1QJGA

Crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni in complex with equilenin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords KETOSTEROID ISOMERASE
publication title Crystal Structure of Delta-5-3-Ketosteroid Isomerase from Pseudomonas Testosteroni in Complex with Equilenin Settles the Correct Hydrogen Scheme for Transition-State Stabilization
pubmed doi rcsb
source organism Pseudomonas testosteroni
total genus 36
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1qjgA00
1K41A 1OH0A 4N3VA 1O7HB 2UX0A 3SOYA 1HKXA 4H3UA 4KVHA 3K0ZA 5CLKA 5CK6A 2QGUA 3OWSA 1VZZA 3EN1B 3OXAA 5BVBA 1A2KA 2Z76A 3HZPA 4HZ9B 5AEUB 3RGAA 1DMQA 3DXOA 5CF2A 1JN5B 3JUPA 1OCVA 3F40A 4K1UA 5D83A 4HZBB 3F8HA 5IEOA 1E97A 4HM7B 3IPTA 3OV4A 2I9WA 3KSPA 1Q42A 4FCJA 4X2HA 3I0YA 5FW5A 5DREA 4L8PA 3E99A 4I4KA 1CQSA 5AIFA 1OUNA 1DMMA 4L8OA 5EVHA 4HM4B 3H51A 3F9SA 3T8NA 3NXJA 2HMMB 3JUQA 1Q40B 3HK4A 3MG1A 1GY6A 6STDA 3DMCA 2XR8B 3BB9A 1OPYA 4LGQA 4X2OA 1GS3A 4WYKB 3MG3A 4GB5A 2INXA 3GZYB 2YFLB 3GWRA 3GRDA 3EBYA 1W00A 3OWYA 1OHPA 3SOAA 3EJVA 5IG5A 1ZO2A 1EA2A 2R4IA 2XSOB 4PEJA 1Q40A 3OX9A 3MHEA 3B4PA 4HM8B 5AIHA 1S5AA 5KP1A 2JQ5A 3G8ZA 3LYGA 3FLJA 3MKIA 3F7SA 1ZX2A 4FCMA 1OHSA 3F14A 1ULIB 5JPUA 4HKVB 1GY5A 3EQQB 3STDA 3DZLA 2BMQB 4LMIA 3D9RA 3NUVA 2CKFB 1U5OA 4RZMA 4J9AA 3T8UA 4OVMA 2STDA 3CNMA 4CDLA 1Z1SA 5G2GA 2F99A 1EG9B 4XB5A 3FSDA 1UUWB 3H3HA 4LEHA 4XDVA 5IG0A 3MSOA 3EN8A 3RGRA 5AIIA 3JUNA 2HMOB 3FGYA 3CNXA 3A76A 4XBTA 1O7PB 4HM0B 1ULJB 3MG2A 4R9LA 2K54A 3FH1A 3UNLA 3FF0A 3LZAA 1JB4A 4HM1B 4HVNA 3K7CA 2HMNB 2GEXA 5IF6A 1IDPA 4XDWA 2RCDA 1OF5B 3HX8A 1JN5A 1E3RA 3EF8A 3MYTA 1W01A 1JKGB 3ER7A 5AIGA 2RGQA 3CPOA 2XSHB 3VSYA 5AEWB 5D81A 2B1XB 5IERA 5TGNA 3EHCA 4WP5A 2YFJB 1SJWA 1GYBA 3GZBA 2QIYA 3VGNA 1AR0A 1O7NB 4HM6B 3JUOA 4OUQA 5IENA 4STDA 4J8TA 2HMKB 1BUQA 4XM4A 1DMNA 3FF2A 3F7XA 2HMJB 7STDA 1O7MB 5BXQA 2RFRA 1QJGA 2BNGA 3ROBA 1JKGA 2W2CA 2BMOB 3SEDA 2GEYA 4WYKA 3FKAA 1NU3A 2BMRB 2Z7AA 1GY7A 4L7KA 4WWUC 1JB2A 1OHOA 1UUVB 3CU3A 4ORLA 3WMDA 1E3VA 3EC9A 1STDA 3G0KA 4HJLB 4R9KA 1O7GB 2OWPA 3G16A 3M8CA 3ECFA 2GBXB 1NWWA 5KP4A 3KKGA 2IMJA 3EBTA 1OGXA 4XBXA 3NM2A 3OWUA 3B7CA 4R1KA 5IG3A 4XBYA 1O7WB 1TUHA 3S5CA 5JPPA 3F8XA 5AI1A 2XRXB 2CHCA 2PZVA 1ISKA 3B8LA 3Q90A 4HM3B 2F86B 3NV0B 5DRVA 2A15A 1W02A 3B4OA 5CF1A 1QMAA 1JB5A 4HM5B 2F98A 5STDA 1W6YA 5HGRA 5KP3A 5CXOA 3BLZA 3KZTA 3GZXB 3UJMA 3DUKA 1TP6A 1WQLB 2B24B 1OGZA 3NHXA 3FZWA 3EX9A 3KE7A 4MJDA 3NBRA 2Z77A 4U13A 1NDOB 3NV0A 2HMLB 4K1VA 1C7HA 4Q53A 2GXFA 3DM8A 3JUMA 4HM2B 5IG4A 5D82A 1OF5A 2GBWB 2YFIB 8CHOA 5IEPA 3GZRA 1ASKA 4IIAA
chains in the Genus database with same CATH superfamily
4K90B 4N6LA 1FUTA 1K41A 1OH0A 4N3VA 1QALA 1O7HB 4KZ1A 5BU4A 3VF1A 3J7Yd 4KFEA 1TFKA 2UX0A 3SOYA 3WODG 1YHQ3 2P0MA 2RNTA 1I2FA 1GSPA 1ZGXA 2KXGA 4EW5A 1HKXA 4R4KA 1BSBA 1FGRA 4H3UA 3I563 1BOXA 1RN1A 2YX9A 2KCDA 2SARA 1SIIA 1T3BA 2C4BA 1BNEA 4FMCA 1B27A 2UUGC 2E2UA 4EC6A 3FCSB 1BANA 4KVHA 1PU4A 3K0ZA 1UI7A 5CLKA 5CK6A 2QGUA 3OWSA 1WTHA 1VZZA 3EN1B 3OXAA 5BVBA 1RJOA 4RNZA 2XGNA 1A2KA 2Z76A 3HZPA 2FGTA 5GSPA 2MF7A 2W6JH 1T2IA 2E2VA 1I0XA 3NBBA 4HZ9B 5AEUB 2W56B 2ZL8A 4FMAA 2CC3A 1GMPA 3RGAA 5RNTA 3AMOA 3QK9A 1I8VA 1DMQA 1W6CA 3DXOA 5CF2A 2CFKA 1JN5B 2LQVA 3JUPA 3CC23 4G1MB 1OCVA 3F40A 4K1UA 5D83A 4HZBB 3F8HA 2IUJA 1LXEA 2WGQA 3NX0A 5IEOA 2IYJA 1RSNA 1BU4A 1E97A 4HM7B 3IPTA 1AV4A 1A67A 3OV4A 1QVF2 5FGOA 3WA2X 3U1WA 2I9WA 1VQM3 2RBIA 3KSPA 1DVCA 1N5PA 1Q42A 3S67A 2O9UX 4FCJA 1B3SA 1IV7A 1W4NA 1LOWA 1V57A 3PGBA 3LTCA 1MGWA 4IPBA 4X2HA 4WHAA 3SLUA 2WOHA 3I0YA 1B2XA 5FW5A 5DREA 4L8PA 2C11A 3D4AA 3E99A 3CCJ3 4I4KA 1CQSA 1RGGA 5AIFA 1QAKA 5ELJA 1V74A 1FW7A 2FNQA 1B2MA 3CMA3 1D6UA 1OUNA 1RCKA 1FUSA 3SVAA 1DMMA 1B2UA 4L8OA 5EVHA 4HM4B 3H51A 3OW22 1FGMA 4K61A 1BNFA 3F9SA 3T8NA 1HZ1A 9RNTA 2AADA 3NXJA 2E2TA 3PYJA 4J5GA 5ELUA 2W56A 1WNHA 2CFLA 3X3XA 3D5GA 3S27A 2AAEA 1OACA 5BIRA 2CWUA 2HMMB 3JUQA 1Q40B 3S28A 1JNQA 6GSPA 3DH2A 3HK4A 3NQZA 1EQKA 1S723 1X1XA 1BNGA 1RKYA 1IVWA 3PZWA 3MG1A 2BO9B 2L4VA 1Q7Y4 1GY6A 6STDA 3DMCA 2D42A 1I3IA 2XR8B 1L5GB 1DETA 2D1WA 1MOLA 2FXTA 3BB9A 1J2BA 2CW9A 4CCVA 4BTXA 3ZG5A 1JBSA 1OPYA 4FMBA 2KRTA 4OK0A 3K9MC 4LGQA 1RRLA 3MPHA 4X2OA 3KN4A 1GS3A 4WYKB 3LTAA 1RGEA 3MG3A 1C54A 1IVXA 