1LOVA

X-ray structure of the e58a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease T1
publication title A nucleophile activation dyad in ribonucleases. A combined X-ray crystallographic/ab initio quantum chemical study
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1lovA00
5RNTA 3WR2A 1BIRA 2KF4A 1A2PA 2RBIA 1RGEA 2F56A 4J5KA 1FW7A 1BNEA 1HZ1A 2F5MA 1T2HA 1BNRA 1BSDA 1R4YA 1DETA 1B2SA 1I70A 3AGOA 1GMRA 1I2FA 1I0VA 1FZUA 3D4AA 1GSPA 3KCHA 1I3IA 1MGRA 1RGKA 1RSNA 1MGWA 1ZGXA 1RHLA 2BIRA 2RNTA 3GSPA 2AADA 1B2MA 1BRJA 2KF5A 1BNJA 3DGYA 9RNTA 3HOHA 1B21A 1UCIA 1C54A 4RNTA 1YVSA 1BVIA 1I2EA 1RGAA 1SARA 1TTOA 4HOHA 3RNTA 1TRPA 1BSEA 1BGSA 1I3FA 1BUJA 1B2ZA 1RGCA 1RLSA 1TRQA 1LRAA 1YGWA 1JBTA 1BANA 1IYYA 4J5GA 1JBSA 1I0XA 3A5EA 1T2IA 5GSPA 1BOXA 1G02A 2F4YA 1RGGA 1RGHA 3AGNA 1UCJA 2F5WA 5BU4A 1AQZA 3WHOA 1RN1A 1RMSA 1HYFA 1X1UA 2BU4A 1I2GA 3SYUA 1BNIA 1RGLA 8RNTA 5HOHA 1RGFA 1B2XA 1BSBA 2AAEA 1FYSA 1FUTA 1AY7A 1BAOA 1PY3A 1BSCA 1YNVX 1BRNL 1UCKA 3D5IA 1BNGA 1BSAA 1RNBA 2KF6A 3AHWA 1BRKA 1BU4A 3BU4A 4HAAA 4BIRA 1Q9EA 2C4BA 1BRHA 1BRGA 1DE3A 3AHSA 1LOVA 1GMQA 2ZA4A 1GOUA 1UCLA 2KAAA 3D5GA 5BIRA 1B2UA 1GOVA 6RNTA 1BRSA 1BNSA 2HOHA 3DH2A 3BIRA 1RCLA 1LOWA 7GSPA 4BU4A 1RTUA 4GSPA 1CH0A 1LOYA 2SARA 7RNTA 1BRIA 1RN4A 1LNIA 1X1XA 1RDSA 2GSPA 4GHOA 1JBRA 6GSPA 3Q3FA 1B20A 1X1WA 1I8VA 1GMPA 1PYLA 1B27A 1RCKA 1BNFA 1GOYA 1B3SA 1RNTA 1X1YA 3URPA 1FUSA 2KF3A
chains in the Genus database with same CATH superfamily
1W02A 1VQK3 5RNTA 3BNCA 4HZ9B 1A2PA 2RBIA 5JPUA 5IW9A 4XBXA 3K7CA 2OOVC 3S5CA 1BNEA 1IT7A 2P09A 2F5MA 3D79A 1W6CA 4L8PA 1R4YA 4BL2A 2GXFA 4MEIA 1N5PA 3AMOA 1W6GA 5M18A 4KZ1A 1W7CA 3V92A 1RRLA 3F8HA 4HYZA 3D4AA 4J9AA 3WA2X 3I563 1MGRA 1ASKA 1ZGXA 4X2HA 2QEX3 2RNTA 2AADA 2GU1A 2CK3H 3NV0A 1NJI4 1B2MA 3HIIA 1N8QA 2E2UA 2XGLA 4FMAA 3STDA 5IG5A 2H0HA 1BNJA 3E99A 1RJOA 4NHFA 4WHAA 1B21A 3B4PA 3EN1B 1SIHA 1MWTA 1A90A 3LTCA 4L7KA 5IERA 3S29A 3X41A 2L4VA 2CFKA 3GWRA 4JF8A 1B2ZA 2W9QA 3NV0B 1JN5A 2OQEA 2CH9A 3KFQC 1AV4A 2IA7A 3LOYA 3FKAA 3OXAA 2CKFB 1Q40B 4FMCA 3UNLA 3CCM3 1JZOA 3PS8A 2RGQA 1IYYA 1OGXA 3JUOA 1I0XA 3A5EA 5GSPA 2GBWB 1G02A 2HMKB 1KC84 1S723 2F5WA 1LOXA 5CF2A 1IV7A 2XFSA 2W6JH 1JJ22 3FZWA 3WHOA 4CPKA 1JN5B 4LGQA 4BL3A 1GD4A 1HYFA 2BU4A 3CU3A 3EC9A 1QAKA 4HM3B 1L5GB 3OW22 5M19A 1YJW3 4O8SA 4TX4A 4NREA 4EBGA 1RGLA 5AIHA 8RNTA 1OUNA 1A67A 1YI23 1M9GA 1BSBA 3OWUA 4O2HA 1FYSA 4KFDA 1AY7A 3LH4A 2QGUA 1M1XB 1PY3A 1ZO2A 3FG3A 2E2TA 1BNGA 3A76A 3FH1A 3AHWA 3LXUX 4IPBA 5CXOA 1ULJB 4KFFA 4MMZB 4OVMA 3DGNA 2CX1A 3N54B 1OF5A 1RKYA 4GL6A 3IPTA 1GMQA 1KWIA 3N8BA 3X3XA 3G8ZA 2CC3A 3NXJA 4LMIA 2CIUA 4OK0A 5IEOA 3JUNA 3F14A 2XFTA 5BIRA 2IUKA 5EQLA 3WOEB 1WTHA 3JUMA 2Z7AA 1OF5B 4RNYA 1BRSA 5AEWB 7STDA 1EG9B 2HOHA 3DH2A 