1LOVA

X-ray structure of the e58a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lovA00
4RNTA 3RNTA 4HOHA 1DE3A 5BIRA 3AHSA 2SARA 1I2FA 1B3SA 5GSPA 1BNRA 1BRGA 1BSAA 1LRAA 1FZUA 1BGSA 4HAAA 1BRHA 1LNIA 2KF4A 1MGRA 1UCKA 1BSDA 1RMSA 1BU4A 3BIRA 1BNJA 3AGNA 2KF6A 1BOXA 1BRSA 2AADA 1BRNL 1BIRA 3Q3FA 1DETA 1I3IA 1ZGXA 2KF3A 1RDSA 1AQZA 3D5IA 1BRKA 2HOHA 4J5KA 1I70A 5HOHA 1YVSA 1BANA 1FUSA 1RGHA 6GSPA 1BNIA 1GOUA 2F56A 2KAAA 1GMPA 3BU4A 1JBSA 1BRJA 1GMQA 1I8VA 3A5EA 2F5MA 1B2ZA 3KCHA 3D5GA 8RNTA 1BAOA 3GSPA 1LOVA 2AAEA 1RTUA 1RLSA 1RSNA 1B20A 1RN1A 1IYYA 1BRIA 5RNTA 1B21A 1I3FA 1B2MA 3WHOA 1C54A 1PY3A 1B2SA 1UCJA 1BNGA 1MGWA 1GOYA 1I2GA 9RNTA 1TRQA 1BNSA 1T2HA 1TTOA 3D4AA 1RGKA 3DGYA 1RHLA 1JBTA 1FUTA 2ZA4A 2F4YA 2F5WA 1RN4A 2BU4A 3DH2A 3WR2A 1YGWA 4BU4A 1R4YA 1YNVX 3AHWA 1X1WA 1BSEA 1HYFA 2BIRA 2C4BA 4J5GA 1SARA 1BVIA 1BNEA 1G02A 1X1UA 2KF5A 1BSBA 1I2EA 1RNTA 1UCIA 1B2XA 1GSPA 1RGEA 1FYSA 3SYUA 1RGLA 4GSPA 7RNTA 1RCKA 1LOWA 1RGCA 1RCLA 3HOHA 1PYLA 1CH0A 6RNTA 1RNBA 1GMRA 2RBIA 4GHOA 1RGFA 1BNFA 1RGGA 2GSPA 3URPA 1BSCA 1RGAA 1GOVA 5BU4A 1HZ1A 1X1XA 4BIRA 1I0XA 2RNTA 1T2IA 1X1YA 1BUJA 1B27A 1JBRA 1B2UA 1AY7A 1UCLA 3AGOA 7GSPA 1TRPA 1I0VA 1Q9EA 1FW7A 1LOYA 1A2PA
chains in the Genus database with same CATH superfamily
3LZAA 4XDWA 2RCDA 3KN4A 5ELJA 3S67A 3LT8A 1DE3A 2OWPA 3LT9A 5BIRA 1L5GB 4HZBB 3X42A 3HZPA 1WNHA 1EEJA 1I2FA 1QALA 4KFEA 2XEPA 5CF1A 5GSPA 1BNRA 4R9KA 5JPUA 4FR9A 4JRFA 1VQ73 4HM8B 1IDPA 2ZL8A 1BRHA 1LNIA 4FMCA 1J2BA 1D6UA 3ALAA 3MYTA 4ILFA 1EKMA 2D1WA 1UCKA 1RRLA 1BSDA 1RMSA 1MNLA 3AGNA 4N6OB 1BRSA 4I5QA 4XDVA 1KSIA 3UB1A 5M19A 3CC23 1N8R4 3KSED 2CFGA 1VQP3 3K7CA 4LEHA 4OVMA 2KF3A 5CXOA 1AQZA 3FLJA 3CCQ3 2J8XB 4X2OA 2HOHA 5D81A 1RGHA 1BNIA 1OHSA 3CU3A 3LOYA 2F56A 3WODG 4KFFA 3U1WA 3EHCA 1GMPA 1RKYA 4R4KA 4L7KA 5D82A 3FF0A 5IEPA 3WA2X 2HMMB 2O3OA 1KC84 3U97A 2UGIA 3CCM3 1SQWA 1ZO2A 3BNDA 3LTDA 1W6GA 5AYSC 3V98A 1SJWA 2CG0A 4HM0B 1Q7HA 3BNBA 1RN1A 5HGRA 1O7MB 1B21A 3BNCA 3MWZA 5FW5A 1B2MA 1UUVB 3T0UA 2XGLA 5I97A 1UCJA 3ROBA 4BL3A 3VGNA 2INXA 2L4VA 4ZM8A 2WGOA 3NM7A 9RNTA 2FGTA 1MWTA 3PGBA 3UL6A 1TU5A 3EBYA 3B4OA 1V58A 4HM5B 3DGYA 1RHLA 3MG1A 5EEOA 1E97A 4LMIA 1FUTA 4HM7B 2ZA4A 4BTXA 1JBTA 4MMYB 4WFOA 5ELUA 3SXXA 5BVBA 2WGQA 2YFIB 1YGWA 2JDIH 1IV7A 5IG3A 2W2CA 1T3BA 3GZBA 4CDLA 4R80A 4EV2A 3S27A 5M18A 3JVCA 4RZMA 2HMOB 1HYFA 4K90B 2OCTA 5AIFA 1WMOA 3EF8A 1X1UA 1VQL3 1I2EA 1BUQA 4FMDA 1N5PA 2FNQA 1FYSA 4IIAA 2P09A 4GSPA 1O7WB 2F98A 2XSOB 2CIUA 1RCLA 4O2HA 1SIHA 1YIT3 3D9RA 6RNTA 3TDGA 3G713 2D42A 4K61A 3M8CA 1GMRA 2LQVA 5FGOA 2CC3A 3OX9A 1RGFA 1ZX2A 4KZ1A 3T8UA 1JB5A 4H3UA 2GEYA 5STDA 4KVHA 2BNGA 3N9HA 3URPA 2W04A 2IUJA 3FH1A 2UX0A 1BSCA 1NJI4 1HZ1A 4TX4A 3FKAA 2K0MA 4FCJA 