4GB5A 2INXA 3U97A 2W04A 3GZYB 3KFQC 3LT8A 2YFLB 2MC8A 4I5QA 3WR2A 3GWRA 3GRDA 3EBYA 3V92A 1W00A 2CH9A 3OWYA 1BIRA 1BRGA 1I2EA 2KF4A 4O02B 2C10A 1OHPA 1STFI 2M7OA 3SOAA 3EJVA 2P0XA 4HOHA 3UL5A 4BIRA 5IG5A 4JF8A 1ZO2A 3N8BA 1EA2A 5LC7A 2R4IA 1YGEA 2XSOB 4PEJA 1YNVX 1UUGB 1Q40A 1X1UA 4MEIA 1VQ53 3OX9A 1DE3A 3G6E3 3MHEA 2IA7A 3B4PA 1UI8A 3G713 4HM8B 1RGCA 4GL6A 5LC6A 1UGHI 1BSDA 1G02A 5AIHA 3X42A 4J5KA 1S5AA 1R4CA 5KP1A 2OQEC 2JQ5A 1Q864 1N9EA 2F56A 4DKIA 1AVLA 3G8ZA 1U8CB 1W2ZA 2CFGA 2ML6A 3FLJA 3LYGA 3MKIA 3F7SA 1ZX2A 1M1XB 2PNCA 3CXC2 4FCMA 1OHSA 3F14A 1RGHA 4JRFA 2BT3A 1QVG2 2H0GA 1VQ73 1ULIB 5JPUA 4HKVB 1BSEA 1RDSA 1GY5A 3Q3FA 1B2ZA 1QAFA 1I0VA 3EQQB 3N54B 3STDA 1HU9A 3DZLA 2CFDA 3ZFZA 4ZM8A 3CCQ3 1BNIA 2BMQB 1VQL3 3WOFB 1PY3A 2W03A 1I70A 4LMIA 1JV2B 3D9RA 1YIJ3 3NUVA 2XFTA 2CKFB 1VQK3 1U5OA 4RZMA 2CWVA 4RBNA 1RGKA 4QWTA 4J9AA 3ALAA 3T8UA 4OVMA 1IYYA 1MWSA 3V98A 1CYVA 2STDA 1YGWA 3PS8A 1RTUA 2P09A 3A5EA 4N6V0 1K8A4 2P05A 3CNMA 4AEQA 4CDLA 1VQO3 1X1YA 1Z1SA 2F99A 4N6NB 5G2GA 7RNTA 1FA3A 1EG9B 4R80A 2L1SA 3X40A 4XB5A 2K3DA 1CYUA 3FSDA 1UUWB 3H3HA 4LEHA 1D6YA 4EV5A 2OOVC 3X3ZA 1T2HA 1TRPA 1WMOA 4XDVA 5IG0A 3LTDA 3MSOA 1KQS2 3EN8A 2F4YA 3RGRA 5AIIA 4MMZB 3X41A 3JUNA 3HIIA 2HMOB 1Q7HA 2WGOA 2RSXA 3T0UA 3FGYA 1K734 1NJI4 3CNXA 3UL6A 1HYFA 3CC73 1BNRA 2GU3A 3LMLA 2W0QA 3A76A 1N8QA 4XBTA 2KF5A 4RNYA 1O7PB 1GD3A 3DGYA 1US1A 4HM0B 8RNTA 1PYLA 2JDIH 1K9M4 1ULJB 1FGOA 1BRJA 1LNHA 2CX1A 3MG2A 4R9LA 5M18A 3CCU3 2K54A 1RRHA 3FH1A 3UNLA 1JRQA 4O2HA 3FF0A 3LZAA 1JB4A 2OCTA 4HM1B 4NHFA 4HVNA 1FYSA 3K7CA 2HMNB 4EV2A 2GEXA 1UW1A 5IF6A 1IDPA 2CG0A 4BL2A 5AYSC 5I97A 3KIIA 4XDWA 2RCDA 1NNVA 3SX1A 3URPA 3GAXA 1OF5B 3HX8A 1N9JA 1JN5A 1E3RA 4BL3A 2OQEA 1FZUA 4FMDA 1LQMB 3BNEA 1I2GA 1K28A 5IW9A 2Y74A 3EF8A 3MYTA 3CPW2 2O3OA 4WFOA 1Q824 5EQLA 1W01A 1JKGB 1BAOA 1RGLA 3ER7A 5AIGA 1W2B2 2RGQA 1UGIA 4N6MA 3CPOA 1JZDA 1AY7A 4HAAA 2CK3H 2XSHB 2BHMA 3VSYA 4LZIA 5AEWB 3N9HA 3LXUX 5D81A 5G1LA 4O8SA 1KSIA 2B1XB 5IERA 4AKZA 5TGNA 1BRSA 3EHCA 4WP5A 2YFJB 1A2PA 1RHLA 1W6GA 1BSAA 5EEOA 1YJ93 1SJWA 1JBTA 1GYBA 1YI23 3GZBA 3FG3A 2QIYA 1Q814 3VGNA 1AR0A 1GOYA 1UCJA 1O7NB 3DY5A 2KF6A 3JUOA 4HM6B 3DGMA 1IT7A 4OUQA 1W7CA 4STDA 2GSPA 1NB3I 5IENA 4J8TA 3CCV3 2HMKB 1BUQA 4XM4A 3AGOA 1DMNA 3FF2A 1TIJA 3F7XA 3PXMA 3CC43 4BTYA 2HMJB 1IT8A 1G96A 2OOVA 4EYCA 1A90A 3EB8A 1B21A 7STDA 1SARA 3CCL3 1IVVA 1TTOA 1O7MB 1N5HA 3DGOA 3SXXA 5BXQA 1FGTA 1BGSA 2RFRA 1QJGA 1SPUA 1IV9A 2BNGA 3DGLA 1B2SA 1LNIA 3LT9A 4HBRA 4KFDA 2XH9A 3Q2PA 3V99A 1T5YA 1M9GA 3ROBA 1D6ZA 3HI7A 3KCHA 1MWRA 3BNBA 3GSPA 1BNJA 1JKGA 2W2CA 5JBSA 2BMOB 1EUIC 1IU7A 2KF3A 1SQWA 2ZHXB 2F5MA 1RNTA 3Q1CA 3MWZA 1VQ63 1DVDA 3SEDA 1YIT3 3HOHA 4LSOA 3BIRA 1TJDA 1VQN3 2GEYA 4N6TA 4TX4A 4WYKA 1UCKA 3FKAA 2ML5A 1VQ83 2SBLA 1NU3A 1G0TA 2BMRB 2XEPA 2Z7AA 1GY7A 4L7KA 1AQZA 3JVCA 2CIUA 2ZA4A 4WWUC 1JB2A 1UDII 1OHOA 1ROVA 1UUVB 3CU3A 4ORLA 3LOYA 3SYUA 2BIRA 1E3VA 3WMDA 3EC9A 3IMAB 1MWUA 1VQ93 1STDA 1CH0A 3AGNA 3FG1A 3G0KA 1GD4A 1WMNA 4HJLB 4ILFA 1ZS7A 4R9KA 3RDEA 1O7GB 1IQXA 1GMQA 2OWPA 3WA3A 3CD63 2F5WA 3G16A 3M8CA 2GBXB 3ECFA 3CCS3 1WMPA 3DGNA 1NWWA 2XGLA 2CWTA 4N6OB 1JJ22 2GU1A 3LTBA 4EXRA 5KP4A 3FG4A 1LVNA 3KKGA 3WOEB 1KD14 1JBRA 1W5ZA 3KSED 3NQYA 2P38A 3PCSA 3HIGA 2IMJA 3EBTA 1VQP3 1OGXA 3BNDA 3NM2A 3K63A 4XBXA 3K5TA 2UGIA 3OWUA 4N6UA 1B20A 3B7CA 2HOHA 4MMYB 4R1KA 5IG3A 1NB5I 4XBYA 1O7WB 4BU4A 1TUHA 3S5CA 2XF3A 2H0HA 5JPPA 1A2VA 3AHSA 5G1KA 3F8XA 5AI1A 4KFFA 1RMSA 3TDGA 2XRXB 4GHOA 4H61A 2CHCA 1EEJA 2KAAA 2PZVA 1GOUA 1ISKA 3B8LA 4BTWA 4KT3B 1YJW3 1X1WA 1N8R4 3Q90A 2LYXA 1JZOA 2Q07A 1M1K4 1KC84 3NM7A 4HM3B 1Q9EA 1UCIA 4O3VA 2QEX3 2V1LA 3S29A 2WOFA 1IQ8A 2F86B 1V58A 3EE1A 3NBJA 5M1AA 2OTL3 1BRKA 1BRIA 2OTJ3 3NV0B 3X3YA 2J8XB 2CX0A 2K0MA 4FR9A 2Z6BA 5DRVA 2A15A 4RNTA 1LOYA 7GSPA 3CCE3 1W02A 1VQ43 3B4OA 2Y73A 3LH4A 5CF1A 1Y4KA 1QMAA 1TRQA 2CFWA 1JB5A 1RGFA 1FUWA 4CJNA 4HM5B 1MWTA 1YVSA 2F98A 3RNTA 4EBGA 4LYLB 5STDA 1YVBI 1W6YA 1FGQA 1R4YA 5HGRA 5KP3A 1BRNL 1NO3A 3QRDA 5CXOA 2CG1A 1EKMA 1BRHA 3BLZA 3WDGB 1PFPA 2R41A 2ZDJA 1RCLA 1TU5A 1IVUA 3BU4A 1LQGC 3KZTA 4GSPA 3D79A 3GZXB 2H0IA 4AKYA 2XFSA 3UJMA 5M19A 3DUKA 1TP6A 1UCLA 1WQLB 2W9PA 1F8NA 4MMXB 2B24B 3UB1A 1RN7A 5HOHA 1LOXA 3WHOA 1KWIA 1AVKA 5AYRB 3AHWA 1OGZA 2W9QA 1TFOA 1IK3A 1RNBA 4CPKA 3NHXA 3FZWA 1LRAA 3BNCA 1SIHA 3D3LA 3L0RA 1BUJA 3CCM3 2QA43 1GMRA 3EX9A 1ROAA 1MGRA 2IY2A 3IJEB 3KE7A 1BNSA 4MJDA 1RN4A 3NBRA 1M904 1CEWI 1I3FA 2Z77A 1IQYA 4U13A 1NDOB 3NV0A 1GOVA 2HMLB 4NPBA 4K1VA 3G4S3 1RGAA 1C7HA 1BVIA 1MNLA 4Q53A 2GXFA 3D5IA 3DM8A 3JUMA 4IT7A 4HM2B 5IG4A 4FCZA 5D82A 2WO0A 1YJN3 1OF5A 4HYZA 2GBWB 2YFIB 2BU4A 3AMOB 4NREA 8CHOA 3O8YA 3I553 1VQQA 3CCR3 2IUKA 3CME3 1DYUA 5IEPA 6RNTA 3GZRA 5A0OB 1BSCA 1LOVA 1RLSA 3ZG0A 3PCRA 1ASKA 4IIAA