3EBYA 1KSIA 2Z6BA 2ML5A 3UL6A 1EUIC 1IDPA 2R41A 4G1MB 3VSYA 3SX1A 1SIIA 1W00A 1VQP3 3ER7A 3NX0A 1BRIA 3MG1A 4LSOA 7RNTA 5EEOA 4AKZA 4STDA 5FW5A 5CK6A 5A0OB 2UX0A 3O8YA 1JB2A 1E3VA 1OACA 3WMDA 3NHXA 3CCR3 3FG4A 4LEHA 1O7PB 1W5ZA 2HMNB 3QK9A 5JBSA 1WNHA 5ELJA 2WGQA 3IMAB 1JZDA 2D42A 4IIAA 1Q7Y4 2SBLA 3Q2PA 2H0IA 3FGYA 3V98A 2W56A 2INXA 3H51A 3MWZA 2IMJA 3FF0A 3WDGB 1IVUA 2UGIA 1WQLB 5IG0A 2BT3A 3T8UA 2QIYA 1T2HA 4MMYB 4WFOA 5LC6A 3CCL3 5AIGA 3LT8A 1MWRA 2XGNA 4LZIA 5AYSC 1GMRA 1I2FA 1I0VA 3PGBA 4X2OA 3HI7A 1IK3A 4FMDA 3CMA3 3KCHA 1JRQA 3DM8A 3UB1A 3KSPA 1SPUA 1IT8A 4O02B 3KSED 1RSNA 2WOHA 1JKGA 3CNMA 1CQSA 3K0ZA 4FMBA 4EV2A 1OCVA 5IG4A 4XBTA 3FG1A 3L0RA 3B4OA 2F86B 4XDVA 1QVF2 4N6TA 3I553 1VQ83 4N6LA 5STDA 3ZG0A 1T5YA 1BVIA 1O7WB 1TTOA 2KCDA 4EW5A 1K9M4 4ILFA 4R9KA 1DMNA 2XEPA 1HKXA 1JKGB 4CDLA 1Q42A 3DGOA 1WMPA 3OV4A 4HM7B 1FGMA 1NO3A 1Q824 1VQ93 3FLJA 1FGTA 2P38A 4XB5A 3DY5A 1D6UA 3PZWA 3HK4A 5G1LA 3T0UA 2F4YA 1RGGA 3F9SA 2CG1A 1OPYA 2CW9A 2BHMA 3CXC2 3MG3A 1X1UA 2XH9A 1VQQA 1ZX2A 3AMOB 1G0TA 1Q864 1E97A 1U8CB 1UI7A 3EQQB 1TUHA 3HIGA 2CFLA 1MNLA 3X3ZA 2CWVA 4L8OA 1BSCA 1YNVX 4K1UA 4K61A 1OGZA 3D5IA 1EQKA 1O7HB 5KP1A 1VQ73 2GBXB 4MMXB 4HAAA 4IT7A 4WYKA 1DVCA 2P0XA 4BIRA 1T3BA 1CYUA 4WWUC 2C10A 3WOFB 3CCS3 2ZL8A 3GAXA 3JVCA 2CWUA 3OX9A 1LOVA 4HM6B 1DE3A 4N6UA 2ZA4A 3EBTA 1D6YA 3WA3A 3RGRA 1EEJA 4I5QA 1NWWA 1OHSA 1TFKA 5D83A 3BLZA 2KAAA 4KVHA 1N9EA 2YX9A 1STFI 1YHQ3 1ULIB 3ECFA 3G6E3 4WYKB 1GOVA 3NQYA 3EN8A 1MOLA 3B7CA 3CCU3 2ML6A 3LTDA 1PFPA 1JB5A 1LOWA 4DKIA 3CCE3 1DVDA 1FGQA 4BU4A 4K1VA 1AVLA 2K0MA 5IF6A 3BNDA 4EV5A 1LOYA 1V58A 3BB9A 3K9MC 1RN4A 3KE7A 1EKMA 2BMQB 2XSHB 1UUVB 1YVBI 6GSPA 3CPOA 3EB8A 1RRHA 3BNBA 4FR9A 1M1K4 1I8VA 2LYXA 1G96A 3UJMA 1DYUA 1GOYA 1B3SA 1VQL3 2OQEC 2WOFA 1FUWA 4GB5A 4H61A 1IV9A 3D3LA 3GZXB 6STDA 1W6YA 2CFDA 3VGNA 2W0QA 5ELUA 2J8XB 4N6V0 3NUVA 3H3HA 4MJDA 1ISKA 1EA2A 1W2B2 3PCRA 2BMRB 2KF4A 1SQWA 1LQGC 2C11A 2YFJB 3F40A 4J5KA 1FGOA 1FW7A 1HZ1A 1DETA 1B2SA 1JV2B 1IQXA 1Q7HA 2W9PA 4AEQA 2BMOB 4J8TA 3AGOA 1FZUA 1GY6A 2XF3A 3PYJA 1NB5I 1YIT3 5M1AA 1JB4A 1D6ZA 5D81A 1JNQA 4OUQA 2RFRA 3NBRA 1NU3A 3CC73 1KD14 1MGWA 1GY7A 2GEXA 3CCJ3 3LYGA 1OHPA 4N6OB 4EXRA 2L1SA 4K90B 4LYLB 3SVAA 1YIJ3 1K28A 1A2KA 2KF5A 3PCSA 3SOAA 5BXQA 3CME3 1VQ43 3IJEB 3GZRA 3HOHA 4R1KA 1AVKA 1M904 3LT9A 1C54A 1YVSA 1UGHI 3GRDA 1GY5A 4ZM8A 2OWPA 4HOHA 3LMLA 3LTAA 1GYBA 5KP3A 1TRPA 1BSEA 1UUWB 3JUQA 1VQ63 1UDII 3KZTA 1RGCA 4HM2B 2STDA 4BTYA 4XM4A 3LTBA 2OTJ3 5BVBA 5AIIA 2Y73A 2W04A 1VQM3 4HBRA 1LRAA 1TFOA 1YGWA 2IUJA 3DMCA 1JBTA 2FGTA 3M8CA 4J5GA 2W56B 1S5AA 2CFGA 4CCVA 5DREA 1JBSA 1BOXA 1GS3A 1IVWA 2CFWA 3N9HA 3NBJA 1RGHA 2OOVA 3UL5A 8CHOA 3F7SA 5BU4A 3WODG 1VQO3 1AQZA 4HVNA 1TU5A 4HKVB 1VQN3 3JUPA 2ZDJA 3CPW2 1N5HA 