5IW9A 4X2HA 1KQS2 1X1YA 1FGOA 4WYKB 5G2GA 1IK3A 1B2UA 4XB5A 3MG2A 1W6YA 4CCVA 4O3VA 1TJDA 1TRPA 4HJLB 1UI8A 2LYXA 1OH0A 1A2PA 2W9QA 2CFLA 2H0IA 3EE1A 2ML5A 3RNTA 1CQSA 4HOHA 4BTWA 3H3HA 3EN1B 3EQQB 4EW5A 1YIJ3 5KP1A 2BMRB 3EBTA 1B3SA 1NDOB 1RRHA 1LRAA 3BNEA 3CCE3 1K734 1FZUA 1KWIA 1JNQA 1BGSA 2B24B 2GEXA 3STDA 4XBYA 4CPKA 3JUQA 1A67A 3VF1A 1JB2A 2PZVA 1D6ZA 4XBXA 3OWSA 1MOLA 2GU3A 2RFRA 1D6YA 2YFJB 3AMOA 3JUMA 1VQK3 4L8OA 3F8XA 4NREA 4RNZA 3OW22 1I3IA 1RDSA 3D5IA 1QJGA 1BRKA 1ULIB 3I553 1US1A 3KKGA 3ZFZA 6GSPA 1AVLA 1BANA 1FUSA 3KE7A 2CFKA 4G1MB 4GL6A 1GOUA 3G16A 3BU4A 3NUVA 1BRJA 1I8VA 1ISKA 2IY2A 2OTJ3 3A5EA 4WHAA 3CPOA 3KCHA 1OACA 3CNMA 1FUWA 1FA3A 2PNCA 1BAOA 4K1VA 1G0TA 4WYKA 2CW9A 3SEDA 3GSPA 3T8NA 3V92A 1LQGC 1LOVA 1OHOA 1SIIA 5BXQA 7STDA 1Z1SA 4AEQA 1RSNA 3GZRA 1VQ93 3EN8A 4H61A 4HYZA 4LZIA 5AEUB 1IYYA 2HMNB 3DXOA 5IG0A 1IU7A 1DMMA 2Z6BA 2GBXB 1NU3A 3EJVA 3MHEA 2K3DA 3PCRA 3X40A 4O02B 1I2GA 4AKYA 4JF8A 4HZ9B 1RJOA 1TRQA 4R9LA 1BNSA 1T2HA 1IT8A 1TTOA 2C10A 2R4IA 2RGQA 3D4AA 3NM2A 2YFLB 4MMXB 3SVAA 3CCU3 1Q864 1UGHI 3X3YA 1M9GA 2XFSA 3K5TA 4AKZA 1VQ83 1A2KA 1E3VA 2F5WA 1RN4A 3DH2A 4EC6A 3OXAA 4LGQA 3WR2A 1IVWA 5G1KA 1Y4KA 4BU4A 1R4YA 1UUWB 3RGAA 1W01A 1Q40A 2C4BA 1LOXA 1SARA 1BVIA 1G02A 1BSBA 4NPBA 5AIHA 2Y74A 5AI1A 1O7PB 3HX8A 3MPHA 2P38A 2WO0A 5D83A 2F86B 1UI7A 2IMJA 5G1LA 3EX9A 3SYUA 2BMOB 4N6MA 4EBGA 1JZOA 5CF2A 4ORLA 1LOWA 1JZDA 5CLKA 2BO9B 3KIIA 1EQKA 1K8A4 3F7SA 3HOHA 3FGYA 1W2ZA 1LNHA 4R1KA 1LQMB 2L1SA 1RNBA 1O7NB 1NB5I 2HMLB 3DUKA 4RNYA 3SX1A 2RBIA 3DM8A 4HBRA 3BB9A 2W56A 1A90A 1WTHA 1BNFA 4HKVB 1DMNA 2GSPA 3NV0B 3UL5A 2UUGC 1TIJA 1C7HA 1IVUA 3IJEB 4EV5A 2Z76A 2XF3A 5BU4A 1X1XA 1K28A 5KP3A 2BHMA 2SBLA 4GB5A 2RNTA 1OF5B 1T2IA 4FMBA 4BIRA 2QA43 1B27A 1Q824 1JBRA 2F99A 1FGTA 3FG3A 2CWUA 3LMLA 4K1UA 4N6LA 1UCLA 4KFDA 1AV4A 4HM1B 2W6JH 2XFTA 1JKGB 1Q9EA 1FW7A 1Q7Y4 1TFOA 3FZWA 5M1AA 5AEWB 2V1LA 3K9MC 2CWTA 3GAXA 4I4KA 3CME3 1GY6A 1W7CA 4N6TA 3ZG5A 3A76A 5IEOA 3AHSA 2SARA 3S5CA 3I563 1TFKA 3S28A 2XR8B 1OPYA 4NHFA 3Q2PA 1BRGA 1BSAA 2CWVA 1LXEA 4Q53A 4MMZB 1OGXA 1MWUA 3X3XA 1JKGA 2B1XB 3CC43 5JPPA 1CYVA 2CFWA 1NWWA 1EG9B 2KF4A 4LYLB 1MGRA 1GD3A 4U13A 3WDGB 2QEX3 3CCR3 2Z7AA 3NXJA 3CXC2 1CYUA 3NBRA 2H0GA 1JN5A 4N6NB 4RBNA 1VQ43 4L8PA 4CJNA 1BOXA 2OOVA 1FGRA 2AADA 1NNVA 1BRNL 1BIRA 3LTAA 5TGNA 2XRXB 3Q3FA 1ZGXA 3PXMA 3MG3A 1U5OA 2O9UX 4HM4B 2CKFB 1NO3A 3WMDA 3KZTA 3MSOA 3WOFB 3B8LA 3F8HA 3O8YA 3NHXA 1JBSA 4HM6B 3AMOB 4XBTA 1TP6A 2W9PA 2CX1A 1N9JA 3D5GA 3ECFA 3DGLA 3LXUX 2BMQB 3KSPA 1WMNA 1RTUA 3PS8A 3UNLA 1RLSA 1YJ93 1GD4A 1B20A 1IQ8A 4J9AA 5LC6A 1BRIA 5RNTA 1OF5A 2CHCA 2MC8A 1VQ53 1M1K4 1C54A 3Q1CA 3HIGA 3CMA3 4KT3B 1BNGA 1PFPA 2CX0A 1MGWA 3K0ZA 5A0OB 3H51A 8CHOA 2K54A 1IQYA 