A2K A;  3NUV A;  2ZDJ A;  3LTA A;  4BTW A;  1JV2 B;  1WMN A;  1OAC A;  1W2B 2;  5D82 A;  1U5O A;  1K41 A;  2PZV A;  3STD A;  5STD A;  1FGT A;  1EQK A;  2IA7 A;  3PS8 A;  3F40 A;  1JKG A;  3DUK A;  3N8B A;  4FCZ A;  1VQN 3;  4XBX A;  1SJW A;  3DXO A;  3CCE 3;  4O3V A;  4LZI A;  3JUO A;  4FR9 A;  1OGZ A;  5EEO A;  4R4K A;  3FF0 A;  3MG1 A;  2Z7A A;  1WMO A;  2P0M A;  2P09 A;  3WOD G;  3QK9 A;  1GD3 A;  3NQY A;  3ALA A;  3CU3 A;  3OWU A;  3DMC A;  1UW1 A;  2WOF A;  4CCV A;  2QGU A;  3SED A;  1ZX2 A;  3J7Y d;  1UI8 A;  2YFL B;  4HM5 B;  4XBY A;  2BNG A;  3LTB A;  2ML6 A;  2Z6B A;  1AV4 A;  2A15 A;  2OOV A;  5IG0 A;  3EN8 A;  4HBR A;  3AMO B;  1DVD A;  4BTY A;  1A67 A;  1RN7 A;  3V98 A;  1TU5 A;  5I97 A;  3D3L A;  5BVB A;  3CCM 3;  1IT8 A;  2K0M A;  1OPY A;  2HMJ B;  2RCD A;  1QMA A;  4R80 A;  4NHF A;  3FG3 A;  2XFS A;  3LZA A;  1UUV B;  3JUP A;  3S5C A;  2LQV A;  3K7C A;  1W00 A;  1W6C A;  3B8L A;  5AIF A;  1KWI A;  2BT3 A;  3CXC 2;  4LEH A;  5D83 A;  1QVF 2;  4MEI A;  5IF6 A;  3B4P A;  3I56 3;  1TUH A;  4N6O B;  1LOX A;  1E97 A;  1RKY A;  1S5A A;  3JUN A;  1IQY A;  3BNB A;  3NXJ A;  2CH9 A;  1G96 A;  1QAK A;  3KSP A;  2BMO B;  4ZM8 A;  4PEJ A;  1WMP A;  1PU4 A;  1Q40 B;  3S27 A;  1IDP A;  3CD6 3;  2BMR B;  1JN5 A;  1BUQ A;  2CW9 A;  1N8R 4;  2CFK A;  3SX1 A;  3EBY A;  2D1W A;  2BHM A;  1O7G B;  3IJE B;  5AEU B;  1LXE A;  4RZM A;  2CKF B;  4QWT A;  3FZW A;  3X3X A;  2FGT A;  1SQW A;  1FGQ A;  3CNM A;  2ZL8 A;  3MKI A;  5HGR A;  1UUW B;  4FMB A;  1W6G A;  2W56 A;  2B24 B;  1HU9 A;  3X40 A;  1A2V A;  1E3R A;  4TX4 A;  4N6U A;  1VQM 3;  3EC9 A;  2WOH A;  1VQP 3;  2F98 A;  1JB5 A;  3K63 A;  3LT9 A;  2IUK A;  2UX0 A;  3EF8 A;  1VQL 3;  4RBN A;  1OHP A;  2QA4 3;  3H3H A;  4XB5 A;  2KRT A;  3I55 3;  2F99 A;  1NB3 I;  2KXG A;  4AKZ A;  2PNC A;  3OX9 A;  1ISK A;  3HZP A;  3GRD A;  5CLK A;  2HMK B;  2R4I A;  3HI7 A;  3KE7 A;  5IEO A;  5IER A;  3V99 A;  1W02 A;  2L4V A;  3NX0 A;  4G1M B;  4WFO A;  4R1K A;  1OUN A;  2OQE A;  4WYK A;  3S67 A;  3VF1 A;  1K9M 4;  3OWS A;  4MJD A;  5IG3 A;  4GL6 A;  1VQ4 3;  3SOA A;  3B7C A;  3G4S 3;  2CC3 A;  1FA3 A;  1IQX A;  2GBX B;  1CYU A;  1GY6 A;  4KZ1 A;  1JRQ A;  3RGA A;  1AVK A;  3EN1 B;  4N6N B;  1O7M