3MSOA 2H0GA 4AKYA 1N9JA 2F99A 1HU9A 4XBYA 3VF1A 2M7OA 1FUTA 3QRDA 2YFLB 3DGMA 1AR0A 4HM1B 1LVNA 3EJVA 5AI1A 4RNZA 1O7MB 1LXEA 1TIJA 1BSAA 1RNBA 2KF6A 1QMAA 5CLKA 1BRKA 3MHEA 1BU4A 3ROBA 3DGLA 1Q9EA 2YFIB 2CG0A 5IEPA 2IYJA 4EYCA 3G16A 3V99A 2Q07A 4O3VA 4EC6A 2W2CA 1VQ53 2UUGC 1IQYA 5G1KA 3FCSB 4XDWA 5DRVA 2P0MA 3B8LA 3X40A 1W4NA 1K8A4 1QJGA 2PNCA 3Q90A 3U97A 1DMQA 1LQMB 1BNSA 3BIRA 1RCLA 1R4CA 3MKIA 1U5OA 2V1LA 1RTUA 5EVHA 5AEUB 1CH0A 1YJN3 4HM4B 5CF1A 1TP6A 2SARA 1LNIA 1UI8A 1V74A 3HX8A 3KKGA 2GSPA 2Y74A 3EX9A 1PU4A 2W03A 3Q3FA 1JBRA 1B20A 1X1WA 5AYRB 3ALAA 1RCKA 4ORLA 3BNEA 3MPHA 3X3YA 2XRXB 3EHCA 4HJLB 1FGRA 1Y4KA 1LNHA 1OH0A 1FUSA 2E2VA 3DXOA 3URPA 1QVG2 1Q40A 3T8NA 3CCV3 4R9LA 3K63A 2K3DA 3WR2A 1BIRA 1W01A 2HMMB 2WGOA 1RGEA 2F56A 2R4IA 1DMMA 2HMLB 2PZVA 1BNRA 1BSDA 1CYVA 3F7XA 1F8NA 4RZMA 1I70A 2MF7A 1YJ93 1NDOB 4U13A 3DUKA 5TGNA 1GSPA 3KN4A 3K5TA 2FXTA 3EE1A 1I3IA 1UGIA 1RGKA 1RHLA 3RGAA 1Z1SA 2BIRA 2I9WA 3GSPA 2CHCA 2HMOB 1BRJA 3KIIA 2MC8A 1IVVA 1UW1A 2Z77A 3DGYA 9RNTA 1UCIA 1US1A 1MWSA 4RNTA 3SLUA 1I2EA 1O7GB 1RGAA 1SARA 1J2BA 3SXXA 5FGOA 3RNTA 1O7NB 1N8R4 3FF2A 2B1XB 2LQVA 1BGSA 1I3FA 2GEYA 3CNXA 3FSDA 4N6NB 1MWUA 1BUJA 2RCDA 3OWYA 3NM2A 1IQ8A 4KT3B 4H3UA 3F8XA 4JRFA 5LC7A 3S28A 1RLSA 3GZBA 4RBNA 1STDA 4HM0B 4QWTA 1VZZA 1TRQA 1QALA 1A2VA 1WMOA 3NBBA 1BANA 2GU3A 4FCJA 2B24B 4NPBA 1WMNA 2CWTA 1T2IA 2FNQA 1IVXA 3G4S3 1RN7A 4HZBB 3AGNA 2IY2A 1UCJA 1YGEA 3X42A 2QA43 1RN1A 1W2ZA 1K41A 1RMSA 3SOYA 4N3VA 3GZYB 3RDEA 2KXGA 5KP4A 3S67A 1I2GA 3J7Yd 3SYUA 1BNIA 5HOHA 1RGFA 3D9RA 4CJNA 1B2XA 1QAFA 2AAEA 2JDIH 2OCTA 3TDGA 1Q814 2KRTA 3Q1CA 3EF8A 1BAOA 3MYTA 4PEJA 1V57A 1BRNL 1UCKA 3CC23 5G2GA 3ZFZA 5HGRA 4FCZA 2XSOB 3CD63 1NNVA 4WP5A 3BU4A 1NB3I 4N6MA 4R4KA 2P05A 1C7HA 2C4BA 1BRHA 2ZHXB 5JPPA 4Q53A 1BRGA 2O3OA 2O9UX 3AHSA 2D1WA 3G713 3CCQ3 1SJWA 5D82A 1IU7A 2JQ5A 2RSXA 3NQZA 3CC43 1GOUA 2BO9B 1OHOA 2Z76A 1UCLA 4I4KA 1ZS7A 2F98A 4HM5B 3D5GA 1UUGB 4HM8B 1B2UA 2A15A 4KFEA 1E3RA 6RNTA 1TJDA 4BTWA 3ZG5A 2BNGA 2WO0A 3OWSA 1K734 7GSPA 3MG2A 2HMJB 5IENA 4GSPA 4FCMA 2K54A 4R80A 4BTXA 1ROAA 2CX0A 1KQS2 1X1XA 1RDSA 1ROVA 3NM7A 1BUQA 1FA3A 3SEDA 4GHOA 3LZAA 2OTL3 1GMPA 1PYLA 1B27A 2XR8B 3HZPA 5AIFA 1BNFA 3G0KA 5I97A 1RNTA 1X1YA 3DZLA 5IG3A 3I0YA 2KF3A 3U1WA 1CEWI 1GD3A 3PXMA 3S27A
chains in the Genus database with same CATH topology
5RNTA 3WR2A 1BIRA 2KF4A 1A2PA 2RBIA 1RGEA 2F56A 4J5KA 1FW7A 1BNEA 1HZ1A 2F5MA 1T2HA 1BNRA 1BSDA 1R4YA 1DETA 1B2SA 1I70A 3AGOA 1GMRA 1I2FA 1I0VA 1FZUA 3D4AA 1GSPA 3KCHA 1I3IA 1MGRA 1RGKA 1RSNA 1MGWA 1ZGXA 1RHLA 2BIRA 2RNTA 3GSPA 2AADA 1B2MA 1BRJA 2KF5A 1BNJA 3DGYA 9RNTA 3HOHA 1B21A 1UCIA 1C54A 4RNTA 1YVSA 1BVIA 1I2EA 1RGAA 1SARA 1TTOA 4HOHA 3RNTA 1TRPA 1BSEA 1BGSA 1I3FA 1BUJA 1B2ZA 1RGCA 1RLSA 1TRQA 