1LOVA

X-ray structure of the e58a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease T1
publication title A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lovA00
1A2PA 1FUSA 1RSNA 3GSPA 1GMQA 1JBRA 1FZUA 2ZA4A 1B3SA 5GSPA 1UCJA 1B20A 1LOYA 3D5GA 4HAAA 1BRNL 7RNTA 1RDSA 4BU4A 1G02A 2HOHA 4HOHA 5BU4A 3SYUA 1LOWA 4RNTA 1B2UA 3DH2A 1B2MA 1AQZA 1MGRA 1RGKA 1T2HA 1I2EA 1I0VA 1BIRA 1BU4A 1B2ZA 2AADA 1BRGA 1BRKA 1X1WA 2BIRA 3WHOA 1BSAA 1BRHA 1LNIA 4GSPA 1TRQA 1BRJA 6GSPA 1RGHA 1UCIA 2KF3A 2F5MA 2C4BA 1FW7A 2F4YA 1I0XA 1RN4A 1YVSA 1TTOA 7GSPA 3AGNA 3AHSA 6RNTA 4GHOA 2BU4A 1I2GA 3DGYA 1X1UA 1BVIA 1BNRA 1RCKA 2RBIA 1HZ1A 4J5KA 1FYSA 2KF6A 2F56A 1UCLA 1BSBA 5HOHA 4J5GA 1B2XA 1I70A 1GMRA 2RNTA 3BIRA 3WR2A 1HYFA 1BNSA 1DETA 1BSCA 1GOVA 1SARA 3RNTA 1LOVA 1JBSA 1JBTA 1UCKA 1BNGA 1I2FA 3URPA 1RHLA 1LRAA 1GOYA 3A5EA 5RNTA 1PY3A 3Q3FA 8RNTA 3AHWA 4BIRA 1AY7A 1B21A 1B2SA 1C54A 1GOUA 1RGFA 1BANA 1R4YA 1B27A 1BNEA 1CH0A 1BSEA 1RGGA 3BU4A 1BOXA 3KCHA 1RN1A 2AAEA 9RNTA 2F5WA 2GSPA 1BRIA 1RNBA 1BNIA 1ZGXA 2KF4A 3HOHA 2KAAA 1BAOA 1GMPA 1Q9EA 1RMSA 1PYLA 1RGEA 3AGOA 1YNVX 1I3FA 1BUJA 1X1XA 1BNJA 1FUTA 1RTUA 1I8VA 2SARA 1RCLA 1I3IA 1RNTA 2KF5A 1BNFA 1RGCA 3D4AA 1MGWA 1RLSA 1RGAA 1IYYA 1BGSA 1TRPA 1GSPA 1YGWA 1BRSA 1X1YA 1T2IA 1BSDA 3D5IA 1DE3A 5BIRA 1RGLA
chains in the Genus database with same CATH superfamily
2CC3A 3ZG0A 1E3RA 4EW5A 2YFLB 1FUSA 1J2BA 4BL3A 3GRDA 1ZX2A 2Q07A 3Q2PA 4R4KA 3STDA 3JUOA 1WMNA 1UCJA 4HAAA 4HM7B 3D5GA 5AIGA 1NB5I 4GB5A 1LNHA 2CG1A 5FGOA 1DMMA 2L4VA 5AIFA 1G02A 4LEHA 1QVF2 5LC7A 1OHPA 2YFIB 3SYUA 2RFRA 1JV2B 1QAFA 2CG0A 4NPBA 3RGRA 1CYUA 3DH2A 3KKGA 1RGKA 3D9RA 3SOYA 3OW22 1SIHA 3PCSA 1DYUA 2JQ5A 1IT7A 2XEPA 1S5AA 3N54B 1BRGA 4NREA 4X2OA 1OPYA 4MEIA 3CCQ3 3LTCA 2W2CA 2CW9A 1ZS7A 3FF0A 3K0ZA 3D79A 1JB4A 3KSED 1KC84 3DMCA 3IJEB 4ILFA 3CCE3 1VQL3 3WOEB 3I553 3X3XA 3CCJ3 3HZPA 3GWRA 1N5HA 6GSPA 1NO3A 1YGEA 1UCIA 2KF3A 2ZDJA 2C4BA 1YVBI 1YVSA 1CYVA 3EC9A 3FG4A 3OV4A 5DREA 1V58A 1EUIC 1HKXA 2KCDA 4L8PA 4N6LA 3CCM3 1IVWA 2BU4A 1I2GA 3E99A 1Z1SA 1WNHA 1X1UA 4LMIA 3LTBA 4LSOA 1BVIA 3ZG5A 2W6JH 3NQZA 3CMA3 1UCLA 4FCJA 3NQYA 4R80A 2IUJA 1VQN3 1I70A 1GMRA 2RNTA 3WR2A 3FF2A 3VSYA 1DETA 3EB8A 4FMBA 1AVLA 2SBLA 2CX0A 1SARA 1TUHA 4HVNA 1LOVA 5BXQA 1JBSA 4LGQA 2H0IA 1BNGA 1UGHI 3VF1A 1OHSA 1Q40A 3S29A 1TJDA 3WMDA 2XH9A 1M1K4 1RHLA 2QIYA 1AVKA 1LRAA 2PZVA 3V92A 3F8XA 2B1XB 1W2ZA 2CIUA 4WP5A 3Q3FA 8RNTA 3JUQA 3NBRA 4N6TA 4XM4A 3ECFA 4BIRA 2CWVA 2LQVA 3T8NA 1E97A 3LZAA 1C7HA 3CCL3 1E3VA 2O3OA 1MOLA 1MWTA 1N8QA 4KT3B 1EQKA 3X42A 3CNXA 2QGUA 3T8UA 1BOXA 1YJ93 1GY5A 1VZZA 5D81A 2C11A 9RNTA 2F5WA 1O7MB 3JUMA 3VGNA 3QK9A 2KF4A 4G1MB 1FGRA 3BLZA 3MHEA 3EJVA 2CH9A 4HM4B 3KN4A 1BAOA 3MWZA 1DMNA 1ULIB 1OHOA 5ELUA 