4HM3B 1YHQ3 3NX0A 1RGKA 1YJN3 3DGOA 1STFI 2XSHB 3SOYA 1AVKA 2BU4A 2WOHA 2XH9A 2XGNA 3SOAA 1YNVX 3AHWA 2OQEC 4DKIA 1X1WA 1W00A 2Z77A 1OCVA 2BIRA 1M1XB 1R4CA 3UJMA 1BNEA 4EYCA 1RNTA 2R41A 1UCIA 2QGUA 1W2B2 1B2XA 1GSPA 1ZS7A 1RGEA 2ZHXB 3DY5A 3G8ZA 3G6E3 2OTL3 3GZXB 2KXGA 7RNTA 1RCKA 1RGCA 4O8SA 3QK9A 3CCV3 5JBSA 2I9WA 3D79A 3HIIA 3PZWA 1PYLA 2CG1A 3ZG0A 1CH0A 5KP4A 1YI23 1CEWI 3OWYA 1V74A 2H0HA 2OQEA 4N3VA 1VQM3 4QWTA 3JUNA 1GS3A 1VQ63 1RGGA 2CFDA 3LYGA 2ZDJA 5AIIA 1RGAA 2A15A 4FCZA 2OOVC 5AYRB 1DMQA 1ULJB 1I0XA 1PU4A 1N5HA 2MF7A 1BUJA 3CNXA 4HVNA 5IERA 3OWUA 2E2TA 1GYBA 1JJ22 1KD14 1AY7A 3AGOA 4BL2A 7GSPA 3CCL3 1O7HB 2W03A 3NQZA 1QVG2 5IG5A 1I0VA 5EQLA 3NV0A 1LOYA 3F9SA 3NBBA 3VSYA 1IQXA 2BT3A 2Q07A 4RNTA 3N54B 3X3ZA 1MWRA 2HMKB 2E2VA 1QMAA 2HMJB 1IT7A 3DGMA 4OUQA 2FXTA 3LTBA 3E99A 3EB8A 3F7XA 1A2VA 3RDEA 1Q40B 1N9EA 3DMCA 3FCSB 3G0KA 5IENA 2C11A 3RGRA 3V99A 1IVVA 4HAAA 4MEIA 3NBJA 1OHPA 1Q42A 1G96A 3JUOA 3CC73 1ROAA 3D3LA 3MKIA 4WP5A 5LC7A 1BU4A 3BIRA 1BNJA 5IG4A 2KF6A 1S723 1EUIC 2P05A 5IF6A 4N6V0 1YJW3 1JN5B 1DETA 1W6CA 3KFQC 2W56B 1ROVA 1STDA 2YX9A 4J5KA 1I70A 5HOHA 1YVSA 3IPTA 1N8QA 1AR0A 4BTYA 1QVF2 1E3RA 2IUKA 2KAAA 1FGQA 1K9M4 2WOFA 1GMQA 3WA3A 3DGNA 5DREA 6STDA 2F5MA 1B2ZA 8RNTA 5DRVA 4PEJA 1W02A 2GXFA 3N8BA 2CH9A 1YVBI 3GRDA 1U8CB 1W4NA 3EC9A 4XM4A 1Q814 1JRQA 2AAEA 3CPW2 3FG4A 1VZZA 4N6UA 3CCS3 1I3FA 2QIYA 3F40A 1QAFA 3FSDA 3WHOA 1T5YA 4IPBA 3WOEB 1PY3A 1B2SA 1GOYA 1QAKA 1TUHA 2STDA 3HI7A 1YGEA 1O7GB 3QRDA 5EVHA 1VQN3 1RN7A 2P0XA 3CCJ3 4FCMA 2W0QA 1ASKA 1V57A 3SLUA 3OV4A 2F4YA 3HK4A 1VQO3 1K41A 3GWRA 3IMAB 3X41A 1JB4A 1SPUA 4STDA 1DVCA 1GY7A 1HU9A 1UDII 5CK6A 3G4S3 1FGMA 3S29A 3DZLA 1HKXA 4LSOA 2Y73A 2ML6A 1OGZA 3GZYB 3NQYA 1BSEA 4J5GA 2KF5A 2KCDA 1VQQA 1IVXA 1GY5A 2JQ5A 3FG1A 1OUNA 1M904 3PYJA 3B7CA 2IA7A 1NB3I 1W5ZA 3I0YA 3LTCA 1RGLA 3JUPA 4FMAA 3B4PA 1S5AA 3BLZA 2GBWB 2RSXA 1EA2A 4WWUC 3J7Yd 1JV2B 1IV9A 1WMPA 4GHOA 1F8NA 3Q90A 3LH4A 4MJDA 3FF2A 2IYJA 3ER7A 1GOVA 1UGIA 2CK3H 4J8TA 3K63A 4IT7A 1DVDA 1DYUA 1UW1A 1UUGB 5AIGA 1WQLB 1LVNA 2E2UA 1MWSA 3F14A 4HM2B 2P0MA 4EXRA 2KRTA 3CD63 3L0RA 2GU1A 2M7OA 4OK0A 3PCSA
chains in the Genus database with same CATH topology
4RNTA 3RNTA 4HOHA 1DE3A 5BIRA 3AHSA 2SARA 1I2FA 1B3SA 5GSPA 1BNRA 1BRGA 1BSAA 1LRAA 1FZUA 1BGSA 4HAAA 1BRHA 1LNIA 2KF4A 1MGRA 1UCKA 1BSDA 1RMSA 1BU4A 3BIRA 1BNJA 3AGNA 2KF6A 1BOXA 1BRSA 2AADA 1BRNL 1BIRA 3Q3FA 1DETA 1I3IA 1ZGXA 2KF3A 1RDSA 1AQZA 3D5IA 1BRKA 2HOHA 4J5KA 1I70A 5HOHA 1YVSA 1BANA 1FUSA 1RGHA 6GSPA 1BNIA 1GOUA 2F56A 2KAAA 1GMPA 3BU4A 1JBSA 1BRJA 1GMQA 1I8VA 3A5EA 2F5MA 1B2ZA 3KCHA 3D5GA 8RNTA 1BAOA 3GSPA 1LOVA 2AAEA 1RTUA 1RLSA 1RSNA 1B20A 1RN1A 1IYYA 1BRIA 5RNTA 1B21A 1I3FA 1B2MA 3WHOA 1C54A 1PY3A 1B2SA 