chains in the Genus database with same CATH topology
4K90B 4N6LA 1K41A 1OH0A 4N3VA 1QALA 1O7HB 4KZ1A 3VF1A 3J7Yd 4KFEA 1TFKA 2UX0A 3SOYA 3WODG 2P0MA 2KXGA 1HKXA 4R4KA 1FGRA 4H3UA 3I563 2YX9A 2KCDA 1SIIA 4FMCA 2E2UA 4EC6A 3FCSB 4KVHA 1PU4A 3K0ZA 1UI7A 5CLKA 5CK6A 2QGUA 3OWSA 1WTHA 1VZZA 3EN1B 3OXAA 5BVBA 1RJOA 4RNZA 2XGNA 1A2KA 2Z76A 3HZPA 2FGTA 2MF7A 2W6JH 2E2VA 3NBBA 4HZ9B 5AEUB 2W56B 2ZL8A 4FMAA 2CC3A 3RGAA 3AMOA 3QK9A 1DMQA 1W6CA 3DXOA 5CF2A 2CFKA 1JN5B 2LQVA 3JUPA 3CC23 4G1MB 1OCVA 3F40A 4K1UA 5D83A 4HZBB 3F8HA 2IUJA 1LXEA 2WGQA 3NX0A 5IEOA 1E97A 4HM7B 3IPTA 1AV4A 1A67A 3OV4A 1QVF2 5FGOA 3WA2X 3U1WA 2I9WA 1VQM3 3KSPA 1DVCA 1N5PA 1Q42A 3S67A 2O9UX 4FCJA 1W4NA 1IV7A 3PGBA 4IPBA 4X2HA 3SLUA 3LTCA 4WHAA 2WOHA 3I0YA 5FW5A 5DREA 4L8PA 2C11A 3CCJ3 3E99A 4I4KA 1CQSA 5ELJA 5AIFA 1QAKA 1V74A 2FNQA 3CMA3 1D6UA 1OUNA 3SVAA 1DMMA 4L8OA 5EVHA 3OW22 4HM4B 3H51A 1FGMA 4K61A 3F9SA 3T8NA 3NXJA 2E2TA 3PYJA 5ELUA 2W56A 1WNHA 2CFLA 3X3XA 3S27A 1OACA 2CWUA 2HMMB 3JUQA 1Q40B 3S28A 1JNQA 3HK4A 3NQZA 1EQKA 1S723 1RKYA 1IVWA 3PZWA 3MG1A 2BO9B 2L4VA 1Q7Y4 1GY6A 6STDA 3DMCA 2D42A 2XR8B 1L5GB 2D1WA 1MOLA 2FXTA 3BB9A 1J2BA 2CW9A 4CCVA 4BTXA 1OPYA 4FMBA 2KRTA 4OK0A 3K9MC 4LGQA 1RRLA 3MPHA 4X2OA 3KN4A 1GS3A 4WYKB 3LTAA 3MG3A 1IVXA 4GB5A 2INXA 3U97A 2W04A 3GZYB 3KFQC 3LT8A 2YFLB 2MC8A 3GWRA 3GRDA 3EBYA 3V92A 1W00A 2CH9A 3OWYA 4O02B 2C10A 1OHPA 1STFI 2M7OA 3SOAA 3EJVA 2P0XA 3UL5A 5IG5A 4JF8A 1ZO2A 3N8BA 1EA2A 5LC7A 2R4IA 1YGEA 2XSOB 4PEJA 1Q40A 1VQ53 4MEIA 3OX9A 3G6E3 3MHEA 2IA7A 3B4PA 1UI8A 3G713 4HM8B 4GL6A 5LC6A 3X42A 5AIHA 1S5AA 1R4CA 5KP1A 2OQEC 2JQ5A 1Q864 1N9EA 1AVLA 3G8ZA 1U8CB 1W2ZA 2CFGA 2ML6A 3FLJA 3LYGA 3MKIA 3F7SA 1ZX2A 1M1XB 2PNCA 3CXC2 4FCMA 1OHSA 3F14A 4JRFA 2BT3A 1QVG2 1VQ73 1ULIB 5JPUA 4HKVB 1GY5A 1QAFA 3EQQB 3N54B 3STDA 3CCQ3 1HU9A 3DZLA 2CFDA 4ZM8A 2BMQB 1VQL3 3WOFB 2W03A 4LMIA 1JV2B 3D9RA 1YIJ3 3NUVA 2XFTA 2CKFB 1VQK3 1U5OA 4RZMA 2CWVA 4RBNA 4QWTA 4J9AA 3ALAA 3T8UA 4OVMA 3V98A 1CYVA 2STDA 3PS8A 2P09A 4N6V0 1K8A4 2P05A 3CNMA 4AEQA 4CDLA 1VQO3 1Z1SA 4N6NB 2F99A 5G2GA 1FA3A 1EG9B 4R80A 3X40A 4XB5A 1CYUA 3FSDA 1UUWB 3H3HA 4LEHA 1D6YA 4EV5A 2OOVC 3X3ZA 1WMOA 4XDVA 5IG0A 3LTDA 3MSOA 1KQS2 3EN8A 3RGRA 5AIIA 4MMZB 3X41A 3JUNA 3HIIA 2HMOB 2WGOA 1NJI4 2RSXA 3T0UA 3FGYA 1K734 3CNXA 3UL6A 3CC73 2GU3A 3LMLA 2W0QA 3A76A 1N8QA 4XBTA 4RNYA 1O7PB 1GD3A 1US1A 4HM0B 1K9M4 2JDIH 1ULJB 1FGOA 3MG2A 1LNHA 4R9LA 3CCU3 2K54A 1RRHA 3FH1A 3UNLA 1JRQA 4O2HA 3FF0A 3LZAA 1JB4A 2OCTA 4HM1B 4NHFA 4HVNA 3K7CA 2HMNB 4EV2A 2GEXA 1UW1A 5IF6A 1IDPA 2CG0A 5AYSC 5I97A 3KIIA 4XDWA 2RCDA 3SX1A 3GAXA 1OF5B 3HX8A 1N9JA 1JN5A 1E3RA 2OQEA 4FMDA 3BNEA 1K28A 5IW9A 2Y74A 3EF8A 3MYTA 3CPW2 2O3OA 4WFOA 1Q824 5EQLA 1W01A 1JKGB 3ER7A 5AIGA 1W2B2 2RGQA 4N6MA 3CPOA 2CK3H 2XSHB 2BHMA 3VSYA 4LZIA 5AEWB 3N9HA 3LXUX 5D81A 4O8SA 1KSIA 2B1XB 5IERA 4AKZA 5TGNA 3EHCA 4WP5A 2YFJB 1W6GA 1YJ93 5EEOA 1SJWA 1GYBA 1YI23 3GZBA 3FG3A 2QIYA 1Q814 3VGNA 1AR0A 1O7NB 3DY5A 3JUOA 4HM6B 3DGMA 1IT7A 4OUQA 1W7CA 4STDA 5IENA 1NB3I 4J8TA 3CCV3 2HMKB 1BUQA 4XM4A 1DMNA 3FF2A 1TIJA 3F7XA 3PXMA 3CC43 4BTYA 2HMJB 1IT8A 1G96A 2OOVA 4EYCA 1A90A 3EB8A 7STDA 3CCL3 1IVVA 1O7MB 1N5HA 3DGOA 3SXXA 5BXQA 1FGTA 2RFRA 1QJGA 1SPUA 1IV9A 2BNGA 3DGLA 4HBRA 1YHQ3 3LT9A 4KFDA 2XH9A 3Q2PA 3V99A 1T5YA 1M9GA 3ROBA 1D6ZA 3HI7A 3BNBA 1JKGA 2W2CA 5JBSA 2BMOB 1IU7A 1SQWA 3Q1CA 3MWZA 1VQ63 1DVDA 3SEDA 1YIT3 1VQN3 4LSOA 2GEYA 4N6TA 4TX4A 4WYKA 3FKAA 2ML5A 1VQ83 2SBLA 1NU3A 2BMRB 2XEPA 2Z7AA 1GY7A 4L7KA 3JVCA 2CIUA 4WWUC 1JB2A 1OHOA 1ROVA 1UUVB 3CU3A 4ORLA 3LOYA 3WMDA 1E3VA 3EC9A 3IMAB 1VQ93 1STDA 3FG1A 3G0KA 1GD4A 1WMNA 4HJLB 4R9KA 3RDEA 1O7GB 1IQXA 2OWPA 3CD63 3WA3A 3G16A 3M8CA 2GBXB 3ECFA 3CCS3 1WMPA 3DGNA 1NWWA 2XGLA 2CWTA 4N6OB 1JJ22 2GU1A 3LTBA 4EXRA 