2OOVA 5M18A 3N9HA 1FA3A 1NB3I 1U5OA 4HM5B 3F14A 4K1VA 1F8NA 4FMAA 4RZMA 1W00A 1BUJA 2IUKA 1I8VA 2FGTA 4MJDA 4K1UA 3V99A 3F40A 2OQEC 4HZ9B 3M8CA 2KF5A 3FH1A 2Z77A 1ASKA 1BNFA 4XDVA 2RSXA 3LOYA 3WA3A 1MGWA 4FMCA 1LOXA 2CWUA 1KWIA 4KZ1A 3DGLA 1RGAA 1SPUA 1WTHA 2D42A 3CXC2 1BGSA 1S723 2QA43 1TRPA 1JZDA 1YGWA 1BRSA 3PCRA 4KFFA 3CC73 1AR0A 1TU5A 2GEXA 1JB2A 1GMQA 3GSPA 3CC23 3S67A 1OH0A 2RGQA 3G0KA 4HZBB 1LOYA 1K734 5FW5A 1BRNL 3GZBA 3LMLA 3NM2A 1PU4A 3MPHA 4RNTA 2OWPA 1YJW3 1N5PA 1EA2A 4K61A 1B2MA 1MGRA 1T2HA 4PEJA 2KXGA 4O8SA 1IQYA 1W6CA 1BU4A 3CC43 1B2ZA 3PS8A 3MG3A 3T0UA 1VQK3 1DVCA 2BIRA 3PXMA 1QVG2 3SEDA 4L7KA 1EEJA 1BSAA 1BRHA 1QAKA 1LNIA 1VQQA 2CWTA 1TRQA 3WODG 1NWWA 3DZLA 1BRJA 3G16A 3NHXA 3Q1CA 5M19A 4HM3B 2MF7A 2GBWB 2UX0A 1M904 1RGHA 1SJWA 2O9UX 1MWUA 1FW7A 2KRTA 3SVAA 2GEYA 1TTOA 5CF1A 1W01A 3AGNA 2IA7A 2BT3A 3AHSA 3H51A 4GL6A 2ML5A 5EEOA 4WFOA 3MYTA 1IVXA 2F86B 4WWUC 1IV7A 3BNCA 4EBGA 3GZXB 3DXOA 4HM0B 1LXEA 3FZWA 1RCKA 2CK3H 3BNDA 4WHAA 2MC8A 7STDA 1MWSA 3LH4A 1FYSA 3LT9A 3KE7A 3LYGA 1JN5B 5HGRA 2HMKB 1FUWA 4BL2A 3F7SA 3BIRA 1RKYA 1HYFA 2BHMA 2R41A 4IT7A 1M1XB 3TDGA 4J8TA 1R4CA 2F98A 1UI8A 3RNTA 1W02A 2WO0A 1JBTA 2CFWA 3LTAA 1VQ83 5IENA 4BTWA 1V74A 3BB9A 3RGAA 4HM2B 2C10A 2E2VA 3S28A 4EV5A 1I2FA 3KSPA 2CFGA 3IPTA 4OVMA 5AIIA 4O3VA 1BUQA 2WGOA 1KSIA 3OX9A 1KD14 1FGQA 3DGOA 1LVNA 4Q53A 2OTJ3 3CCR3 2P05A 1VQP3 1GOUA 1US1A 1N8R4 3CPOA 1UUVB 3L0RA 1NNVA 1B27A 3B4PA 4JF8A 3WDGB 5IG5A 5EVHA 1VQO3 2BMOB 2P0XA 2D1WA 2R4IA 3D3LA 4J9AA 1BSEA 3B7CA 3BU4A 3NX0A 4XBXA 1IK3A 2P0MA 4AKZA 2BNGA 1RRHA 1FGOA 5IW9A 1BNIA 1ZGXA 2HMMB 3OXAA 3LT8A 3HOHA 1KQS2 4HBRA 1N9EA 3HIIA 1Q9EA 1YHQ3 2M7OA 2F99A 1RGEA 1OF5B 2HMNB 1IDPA 1UGIA 2OCTA 5DRVA 1FUTA 3FLJA 1RTUA 4FCMA 3AMOB 2YFJB 2Y74A 1V57A 4X2HA 3NUVA 4HYZA 3WA2X 3X41A 1IVVA 2INXA 1LQGC 1MNLA 3LXUX 1D6YA 1RLSA 2GU1A 4DKIA 2GU3A 1O7GB 4N6OB 4XBTA 3NXJA 5JPPA 1K41A 4N6V0 1VQ43 1X1YA 2P38A 1T2IA 3SXXA 3D5IA 3OWSA 4CCVA 1W6GA 3PYJA 5BIRA 1D6UA 2K3DA 5CF2A 3U1WA 4O2HA 1A2VA 2CHCA 2ZA4A 2Y73A 1TIJA 1W7CA 1B3SA 2WGQA 3I0YA 5GSPA 4HM1B 3MG1A 2W04A 1L5GB 5I97A 1B20A 1IQ8A 1ROAA 1IV9A 4KFDA 5EQLA 4XBYA 4BU4A 4LYLB 1OGZA 2HOHA 5BU4A 1O7NB 4IPBA 5IG4A 4MMXB 1LOWA 4R1KA 4QWTA 3CCV3 3HIGA 1AQZA 3PZWA 2I9WA 3DM8A 1I2EA 2W0QA 1BIRA 3JUNA 1CEWI 3DGMA 3K63A 2XSOB 2CFDA 1EKMA 5AEUB 4I5QA 5AIHA 4JRFA 3WHOA 3EHCA 3FG3A 3G8ZA 1Q7HA 2Z6BA 3CCS3 3K5TA 1W5ZA 4FCZA 5KP1A 1JN5A 1D6ZA 5CXOA 3NM7A 1GS3A 2F5MA 2A15A 1IU7A 1GD4A 2L1SA 1GY7A 1I0XA 1RN4A 2XR8B 3Q90A 1DVDA 4U13A 7GSPA 2B24B 3FG1A 1JZOA 2W9PA 1GY6A 4CJNA 1Q814 2UUGC 5M1AA 2K54A 2IMJA 1YJN3 4GHOA 2J8XB 3HI7A 1ISKA 1VQM3 3ALAA 3NV0B 1OGXA 1HZ1A 5D83A 5A0OB 4FR9A 1BSBA 1FGTA 1IQXA 3B8LA 4J5GA 4XDWA 1B2XA 1UUWB 2GXFA 3G713 