1UCJA 1BNGA 1MGWA 1GOYA 1I2GA 9RNTA 1TRQA 1BNSA 1T2HA 1TTOA 3D4AA 1RGKA 3DGYA 1RHLA 1JBTA 1FUTA 2ZA4A 2F4YA 2F5WA 1RN4A 2BU4A 3DH2A 3WR2A 1YGWA 4BU4A 1R4YA 1YNVX 3AHWA 1X1WA 1BSEA 1HYFA 2BIRA 2C4BA 4J5GA 1SARA 1BVIA 1BNEA 1G02A 1X1UA 2KF5A 1BSBA 1I2EA 1RNTA 1UCIA 1B2XA 1GSPA 1RGEA 1FYSA 3SYUA 1RGLA 4GSPA 7RNTA 1RCKA 1LOWA 1RGCA 1RCLA 3HOHA 1PYLA 1CH0A 6RNTA 1RNBA 1GMRA 2RBIA 4GHOA 1RGFA 1BNFA 1RGGA 2GSPA 3URPA 1BSCA 1RGAA 1GOVA 5BU4A 1HZ1A 1X1XA 4BIRA 1I0XA 2RNTA 1T2IA 1X1YA 1BUJA 1B27A 1JBRA 1B2UA 1AY7A 1UCLA 3AGOA 7GSPA 1TRPA 1I0VA 1Q9EA 1FW7A 1LOYA 1A2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNT A;  3RNT A;  4HOH A;  1DE3 A;  5BIR A;  3AHS A;  2SAR A;  1I2F A;  1B3S A;  5GSP A;  1BNR A;  1BRG A;  1BSA A;  1LRA A;  1FZU A;  1BGS A;  4HAA A;  1BRH A;  1LNI A;  2KF4 A;  1MGR A;  1UCK A;  1BSD A;  1RMS A;  1BU4 A;  3BIR A;  1BNJ A;  3AGN A;  2KF6 A;  1BOX A;  1BRS A;  2AAD A;  1BRN L;  1BIR A;  3Q3F A;  1DET A;  1I3I A;  1ZGX A;  2KF3 A;  1RDS A;  1AQZ A;  3D5I A;  1BRK A;  2HOH A;  4J5K A;  1I70 A;  5HOH A;  1YVS A;  1BAN A;  1FUS A;  1RGH A;  6GSP A;  1BNI A;  1GOU A;  2F56 A;  2KAA A;  1GMP A;  3BU4 A;  1JBS A;  1BRJ A;  1GMQ A;  1I8V A;  3A5E A;  2F5M A;  1B2Z A;  3KCH A;  3D5G A;  8RNT A;  1BAO A;  3GSP A;  1LOV A;  2AAE A;  1RTU A;  1RLS A;  1RSN A;  1B20 A;  1RN1 A;  1IYY A;  1BRI A;  5RNT A;  1B21 A;  1I3F A;  1B2M A;  3WHO A;  1C54 A;  1PY3 A;  1B2S A;  1UCJ A;  1BNG A;  1MGW A;  1GOY A;  1I2G A;  9RNT A;  1TRQ A;  1BNS A;  1T2H A;  1TTO A;  3D4A A;  1RGK A;  3DGY A;  1RHL A;  1JBT A;  1FUT A;  2ZA4 A;  2F4Y A;  2F5W A;  1RN4 A;  2BU4 A;  3DH2 A;  3WR2 A;  1YGW A;  4BU4 A;  1R4Y A;  1YNV X;  3AHW A;  1X1W A;  1BSE A;  1HYF A;  2BIR A;  2C4B A;  4J5G A;  1SAR A;  1BVI A;  1BNE A;  1G02 A;  1X1U A;  2KF5 A;  1BSB A;  1I2E A;  1RNT A;  1UCI A;  1B2X A;  1GSP A;  1RGE A;  1FYS A;  3SYU A;  1RGL A;  4GSP A;  7RNT A;  1RCK A;  1LOW A;  1RGC A;  1RCL A;  3HOH A;  1PYL A;  1CH0 A;  6RNT A;  1RNB A;  1GMR A;  2RBI A;  4GHO A;  1RGF A;  1BNF A;  1RGG A;  2GSP A;  3URP A;  1BSC A;  1RGA A;  1GOV A;  5BU4 A;  1HZ1 A;  1X1X A;  4BIR A;  1I0X A;  2RNT A;  1T2I A;  1X1Y A;  1BUJ A;  1B27 A;  1JBR A;  1B2U A;  1AY7 A;  1UCL A;  3AGO A;  7GSP A;  1TRP A;  1I0V A;  1Q9E A;  1FW7 A;  1LOY A;  1A2P A; 
#chains in the Genus database with same CATH topology