5KP4A 3FG4A 1LVNA 3KKGA 3WOEB 1KD14 1W5ZA 3KSED 3NQYA 2P38A 3PCSA 3HIGA 2IMJA 3EBTA 1VQP3 1OGXA 3BNDA 3NM2A 3K63A 4XBXA 3K5TA 3OWUA 4N6UA 3B7CA 4MMYB 4R1KA 5IG3A 1NB5I 4XBYA 1O7WB 1TUHA 3S5CA 2XF3A 5JPPA 1A2VA 3F8XA 5AI1A 4KFFA 3TDGA 2XRXB 4H61A 2CHCA 2PZVA 1ISKA 3B8LA 4BTWA 1YJW3 1N8R4 3Q90A 2LYXA 2Q07A 1M1K4 1KC84 3NM7A 4HM3B 4O3VA 2QEX3 2V1LA 3S29A 2WOFA 1IQ8A 2F86B 3EE1A 3NBJA 2OTL3 2OTJ3 3NV0B 3X3YA 2K0MA 4FR9A 2Z6BA 5DRVA 2A15A 3CCE3 1W02A 1VQ43 3B4OA 2Y73A 3LH4A 5CF1A 1Y4KA 1QMAA 2CFWA 1JB5A 1FUWA 4HM5B 2F98A 4EBGA 5STDA 1YVBI 1W6YA 1FGQA 5HGRA 5KP3A 1NO3A 3QRDA 5CXOA 2CG1A 1EKMA 3BLZA 3WDGB 1PFPA 2ZDJA 1TU5A 1IVUA 3KZTA 3GZXB 4AKYA 2XFSA 3UJMA 3DUKA 1TP6A 1WQLB 2W9PA 3UB1A 1F8NA 4MMXB 2B24B 1RN7A 1LOXA 1KWIA 1AVKA 5AYRB 1OGZA 2W9QA 1TFOA 1IK3A 3NHXA 3FZWA 3BNCA 1SIHA 3D3LA 3L0RA 3CCM3 2QA43 3EX9A 1ROAA 3IJEB 3KE7A 1M904 4MJDA 3NBRA 1CEWI 2Z77A 1IQYA 4U13A 1NDOB 3NV0A 2HMLB 4K1VA 3G4S3 1C7HA 1MNLA 4Q53A 2GXFA 3DM8A 4IT7A 3JUMA 4HM2B 5IG4A 4FCZA 5D82A 2WO0A 1YJN3 1OF5A 4HYZA 2GBWB 2YFIB 3AMOB 4NREA 8CHOA 3I553 3O8YA 3CCR3 2IUKA 3CME3 1DYUA 5IEPA 3GZRA 5A0OB 3PCRA 1ASKA 4IIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K41 A;  1OH0 A;  4N3V A;  1O7H B;  2UX0 A;  3SOY A;  1HKX A;  4H3U A;  4KVH A;  3K0Z A;  5CLK A;  5CK6 A;  2QGU A;  3OWS A;  1VZZ A;  3EN1 B;  3OXA A;  5BVB A;  1A2K A;  2Z76 A;  3HZP A;  4HZ9 B;  5AEU B;  3RGA A;  1DMQ A;  3DXO A;  5CF2 A;  1JN5 B;  3JUP A;  1OCV A;  3F40 A;  4K1U A;  5D83 A;  4HZB B;  3F8H A;  5IEO A;  1E97 A;  4HM7 B;  3IPT A;  3OV4 A;  2I9W A;  3KSP A;  1Q42 A;  4FCJ A;  4X2H A;  3I0Y A;  5FW5 A;  5DRE A;  4L8P A;  3E99 A;  4I4K A;  1CQS A;  5AIF A;  1OUN A;  1DMM A;  4L8O A;  5EVH A;  4HM4 B;  3H51 A;  3F9S A;  3T8N A;  3NXJ A;  2HMM B;  3JUQ A;  1Q40 B;  3HK4 A;  3MG1 A;  1GY6 A;  6STD A;  3DMC A;  2XR8 B;  3BB9 A;  1OPY A;  4LGQ A;  4X2O A;  1GS3 A;  4WYK B;  3MG3 A;  4GB5 A;  2INX A;  3GZY B;  2YFL B;  3GWR A;  3GRD A;  3EBY A;  1W00 A;  3OWY A;  1OHP A;  3SOA A;  3EJV A;  5IG5 A;  1ZO2 A;  1EA2 A;  2R4I A;  2XSO B;  4PEJ A;  1Q40 A;  3OX9 A;  3MHE A;  3B4P A;  4HM8 B;  5AIH A;  1S5A A;  5KP1 A;  2JQ5 A;  3G8Z A;  3LYG A;  3FLJ A;  3MKI A;  3F7S A;  1ZX2 A;  4FCM A;  1OHS A;  3F14 A;  1ULI B;  5JPU A;  4HKV B;  1GY5 A;  3EQQ B;  3STD A;  3DZL A;  2BMQ B;  4LMI A;  3D9R A;  3NUV A;  2CKF B;  1U5O A;  4RZM A;  4J9A A;  3T8U A;  4OVM A;  2STD A;  3CNM A;  4CDL A;  1Z1S A;  5G2G A;  2F99 A;  1EG9 B;  4XB5 A;  3FSD A;  1UUW B;  3H3H A;  4LEH A;  4XDV A;  5IG0 A;  3MSO A;  3EN8 A;  3RGR A;  5AII A;  3JUN A;  2HMO B;  3FGY A;  3CNX A;  3A76 A;  4XBT A;  1O7P B;  4HM0 B;  1ULJ B;  3MG2 A;  4R9L A;  2K54 A;  3FH1 A;  3UNL A;  3FF0 A;  3LZA A;  1JB4 A;  4HM1 B;  4HVN A;  3K7C A;  2HMN B;  2GEX A;  5IF6 A;  1IDP A;  4XDW A;  2RCD A;  1OF5 B;  3HX8 A;  1JN5 A;  1E3R A;  3EF8 A;  3MYT A;  1W01 A;  1JKG B;  3ER7 A;  5AIG A;  2RGQ A;  3CPO A;  2XSH B;  3VSY A;  5AEW B;  5D81 A;  2B1X B;  5IER A;  5TGN A;  3EHC A;  4WP5 A;  2YFJ B;  1SJW A;  1GYB A;  3GZB A;  2QIY A;  3VGN A;  1AR0 A;  1O7N B;  4HM6 B;  3JUO A;  4OUQ A;  5IEN A;  4STD A;  4J8T A;  2HMK B;  1BUQ A;  4XM4 A;  1DMN A;  3FF2 A;  3F7X A;  2HMJ B;  7STD A;  1O7M B;  5BXQ A;  2RFR A;  1QJG A;  2BNG A;  3ROB A;  1JKG A;  2W2C A;  2BMO B;  3SED A;  2GEY A;  4WYK A;  3FKA A;  1NU3 A;  2BMR B;  2Z7A A;  1GY7 A;  4L7K A;  4WWU C;  1JB2 A;  1OHO A;  1UUV B;  3CU3 A;  4ORL A;  3WMD A;  1E3V A;  3EC9 A;  1STD A;  3G0K A;  4HJL B;  4R9K A;  1O7G B;  2OWP A;  3G16 A;  3M8C A;  3ECF A;  2GBX B;  1NWW A;  5KP4 A;  3KKG A;  2IMJ A;  3EBT A;  1OGX A;  4XBX A;  3NM2 A;  3OWU A;  3B7C A;  4R1K A;  5IG3 A;  4XBY A;  1O7W B;  1TUH A;  3S5C A;  5JPP A;  3F8X A;  5AI1 A;  2XRX B;  2CHC A;  2PZV A;  1ISK A;  3B8L A;  3Q90 A;  4HM3 B;  2F86 B;  3NV0 B;  5DRV A;  2A15 A;  1W02 A;  3B4O A;  5CF1 A;  1QMA A;  1JB5 A;  4HM5 B;  2F98 A;  5STD A;  1W6Y A;  5HGR A;  5KP3 A;  5CXO A;  3BLZ A;  3KZT A;  3GZX B;  3UJM A;  3DUK A;  1TP6 A;  1WQL B;  2B24 B;  1OGZ A;  3NHX A;  3FZW A;  3EX9 A;  3KE7 A;  4MJD A;  3NBR A;  2Z77 A;  4U13 A;  1NDO B;  3NV0 A;  2HML B;  4K1V A;  1C7H A;  4Q53 A;  2GXF A;  3DM8 A;  3JUM A;  4HM2 B;  5IG4 A;  5D82 A;  1OF5 A;  2GBW B;  2YFI B;  8CHO A;  5IEP A;  3GZR A;  1ASK A;  4IIA A; 
