1QJGA

Crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni in complex with equilenin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Delta-5-3-Ketosteroid Isomerase from Pseudomonas Testosteroni in Complex with Equilenin Settles the Correct Hydrogen Scheme for Transition-State Stabilization
pubmed doi rcsb
source organism Pseudomonas testosteroni
molecule tags Isomerase
molecule keywords KETOSTEROID ISOMERASE
total genus 36
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1qjgA00
3A76A 3GZBA 1O7PB 3OWYA 3FGYA 3F7XA 1OGXA 1SJWA 3MKIA 4HM6B 5DREA 3F8HA 5KP4A 2XRXB 4OVMA 2Z76A 3B4PA 3OXAA 1ZO2A 1ULIB 4HZ9B 4R9LA 6STDA 3HZPA 4HM8B 3OWSA 2CKFB 4U13A 3KE7A 2BMQB 1CQSA 1EG9B 4FCJA 4Q53A 1QJGA 3UJMA 4LGQA 5BXQA 3DUKA 2GEYA 1GS3A 1TUHA 3FSDA 3H51A 3EN8A 3LZAA 3VGNA 4WYKA 2QIYA 1O7NB 2INXA 5IG4A 3CNMA 2RFRA 5KP3A 5AEWB 1JN5B 1W01A 3E99A 4XBXA 4HM2B 1DMNA 5KP1A 1E97A 3CNXA 3F14A 4L8OA 3F40A 1NWWA 2RGQA 2BMRB 2GBXB 5D83A 3KZTA 1Q40B 1ULJB 4OUQA 2F99A 8CHOA 4CDLA 4HM1B 2F98A 5IG5A 3F8XA 1DMQA 4HM7B 3FLJA 3EJVA 3JUMA 4XBTA 2HMOB 1OPYA 5STDA 3UNLA 4K1VA 3HX8A 4WYKB 2I9WA 3RGRA 3GRDA 1W00A 2QGUA 1NDOB 3FKAA 4HM3B 4XM4A 5AEUB 3BLZA 2HMNB 3F9SA 3MSOA 5D82A 1E3RA 1UUWB 3NV0B 3T8NA 5IERA 3BB9A 4PEJA 3GZYB 3NXJA 1E3VA 2IMJA 1OHSA 2YFIB 3GZXB 4XDVA 4WP5A 3GZRA 2R4IA 4FCMA 2GXFA 2PZVA 3F7SA 3JUQA 1K41A 1JB2A 1IDPA 3NUVA 4J9AA 4XDWA 3MYTA 4X2OA 3FH1A 2BNGA 5DRVA 3B4OA 2B1XB 1AR0A 3FF2A 3MHEA 2JQ5A 4H3UA 4RZMA 5EVHA 1TP6A 5FW5A 3S5CA 1OF5B 3DZLA 3KSPA 2HMMB 3DM8A 5HGRA 2K54A 2STDA 3FF0A 1O7GB 4WWUC 3G16A 4XB5A 2Z7AA 3ER7A 1OCVA 3WMDA 2F86B 1C7HA 3EBTA 3I0YA 3MG2A 5IEOA 3B8LA 3CPOA 5IEPA 1JKGB 3EX9A 3EQQB 3H3HA 1JB4A 4R1KA 3SOYA 3G0KA 3JUPA 5CK6A 2BMOB 1W6YA 2OWPA 3IPTA 3EF8A 3EHCA 4XBYA 5AIHA 5JPUA 1ASKA 2RCDA 3DXOA 3Q90A 1GYBA 3EN1B 2XSOB 3RGAA 1U5OA 3OWUA 4STDA 2HMKB 3K7CA 5BVBA 1HKXA 3FZWA 3CU3A 5CXOA 5AIIA 2B24B 1JN5A 3T8UA 4I4KA 2GBWB 2CHCA 4GB5A 4HZBB 5IG0A 2UX0A 7STDA 3G8ZA 3KKGA 3D9RA 3SOAA 2YFLB 3ROBA 1O7HB 4HM0B 1GY7A 1Q40A 1W02A 3GWRA 3OX9A 5TGNA 3EBYA 3LYGA 3OV4A 5IF6A 4HM4B 4L7KA 3B7CA 3NV0A 1JKGA 5IENA 3SEDA 2Z77A 3NBRA 4LMIA 4R9KA 1OHOA 1UUVB 1DMMA 2HMLB 3NM2A 1GY6A 4HKVB 3JUNA 4J8TA 4ORLA 1O7WB 1BUQA 3MG3A 1JB5A 4HM5B 4LEHA 4X2HA 3EC9A 3DMCA 1A2KA 1STDA 2GEXA 3HK4A 1ZX2A 4HJLB 3VSYA 5CF1A 1NU3A 1O7MB 1WQLB 3JUOA 3K0ZA 1EA2A 1QMAA 4L8PA 4MJDA 5AIGA 5AIFA 3STDA 1ISKA 2W2CA 3M8CA 5CLKA 4K1UA 5D81A 1S5AA 1VZZA 2XSHB 5IG3A 4N3VA 2HMJB 2YFJB 3MG1A 4KVHA 5JPPA 3ECFA 1Q42A 1GY5A 1OF5A 1OH0A 1Z1SA 5G2GA 5CF2A 4HVNA 4IIAA 1OGZA 2XR8B 3NHXA 2A15A 5AI1A 1OHPA 1OUNA