 3LZA A;  4XDW A;  2RCD A;  3KN4 A;  5ELJ A;  3S67 A;  3LT8 A;  1DE3 A;  2OWP A;  3LT9 A;  5BIR A;  1L5G B;  4HZB B;  3X42 A;  3HZP A;  1WNH A;  1EEJ A;  1I2F A;  1QAL A;  4KFE A;  2XEP A;  5CF1 A;  5GSP A;  1BNR A;  4R9K A;  5JPU A;  4FR9 A;  4JRF A;  1VQ7 3;  4HM8 B;  1IDP A;  2ZL8 A;  1BRH A;  1LNI A;  4FMC A;  1J2B A;  1D6U A;  3ALA A;  3MYT A;  4ILF A;  1EKM A;  2D1W A;  1UCK A;  1RRL A;  1BSD A;  1RMS A;  1MNL A;  3AGN A;  4N6O B;  1BRS A;  4I5Q A;  4XDV A;  1KSI A;  3UB1 A;  5M19 A;  3CC2 3;  1N8R 4;  3KSE D;  2CFG A;  1VQP 3;  3K7C A;  4LEH A;  4OVM A;  2KF3 A;  5CXO A;  1AQZ A;  3FLJ A;  3CCQ 3;  2J8X B;  4X2O A;  2HOH A;  5D81 A;  1RGH A;  1BNI A;  1OHS A;  3CU3 A;  3LOY A;  2F56 A;  3WOD G;  4KFF A;  3U1W A;  3EHC A;  1GMP A;  1RKY A;  4R4K A;  4L7K A;  5D82 A;  3FF0 A;  5IEP A;  3WA2 X;  2HMM B;  2O3O A;  1KC8 4;  3U97 A;  2UGI A;  3CCM 3;  1SQW A;  1ZO2 A;  3BND A;  3LTD A;  1W6G A;  5AYS C;  3V98 A;  1SJW A;  2CG0 A;  4HM0 B;  1Q7H A;  3BNB A;  1RN1 A;  5HGR A;  1O7M B;  1B21 A;  3BNC A;  3MWZ A;  5FW5 A;  1B2M A;  1UUV B;  3T0U A;  2XGL A;  5I97 A;  1UCJ A;  3ROB A;  4BL3 A;  3VGN A;  2INX A;  2L4V A;  4ZM8 A;  2WGO A;  3NM7 A;  9RNT A;  2FGT A;  1MWT A;  3PGB A;  3UL6 A;  1TU5 A;  3EBY A;  3B4O A;  1V58 A;  4HM5 B;  3DGY A;  1RHL A;  3MG1 A;  5EEO A;  1E97 A;  4LMI A;  1FUT A;  4HM7 B;  2ZA4 A;  4BTX A;  1JBT A;  4MMY B;  4WFO A;  5ELU A;  3SXX A;  5BVB A;  2WGQ A;  2YFI B;  1YGW A;  2JDI H;  1IV7 A;  5IG3 A;  2W2C A;  1T3B A;  3GZB A;  4CDL A;  4R80 A;  4EV2 A;  3S27 A;  5M18 A;  3JVC A;  4RZM A;  2HMO B;  1HYF A;  4K90 B;  2OCT A;  5AIF A;  1WMO A;  3EF8 A;  1X1U A;  1VQL 3;  1I2E A;  1BUQ A;  4FMD A;  1N5P A;  2FNQ A;  1FYS A;  4IIA A;  2P09 A;  4GSP A;  1O7W B;  2F98 A;  2XSO B;  2CIU A;  1RCL A;  4O2H A;  1SIH A;  1YIT 3;  3D9R A;  6RNT A;  3TDG A;  3G71 3;  2D42 A;  4K61 A;  3M8C A;  1GMR A;  2LQV A;  5FGO A;  2CC3 A;  3OX9 A;  1RGF A;  1ZX2 A;  4KZ1 A;  3T8U A;  1JB5 A;  4H3U A;  2GEY A;  5STD A;  4KVH A;  2BNG A;  3N9H A;  3URP A;  2W04 A;  2IUJ A;  3FH1 A;  2UX0 A;  1BSC A;  1NJI 4;  1HZ1 A;  4TX4 A;  3FKA A;  2K0M A;  4FCJ A;  5IW9 A;  4X2H A;  1KQS 2;  1X1Y A;  1FGO A;  4WYK B;  5G2G A;  1IK3 A;  1B2U A;  4XB5 A;  3MG2 A;  1W6Y A;  4CCV A;  4O3V A;  1TJD A;  1TRP A;  4HJL B;  1UI8 A;  2LYX A;  1OH0 A;  1A2P A;  2W9Q A;  2CFL A;  2H0I A;  3EE1 A;  2ML5 A;  3RNT A;  1CQS A;  4HOH A;  4BTW A;  3H3H A;  3EN1 B;  3EQQ B;  4EW5 A;  1YIJ 3;  5KP1 A;  2BMR B;  3EBT A;  1B3S A;  1NDO B;  1RRH A;  1LRA A;  3BNE A;  3CCE 3;  1K73 4;  1FZU A;  1KWI A;  1JNQ A;  1BGS A;  2B24 B;  2GEX A;  3STD A;  4XBY A;  4CPK A;  3JUQ A;  1A67 A;  3VF1 A;  1JB2 A;  2PZV A;  1D6Z A;  4XBX A;  3OWS A;  1MOL A;  2GU3 A;  2RFR A;  1D6Y A;  2YFJ B;  3AMO A;  3JUM A;  1VQK 3;  4L8O A;  3F8X A;  4NRE A;  4RNZ A;  3OW2 2;  1I3I A;  1RDS A;  3D5I A;  1QJG A;  1BRK A;  1ULI B;  3I55 3;  1US1 A;  3KKG A;  3ZFZ A;  6GSP A;  1AVL A;  1BAN A;  1FUS A;  3KE7 A;  2CFK A;  4G1M B;  4GL6 A;  1GOU A;  3G16 A;  3BU4 A;  3NUV A;  