#chains in the Genus database with same CATH topology
 4K90 B;  4N6L A;  1FUT A;  1K41 A;  1OH0 A;  4N3V A;  1QAL A;  1O7H B;  4KZ1 A;  5BU4 A;  3VF1 A;  3J7Y d;  4KFE A;  1TFK A;  2UX0 A;  3SOY A;  3WOD G;  1YHQ 3;  2P0M A;  2RNT A;  1I2F A;  1GSP A;  1ZGX A;  2KXG A;  4EW5 A;  1HKX A;  4R4K A;  1BSB A;  1FGR A;  4H3U A;  3I56 3;  1BOX A;  1RN1 A;  2YX9 A;  2KCD A;  2SAR A;  1SII A;  1T3B A;  2C4B A;  1BNE A;  4FMC A;  1B27 A;  2UUG C;  2E2U A;  4EC6 A;  3FCS B;  1BAN A;  4KVH A;  1PU4 A;  3K0Z A;  1UI7 A;  5CLK A;  5CK6 A;  2QGU A;  3OWS A;  1WTH A;  1VZZ A;  3EN1 B;  3OXA A;  5BVB A;  1RJO A;  4RNZ A;  2XGN A;  1A2K A;  2Z76 A;  3HZP A;  2FGT A;  5GSP A;  2MF7 A;  2W6J H;  1T2I A;  2E2V A;  1I0X A;  3NBB A;  4HZ9 B;  5AEU B;  2W56 B;  2ZL8 A;  4FMA A;  2CC3 A;  1GMP A;  3RGA A;  5RNT A;  3AMO A;  3QK9 A;  1I8V A;  1DMQ A;  1W6C A;  3DXO A;  5CF2 A;  2CFK A;  1JN5 B;  2LQV A;  3JUP A;  3CC2 3;  4G1M B;  1OCV A;  3F40 A;  4K1U A;  5D83 A;  4HZB B;  3F8H A;  2IUJ A;  1LXE A;  2WGQ A;  3NX0 A;  5IEO A;  2IYJ A;  1RSN A;  1BU4 A;  1E97 A;  4HM7 B;  3IPT A;  1AV4 A;  1A67 A;  3OV4 A;  1QVF 2;  5FGO A;  3WA2 X;  3U1W A;  2I9W A;  1VQM 3;  2RBI A;  3KSP A;  1DVC A;  1N5P A;  1Q42 A;  3S67 A;  2O9U X;  4FCJ A;  1B3S A;  1IV7 A;  1W4N A;  1LOW A;  1V57 A;  3PGB A;  3LTC A;  1MGW A;  4IPB A;  4X2H A;  4WHA A;  3SLU A;  2WOH A;  3I0Y A;  1B2X A;  5FW5 A;  5DRE A;  4L8P A;  2C11 A;  3D4A A;  3E99 A;  3CCJ 3;  4I4K A;  1CQS A;  1RGG A;  5AIF A;  1QAK A;  5ELJ A;  1V74 A;  1FW7 A;  2FNQ A;  1B2M A;  3CMA 3;  1D6U A;  1OUN A;  1RCK A;  1FUS A;  3SVA A;  1DMM A;  1B2U A;  4L8O A;  5EVH A;  4HM4 B;  3H51 A;  3OW2 2;  1FGM A;  4K61 A;  1BNF A;  3F9S A;  3T8N A;  1HZ1 A;  9RNT A;  2AAD A;  3NXJ A;  2E2T A;  3PYJ A;  4J5G A;  5ELU A;  2W56 A;  1WNH A;  2CFL A;  3X3X A;  3D5G A;  3S27 A;  2AAE A;  1OAC A;  5BIR A;  2CWU A;  2HMM B;  3JUQ A;  1Q40 B;  3S28 A;  1JNQ A;  6GSP A;  3DH2 A;  3HK4 A;  3NQZ A;  1EQK A;  1S72 3;  1X1X A;  1BNG A;  1RKY A;  1IVW A;  3PZW A;  3MG1 A;  2BO9 B;  2L4V A;  1Q7Y 4;  1GY6 A;  6STD A;  3DMC A;  2D42 A;  1I3I A;  2XR8 B;  1L5G B;  1DET A;  2D1W A;  1MOL A;  2FXT A;  3BB9 A;  1J2B A;  2CW9 A;  4CCV A;  4BTX A;  3ZG5 A;  1JBS A;  1OPY A;  4FMB A;  2KRT A;  4OK0 A;  3K9M C;  4LGQ A;  1RRL A;  3MPH A;  4X2O A;  3KN4 A;  1GS3 A;  4WYK B;  3LTA A;  1RGE A;  3MG3 A;  1C54 A;  1IVX A;  4GB5 A;  2INX A;  3U97 A;  2W04 A;  3GZY B;  3KFQ C;  3LT8 A;  2YFL B;  2MC8 A;  4I5Q A;  3WR2 A;  3GWR A;  3GRD A;  3EBY A;  3V92 A;  1W00 A;  2CH9 A;  3OWY A;  1BIR A;  1BRG A;  1I2E A;  2KF4 A;  4O02 B;  2C10 A;  1OHP A;  1STF I;  2M7O A;  3SOA A;  3EJV A;  2P0X A;  4HOH A;  3UL5 A;  4BIR A;  5IG5 A;  4JF8 A;  1ZO2 A;  3N8B A;  1EA2 A;  5LC7 A;  2R4I A;  1YGE A;  2XSO B;  4PEJ A;  1YNV X;  1UUG B;  1Q40 A;  1X1U A;  4MEI A;  1VQ5 3;  3OX9 A;  1DE3 A;  3G6E 3;  3MHE A;  2IA7 A;  3B4P A;  1UI8 A;  3G71 3;  4HM8 B;  1RGC A;  4GL6 A;  5LC6 A;  1UGH I;  1BSD A;  1G02 A;  5AIH A;  3X42 A;  4J5K A;  1S5A A;  1R4C A;  5KP1 A;  2OQE C;  2JQ5 A;  1Q86 4;  1N9E A;  2F56 A;  4DKI A;  1AVL A;  3G8Z A;  1U8C B;  1W2Z A;  2CFG A;  2ML6 A;  3FLJ A;  3LYG A;  3MKI A;  3F7S A;  1ZX2 A;  1M1X B;  2PNC A;  3CXC 2;  4FCM A;  1OHS A;  3F14 A;  1RGH A;  4JRF A;  2BT3 A;  1QVG 2;  2H0G A;  1VQ7 3;  1ULI B;  5JPU A;  4HKV B;  1BSE A;  1RDS A;  1GY5 A;  3Q3F A;  1B2Z A;  1QAF A;  1I0V A;  3EQQ B;  3N54 B;  3STD A;  1HU9 A;  3DZL A;  2CFD A;  3ZFZ A;  4ZM8 A;  3CCQ 3;  1BNI A;  2BMQ B;  1VQL 3;  3WOF B;  1PY3 A;  2W03 A;  1I70 A;  4LMI A;  1JV2 B;  3D9R A;  1YIJ 3;  3NUV A;  2XFT A;  2CKF B;  1VQK 3;  1U5O A;  4RZM A;  2CWV A;  4RBN A;  1RGK A;  4QWT A;  4J9A A;  3ALA A;  3T8U A;  4OVM A;  1IYY A;  1MWS A;  3V98 A;  1CYV A;  2STD A;  1YGW A;  3PS8 A;  1RTU A;  2P09 A;  3A5E A;  4N6V 0;  1K8A 4;  2P05 A;  3CNM A;  4AEQ A;  4CDL A;  1VQO 3;  1X1Y A;  1Z1S A;  2F99 A;  4N6N B;  5G2G A;  7RNT A;  1FA3 A;  1EG9 B;  4R80 A;  2L1S A;  3X40 A;  4XB5 A;  2K3D A;  1CYU A;  3FSD A;  1UUW B;  3H3H A;  4LEH A;  1D6Y A;  4EV5 A;  2OOV C;  3X3Z A;  1T2H A;  1TRP A;  1WMO A;  4XDV A;  5IG0 