1BSCA 2XFSA 4KVHA 5TGNA 2XF3A 1GOVA 1SQWA 4N3VA 3NBBA 2BO9B 3F9SA 1NU3A 3PGBA 1OACA 3G6E3 1Q42A 1JRQA 2UGIA 3RDEA 3JVCA 2QEX3 2V1LA 1A2KA 3FSDA 5CK6A 3URPA 2XGLA 3EE1A 4XB5A 2HMLB 3UB1A 1JJ22 1GOYA 3A5EA 5RNTA 1PY3A 4CPKA 3EX9A 1RJOA 4TX4A 1Y4KA 1IVUA 6STDA 4AEQA 2CX1A 3AHWA 1B21A 1GD3A 3S27A 4EYCA 3GZRA 3KFQC 4STDA 5AEWB 5LC6A 1BANA 1R4YA 3DGNA 1BNEA 1QMAA 5AYSC 4MMYB 1OUNA 1OF5A 1Q7Y4 2K0MA 3FCSB 3K9MC 2YX9A 1TP6A 3OWUA 3AMOA 3KCHA 4R9LA 2AAEA 2GSPA 2OQEA 3QRDA 3GAXA 1RNBA 3H3HA 3BNBA 4OUQA 1GYBA 2KAAA 4L8OA 1WMPA 1G0TA 2E2TA 1RMSA 2Z7AA 2STDA 4EC6A 1UI7A 1RRLA 3AGOA 1YNVX 3MG2A 3GZYB 3K7CA 1I3FA 5G1KA 2XFTA 3EBTA 1X1XA 1TFOA 3SLUA 2W56B 1A90A 1DMQA 4FMDA 1STFI 1Q824 1I3IA 2FNQA 1RNTA 2XRXB 1RGCA 1O7PB 1PFPA 5IEOA 3O8YA 3F8HA 5BVBA 5JPUA 2OOVC 1JB5A 1IYYA 1HU9A 3UL6A 3WOFB 1JKGA 1AV4A 1BSDA 1UW1A 3FKAA 3HK4A 3MSOA 3ROBA 1K8A4 2XSHB 1U8CB 1A2PA 1Q864 3U97A 1RSNA 4HM6B 4WYKB 4BTYA 8CHOA 1JNQA 1FZUA 1JBRA 1QJGA 3CU3A 4K90B 3LTDA 3UJMA 7RNTA 4EV2A 2W03A 1RDSA 1UDII 4HOHA 4BTXA 5CLKA 1STDA 3I563 4HM8B 5STDA 1B2UA 1FGMA 3SOAA 1MWRA 1I0VA 3X3ZA 1NJI4 1IT8A 1DE3A 4N6MA 5IEPA 2AADA 2H0GA 4HJLB 1BRKA 1X1WA 5AYRB 1M9GA 3DUKA 3CPW2 1EG9B 2H0HA 2HMOB 2JDIH 3DY5A 4GSPA 1YIJ3 5JBSA 2GBXB 2HMJB 3NV0A 4N6NB 5AI1A 2F4YA 2ZL8A 1SIIA 6RNTA 3CME3 2FXTA 3EN8A 1JKGB 3DGYA 1T3BA 3ZFZA 3J7Yd 1BNRA 2RBIA 4J5KA 4LZIA 2KF6A 4H3UA 2F56A 3FGYA 5HOHA 2ML6A 1OCVA 1UUGB 4RNYA 1BNSA 4ORLA 1WMOA 5D82A 2IY2A 4I4KA 2XGNA 1W4NA 2LYXA 3KIIA 5KP4A 1VQ73 1ROVA 2WOFA 3KZTA 3UNLA 3CCU3 1VQ53 1UCKA 2PNCA 2CFLA 2BMQB 3S5CA 4AKYA 5IF6A 2IYJA 3G4S3 3IMAB 3X3YA 3V98A 3BNEA 2BMRB 3NBJA 1K28A 4KFEA 2P09A 4N6UA 1O7WB 2CFKA 1AY7A 1B2SA 3N8BA 1C54A 1W6YA 4H61A 5IG3A 3OWYA 1N9JA 1RGFA 1Q40B 4HKVB 3X40A 1CH0A 3EN1B 5G2GA 2WOHA 3F7XA 3ER7A 4RBNA 5KP3A 3UL5A 1RGGA 2W56A 3MKIA 3CD63 1CQSA 1NDOB 5IERA 1RN1A 1O7HB 1BRIA 2OTL3 2RCDA 3A76A 1GMPA 1LQMB 3EBYA 1PYLA 5ELJA 4NHFA 1BNJA 2SARA 3B4OA 1T5YA 1RCLA 2CKFB 5IG0A 4MMZB 4RNZA 4WYKA 1VQ63 1ULJB 1G96A 4O02B 3EF8A 3D4AA 1A67A 3HX8A 2ZHXB 2E2UA 3CNMA 4CDLA 1YI23 2W9QA 1ZO2A 1TFKA 1W2B2 1YIT3 1VQ93 1WQLB 4EXRA 1RN7A 4IIAA 1QALA 4R9KA 1GSPA 4OK0A 4ZM8A 5G1LA 3JUPA 1K9M4 3SX1A 2Z76A 3EQQB 1RGLA
chains in the Genus database with same CATH topology
1A2PA 1FUSA 1RSNA 3GSPA 1GMQA 1JBRA 1FZUA 2ZA4A 1B3SA 5GSPA 1UCJA 1B20A 1LOYA 3D5GA 4HAAA 1BRNL 7RNTA 1RDSA 4BU4A 1G02A 2HOHA 4HOHA 5BU4A 3SYUA 1LOWA 4RNTA 1B2UA 3DH2A 1B2MA 1AQZA 1MGRA 1RGKA 1T2HA 1I2EA 1I0VA 1BIRA 1BU4A 1B2ZA 2AADA 1BRGA 1BRKA 1X1WA 2BIRA 3WHOA 1BSAA 1BRHA 1LNIA 4GSPA 1TRQA 1BRJA 6GSPA 1RGHA 1UCIA 2KF3A 2F5MA 2C4BA 1FW7A 2F4YA 1I0XA 1RN4A 1YVSA 1TTOA 7GSPA 3AGNA 3AHSA 6RNTA 4GHOA 2BU4A 1I2GA 3DGYA 1X1UA 1BVIA 1BNRA 1RCKA 2RBIA 1HZ1A 4J5KA 1FYSA 2KF6A 