1BRJ A;  1I8V A;  1ISK A;  2IY2 A;  2OTJ 3;  3A5E A;  4WHA A;  3CPO A;  3KCH A;  1OAC A;  3CNM A;  1FUW A;  1FA3 A;  2PNC A;  1BAO A;  4K1V A;  1G0T A;  4WYK A;  2CW9 A;  3SED A;  3GSP A;  3T8N A;  3V92 A;  1LQG C;  1LOV A;  1OHO A;  1SII A;  5BXQ A;  7STD A;  1Z1S A;  4AEQ A;  1RSN A;  3GZR A;  1VQ9 3;  3EN8 A;  4H61 A;  4HYZ A;  4LZI A;  5AEU B;  1IYY A;  2HMN B;  3DXO A;  5IG0 A;  1IU7 A;  1DMM A;  2Z6B A;  2GBX B;  1NU3 A;  3EJV A;  3MHE A;  2K3D A;  3PCR A;  3X40 A;  4O02 B;  1I2G A;  4AKY A;  4JF8 A;  4HZ9 B;  1RJO A;  1TRQ A;  4R9L A;  1BNS A;  1T2H A;  1IT8 A;  1TTO A;  2C10 A;  2R4I A;  2RGQ A;  3D4A A;  3NM2 A;  2YFL B;  4MMX B;  3SVA A;  3CCU 3;  1Q86 4;  1UGH I;  3X3Y A;  1M9G A;  2XFS A;  3K5T A;  4AKZ A;  1VQ8 3;  1A2K A;  1E3V A;  2F5W A;  1RN4 A;  3DH2 A;  4EC6 A;  3OXA A;  4LGQ A;  3WR2 A;  1IVW A;  5G1K A;  1Y4K A;  4BU4 A;  1R4Y A;  1UUW B;  3RGA A;  1W01 A;  1Q40 A;  2C4B A;  1LOX A;  1SAR A;  1BVI A;  1G02 A;  1BSB A;  4NPB A;  5AIH A;  2Y74 A;  5AI1 A;  1O7P B;  3HX8 A;  3MPH A;  2P38 A;  2WO0 A;  5D83 A;  2F86 B;  1UI7 A;  2IMJ A;  5G1L A;  3EX9 A;  3SYU A;  2BMO B;  4N6M A;  4EBG A;  1JZO A;  5CF2 A;  4ORL A;  1LOW A;  1JZD A;  5CLK A;  2BO9 B;  3KII A;  1EQK A;  1K8A 4;  3F7S A;  3HOH A;  3FGY A;  1W2Z A;  1LNH A;  4R1K A;  1LQM B;  2L1S A;  1RNB A;  1O7N B;  1NB5 I;  2HML B;  3DUK A;  4RNY A;  3SX1 A;  2RBI A;  3DM8 A;  4HBR A;  3BB9 A;  2W56 A;  1A90 A;  1WTH A;  1BNF A;  4HKV B;  1DMN A;  2GSP A;  3NV0 B;  3UL5 A;  2UUG C;  1TIJ A;  1C7H A;  1IVU A;  3IJE B;  4EV5 A;  2Z76 A;  2XF3 A;  5BU4 A;  1X1X A;  1K28 A;  5KP3 A;  2BHM A;  2SBL A;  4GB5 A;  2RNT A;  1OF5 B;  1T2I A;  4FMB A;  4BIR A;  2QA4 3;  1B27 A;  1Q82 4;  1JBR A;  2F99 A;  1FGT A;  3FG3 A;  2CWU A;  3LML A;  4K1U A;  4N6L A;  1UCL A;  4KFD A;  1AV4 A;  4HM1 B;  2W6J H;  2XFT A;  1JKG B;  1Q9E A;  1FW7 A;  1Q7Y 4;  1TFO A;  3FZW A;  5M1A A;  5AEW B;  2V1L A;  3K9M C;  2CWT A;  3GAX A;  4I4K A;  3CME 3;  1GY6 A;  1W7C A;  4N6T A;  3ZG5 A;  3A76 A;  5IEO A;  3AHS A;  2SAR A;  3S5C A;  3I56 3;  1TFK A;  3S28 A;  2XR8 B;  1OPY A;  4NHF A;  3Q2P A;  1BRG A;  1BSA A;  2CWV A;  1LXE A;  4Q53 A;  4MMZ B;  1OGX A;  1MWU A;  3X3X A;  1JKG A;  2B1X B;  3CC4 3;  5JPP A;  1CYV A;  2CFW A;  1NWW A;  1EG9 B;  2KF4 A;  4LYL B;  1MGR A;  1GD3 A;  4U13 A;  3WDG B;  2QEX 3;  3CCR 3;  2Z7A A;  3NXJ A;  3CXC 2;  1CYU A;  3NBR A;  2H0G A;  1JN5 A;  4N6N B;  4RBN A;  1VQ4 3;  4L8P A;  4CJN A;  1BOX A;  2OOV A;  1FGR A;  2AAD A;  1NNV A;  1BRN L;  1BIR A;  3LTA A;  5TGN A;  2XRX B;  3Q3F A;  1ZGX A;  3PXM A;  3MG3 A;  1U5O A;  2O9U X;  4HM4 B;  2CKF B;  1NO3 A;  3WMD A;  3KZT A;  3MSO A;  3WOF B;  3B8L A;  3F8H A;  3O8Y