B;  1R4C A;  3WA2 X;  2STD A;  4KVH A;  2W2C A;  2XFT A;  3BND A;  3F7S A;  3F9S A;  4NRE A;  1WTH A;  4N3V A;  3LT8 A;  3FCS B;  3KKG A;  5CF2 A;  3CPW 2;  2Q07 A;  4J9A A;  5AIH A;  3S29 A;  2YFJ B;  3MG3 A;  4JF8 A;  3SLU A;  4HJL B;  1IVX A;  2M7O A;  1Q82 4;  1MOL A;  2V1L A;  4EC6 A;  2QIY A;  3JUQ A;  1VQ9 3;  3CNX A;  1YIT 3;  4OK0 A;  1W4N A;  1VQK 3;  4X2O A;  5IW9 A;  1A90 A;  4OUQ A;  1WQL B;  1OH0 A;  3RGR A;  2CWV A;  1YHQ 3;  2CFW A;  3CC2 3;  1CQS A;  1IQ8 A;  1K73 4;  3MG2 A;  4R9K A;  3X42 A;  4O2H A;  1D6U A;  2P0X A;  2YFI B;  1SPU A;  5EVH A;  3CC4 3;  1DMN A;  1VQ8 3;  3WA3 A;  1D6Z A;  3BNC A;  3O8Y A;  1D6Y A;  2O3O A;  3NV0 B;  5IG4 A;  4GB5 A;  4R9L A;  3OWY A;  1VQ5 3;  3WMD A;  1U8C B;  1NJI 4;  2XEP A;  1QAF A;  4EV5 A;  1K8A 4;  2RSX A;  1CYV A;  1E3V A;  4WP5 A;  2XGN A;  1Y4K A;  3BNE A;  3N9H A;  3OXA A;  3SVA A;  3M8C A;  1OF5 B;  4H3U A;  3FG1 A;  2W04 A;  1NDO B;  3UL6 A;  2GEX A;  2GU1 A;  1HKX A;  1T5Y A;  3MWZ A;  2K54 A;  1ROV A;  2E2T A;  1MNL A;  5IEN A;  2OOV C;  2MF7 A;  1QAL A;  4L7K A;  1IV9 A;  2OWP A;  3AMO A;  4LSO A;  2LYX A;  2W9P A;  2W0Q A;  4HYZ A;  4MMZ B;  1ROA A;  3NBR A;  4H61 A;  3MPH A;  4MMY B;  4AEQ A;  1VQ6 3;  1JB4 A;  4HVN A;  2XRX B;  2XR8 B;  1GY5 A;  3G8Z A;  4HZB B;  3WOF B;  4KFF A;  1KSI A;  1TFO A;  1Q7Y 4;  1GS3 A;  3HIG A;  4K1U A;  2INX A;  3LH4 A;  3LML A;  4HM8 B;  2IUJ A;  3ECF A;  1K28 A;  5LC7 A;  2GU3 A;  1WNH A;  3EHC A;  4HM0 B;  2GEY A;  3NQZ A;  2YX9 A;  2JQ5 A;  3GZB A;  4RNY A;  3MHE A;  2XGL A;  2XSH B;  1NO3 A;  2CFD A;  5FW5 A;  4MMX B;  3FSD A;  3H51 A;  4L8O A;  3CC7 3;  1STF I;  3LOY A;  1Q40 A;  3DGN A;  1W6Y A;  3BLZ A;  3HK4 A;  4N6L A;  1YJ9 3;  1J2B A;  2Z77 A;  4K61 A;  5DRE A;  2MC8 A;  1RRL A;  2P05 A;  1IK3 A;  2HMN B;  4O02 B;  1ASK A;  3EX9 A;  4U13 A;  1NWW A;  1VZZ A;  3EQQ B;  1N9J A;  3G0K A;  4LMI A;  1N8Q A;  4AKY A;  1KC8 4;  2KCD A;  6STD A;  1RJO A;  2WGQ A;  4K90 B;  3G16 A;  5AEW B;  3EJV A;  2W6J H;  1TFK A;  2QEX 3;  1ZO2 A;  4FMD A;  1OCV A;  1SII A;  3I0Y A;  5KP3 A;  3MSO A;  1GYB A;  2HMM B;  2WO0 A;  3FH1 A;  3A76 A;  3PCR A;  1O7N B;  1NB5 I;  5KP1 A;  2O9U X;  3IMA B;  7STD A;  3HII A;  2CFL A;  1DVC