1LRAA 1YGWA 1JBTA 1BANA 1IYYA 4J5GA 1JBSA 1I0XA 3A5EA 1T2IA 5GSPA 1BOXA 1G02A 2F4YA 1RGGA 1RGHA 3AGNA 1UCJA 2F5WA 5BU4A 1AQZA 3WHOA 1RN1A 1RMSA 1HYFA 1X1UA 2BU4A 1I2GA 3SYUA 1BNIA 1RGLA 8RNTA 5HOHA 1RGFA 1B2XA 1BSBA 2AAEA 1FYSA 1FUTA 1AY7A 1BAOA 1PY3A 1BSCA 1YNVX 1BRNL 1UCKA 3D5IA 1BNGA 1BSAA 1RNBA 2KF6A 3AHWA 1BRKA 1BU4A 3BU4A 4HAAA 4BIRA 1Q9EA 2C4BA 1BRHA 1BRGA 1DE3A 3AHSA 1LOVA 1GMQA 2ZA4A 1GOUA 1UCLA 2KAAA 3D5GA 5BIRA 1B2UA 1GOVA 6RNTA 1BRSA 1BNSA 2HOHA 3DH2A 3BIRA 1RCLA 1LOWA 7GSPA 4BU4A 1RTUA 4GSPA 1CH0A 1LOYA 2SARA 7RNTA 1BRIA 1RN4A 1LNIA 1X1XA 1RDSA 2GSPA 4GHOA 1JBRA 6GSPA 3Q3FA 1B20A 1X1WA 1I8VA 1GMPA 1PYLA 1B27A 1RCKA 1BNFA 1GOYA 1B3SA 1RNTA 1X1YA 3URPA 1FUSA 2KF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5RNT A;  3WR2 A;  1BIR A;  2KF4 A;  1A2P A;  2RBI A;  1RGE A;  2F56 A;  4J5K A;  1FW7 A;  1BNE A;  1HZ1 A;  2F5M A;  1T2H A;  1BNR A;  1BSD A;  1R4Y A;  1DET A;  1B2S A;  1I70 A;  3AGO A;  1GMR A;  1I2F A;  1I0V A;  1FZU A;  3D4A A;  1GSP A;  3KCH A;  1I3I A;  1MGR A;  1RGK A;  1RSN A;  1MGW A;  1ZGX A;  1RHL A;  2BIR A;  2RNT A;  3GSP A;  2AAD A;  1B2M A;  1BRJ A;  2KF5 A;  1BNJ A;  3DGY A;  9RNT A;  3HOH A;  1B21 A;  1UCI A;  1C54 A;  4RNT A;  1YVS A;  1BVI A;  1I2E A;  1RGA A;  1SAR A;  1TTO A;  4HOH A;  3RNT A;  1TRP A;  1BSE A;  1BGS A;  1I3F A;  1BUJ A;  1B2Z A;  1RGC A;  1RLS A;  1TRQ A;  1LRA A;  1YGW A;  1JBT A;  1BAN A;  1IYY A;  4J5G A;  1JBS A;  1I0X A;  3A5E A;  1T2I A;  5GSP A;  1BOX A;  1G02 A;  2F4Y A;  1RGG A;  1RGH A;  3AGN A;  1UCJ A;  2F5W A;  5BU4 A;  1AQZ A;  3WHO A;  1RN1 A;  1RMS A;  1HYF A;  1X1U A;  2BU4 A;  1I2G A;  3SYU A;  1BNI A;  1RGL A;  8RNT A;  5HOH A;  1RGF A;  1B2X A;  1BSB A;  2AAE A;  1FYS A;  1FUT A;  1AY7 A;  1BAO A;  1PY3 A;  1BSC A;  1YNV X;  1BRN L;  1UCK A;  3D5I A;  1BNG A;  1BSA A;  1RNB A;  2KF6 A;  3AHW A;  1BRK A;  1BU4 A;  3BU4 A;  4HAA A;  4BIR A;  1Q9E A;  2C4B A;  1BRH A;  1BRG A;  1DE3 A;  3AHS A;  1LOV A;  1GMQ A;  2ZA4 A;  1GOU A;  1UCL A;  2KAA A;  3D5G A;  5BIR A;  1B2U A;  1GOV A;  6RNT A;  1BRS A;  1BNS A;  2HOH A;  3DH2 A;  3BIR A;  1RCL A;  1LOW A;  7GSP A;  4BU4 A;  1RTU A;  4GSP A;  1CH0 A;  1LOY A;  2SAR A;  7RNT A;  1BRI A;  1RN4 A;  1LNI A;  1X1X A;  1RDS A;  2GSP A;  4GHO A;  1JBR A;  6GSP A;  3Q3F A;  1B20 A;  1X1W A;  1I8V A;  1GMP A;  1PYL A;  1B27 A;  1RCK A;  1BNF A;  1GOY A;  1B3S A;  1RNT A;  1X1Y A;  3URP A;  1FUS A;  2KF3 A; 
#chains in the Genus database with same CATH topology