A;  3LTD A;  3MSO A;  1KQS 2;  3EN8 A;  2F4Y A;  3RGR A;  5AII A;  4MMZ B;  3X41 A;  3JUN A;  3HII A;  2HMO B;  1Q7H A;  2WGO A;  2RSX A;  3T0U A;  3FGY A;  1K73 4;  1NJI 4;  3CNX A;  3UL6 A;  1HYF A;  3CC7 3;  1BNR A;  2GU3 A;  3LML A;  2W0Q A;  3A76 A;  1N8Q A;  4XBT A;  2KF5 A;  4RNY A;  1O7P B;  1GD3 A;  3DGY A;  1US1 A;  4HM0 B;  8RNT A;  1PYL A;  2JDI H;  1K9M 4;  1ULJ B;  1FGO A;  1BRJ A;  1LNH A;  2CX1 A;  3MG2 A;  4R9L A;  5M18 A;  3CCU 3;  2K54 A;  1RRH A;  3FH1 A;  3UNL A;  1JRQ A;  4O2H A;  3FF0 A;  3LZA A;  1JB4 A;  2OCT A;  4HM1 B;  4NHF A;  4HVN A;  1FYS A;  3K7C A;  2HMN B;  4EV2 A;  2GEX A;  1UW1 A;  5IF6 A;  1IDP A;  2CG0 A;  4BL2 A;  5AYS C;  5I97 A;  3KII A;  4XDW A;  2RCD A;  1NNV A;  3SX1 A;  3URP A;  3GAX A;  1OF5 B;  3HX8 A;  1N9J A;  1JN5 A;  1E3R A;  4BL3 A;  2OQE A;  1FZU A;  4FMD A;  1LQM B;  3BNE A;  1I2G A;  1K28 A;  5IW9 A;  2Y74 A;  3EF8 A;  3MYT A;  3CPW 2;  2O3O A;  4WFO A;  1Q82 4;  5EQL A;  1W01 A;  1JKG B;  1BAO A;  1RGL A;  3ER7 A;  5AIG A;  1W2B 2;  2RGQ A;  1UGI A;  4N6M A;  3CPO A;  1JZD A;  1AY7 A;  4HAA A;  2CK3 H;  2XSH B;  2BHM A;  3VSY A;  4LZI A;  5AEW B;  3N9H A;  3LXU X;  5D81 A;  5G1L A;  4O8S A;  1KSI A;  2B1X B;  5IER A;  4AKZ A;  5TGN A;  1BRS A;  3EHC A;  4WP5 A;  2YFJ B;  1A2P A;  1RHL A;  1W6G A;  1BSA A;  5EEO A;  1YJ9 3;  1SJW A;  1JBT A;  1GYB A;  1YI2 3;  3GZB A;  3FG3 A;  2QIY A;  1Q81 4;  3VGN A;  1AR0 A;  1GOY A;  1UCJ A;  1O7N B;  3DY5 A;  2KF6 A;  3JUO A;  4HM6 B;  3DGM A;  1IT7 A;  4OUQ A;  1W7C A;  4STD A;  2GSP A;  1NB3 I;  5IEN A;  4J8T A;  3CCV 3;  2HMK B;  1BUQ A;  4XM4 A;  3AGO A;  1DMN A;  3FF2 A;  1TIJ A;  3F7X A;  3PXM A;  3CC4 3;  4BTY A;  2HMJ B;  1IT8 A;  1G96 A;  2OOV A;  4EYC A;  1A90 A;  3EB8 A;  1B21 A;  7STD A;  1SAR A;  3CCL 3;  1IVV A;  1TTO A;  1O7M B;  1N5H A;  3DGO A;  3SXX A;  5BXQ A;  1FGT A;  1BGS A;  2RFR A;  1QJG A;  1SPU A;  1IV9 A;  2BNG A;  3DGL A;  1B2S A;  1LNI A;  3LT9 A;  4HBR A;  4KFD A;  2XH9 A;  3Q2P A;  3V99 A;  1T5Y A;  1M9G A;  3ROB A;  1D6Z A;  3HI7 A;  3KCH A;  1MWR A;  3BNB A;  3GSP A;  1BNJ A;  1JKG A;  2W2C A;  5JBS A;  2BMO B;  1EUI C;  1IU7 A;  2KF3 A;  1SQW A;  2ZHX B;  2F5M A;  1RNT A;  3Q1C A;  3MWZ A;  1VQ6 3;  1DVD A;  3SED A;  1YIT 3;  3HOH A;  4LSO A;  3BIR A;  1TJD A;  1VQN 3;  2GEY A;  4N6T A;  4TX4 A;  4WYK A;  1UCK A;  3FKA A;  2ML5 A;  1VQ8 3;  2SBL A;  1NU3 A;  1G0T A;  2BMR B;  2XEP A;  2Z7A A;  1GY7 A;  4L7K A;  1AQZ A;  3JVC A;  2CIU A;  2ZA4 A;  4WWU C;  1JB2 A;  1UDI I;  1OHO A;  1ROV A;  1UUV B;  3CU3 A;  4ORL A;  3LOY A;  3SYU A;  2BIR A;  1E3V A;  3WMD A;  3EC9 A;  3IMA B;  1MWU A;  1VQ9 3;  1STD A;  1CH0 A;  3AGN A;  3FG1 A;  3G0K A;  1GD4 A;  1WMN A;  4HJL B;  4ILF A;  1ZS7 A;  4R9K A;  3RDE A;  1O7G B;  1IQX A;  1GMQ A;  2OWP A;  3WA3 A;  3CD6 3;  2F5W A;  3G16 A;  3M8C A;  2GBX B;  3ECF A;  3CCS 3;  1WMP A;  3DGN A;  1NWW A;  2XGL A;  2CWT A;  4N6O B;  1JJ2 2;  2GU1 A;  3LTB A;  4EXR A;  5KP4 A;  3FG4 A;  1LVN A;  3KKG A;  3WOE B;  1KD1 4;  1JBR A;  1W5Z A;  3KSE D;  3NQY A;  2P38 A;  3PCS A;  3HIG A;  2IMJ A;  3EBT A;  1VQP 3;  1OGX A;  3BND A;  3NM2 A;  3K63 A;  4XBX A;  3K5T A;  2UGI A;  3OWU A;  4N6U A;  1B20 A;  3B7C A;  2HOH A;  4MMY B;  4R1K A;  5IG3 A;  1NB5 I;  4XBY A;  1O7W B;  4BU4 A;  1TUH A;  3S5C A;  2XF3 A;  2H0H A;  5JPP A;  1A2V A;  3AHS A;  5G1K A;  3F8X A;  5AI1 A;  4KFF A;  1RMS A;  3TDG A;  2XRX B;  4GHO A;  4H61 A;  2CHC A;  1EEJ A;  2KAA A;  2PZV A;  1GOU A;  1ISK A;  3B8L A;  4BTW A;  4KT3 B;  1YJW 3;  1X1W A;  1N8R 4;  3Q90 A;  2LYX A;  1JZO A;  2Q07 A;  1M1K 4;  1KC8 4;  3NM7 A;  4HM3 B;  1Q9E A;  1UCI A;  4O3V A;  2QEX 3;  2V1L A;  3S29 A;  2WOF A;  1IQ8 A;  2F86 B;  1V58 A;  3EE1 A;  3NBJ A;  5M1A A;  2OTL 3;  1BRK A;  1BRI A;  2OTJ 3;  3NV0 B;  3X3Y A;  2J8X B;  2CX0 A;  2K0M A;  4FR9 A;  2Z6B A;  5DRV A;  2A15 A;  4RNT A;  1LOY A;  7GSP A;  3CCE 3;  1W02 A;  1VQ4 3;  3B4O A;  2Y73 A;  3LH4 A;  5CF1 A;  1Y4K A;  1QMA A;  1TRQ A;  2CFW A;  1JB5 A;  1RGF A;  1FUW A;  4CJN A;  4HM5 B;  1MWT A;  1YVS A;  2F98 A;  3RNT A;  4EBG A;  4LYL B;  5STD A;  1YVB I;  1W6Y A;  1FGQ A;  1R4Y A;  5HGR A;  5KP3 A;  1BRN L;  1NO3 A;  3QRD A;  5CXO A;  2CG1 