2F56A 1UCLA 1BSBA 5HOHA 4J5GA 1B2XA 1I70A 1GMRA 2RNTA 3BIRA 3WR2A 1HYFA 1BNSA 1DETA 1BSCA 1GOVA 1SARA 3RNTA 1LOVA 1JBSA 1JBTA 1UCKA 1BNGA 1I2FA 3URPA 1RHLA 1LRAA 1GOYA 3A5EA 5RNTA 1PY3A 3Q3FA 8RNTA 3AHWA 4BIRA 1AY7A 1B21A 1B2SA 1C54A 1GOUA 1RGFA 1BANA 1R4YA 1B27A 1BNEA 1CH0A 1BSEA 1RGGA 3BU4A 1BOXA 3KCHA 1RN1A 2AAEA 9RNTA 2F5WA 2GSPA 1BRIA 1RNBA 1BNIA 1ZGXA 2KF4A 3HOHA 2KAAA 1BAOA 1GMPA 1Q9EA 1RMSA 1PYLA 1RGEA 3AGOA 1YNVX 1I3FA 1BUJA 1X1XA 1BNJA 1FUTA 1RTUA 1I8VA 2SARA 1RCLA 1I3IA 1RNTA 2KF5A 1BNFA 1RGCA 3D4AA 1MGWA 1RLSA 1RGAA 1IYYA 1BGSA 1TRPA 1GSPA 1YGWA 1BRSA 1X1YA 1T2IA 1BSDA 3D5IA 1DE3A 5BIRA 1RGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2P A;  1FUS A;  1RSN A;  3GSP A;  1GMQ A;  1JBR A;  1FZU A;  2ZA4 A;  1B3S A;  5GSP A;  1UCJ A;  1B20 A;  1LOY A;  3D5G A;  4HAA A;  1BRN L;  7RNT A;  1RDS A;  4BU4 A;  1G02 A;  2HOH A;  4HOH A;  5BU4 A;  3SYU A;  1LOW A;  4RNT A;  1B2U A;  3DH2 A;  1B2M A;  1AQZ A;  1MGR A;  1RGK A;  1T2H A;  1I2E A;  1I0V A;  1BIR A;  1BU4 A;  1B2Z A;  2AAD A;  1BRG A;  1BRK A;  1X1W A;  2BIR A;  3WHO A;  1BSA A;  1BRH A;  1LNI A;  4GSP A;  1TRQ A;  1BRJ A;  6GSP A;  1RGH A;  1UCI A;  2KF3 A;  2F5M A;  2C4B A;  1FW7 A;  2F4Y A;  1I0X A;  1RN4 A;  1YVS A;  1TTO A;  7GSP A;  3AGN A;  3AHS A;  6RNT A;  4GHO A;  2BU4 A;  1I2G A;  3DGY A;  1X1U A;  1BVI A;  1BNR A;  1RCK A;  2RBI A;  1HZ1 A;  4J5K A;  1FYS A;  2KF6 A;  2F56 A;  1UCL A;  1BSB A;  5HOH A;  4J5G A;  1B2X A;  1I70 A;  1GMR A;  2RNT A;  3BIR A;  3WR2 A;  1HYF A;  1BNS A;  1DET A;  1BSC A;  1GOV A;  1SAR A;  3RNT A;  1LOV A;  1JBS A;  1JBT A;  1UCK A;  1BNG A;  1I2F A;  3URP A;  1RHL A;  1LRA A;  1GOY A;  3A5E A;  5RNT A;  1PY3 A;  3Q3F A;  8RNT A;  3AHW A;  4BIR A;  1AY7 A;  1B21 A;  1B2S A;  1C54 A;  1GOU A;  1RGF A;  1BAN A;  1R4Y A;  1B27 A;  1BNE A;  1CH0 A;  1BSE A;  1RGG A;  3BU4 A;  1BOX A;  3KCH A;  1RN1 A;  2AAE A;  9RNT A;  2F5W A;  2GSP A;  1BRI A;  1RNB A;  1BNI A;  1ZGX A;  2KF4 A;  3HOH A;  2KAA A;  1BAO A;  1GMP A;  1Q9E A;  1RMS A;  1PYL A;  1RGE A;  3AGO A;  1YNV X;  1I3F A;  1BUJ A;  1X1X A;  1BNJ A;  1FUT A;  1RTU A;  1I8V A;  2SAR A;  1RCL A;  1I3I A;  1RNT A;  2KF5 A;  1BNF A;  1RGC A;  3D4A A;  1MGW A;  1RLS A;  1RGA A;  1IYY A;  1BGS A;  1TRP A;  1GSP A;  1YGW A;  1BRS A;  1X1Y A;  1T2I A;  1BSD A;  3D5I A;  1DE3 A;  5BIR A;  1RGL A; 
#chains in the Genus database with same CATH topology