 1W02 A;  1VQK 3;  5RNT A;  3BNC A;  4HZ9 B;  1A2P A;  2RBI A;  5JPU A;  5IW9 A;  4XBX A;  3K7C A;  2OOV C;  3S5C A;  1BNE A;  1IT7 A;  2P09 A;  2F5M A;  3D79 A;  1W6C A;  4L8P A;  1R4Y A;  4BL2 A;  2GXF A;  4MEI A;  1N5P A;  3AMO A;  1W6G A;  5M18 A;  4KZ1 A;  1W7C A;  3V92 A;  1RRL A;  3F8H A;  4HYZ A;  3D4A A;  4J9A A;  3WA2 X;  3I56 3;  1MGR A;  1ASK A;  1ZGX A;  4X2H A;  2QEX 3;  2RNT A;  2AAD A;  2GU1 A;  2CK3 H;  3NV0 A;  1NJI 4;  1B2M A;  3HII A;  1N8Q A;  2E2U A;  2XGL A;  4FMA A;  3STD A;  5IG5 A;  2H0H A;  1BNJ A;  3E99 A;  1RJO A;  4NHF A;  4WHA A;  1B21 A;  3B4P A;  3EN1 B;  1SIH A;  1MWT A;  1A90 A;  3LTC A;  4L7K A;  5IER A;  3S29 A;  3X41 A;  2L4V A;  2CFK A;  3GWR A;  4JF8 A;  1B2Z A;  2W9Q A;  3NV0 B;  1JN5 A;  2OQE A;  2CH9 A;  3KFQ C;  1AV4 A;  2IA7 A;  3LOY A;  3FKA A;  3OXA A;  2CKF B;  1Q40 B;  4FMC A;  3UNL A;  3CCM 3;  1JZO A;  3PS8 A;  2RGQ A;  1IYY A;  1OGX A;  3JUO A;  1I0X A;  3A5E A;  5GSP A;  2GBW B;  1G02 A;  2HMK B;  1KC8 4;  1S72 3;  2F5W A;  1LOX A;  5CF2 A;  1IV7 A;  2XFS A;  2W6J H;  1JJ2 2;  3FZW A;  3WHO A;  4CPK A;  1JN5 B;  4LGQ A;  4BL3 A;  1GD4 A;  1HYF A;  2BU4 A;  3CU3 A;  3EC9 A;  1QAK A;  4HM3 B;  1L5G B;  3OW2 2;  5M19 A;  1YJW 3;  4O8S A;  4TX4 A;  4NRE A;  4EBG A;  1RGL A;  5AIH A;  8RNT A;  1OUN A;  1A67 A;  1YI2 3;  1M9G A;  1BSB A;  3OWU A;  4O2H A;  1FYS A;  4KFD A;  1AY7 A;  3LH4 A;  2QGU A;  1M1X B;  1PY3 A;  1ZO2 A;  3FG3 A;  2E2T A;  1BNG A;  3A76 A;  3FH1 A;  3AHW A;  3LXU X;  4IPB A;  5CXO A;  1ULJ B;  4KFF A;  4MMZ B;  4OVM A;  3DGN A;  2CX1 A;  3N54 B;  1OF5 A;  1RKY A;  4GL6 A;  3IPT A;  1GMQ A;  1KWI A;  3N8B A;  3X3X A;  3G8Z A;  2CC3 A;  3NXJ A;  4LMI A;  2CIU A;  4OK0 A;  5IEO A;  3JUN A;  3F14 A;  2XFT A;  5BIR A;  2IUK A;  5EQL A;  3WOE B;  1WTH A;  3JUM A;  2Z7A A;  1OF5 B;  4RNY A;  1BRS A;  5AEW B;  7STD A;  1EG9 B;  2HOH A;  3DH2 A;  3EBY A;  1KSI A;  2Z6B A;  2ML5 A;  3UL6 A;  1EUI C;  1IDP A;  2R41 A;  4G1M B;  3VSY A;  3SX1 A;  1SII A;  1W00 A;  1VQP 3;  3ER7 A;  3NX0 A;  1BRI A;  3MG1 A;  4LSO A;  7RNT A;  5EEO A;  4AKZ A;  4STD A;  5FW5 A;  5CK6 A;  5A0O B;  2UX0 A;  3O8Y A;  1JB2 A;  1E3V A;  1OAC A;  3WMD A;  3NHX A;  3CCR 3;  3FG4 A;  4LEH A;  1O7P B;  1W5Z A;  2HMN B;  3QK9 A;  5JBS A;  1WNH A;  5ELJ A;  2WGQ A;  3IMA B;  1JZD A;  2D42 A;  4IIA A;  1Q7Y 4;  2SBL A;  3Q2P A;  2H0I A;  3FGY A;  3V98 A;  2W56 A;  2INX A;  3H51 A;  3MWZ A;  2IMJ A;  3FF0 A;  3WDG B;  1IVU A;  2UGI A;  1WQL B;  5IG0 A;  2BT3 A;  3T8U A;  2QIY A;  1T2H A;  4MMY B;  4WFO A;  5LC6 A;  3CCL 3;  5AIG A;  3LT8 A;  1MWR A;  2XGN A;  4LZI A;  5AYS C;  1GMR A;  1I2F A;  1I0V A;  3PGB A;  4X2O A;  3HI7 A;  1IK3 A;  4FMD A;  3CMA 3;  3KCH A;  1JRQ A;  3DM8 A;  3UB1 A;  3KSP A;  1SPU A;  1IT8 A;  4O02 B;  3KSE D;  1RSN A;  2WOH A;  1JKG A;  3CNM A;  1CQS A;  3K0Z A;  4FMB A;  4EV2 A;  1OCV A;  5IG4 A;  4XBT A;  3FG1 A;  3L0R A;  3B4O A;  2F86 B;  4XDV A;  1QVF 2;  4N6T A;  3I55 3;  1VQ8 3;  