A;  1EKM A;  1BRH A;  3BLZ A;  3WDG B;  1PFP A;  2R41 A;  2ZDJ A;  1RCL A;  1TU5 A;  1IVU A;  3BU4 A;  1LQG C;  3KZT A;  4GSP A;  3D79 A;  3GZX B;  2H0I A;  4AKY A;  2XFS A;  3UJM A;  5M19 A;  3DUK A;  1TP6 A;  1UCL A;  1WQL B;  2W9P A;  1F8N A;  4MMX B;  2B24 B;  3UB1 A;  1RN7 A;  5HOH A;  1LOX A;  3WHO A;  1KWI A;  1AVK A;  5AYR B;  3AHW A;  1OGZ A;  2W9Q A;  1TFO A;  1IK3 A;  1RNB A;  4CPK A;  3NHX A;  3FZW A;  1LRA A;  3BNC A;  1SIH A;  3D3L A;  3L0R A;  1BUJ A;  3CCM 3;  2QA4 3;  1GMR A;  3EX9 A;  1ROA A;  1MGR A;  2IY2 A;  3IJE B;  3KE7 A;  1BNS A;  4MJD A;  1RN4 A;  3NBR A;  1M90 4;  1CEW I;  1I3F A;  2Z77 A;  1IQY A;  4U13 A;  1NDO B;  3NV0 A;  1GOV A;  2HML B;  4NPB A;  4K1V A;  3G4S 3;  1RGA A;  1C7H A;  1BVI A;  1MNL A;  4Q53 A;  2GXF A;  3D5I A;  3DM8 A;  3JUM A;  4IT7 A;  4HM2 B;  5IG4 A;  4FCZ A;  5D82 A;  2WO0 A;  1YJN 3;  1OF5 A;  4HYZ A;  2GBW B;  2YFI B;  2BU4 A;  3AMO B;  4NRE A;  8CHO A;  3O8Y A;  3I55 3;  1VQQ A;  3CCR 3;  2IUK A;  3CME 3;  1DYU A;  5IEP A;  6RNT A;  3GZR A;  5A0O B;  1BSC A;  1LOV A;  1RLS A;  3ZG0 A;  3PCR A;  1ASK A;  4IIA A; 
#chains in the Genus database with same CATH homology
 4K90 B;  4N6L A;  1K41 A;  1OH0 A;  4N3V A;  1QAL A;  1O7H B;  4KZ1 A;  3VF1 A;  3J7Y d;  4KFE A;  1TFK A;  2UX0 A;  3SOY A;  3WOD G;  2P0M A;  2KXG A;  1HKX A;  4R4K A;  1FGR A;  4H3U A;  3I56 3;  2YX9 A;  2KCD A;  1SII A;  4FMC A;  2E2U A;  4EC6 A;  3FCS B;  4KVH A;  1PU4 A;  3K0Z A;  1UI7 A;  5CLK A;  5CK6 A;  2QGU A;  3OWS A;  1WTH A;  1VZZ A;  3EN1 B;  3OXA A;  5BVB A;  1RJO A;  4RNZ A;  2XGN A;  1A2K A;  2Z76 A;  3HZP A;  2FGT A;  2MF7 A;  2W6J H;  2E2V A;  3NBB A;  4HZ9 B;  5AEU B;  2W56 B;  2ZL8 A;  4FMA A;  2CC3 A;  3RGA A;  3AMO A;  3QK9 A;  1DMQ A;  1W6C A;  3DXO A;  5CF2 A;  2CFK A;  1JN5 B;  2LQV A;  3JUP A;  3CC2 3;  4G1M B;  1OCV A;  3F40 A;  4K1U A;  5D83 A;  4HZB B;  3F8H A;  2IUJ A;  1LXE A;  2WGQ A;  3NX0 A;  5IEO A;  1E97 A;  4HM7 B;  3IPT A;  1AV4 A;  1A67 A;  3OV4 A;  1QVF 2;  5FGO A;  3WA2 X;  3U1W A;  2I9W A;  1VQM 3;  3KSP A;  1DVC A;  1N5P A;  1Q42 A;  3S67 A;  2O9U X;  4FCJ A;  1W4N A;  1IV7 A;  3PGB A;  4IPB A;  4X2H A;  3SLU A;  3LTC A;  4WHA A;  2WOH A;  3I0Y A;  5FW5 A;  5DRE A;  4L8P A;  2C11 A;  3CCJ 3;  3E99 A;  4I4K A;  1CQS A;  5ELJ A;  5AIF A;  1QAK A;  1V74 A;  2FNQ A;  3CMA 3;  1D6U A;  1OUN A;  3SVA A;  1DMM A;  4L8O A;  5EVH A;  3OW2 2;  4HM4 B;  3H51 A;  1FGM A;  4K61 A;  3F9S A;  3T8N A;  3NXJ A;  2E2T A;  3PYJ A;  5ELU A;  2W56 A;  1WNH A;  2CFL A;  3X3X A;  3S27 A;  1OAC A;  2CWU A;  2HMM B;  3JUQ A;  1Q40 B;  3S28 A;  1JNQ A;  3HK4 A;  3NQZ A;  1EQK A;  1S72 3;  1RKY A;  1IVW A;  3PZW A;  3MG1 A;  2BO9 B;  2L4V A;  1Q7Y 4;  1GY6 A;  6STD A;  3DMC A;  2D42 A;  2XR8 B;  1L5G B;  2D1W A;  1MOL A;  2FXT A;  3BB9 A;  1J2B A;  2CW9 A;  4CCV A;  4BTX A;  1OPY A;  4FMB A;  2KRT A;  4OK0 A;  3K9M C;  4LGQ A;  1RRL A;  3MPH A;  4X2O A;  3KN4 A;  1GS3 A;  4WYK B;  3LTA A;  3MG3 A;  1IVX A;  4GB5 A;  2INX A;  3U97 A;  2W04 A;  3GZY B;  3KFQ C;  3LT8 A;  2YFL B;  2MC8 A;  3GWR A;  3GRD A;  3EBY A;  3V92 A;  1W00 A;  2CH9 A;  3OWY A;  4O02 B;  2C10 A;  1OHP A;  1STF I;  2M7O A;  3SOA A;  3EJV A;  2P0X A;  3UL5 A;  5IG5 A;  4JF8 A;  1ZO2 A;  3N8B A;  1EA2 A;  5LC7 A;  2R4I A;  1YGE A;  2XSO B;  4PEJ A;  1Q40 A;  1VQ5 3;  4MEI A;  3OX9 A;  3G6E 3;  3MHE A;  2IA7 A;  3B4P A;  1UI8 A;  3G71 3;  4HM8 B;  4GL6 A;  5LC6 A;  3X42 A;  5AIH A;  1S5A A;  1R4C A;  5KP1 A;  2OQE C;  2JQ5 A;  1Q86 4;  1N9E A;  1AVL A;  3G8Z A;  1U8C B;  1W2Z A;  2CFG A;  2ML6 A;  3FLJ A;  3LYG A;  3MKI A;  3F7S A;  1ZX2 A;  1M1X B;  2PNC A;  3CXC 2;  4FCM A;  1OHS A;  3F14 A;  4JRF A;  2BT3 A;  1QVG 2;  1VQ7 3;  1ULI B;  5JPU A;  4HKV B;  1GY5 A;  1QAF A;  3EQQ B;  3N54 B;  3STD A;  3CCQ 3;  1HU9 A;  3DZL A;  2CFD A;  4ZM8 A;  2BMQ B;  1VQL 3;  3WOF B;  2W03 A;  4LMI A;  1JV2 B;  3D9R A;  1YIJ 3;  3NUV A;  2XFT A;  2CKF B;  1VQK 3;  1U5O A;  4RZM A;  2CWV A;  4RBN A;  4QWT A;  4J9A A;  3ALA A;  3T8U A;  4OVM A;  3V98 A;  1CYV A;  2STD A;  3PS8 A;  2P09 A;  4N6V 0;  1K8A 4;  2P05 A;  3CNM A;  4AEQ A;  4CDL A;  1VQO 3;  1Z1S A;  4N6N B;  2F99 A;  5G2G A;  1FA3 A;  1EG9 B;  4R80 A;  3X40 A;  