 2CC3 A;  3ZG0 A;  1E3R A;  4EW5 A;  2YFL B;  1FUS A;  1J2B A;  4BL3 A;  3GRD A;  1ZX2 A;  2Q07 A;  3Q2P A;  4R4K A;  3STD A;  3JUO A;  1WMN A;  1UCJ A;  4HAA A;  4HM7 B;  3D5G A;  5AIG A;  1NB5 I;  4GB5 A;  1LNH A;  2CG1 A;  5FGO A;  1DMM A;  2L4V A;  5AIF A;  1G02 A;  4LEH A;  1QVF 2;  5LC7 A;  1OHP A;  2YFI B;  3SYU A;  2RFR A;  1JV2 B;  1QAF A;  2CG0 A;  4NPB A;  3RGR A;  1CYU A;  3DH2 A;  3KKG A;  1RGK A;  3D9R A;  3SOY A;  3OW2 2;  1SIH A;  3PCS A;  1DYU A;  2JQ5 A;  1IT7 A;  2XEP A;  1S5A A;  3N54 B;  1BRG A;  4NRE A;  4X2O A;  1OPY A;  4MEI A;  3CCQ 3;  3LTC A;  2W2C A;  2CW9 A;  1ZS7 A;  3FF0 A;  3K0Z A;  3D79 A;  1JB4 A;  3KSE D;  1KC8 4;  3DMC A;  3IJE B;  4ILF A;  3CCE 3;  1VQL 3;  3WOE B;  3I55 3;  3X3X A;  3CCJ 3;  3HZP A;  3GWR A;  1N5H A;  6GSP A;  1NO3 A;  1YGE A;  1UCI A;  2KF3 A;  2ZDJ A;  2C4B A;  1YVB I;  1YVS A;  1CYV A;  3EC9 A;  3FG4 A;  3OV4 A;  5DRE A;  1V58 A;  1EUI C;  1HKX A;  2KCD A;  4L8P A;  4N6L A;  3CCM 3;  1IVW A;  2BU4 A;  1I2G A;  3E99 A;  1Z1S A;  1WNH A;  1X1U A;  4LMI A;  3LTB A;  4LSO A;  1BVI A;  3ZG5 A;  2W6J H;  3NQZ A;  3CMA 3;  1UCL A;  4FCJ A;  3NQY A;  4R80 A;  2IUJ A;  1VQN 3;  1I70 A;  1GMR A;  2RNT A;  3WR2 A;  3FF2 A;  3VSY A;  1DET A;  3EB8 A;  4FMB A;  1AVL A;  2SBL A;  2CX0 A;  1SAR A;  1TUH A;  4HVN A;  1LOV A;  5BXQ A;  1JBS A;  4LGQ A;  2H0I A;  1BNG A;  1UGH I;  3VF1 A;  1OHS A;  1Q40 A;  3S29 A;  1TJD A;  3WMD A;  2XH9 A;  1M1K 4;  1RHL A;  2QIY A;  1AVK A;  1LRA A;  2PZV A;  3V92 A;  3F8X A;  2B1X B;  1W2Z A;  2CIU A;  4WP5 A;  3Q3F A;  8RNT A;  3JUQ A;  3NBR A;  4N6T A;  4XM4 A;  3ECF A;  4BIR A;  2CWV A;  2LQV A;  3T8N A;  1E97 A;  3LZA A;  1C7H A;  3CCL 3;  1E3V A;  2O3O A;  1MOL A;  1MWT A;  1N8Q A;  4KT3 B;  1EQK A;  3X42 A;  3CNX A;  2QGU A;  3T8U A;  1BOX A;  1YJ9 3;  1GY5 A;  1VZZ A;  5D81 A;  2C11 A;  9RNT A;  2F5W A;  1O7M B;  3JUM A;  3VGN A;  3QK9 A;  2KF4 A;  4G1M B;  1FGR A;  3BLZ A;  3MHE A;  3EJV A;  2CH9 A;  4HM4 B;  3KN4 A;  1BAO A;  3MWZ A;  1DMN A;  1ULI B;  1OHO A;  5ELU A;  2OOV A;  5M18 A;  3N9H A;  1FA3 A;  1NB3 I;  1U5O A;  4HM5 B;  3F14 A;  4K1V A;  1F8N A;  4FMA A;  4RZM A;  1W00 A;  1BUJ A;  2IUK A;  1I8V A;  2FGT A;  4MJD A;  4K1U A;  3V99 A;  3F40 A;  2OQE C;  4HZ9 B;  3M8C A;  2KF5 A;  3FH1 A;  2Z77 A;  1ASK A;  1BNF A;  4XDV A;  2RSX A;  3LOY A;  3WA3 A;  1MGW A;  4FMC A;  1LOX A;  2CWU A;  1KWI A;  4KZ1 A;  3DGL A;  1RGA A;  1SPU A;  1WTH A;  2D42 A;  3CXC 2;  1BGS A;  1S72 3;  2QA4 3;  1TRP A;  1JZD A;  1YGW A;  1BRS A;  3PCR A;  4KFF A;  3CC7 3;  1AR0 A;  1TU5 A;  2GEX A;  1JB2 A;  1GMQ A;  3GSP A;  3CC2 3;  3S67 A;  1OH0 A;  2RGQ A;  3G0K A;  4HZB B;  1LOY A;  1K73 4;  5FW5 A;  1BRN L;  3GZB A;  3LML A;  3NM2 A;  1PU4 A;  3MPH A;  4RNT A;  2OWP A;  1YJW 3;  1N5P A;  1EA2 A;  4K61 A;  1B2M A;  1MGR A;  1T2H A;  4PEJ A;  2KXG A;  4O8S A;  1IQY A;  1W6C A;  1BU4 A;  3CC4 3;  1B2Z A;  3PS8 A;  3MG3 A;  3T0U A;  1VQK 3;  1DVC A;  2BIR A;  3PXM A;  1QVG 2;  3SED A;  4L7K A;  1EEJ A;  1BSA A;  