A;  3NHX A;  1JBS A;  4HM6 B;  3AMO B;  4XBT A;  1TP6 A;  2W9P A;  2CX1 A;  1N9J A;  3D5G A;  3ECF A;  3DGL A;  3LXU X;  2BMQ B;  3KSP A;  1WMN A;  1RTU A;  3PS8 A;  3UNL A;  1RLS A;  1YJ9 3;  1GD4 A;  1B20 A;  1IQ8 A;  4J9A A;  5LC6 A;  1BRI A;  5RNT A;  1OF5 A;  2CHC A;  2MC8 A;  1VQ5 3;  1M1K 4;  1C54 A;  3Q1C A;  3HIG A;  3CMA 3;  4KT3 B;  1BNG A;  1PFP A;  2CX0 A;  1MGW A;  3K0Z A;  5A0O B;  3H51 A;  8CHO A;  2K54 A;  1IQY A;  4HM3 B;  1YHQ 3;  3NX0 A;  1RGK A;  1YJN 3;  3DGO A;  1STF I;  2XSH B;  3SOY A;  1AVK A;  2BU4 A;  2WOH A;  2XH9 A;  2XGN A;  3SOA A;  1YNV X;  3AHW A;  2OQE C;  4DKI A;  1X1W A;  1W00 A;  2Z77 A;  1OCV A;  2BIR A;  1M1X B;  1R4C A;  3UJM A;  1BNE A;  4EYC A;  1RNT A;  2R41 A;  1UCI A;  2QGU A;  1W2B 2;  1B2X A;  1GSP A;  1ZS7 A;  1RGE A;  2ZHX B;  3DY5 A;  3G8Z A;  3G6E 3;  2OTL 3;  3GZX B;  2KXG A;  7RNT A;  1RCK A;  1RGC A;  4O8S A;  3QK9 A;  3CCV 3;  5JBS A;  2I9W A;  3D79 A;  3HII A;  3PZW A;  1PYL A;  2CG1 A;  3ZG0 A;  1CH0 A;  5KP4 A;  1YI2 3;  1CEW I;  3OWY A;  1V74 A;  2H0H A;  2OQE A;  4N3V A;  1VQM 3;  4QWT A;  3JUN A;  1GS3 A;  1VQ6 3;  1RGG A;  2CFD A;  3LYG A;  2ZDJ A;  5AII A;  1RGA A;  2A15 A;  4FCZ A;  2OOV C;  5AYR B;  1DMQ A;  1ULJ B;  1I0X A;  1PU4 A;  1N5H A;  2MF7 A;  1BUJ A;  3CNX A;  4HVN A;  5IER A;  3OWU A;  2E2T A;  1GYB A;  1JJ2 2;  1KD1 4;  1AY7 A;  3AGO A;  4BL2 A;  7GSP A;  3CCL 3;  1O7H B;  2W03 A;  3NQZ A;  1QVG 2;  5IG5 A;  1I0V A;  5EQL A;  3NV0 A;  1LOY A;  3F9S A;  3NBB A;  3VSY A;  1IQX A;  2BT3 A;  2Q07 A;  4RNT A;  3N54 B;  3X3Z A;  1MWR A;  2HMK B;  2E2V A;  1QMA A;  2HMJ B;  1IT7 A;  3DGM A;  4OUQ A;  2FXT A;  3LTB A;  3E99 A;  3EB8 A;  3F7X A;  1A2V A;  3RDE A;  1Q40 B;  1N9E A;  3DMC A;  3FCS B;  3G0K A;  5IEN A;  2C11 A;  3RGR A;  3V99 A;  1IVV A;  4HAA A;  4MEI A;  3NBJ A;  1OHP A;  1Q42 A;  1G96 A;  3JUO A;  3CC7 3;  1ROA A;  3D3L A;  3MKI A;  4WP5 A;  5LC7 A;  1BU4 A;  3BIR A;  1BNJ A;  5IG4 A;  2KF6 A;  1S72 3;  1EUI C;  2P05 A;  5IF6 A;  4N6V 0;  1YJW 3;  1JN5 B;  1DET A;  1W6C A;  3KFQ C;  2W56 B;  1ROV A;  1STD A;  2YX9 A;  4J5K A;  1I70 A;  5HOH A;  1YVS A;  3IPT A;  1N8Q A;  1AR0 A;  4BTY A;  1QVF 2;  1E3R A;  2IUK A;  2KAA A;  1FGQ A;  1K9M 4;  2WOF A;  1GMQ A;  3WA3 A;  3DGN A;  5DRE A;  6STD A;  2F5M A;  1B2Z A;  8RNT A;  5DRV A;  4PEJ A;  1W02 A;  2GXF A;  3N8B A;  2CH9 A;  1YVB I;  3GRD A;  1U8C B;  1W4N A;  3EC9 A;  4XM4 A;  1Q81 4;  1JRQ A;  2AAE A;  3CPW 2;  3FG4 A;  1VZZ A;  4N6U A;  3CCS 3;  1I3F A;  2QIY A;  3F40 A;  1QAF A;  3FSD A;  3WHO A;  1T5Y A;  4IPB A;  3WOE B;  1PY3 A;  1B2S A;  1GOY A;  1QAK A;  1TUH A;  2STD A;  3HI7 A;  1YGE A;  1O7G B;  3QRD A;  5EVH A;  1VQN 3;  1RN7 A;  2P0X