4N6L A;  5STD A;  3ZG0 A;  1T5Y A;  1BVI A;  1O7W B;  1TTO A;  2KCD A;  4EW5 A;  1K9M 4;  4ILF A;  4R9K A;  1DMN A;  2XEP A;  1HKX A;  1JKG B;  4CDL A;  1Q42 A;  3DGO A;  1WMP A;  3OV4 A;  4HM7 B;  1FGM A;  1NO3 A;  1Q82 4;  1VQ9 3;  3FLJ A;  1FGT A;  2P38 A;  4XB5 A;  3DY5 A;  1D6U A;  3PZW A;  3HK4 A;  5G1L A;  3T0U A;  2F4Y A;  1RGG A;  3F9S A;  2CG1 A;  1OPY A;  2CW9 A;  2BHM A;  3CXC 2;  3MG3 A;  1X1U A;  2XH9 A;  1VQQ A;  1ZX2 A;  3AMO B;  1G0T A;  1Q86 4;  1E97 A;  1U8C B;  1UI7 A;  3EQQ B;  1TUH A;  3HIG A;  2CFL A;  1MNL A;  3X3Z A;  2CWV A;  4L8O A;  1BSC A;  1YNV X;  4K1U A;  4K61 A;  1OGZ A;  3D5I A;  1EQK A;  1O7H B;  5KP1 A;  1VQ7 3;  2GBX B;  4MMX B;  4HAA A;  4IT7 A;  4WYK A;  1DVC A;  2P0X A;  4BIR A;  1T3B A;  1CYU A;  4WWU C;  2C10 A;  3WOF B;  3CCS 3;  2ZL8 A;  3GAX A;  3JVC A;  2CWU A;  3OX9 A;  1LOV A;  4HM6 B;  1DE3 A;  4N6U A;  2ZA4 A;  3EBT A;  1D6Y A;  3WA3 A;  3RGR A;  1EEJ A;  4I5Q A;  1NWW A;  1OHS A;  1TFK A;  5D83 A;  3BLZ A;  2KAA A;  4KVH A;  1N9E A;  2YX9 A;  1STF I;  1YHQ 3;  1ULI B;  3ECF A;  3G6E 3;  4WYK B;  1GOV A;  3NQY A;  3EN8 A;  1MOL A;  3B7C A;  3CCU 3;  2ML6 A;  3LTD A;  1PFP A;  1JB5 A;  1LOW A;  4DKI A;  3CCE 3;  1DVD A;  1FGQ A;  4BU4 A;  4K1V A;  1AVL A;  2K0M A;  5IF6 A;  3BND A;  4EV5 A;  1LOY A;  1V58 A;  3BB9 A;  3K9M C;  1RN4 A;  3KE7 A;  1EKM A;  2BMQ B;  2XSH B;  1UUV B;  1YVB I;  6GSP A;  3CPO A;  3EB8 A;  1RRH A;  3BNB A;  4FR9 A;  1M1K 4;  1I8V A;  2LYX A;  1G96 A;  3UJM A;  1DYU A;  1GOY A;  1B3S A;  1VQL 3;  2OQE C;  2WOF A;  1FUW A;  4GB5 A;  4H61 A;  1IV9 A;  3D3L A;  3GZX B;  6STD A;  1W6Y A;  2CFD A;  3VGN A;  2W0Q A;  5ELU A;  2J8X B;  4N6V 0;  3NUV A;  3H3H A;  4MJD A;  1ISK A;  1EA2 A;  1W2B 2;  3PCR A;  2BMR B;  2KF4 A;  1SQW A;  1LQG C;  2C11 A;  2YFJ B;  3F40 A;  4J5K A;  1FGO A;  1FW7 A;  1HZ1 A;  1DET A;  1B2S A;  1JV2 B;  1IQX A;  1Q7H A;  2W9P A;  4AEQ A;  2BMO B;  4J8T A;  3AGO A;  1FZU A;  1GY6 A;  2XF3 A;  3PYJ A;  1NB5 I;  1YIT 3;  5M1A A;  1JB4 A;  1D6Z A;  5D81 A;  1JNQ A;  4OUQ A;  2RFR A;  3NBR A;  1NU3 A;  3CC7 3;  1KD1 4;  1MGW A;  1GY7 A;  2GEX A;  3CCJ 3;  3LYG A;  1OHP A;  4N6O B;  4EXR A;  2L1S A;  4K90 B;  4LYL B;  3SVA A;  1YIJ 3;  1K28 A;  1A2K A;  2KF5 A;  3PCS A;  3SOA A;  5BXQ A;  3CME 3;  1VQ4 3;  3IJE B;  3GZR A;  3HOH A;  4R1K A;  1AVK A;  1M90 4;  3LT9 A;  1C54 A;  1YVS A;  1UGH I;  3GRD A;  1GY5 A;  4ZM8 A;  2OWP A;  4HOH A;  3LML A;  3LTA A;  1GYB A;  5KP3 A;  1TRP A;  1BSE A;  1UUW B;  3JUQ A;  1VQ6 3;  1UDI I;  3KZT A;  1RGC A;  4HM2 B;  2STD A;  4BTY A;  4XM4 A;  3LTB A;  2OTJ 3;  5BVB A;  5AII A;  2Y73 A;  2W04 A;  1VQM 3;  4HBR A;  1LRA A;  1TFO A;  1YGW A;  2IUJ A;  3DMC A;  1JBT A;  2FGT A;  3M8C A;  