1BRH A;  1QAK A;  1LNI A;  1VQQ A;  2CWT A;  1TRQ A;  3WOD G;  1NWW A;  3DZL A;  1BRJ A;  3G16 A;  3NHX A;  3Q1C A;  5M19 A;  4HM3 B;  2MF7 A;  2GBW B;  2UX0 A;  1M90 4;  1RGH A;  1SJW A;  2O9U X;  1MWU A;  1FW7 A;  2KRT A;  3SVA A;  2GEY A;  1TTO A;  5CF1 A;  1W01 A;  3AGN A;  2IA7 A;  2BT3 A;  3AHS A;  3H51 A;  4GL6 A;  2ML5 A;  5EEO A;  4WFO A;  3MYT A;  1IVX A;  2F86 B;  4WWU C;  1IV7 A;  3BNC A;  4EBG A;  3GZX B;  3DXO A;  4HM0 B;  1LXE A;  3FZW A;  1RCK A;  2CK3 H;  3BND A;  4WHA A;  2MC8 A;  7STD A;  1MWS A;  3LH4 A;  1FYS A;  3LT9 A;  3KE7 A;  3LYG A;  1JN5 B;  5HGR A;  2HMK B;  1FUW A;  4BL2 A;  3F7S A;  3BIR A;  1RKY A;  1HYF A;  2BHM A;  2R41 A;  4IT7 A;  1M1X B;  3TDG A;  4J8T A;  1R4C A;  2F98 A;  1UI8 A;  3RNT A;  1W02 A;  2WO0 A;  1JBT A;  2CFW A;  3LTA A;  1VQ8 3;  5IEN A;  4BTW A;  1V74 A;  3BB9 A;  3RGA A;  4HM2 B;  2C10 A;  2E2V A;  3S28 A;  4EV5 A;  1I2F A;  3KSP A;  2CFG A;  3IPT A;  4OVM A;  5AII A;  4O3V A;  1BUQ A;  2WGO A;  1KSI A;  3OX9 A;  1KD1 4;  1FGQ A;  3DGO A;  1LVN A;  4Q53 A;  2OTJ 3;  3CCR 3;  2P05 A;  1VQP 3;  1GOU A;  1US1 A;  1N8R 4;  3CPO A;  1UUV B;  3L0R A;  1NNV A;  1B27 A;  3B4P A;  4JF8 A;  3WDG B;  5IG5 A;  5EVH A;  1VQO 3;  2BMO B;  2P0X A;  2D1W A;  2R4I A;  3D3L A;  4J9A A;  1BSE A;  3B7C A;  3BU4 A;  3NX0 A;  4XBX A;  1IK3 A;  2P0M A;  4AKZ A;  2BNG A;  1RRH A;  1FGO A;  5IW9 A;  1BNI A;  1ZGX A;  2HMM B;  3OXA A;  3LT8 A;  3HOH A;  1KQS 2;  4HBR A;  1N9E A;  3HII A;  1Q9E A;  1YHQ 3;  2M7O A;  2F99 A;  1RGE A;  1OF5 B;  2HMN B;  1IDP A;  1UGI A;  2OCT A;  5DRV A;  1FUT A;  3FLJ A;  1RTU A;  4FCM A;  3AMO B;  2YFJ B;  2Y74 A;  1V57 A;  4X2H A;  3NUV A;  4HYZ A;  3WA2 X;  3X41 A;  1IVV A;  2INX A;  1LQG C;  1MNL A;  3LXU X;  1D6Y A;  1RLS A;  2GU1 A;  4DKI A;  2GU3 A;  1O7G B;  4N6O B;  4XBT A;  3NXJ A;  5JPP A;  1K41 A;  4N6V 0;  1VQ4 3;  1X1Y A;  2P38 A;  1T2I A;  3SXX A;  3D5I A;  3OWS A;  4CCV A;  1W6G A;  3PYJ A;  5BIR A;  1D6U A;  2K3D A;  5CF2 A;  3U1W A;  4O2H A;  1A2V A;  2CHC A;  2ZA4 A;  2Y73 A;  1TIJ A;  1W7C A;  1B3S A;  2WGQ A;  3I0Y A;  5GSP A;  4HM1 B;  3MG1 A;  2W04 A;  1L5G B;  5I97 A;  1B20 A;  1IQ8 A;  1ROA A;  1IV9 A;  4KFD A;  5EQL A;  4XBY A;  4BU4 A;  4LYL B;  1OGZ A;  2HOH A;  5BU4 A;  1O7N B;  4IPB A;  5IG4 A;  4MMX B;  1LOW A;  4R1K A;  4QWT A;  3CCV 3;  3HIG A;  1AQZ A;  3PZW A;  2I9W A;  3DM8 A;  1I2E A;  2W0Q A;  1BIR A;  3JUN A;  1CEW I;  3DGM A;  3K63 A;  2XSO B;  2CFD A;  1EKM A;  5AEU B;  4I5Q A;  5AIH A;  4JRF A;  3WHO A;  3EHC A;  3FG3 A;  3G8Z A;  1Q7H A;  2Z6B A;  3CCS 3;  3K5T A;  1W5Z A;  4FCZ A;  5KP1 A;  1JN5 A;  1D6Z A;  5CXO A;  3NM7 A;  1GS3 A;  2F5M A;  2A15 A;  1IU7 A;  1GD4 A;  2L1S A;  1GY7 A;  