A;  3CCJ 3;  4FCM A;  2W0Q A;  1ASK A;  1V57 A;  3SLU A;  3OV4 A;  2F4Y A;  3HK4 A;  1VQO 3;  1K41 A;  3GWR A;  3IMA B;  3X41 A;  1JB4 A;  1SPU A;  4STD A;  1DVC A;  1GY7 A;  1HU9 A;  1UDI I;  5CK6 A;  3G4S 3;  1FGM A;  3S29 A;  3DZL A;  1HKX A;  4LSO A;  2Y73 A;  2ML6 A;  1OGZ A;  3GZY B;  3NQY A;  1BSE A;  4J5G A;  2KF5 A;  2KCD A;  1VQQ A;  1IVX A;  1GY5 A;  2JQ5 A;  3FG1 A;  1OUN A;  1M90 4;  3PYJ A;  3B7C A;  2IA7 A;  1NB3 I;  1W5Z A;  3I0Y A;  3LTC A;  1RGL A;  3JUP A;  4FMA A;  3B4P A;  1S5A A;  3BLZ A;  2GBW B;  2RSX A;  1EA2 A;  4WWU C;  3J7Y d;  1JV2 B;  1IV9 A;  1WMP A;  4GHO A;  1F8N A;  3Q90 A;  3LH4 A;  4MJD A;  3FF2 A;  2IYJ A;  3ER7 A;  1GOV A;  1UGI A;  2CK3 H;  4J8T A;  3K63 A;  4IT7 A;  1DVD A;  1DYU A;  1UW1 A;  1UUG B;  5AIG A;  1WQL B;  1LVN A;  2E2U A;  1MWS A;  3F14 A;  4HM2 B;  2P0M A;  4EXR A;  2KRT A;  3CD6 3;  3L0R A;  2GU1 A;  2M7O A;  4OK0 A;  3PCS A; 
#chains in the Genus database with same CATH homology
 4RNT A;  3RNT A;  4HOH A;  1DE3 A;  5BIR A;  3AHS A;  2SAR A;  1I2F A;  1B3S A;  5GSP A;  1BNR A;  1BRG A;  1BSA A;  1LRA A;  1FZU A;  1BGS A;  4HAA A;  1BRH A;  1LNI A;  2KF4 A;  1MGR A;  1UCK A;  1BSD A;  1RMS A;  1BU4 A;  3BIR A;  1BNJ A;  3AGN A;  2KF6 A;  1BOX A;  1BRS A;  2AAD A;  1BRN L;  1BIR A;  3Q3F A;  1DET A;  1I3I A;  1ZGX A;  2KF3 A;  1RDS A;  1AQZ A;  3D5I A;  1BRK A;  2HOH A;  4J5K A;  1I70 A;  5HOH A;  1YVS A;  1BAN A;  1FUS A;  1RGH A;  6GSP A;  1BNI A;  1GOU A;  2F56 A;  2KAA A;  1GMP A;  3BU4 A;  1JBS A;  1BRJ A;  1GMQ A;  1I8V A;  3A5E A;  2F5M A;  1B2Z A;  3KCH A;  3D5G A;  8RNT A;  1BAO A;  3GSP A;  1LOV A;  2AAE A;  1RTU A;  1RLS A;  1RSN A;  1B20 A;  1RN1 A;  1IYY A;  1BRI A;  5RNT A;  1B21 A;  1I3F A;  1B2M A;  3WHO A;  1C54 A;  1PY3 A;  1B2S A;  1UCJ A;  1BNG A;  1MGW A;  1GOY A;  1I2G A;  9RNT A;  1TRQ A;  1BNS A;  1T2H A;  1TTO A;  3D4A A;  1RGK A;  3DGY A;  1RHL A;  1JBT A;  1FUT A;  2ZA4 A;  2F4Y A;  2F5W A;  1RN4 A;  2BU4 A;  3DH2 A;  3WR2 A;  1YGW A;  4BU4 A;  1R4Y A;  1YNV X;  3AHW A;  1X1W A;  1BSE A;  1HYF A;  2BIR A;  2C4B A;  4J5G A;  1SAR A;  1BVI A;  1BNE A;  1G02 A;  1X1U A;  2KF5 A;  1BSB A;  1I2E A;  1RNT A;  1UCI A;  1B2X A;  1GSP A;  1RGE A;  1FYS A;  3SYU A;  1RGL A;  4GSP A;  7RNT A;  1RCK A;  1LOW A;  1RGC A;  1RCL A;  3HOH A;  1PYL A;  1CH0 A;  6RNT A;  1RNB A;  1GMR A;  2RBI A;  4GHO A;  1RGF A;  1BNF A;  1RGG A;  2GSP A;  3URP A;  1BSC A;  1RGA A;  1GOV A;  5BU4 A;  1HZ1 A;  1X1X A;  4BIR A;  1I0X A;  2RNT A;  1T2I A;  1X1Y A;  1BUJ A;  1B27 A;  1JBR A;  1B2U A;  1AY7 A;  1UCL A;  3AGO A;  7GSP A;  1TRP A;  1I0V A;  1Q9E A;  1FW7 A;  1LOY A;  1A2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...