4J5G A;  2W56 B;  1S5A A;  2CFG A;  4CCV A;  5DRE A;  1JBS A;  1BOX A;  1GS3 A;  1IVW A;  2CFW A;  3N9H A;  3NBJ A;  1RGH A;  2OOV A;  3UL5 A;  8CHO A;  3F7S A;  5BU4 A;  3WOD G;  1VQO 3;  1AQZ A;  4HVN A;  1TU5 A;  4HKV B;  1VQN 3;  3JUP A;  2ZDJ A;  3CPW 2;  1N5H A;  3MSO A;  2H0G A;  4AKY A;  1N9J A;  2F99 A;  1HU9 A;  4XBY A;  3VF1 A;  2M7O A;  1FUT A;  3QRD A;  2YFL B;  3DGM A;  1AR0 A;  4HM1 B;  1LVN A;  3EJV A;  5AI1 A;  4RNZ A;  1O7M B;  1LXE A;  1TIJ A;  1BSA A;  1RNB A;  2KF6 A;  1QMA A;  5CLK A;  1BRK A;  3MHE A;  1BU4 A;  3ROB A;  3DGL A;  1Q9E A;  2YFI B;  2CG0 A;  5IEP A;  2IYJ A;  4EYC A;  3G16 A;  3V99 A;  2Q07 A;  4O3V A;  4EC6 A;  2W2C A;  1VQ5 3;  2UUG C;  1IQY A;  5G1K A;  3FCS B;  4XDW A;  5DRV A;  2P0M A;  3B8L A;  3X40 A;  1W4N A;  1K8A 4;  1QJG A;  2PNC A;  3Q90 A;  3U97 A;  1DMQ A;  1LQM B;  1BNS A;  3BIR A;  1RCL A;  1R4C A;  3MKI A;  1U5O A;  2V1L A;  1RTU A;  5EVH A;  5AEU B;  1CH0 A;  1YJN 3;  4HM4 B;  5CF1 A;  1TP6 A;  2SAR A;  1LNI A;  1UI8 A;  1V74 A;  3HX8 A;  3KKG A;  2GSP A;  2Y74 A;  3EX9 A;  1PU4 A;  2W03 A;  3Q3F A;  1JBR A;  1B20 A;  1X1W A;  5AYR B;  3ALA A;  1RCK A;  4ORL A;  3BNE A;  3MPH A;  3X3Y A;  2XRX B;  3EHC A;  4HJL B;  1FGR A;  1Y4K A;  1LNH A;  1OH0 A;  1FUS A;  2E2V A;  3DXO A;  3URP A;  1QVG 2;  1Q40 A;  3T8N A;  3CCV 3;  4R9L A;  3K63 A;  2K3D A;  3WR2 A;  1BIR A;  1W01 A;  2HMM B;  2WGO A;  1RGE A;  2F56 A;  2R4I A;  1DMM A;  2HML B;  2PZV A;  1BNR A;  1BSD A;  1CYV A;  3F7X A;  1F8N A;  4RZM A;  1I70 A;  2MF7 A;  1YJ9 3;  1NDO B;  4U13 A;  3DUK A;  5TGN A;  1GSP A;  3KN4 A;  3K5T A;  2FXT A;  3EE1 A;  1I3I A;  1UGI A;  1RGK A;  1RHL A;  3RGA A;  1Z1S A;  2BIR A;  2I9W A;  3GSP A;  2CHC A;  2HMO B;  1BRJ A;  3KII A;  2MC8 A;  1IVV A;  1UW1 A;  2Z77 A;  3DGY A;  9RNT A;  1UCI A;  1US1 A;  1MWS A;  4RNT A;  3SLU A;  1I2E A;  1O7G B;  1RGA A;  1SAR A;  1J2B A;  3SXX A;  5FGO A;  3RNT A;  1O7N B;  1N8R 4;  3FF2 A;  2B1X B;  2LQV A;  1BGS A;  1I3F A;  2GEY A;  3CNX A;  3FSD A;  4N6N B;  1MWU A;  1BUJ A;  2RCD A;  3OWY A;  3NM2 A;  1IQ8 A;  4KT3 B;  4H3U A;  3F8X A;  4JRF A;  5LC7 A;  3S28 A;  1RLS A;  3GZB A;  4RBN A;  1STD A;  4HM0 B;  4QWT A;  1VZZ A;  1TRQ A;  1QAL A;  1A2V A;  1WMO A;  3NBB A;  1BAN A;  2GU3 A;  4FCJ A;  2B24 B;  4NPB A;  1WMN A;  2CWT A;  1T2I A;  2FNQ A;  1IVX A;  3G4S 3;  1RN7 A;  4HZB B;  3AGN A;  2IY2 A;  1UCJ A;  1YGE A;  3X42 A;  2QA4 3;  1RN1 A;  1W2Z A;  1K41 A;  1RMS A;  3SOY A;  4N3V A;  3GZY B;  3RDE A;  2KXG A;  5KP4 A;  3S67 A;  1I2G A;  3J7Y d;  3SYU A;  1BNI A;  5HOH A;  1RGF A;  3D9R A;  4CJN A;  1B2X A;  1QAF A;  2AAE A;  2JDI H;  2OCT A;  3TDG A;  1Q81 4;  2KRT A;  3Q1C A;  3EF8 A;  1BAO A;  3MYT A;  4PEJ A;  1V57 