1I0X A;  1RN4 A;  2XR8 B;  3Q90 A;  1DVD A;  4U13 A;  7GSP A;  2B24 B;  3FG1 A;  1JZO A;  2W9P A;  1GY6 A;  4CJN A;  1Q81 4;  2UUG C;  5M1A A;  2K54 A;  2IMJ A;  1YJN 3;  4GHO A;  2J8X B;  3HI7 A;  1ISK A;  1VQM 3;  3ALA A;  3NV0 B;  1OGX A;  1HZ1 A;  5D83 A;  5A0O B;  4FR9 A;  1BSB A;  1FGT A;  1IQX A;  3B8L A;  4J5G A;  4XDW A;  1B2X A;  1UUW B;  2GXF A;  3G71 3;  1BSC A;  2XFS A;  4KVH A;  5TGN A;  2XF3 A;  1GOV A;  1SQW A;  4N3V A;  3NBB A;  2BO9 B;  3F9S A;  1NU3 A;  3PGB A;  1OAC A;  3G6E 3;  1Q42 A;  1JRQ A;  2UGI A;  3RDE A;  3JVC A;  2QEX 3;  2V1L A;  1A2K A;  3FSD A;  5CK6 A;  3URP A;  2XGL A;  3EE1 A;  4XB5 A;  2HML B;  3UB1 A;  1JJ2 2;  1GOY A;  3A5E A;  5RNT A;  1PY3 A;  4CPK A;  3EX9 A;  1RJO A;  4TX4 A;  1Y4K A;  1IVU A;  6STD A;  4AEQ A;  2CX1 A;  3AHW A;  1B21 A;  1GD3 A;  3S27 A;  4EYC A;  3GZR A;  3KFQ C;  4STD A;  5AEW B;  5LC6 A;  1BAN A;  1R4Y A;  3DGN A;  1BNE A;  1QMA A;  5AYS C;  4MMY B;  1OUN A;  1OF5 A;  1Q7Y 4;  2K0M A;  3FCS B;  3K9M C;  2YX9 A;  1TP6 A;  3OWU A;  3AMO A;  3KCH A;  4R9L A;  2AAE A;  2GSP A;  2OQE A;  3QRD A;  3GAX A;  1RNB A;  3H3H A;  3BNB A;  4OUQ A;  1GYB A;  2KAA A;  4L8O A;  1WMP A;  1G0T A;  2E2T A;  1RMS A;  2Z7A A;  2STD A;  4EC6 A;  1UI7 A;  1RRL A;  3AGO A;  1YNV X;  3MG2 A;  3GZY B;  3K7C A;  1I3F A;  5G1K A;  2XFT A;  3EBT A;  1X1X A;  1TFO A;  3SLU A;  2W56 B;  1A90 A;  1DMQ A;  4FMD A;  1STF I;  1Q82 4;  1I3I A;  2FNQ A;  1RNT A;  2XRX B;  1RGC A;  1O7P B;  1PFP A;  5IEO A;  3O8Y A;  3F8H A;  5BVB A;  5JPU A;  2OOV C;  1JB5 A;  1IYY A;  1HU9 A;  3UL6 A;  3WOF B;  1JKG A;  1AV4 A;  1BSD A;  1UW1 A;  3FKA A;  3HK4 A;  3MSO A;  3ROB A;  1K8A 4;  2XSH B;  1U8C B;  1A2P A;  1Q86 4;  3U97 A;  1RSN A;  4HM6 B;  4WYK B;  4BTY A;  8CHO A;  1JNQ A;  1FZU A;  1JBR A;  1QJG A;  3CU3 A;  4K90 B;  3LTD A;  3UJM A;  7RNT A;  4EV2 A;  2W03 A;  1RDS A;  1UDI I;  4HOH A;  4BTX A;  5CLK A;  1STD A;  3I56 3;  4HM8 B;  5STD A;  1B2U A;  1FGM A;  3SOA A;  1MWR A;  1I0V A;  3X3Z A;  1NJI 4;  1IT8 A;  1DE3 A;  4N6M A;  5IEP A;  2AAD A;  2H0G A;  4HJL B;  1BRK A;  1X1W A;  5AYR B;  1M9G A;  3DUK A;  3CPW 2;  1EG9 B;  2H0H A;  2HMO B;  2JDI H;  3DY5 A;  4GSP A;  1YIJ 3;  5JBS A;  2GBX B;  2HMJ B;  3NV0 A;  4N6N B;  5AI1 A;  2F4Y A;  2ZL8 A;  1SII A;  6RNT A;  3CME 3;  2FXT A;  3EN8 A;  1JKG B;  3DGY A;  1T3B A;  3ZFZ A;  3J7Y d;  1BNR A;  2RBI A;  4J5K A;  4LZI A;  2KF6 A;  4H3U A;  2F56 A;  3FGY A;  5HOH A;  2ML6 A;  1OCV A;  1UUG B;  4RNY A;  1BNS A;  4ORL A;  1WMO A;  5D82 A;  2IY2 A;  4I4K A;  2XGN A;  1W4N A;  2LYX A;  3KII A;  5KP4 A;  1VQ7 3;  1ROV A;  2WOF A;  3KZT A;  3UNL A;  3CCU 3;  1VQ5 3;  1UCK A;  2PNC A;  2CFL A;  2BMQ B;  3S5C A;  4AKY A;  5IF6 