4XB5 A;  1CYU A;  3FSD A;  1UUW B;  3H3H A;  4LEH A;  1D6Y A;  4EV5 A;  2OOV C;  3X3Z A;  1WMO A;  4XDV A;  5IG0 A;  3LTD A;  3MSO A;  1KQS 2;  3EN8 A;  3RGR A;  5AII A;  4MMZ B;  3X41 A;  3JUN A;  3HII A;  2HMO B;  2WGO A;  1NJI 4;  2RSX A;  3T0U A;  3FGY A;  1K73 4;  3CNX A;  3UL6 A;  3CC7 3;  2GU3 A;  3LML A;  2W0Q A;  3A76 A;  1N8Q A;  4XBT A;  4RNY A;  1O7P B;  1GD3 A;  1US1 A;  4HM0 B;  1K9M 4;  2JDI H;  1ULJ B;  1FGO A;  3MG2 A;  1LNH A;  4R9L A;  3CCU 3;  2K54 A;  1RRH A;  3FH1 A;  3UNL A;  1JRQ A;  4O2H A;  3FF0 A;  3LZA A;  1JB4 A;  2OCT A;  4HM1 B;  4NHF A;  4HVN A;  3K7C A;  2HMN B;  4EV2 A;  2GEX A;  1UW1 A;  5IF6 A;  1IDP A;  2CG0 A;  5AYS C;  5I97 A;  3KII A;  4XDW A;  2RCD A;  3SX1 A;  3GAX A;  1OF5 B;  3HX8 A;  1N9J A;  1JN5 A;  1E3R A;  2OQE A;  4FMD A;  3BNE A;  1K28 A;  5IW9 A;  2Y74 A;  3EF8 A;  3MYT A;  3CPW 2;  2O3O A;  4WFO A;  1Q82 4;  5EQL A;  1W01 A;  1JKG B;  3ER7 A;  5AIG A;  1W2B 2;  2RGQ A;  4N6M A;  3CPO A;  2CK3 H;  2XSH B;  2BHM A;  3VSY A;  4LZI A;  5AEW B;  3N9H A;  3LXU X;  5D81 A;  4O8S A;  1KSI A;  2B1X B;  5IER A;  4AKZ A;  5TGN A;  3EHC A;  4WP5 A;  2YFJ B;  1W6G A;  1YJ9 3;  5EEO A;  1SJW A;  1GYB A;  1YI2 3;  3GZB A;  3FG3 A;  2QIY A;  1Q81 4;  3VGN A;  1AR0 A;  1O7N B;  3DY5 A;  3JUO A;  4HM6 B;  3DGM A;  1IT7 A;  4OUQ A;  1W7C A;  4STD A;  5IEN A;  1NB3 I;  4J8T A;  3CCV 3;  2HMK B;  1BUQ A;  4XM4 A;  1DMN A;  3FF2 A;  1TIJ A;  3F7X A;  3PXM A;  3CC4 3;  4BTY A;  2HMJ B;  1IT8 A;  1G96 A;  2OOV A;  4EYC A;  1A90 A;  3EB8 A;  7STD A;  3CCL 3;  1IVV A;  1O7M B;  1N5H A;  3DGO A;  3SXX A;  5BXQ A;  1FGT A;  2RFR A;  1QJG A;  1SPU A;  1IV9 A;  2BNG A;  3DGL A;  4HBR A;  1YHQ 3;  3LT9 A;  4KFD A;  2XH9 A;  3Q2P A;  3V99 A;  1T5Y A;  1M9G A;  3ROB A;  1D6Z A;  3HI7 A;  3BNB A;  1JKG A;  2W2C A;  5JBS A;  2BMO B;  1IU7 A;  1SQW A;  3Q1C A;  3MWZ A;  1VQ6 3;  1DVD A;  3SED A;  1YIT 3;  1VQN 3;  4LSO A;  2GEY A;  4N6T A;  4TX4 A;  4WYK A;  3FKA A;  2ML5 A;  1VQ8 3;  2SBL A;  1NU3 A;  2BMR B;  2XEP A;  2Z7A A;  1GY7 A;  4L7K A;  3JVC A;  2CIU A;  4WWU C;  1JB2 A;  1OHO A;  1ROV A;  1UUV B;  3CU3 A;  4ORL A;  3LOY A;  3WMD A;  1E3V A;  3EC9 A;  3IMA B;  1VQ9 3;  1STD A;  3FG1 A;  3G0K A;  1GD4 A;  1WMN A;  4HJL B;  4R9K A;  3RDE A;  1O7G B;  1IQX A;  2OWP A;  3CD6 3;  3WA3 A;  3G16 A;  3M8C A;  2GBX B;  3ECF A;  3CCS 3;  1WMP A;  3DGN A;  1NWW A;  2XGL A;  2CWT A;  4N6O B;  1JJ2 2;  2GU1 A;  3LTB A;  4EXR A;  5KP4 A;  3FG4 A;  1LVN A;  3KKG A;  3WOE B;  1KD1 4;  1W5Z A;  3KSE D;  3NQY A;  2P38 A;  3PCS A;  3HIG A;  2IMJ A;  3EBT A;  1VQP 3;  1OGX A;  3BND A;  3NM2 A;  3K63 A;  4XBX A;  3K5T A;  3OWU A;  4N6U A;  3B7C A;  4MMY B;  4R1K A;  5IG3 A;  1NB5 I;  4XBY A;  1O7W B;  1TUH A;  3S5C A;  2XF3 A;  5JPP A;  1A2V A;  3F8X A;  5AI1 A;  4KFF A;  3TDG A;  2XRX B;  4H61 A;  2CHC A;  2PZV A;  1ISK A;  3B8L A;  4BTW A;  1YJW 3;  1N8R 4;  3Q90 A;  2LYX A;  2Q07 A;  1M1K 4;  1KC8 4;  3NM7 A;  4HM3 B;  4O3V A;  2QEX 3;  2V1L A;  3S29 A;  2WOF A;  1IQ8 A;  2F86 B;  3EE1 A;  3NBJ A;  2OTL 3;  2OTJ 3;  3NV0 B;  3X3Y A;  2K0M A;  4FR9 A;  2Z6B A;  5DRV A;  2A15 A;  3CCE 3;  1W02 A;  1VQ4 3;  3B4O A;  2Y73 A;  3LH4 A;  5CF1 A;  1Y4K A;  1QMA A;  2CFW A;  1JB5 A;  1FUW A;  4HM5 B;  2F98 A;  4EBG A;  5STD A;  1YVB I;  1W6Y A;  1FGQ A;  5HGR A;  5KP3 A;  1NO3 A;  3QRD A;  5CXO A;  2CG1 A;  1EKM A;  3BLZ A;  3WDG B;  1PFP A;  2ZDJ A;  1TU5 A;  1IVU A;  3KZT A;  3GZX B;  4AKY A;  2XFS A;  3UJM A;  3DUK A;  1TP6 A;  1WQL B;  2W9P A;  3UB1 A;  1F8N A;  4MMX B;  2B24 B;  1RN7 A;  1LOX A;  1KWI A;  1AVK A;  5AYR B;  1OGZ A;  2W9Q A;  1TFO A;  1IK3 A;  3NHX A;  3FZW A;  3BNC A;  1SIH A;  3D3L A;  3L0R A;  3CCM 3;  2QA4 3;  3EX9 A;  1ROA A;  3IJE B;  3KE7 A;  1M90 4;  4MJD A;  3NBR A;  1CEW I;  2Z77 A;  1IQY A;  4U13 A;  1NDO B;  3NV0 A;  2HML B;  4K1V A;  3G4S 3;  1C7H A;  1MNL A;  4Q53 A;  2GXF A;  3DM8 A;  4IT7 A;  3JUM A;  4HM2 B;  5IG4 A;  4FCZ A;  5D82 A;  2WO0 A;  1YJN 3;  1OF5 A;  4HYZ A;  2GBW B;  2YFI B;  3AMO B;  4NRE A;  8CHO A;  3I55 3;  3O8Y A;  3CCR 3;  2IUK A;  3CME 3;  1DYU A;  5IEP A;  3GZR A;  5A0O B;  3PCR A;  1ASK A;  4IIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...