A;  1BRN L;  1UCK A;  3CC2 3;  5G2G A;  3ZFZ A;  5HGR A;  4FCZ A;  2XSO B;  3CD6 3;  1NNV A;  4WP5 A;  3BU4 A;  1NB3 I;  4N6M A;  4R4K A;  2P05 A;  1C7H A;  2C4B A;  1BRH A;  2ZHX B;  5JPP A;  4Q53 A;  1BRG A;  2O3O A;  2O9U X;  3AHS A;  2D1W A;  3G71 3;  3CCQ 3;  1SJW A;  5D82 A;  1IU7 A;  2JQ5 A;  2RSX A;  3NQZ A;  3CC4 3;  1GOU A;  2BO9 B;  1OHO A;  2Z76 A;  1UCL A;  4I4K A;  1ZS7 A;  2F98 A;  4HM5 B;  3D5G A;  1UUG B;  4HM8 B;  1B2U A;  2A15 A;  4KFE A;  1E3R A;  6RNT A;  1TJD A;  4BTW A;  3ZG5 A;  2BNG A;  2WO0 A;  3OWS A;  1K73 4;  7GSP A;  3MG2 A;  2HMJ B;  5IEN A;  4GSP A;  4FCM A;  2K54 A;  4R80 A;  4BTX A;  1ROA A;  2CX0 A;  1KQS 2;  1X1X A;  1RDS A;  1ROV A;  3NM7 A;  1BUQ A;  1FA3 A;  3SED A;  4GHO A;  3LZA A;  2OTL 3;  1GMP A;  1PYL A;  1B27 A;  2XR8 B;  3HZP A;  5AIF A;  1BNF A;  3G0K A;  5I97 A;  1RNT A;  1X1Y A;  3DZL A;  5IG3 A;  3I0Y A;  2KF3 A;  3U1W A;  1CEW I;  1GD3 A;  3PXM A;  3S27 A; 
#chains in the Genus database with same CATH homology
 5RNT A;  3WR2 A;  1BIR A;  2KF4 A;  1A2P A;  2RBI A;  1RGE A;  2F56 A;  4J5K A;  1FW7 A;  1BNE A;  1HZ1 A;  2F5M A;  1T2H A;  1BNR A;  1BSD A;  1R4Y A;  1DET A;  1B2S A;  1I70 A;  3AGO A;  1GMR A;  1I2F A;  1I0V A;  1FZU A;  3D4A A;  1GSP A;  3KCH A;  1I3I A;  1MGR A;  1RGK A;  1RSN A;  1MGW A;  1ZGX A;  1RHL A;  2BIR A;  2RNT A;  3GSP A;  2AAD A;  1B2M A;  1BRJ A;  2KF5 A;  1BNJ A;  3DGY A;  9RNT A;  3HOH A;  1B21 A;  1UCI A;  1C54 A;  4RNT A;  1YVS A;  1BVI A;  1I2E A;  1RGA A;  1SAR A;  1TTO A;  4HOH A;  3RNT A;  1TRP A;  1BSE A;  1BGS A;  1I3F A;  1BUJ A;  1B2Z A;  1RGC A;  1RLS A;  1TRQ A;  1LRA A;  1YGW A;  1JBT A;  1BAN A;  1IYY A;  4J5G A;  1JBS A;  1I0X A;  3A5E A;  1T2I A;  5GSP A;  1BOX A;  1G02 A;  2F4Y A;  1RGG A;  1RGH A;  3AGN A;  1UCJ A;  2F5W A;  5BU4 A;  1AQZ A;  3WHO A;  1RN1 A;  1RMS A;  1HYF A;  1X1U A;  2BU4 A;  1I2G A;  3SYU A;  1BNI A;  1RGL A;  8RNT A;  5HOH A;  1RGF A;  1B2X A;  1BSB A;  2AAE A;  1FYS A;  1FUT A;  1AY7 A;  1BAO A;  1PY3 A;  1BSC A;  1YNV X;  1BRN L;  1UCK A;  3D5I A;  1BNG A;  1BSA A;  1RNB A;  2KF6 A;  3AHW A;  1BRK A;  1BU4 A;  3BU4 A;  4HAA A;  4BIR A;  1Q9E A;  2C4B A;  1BRH A;  1BRG A;  1DE3 A;  3AHS A;  1LOV A;  1GMQ A;  2ZA4 A;  1GOU A;  1UCL A;  2KAA A;  3D5G A;  5BIR A;  1B2U A;  1GOV A;  6RNT A;  1BRS A;  1BNS A;  2HOH A;  3DH2 A;  3BIR A;  1RCL A;  1LOW A;  7GSP A;  4BU4 A;  1RTU A;  4GSP A;  1CH0 A;  1LOY A;  2SAR A;  7RNT A;  1BRI A;  1RN4 A;  1LNI A;  1X1X A;  1RDS A;  2GSP A;  4GHO A;  1JBR A;  6GSP A;  3Q3F A;  1B20 A;  1X1W A;  1I8V A;  1GMP A;  1PYL A;  1B27 A;  1RCK A;  1BNF A;  1GOY A;  1B3S A;  1RNT A;  1X1Y A;  3URP A;  1FUS A;  2KF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...