A;  2IYJ A;  3G4S 3;  3IMA B;  3X3Y A;  3V98 A;  3BNE A;  2BMR B;  3NBJ A;  1K28 A;  4KFE A;  2P09 A;  4N6U A;  1O7W B;  2CFK A;  1AY7 A;  1B2S A;  3N8B A;  1C54 A;  1W6Y A;  4H61 A;  5IG3 A;  3OWY A;  1N9J A;  1RGF A;  1Q40 B;  4HKV B;  3X40 A;  1CH0 A;  3EN1 B;  5G2G A;  2WOH A;  3F7X A;  3ER7 A;  4RBN A;  5KP3 A;  3UL5 A;  1RGG A;  2W56 A;  3MKI A;  3CD6 3;  1CQS A;  1NDO B;  5IER A;  1RN1 A;  1O7H B;  1BRI A;  2OTL 3;  2RCD A;  3A76 A;  1GMP A;  1LQM B;  3EBY A;  1PYL A;  5ELJ A;  4NHF A;  1BNJ A;  2SAR A;  3B4O A;  1T5Y A;  1RCL A;  2CKF B;  5IG0 A;  4MMZ B;  4RNZ A;  4WYK A;  1VQ6 3;  1ULJ B;  1G96 A;  4O02 B;  3EF8 A;  3D4A A;  1A67 A;  3HX8 A;  2ZHX B;  2E2U A;  3CNM A;  4CDL A;  1YI2 3;  2W9Q A;  1ZO2 A;  1TFK A;  1W2B 2;  1YIT 3;  1VQ9 3;  1WQL B;  4EXR A;  1RN7 A;  4IIA A;  1QAL A;  4R9K A;  1GSP A;  4OK0 A;  4ZM8 A;  5G1L A;  3JUP A;  1K9M 4;  3SX1 A;  2Z76 A;  3EQQ B;  1RGL A; 
#chains in the Genus database with same CATH homology
 1A2P A;  1FUS A;  1RSN A;  3GSP A;  1GMQ A;  1JBR A;  1FZU A;  2ZA4 A;  1B3S A;  5GSP A;  1UCJ A;  1B20 A;  1LOY A;  3D5G A;  4HAA A;  1BRN L;  7RNT A;  1RDS A;  4BU4 A;  1G02 A;  2HOH A;  4HOH A;  5BU4 A;  3SYU A;  1LOW A;  4RNT A;  1B2U A;  3DH2 A;  1B2M A;  1AQZ A;  1MGR A;  1RGK A;  1T2H A;  1I2E A;  1I0V A;  1BIR A;  1BU4 A;  1B2Z A;  2AAD A;  1BRG A;  1BRK A;  1X1W A;  2BIR A;  3WHO A;  1BSA A;  1BRH A;  1LNI A;  4GSP A;  1TRQ A;  1BRJ A;  6GSP A;  1RGH A;  1UCI A;  2KF3 A;  2F5M A;  2C4B A;  1FW7 A;  2F4Y A;  1I0X A;  1RN4 A;  1YVS A;  1TTO A;  7GSP A;  3AGN A;  3AHS A;  6RNT A;  4GHO A;  2BU4 A;  1I2G A;  3DGY A;  1X1U A;  1BVI A;  1BNR A;  1RCK A;  2RBI A;  1HZ1 A;  4J5K A;  1FYS A;  2KF6 A;  2F56 A;  1UCL A;  1BSB A;  5HOH A;  4J5G A;  1B2X A;  1I70 A;  1GMR A;  2RNT A;  3BIR A;  3WR2 A;  1HYF A;  1BNS A;  1DET A;  1BSC A;  1GOV A;  1SAR A;  3RNT A;  1LOV A;  1JBS A;  1JBT A;  1UCK A;  1BNG A;  1I2F A;  3URP A;  1RHL A;  1LRA A;  1GOY A;  3A5E A;  5RNT A;  1PY3 A;  3Q3F A;  8RNT A;  3AHW A;  4BIR A;  1AY7 A;  1B21 A;  1B2S A;  1C54 A;  1GOU A;  1RGF A;  1BAN A;  1R4Y A;  1B27 A;  1BNE A;  1CH0 A;  1BSE A;  1RGG A;  3BU4 A;  1BOX A;  3KCH A;  1RN1 A;  2AAE A;  9RNT A;  2F5W A;  2GSP A;  1BRI A;  1RNB A;  1BNI A;  1ZGX A;  2KF4 A;  3HOH A;  2KAA A;  1BAO A;  1GMP A;  1Q9E A;  1RMS A;  1PYL A;  1RGE A;  3AGO A;  1YNV X;  1I3F A;  1BUJ A;  1X1X A;  1BNJ A;  1FUT A;  1RTU A;  1I8V A;  2SAR A;  1RCL A;  1I3I A;  1RNT A;  2KF5 A;  1BNF A;  1RGC A;  3D4A A;  1MGW A;  1RLS A;  1RGA A;  1IYY A;  1BGS A;  1TRP A;  1GSP A;  1YGW A;  1BRS A;  1X1Y A;  1T2I A;  1BSD A;  3D5I A;  1DE3 A;  5BIR A;  1RGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...