A;  5JPU A;  2SBL A;  2RFR A;  1V74 A;  3N54 B;  2XSO B;  2W9Q A;  2F86 B;  2W03 A;  2I9W A;  4HKV B;  3U1W A;  4EV2 A;  1DYU A;  1STD A;  3KN4 A;  3NBJ A;  5A0O B;  4N6M A;  4JRF A;  2RGQ A;  1JNQ A;  3PCS A;  1TP6 A;  1FGM A;  4LGQ A;  2Z76 A;  3E99 A;  1JKG B;  3K5T A;  3PZW A;  1NU3 A;  1LVN A;  2OQE C;  1EKM A;  3UJM A;  3B4O A;  1EA2 A;  3NBB A;  3PXM A;  1YGE A;  5CXO A;  4X2H A;  2CK3 H;  2CWU A;  3BB9 A;  1KD1 4;  1JB2 A;  3F8X A;  3KSE D;  3CCR 3;  1QVG 2;  4N6V 0;  3F7X A;  3WDG B;  4XDV A;  2CIU A;  1YIJ 3;  1Z1S A;  2OTL 3;  1M90 4;  8CHO A;  1O7H B;  2IMJ A;  3DGL A;  3CMA 3;  1IVU A;  3X3Y A;  3Q90 A;  2B1X B;  3LTC A;  5AI1 A;  2GXF A;  1OGX A;  4RNZ A;  1N5P A;  4FMC A;  2GBW B;  5BXQ A;  1Q42 A;  3CME 3;  3EBT A;  3LXU X;  4XDW A;  3SOY A;  4BTX A;  3CCJ 3;  3U97 A;  4CDL A;  4XM4 A;  1DMM A;  4HM7 B;  2CG0 A;  3NM2 A;  2BO9 B;  1ULJ B;  3Q1C A;  3T8U A;  3CCU 3;  3D9R A;  4IT7 A;  1O7P B;  2FXT A;  3KFQ C;  3T8N A;  4IIA A;  4FCM A;  1EG9 B;  2WGO A;  1CEW I;  5D81 A;  1GD4 A;  3DZL A;  4HM4 B;  4XBT A;  3VSY A;  2CWT A;  4IPB A;  3JUM A;  4L8P A;  1M1K 4;  3NM7 A;  2E2U A;  1F8N A;  1W5Z A;  2P38 A;  4Q53 A;  4EBG A;  3F14 A;  3GZY B;  5EQL A;  5LC6 A;  2C10 A;  4EXR A;  2OTJ 3;  3TDG A;  2XF3 A;  5TGN A;  1JN5 B;  3GZX B;  3NV0 A;  1N9E A;  1IV7 A;  1OHS A;  3DGO A;  5CF1 A;  3K9M C;  1O7W B;  4WHA A;  3CCV 3;  2HMO B;  3DY5 A;  5G2G A;  4N6T A;  4HM1 B;  1W01 A;  1YI2 3;  3G71 3;  4STD A;  1ULI B;  2Y73 A;  3G6E 3;  1OHO A;  2CG1 A;  1W7C A;  1FGR A;  1FGO A;  1OF5 A;  4OVM A;  5FGO A;  5JPP A;  1S72 3;  3OV4 A;  2W56 B;  4FMA A;  5ELU A;  2HML B;  3UNL A;  3JVC A;  4K1V A;  3CCL 3;  3EE1 A;  3F8H A;  1C7H A;  1PFP A;  2CFG A;  3EB8 A;  1VQO 3;  1VQ7 3;  4HM6 B;  4HM2 B;  2CHC A;  3S28 A;  3PGB A;  1Q81 4;  2FNQ A;  5CK6 A;  3CCQ 3;  1YJN 3;  2BMQ B;  3FLJ A;  1QJG A;  1RRH A;  3FF2 A;  1YJW 3;  1LNH A;  3T0U A;  1AVL A;  3IPT A;  4WWU C;  4HZ9 B;  3UL5 A;  4WYK B;  3GWR A;  1L5G B;  4O8S A;  3PYJ A;  3CPO A;  3L0R A;  3WOE B;  4KFD A;  4J8T A;  1M9G A;  5ELJ A;  4HM3 B;  3FGY A;  5JBS A;  1SIH A;  5IEP A;  5DRV A;  2C11 A;  2D42 A;  3DM8 A;  3CCS 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...