chains in the Genus database with same CATH superfamily
1Q7HA 1O7PB 3OWYA 3F7XA 1OGXA 2W0QA 2K0MA 1TFKA 3F8HA 1VQO3 3GSPA 4LZIA 2RBIA 2KF4A 2OQEC 1RNBA 1PY3A 2AADA 3KE7A 3S28A 3D79A 1BNGA 2XF3A 3EE1A 4NPBA 1MGWA 3V99A 3A5EA 1BSDA 3G4S3 1GMPA 1K9M4 3CCR3 1N9EA 2QIYA 4J5KA 1FYSA 1RRLA 2INXA 5IG4A 4MMXB 1RN7A 1I0VA 4XBXA 1DMNA 3F14A 4O8SA 2RGQA 1GMRA 3PS8A 1Q40B 4N6UA 1I3FA 1ULJB 2O3OA 4NHFA 2F98A 3FLJA 1IT7A 4KFEA 2HMOB 2MF7A 1RLSA 3FCSB 4LYLB 4HBRA 4R4KA 1A2VA 1W2B2 1JBSA 3CCU3 5LC7A 3HX8A 1KQS2 1RMSA 1SQWA 1BNRA 3ZFZA 3GRDA 2KRTA 3FKAA 4FMCA 4K90B 2CWTA 3BLZA 1N5PA 2J8XB 3GAXA 3MSOA 1V57A 3CCM3 3NV0B 3K5TA 1E3VA 2UUGC 6GSPA 1UGHI 2CX1A 2R4IA 1KSIA 3WA2X 2CK3H 4J9AA 3ZG0A 3RNTA 2IYJA 1MWSA 1AR0A 2YX9A 1A90A 1CYVA 3N54B 4N6LA 1VQN3 3HIIA 3LH4A 4HAAA 1B21A 3JVCA 2HMMB 3BNDA 1K28A 5HGRA 1IT8A 2STDA 1O7GB 1NO3A 2F5WA 1T2HA 4WWUC 3LXUX 3PCSA 4XB5A 3ER7A 1EEJA 3QRDA 3D4AA 5IEOA 1LXEA 1N5HA 5I97A 1B20A 3SOYA 2BO9B 5AIHA 3BNCA 4XBYA 3EHCA 3Q3FA 1LNIA 3DXOA 1AV4A 3UL5A 3WOFB 2IY2A 1N8QA 3CCS3 1WMPA 3FG3A 1RHLA 4N6MA 3CU3A 1JN5A 1BSAA 2KF3A 2CHCA 7STDA 4IPBA 3CXC2 3LT8A 2OOVA 1I2FA 2WO0A 1GOUA 3D9RA 3KKGA 3CD63 3KIIA 2XFSA 1W02A 3LOYA 1JBTA 3G713 3CCQ3 1EKMA 1RN1A 1MWTA 1D6ZA 1IVUA 1JKGA 3SEDA 4R9KA 3SVAA 1ROAA 1BAOA 2HMLB 3NM2A 2LQVA 3AHSA 4EBGA 4J8TA 1BUQA 2IA7A 1O7WB 1GD4A 1NJI4 4HM5B 1NB5I 4X2HA 1SPUA 2XGLA 1RGFA 3HK4A 2BIRA 5CF1A 5AYSC 3AMOA 1WQLB 4EW5A 1MGRA 2CFLA 1ISKA 1SIHA 1Q814 3DGYA 3M8CA 1FUTA 1LVNA 4K1UA 1YIT3 1S5AA 1VZZA 4N3VA 1LOXA 3MG1A 1RGGA 1OF5A 2H0GA 1NNVA 2CFKA 1IQYA 2M7OA 4IIAA 4JF8A 2CWUA 5AI1A 5DREA 4HM6B 5KP4A 4OVMA 2K3DA 5M18A 2Z76A 4OK0A 2Y73A 4R9LA 3OWSA 2CKFB 1TJDA 1JZOA 2BMQB 3N8BA 1EG9B 1VQP3 4LGQA 2L4VA 3DUKA 3FSDA 1MNLA 1TUHA 1HU9A 1UCKA 1ZGXA 3BIRA 3H51A 1YJW3 2ZDJA 4WYKA 3SX1A 3MPHA 4EC6A 1O7NB 1GOVA 4AKYA 2CW9A 2KAAA 3CNMA 5KP3A 3BNBA 3MWZA 1YHQ3 2C4BA 4HM2B 1FGOA 1VQM3 5JBSA 1CEWI 1W2ZA 1BNIA 2BMRB 2FGTA 4JRFA 4BL3A 1M9GA 3KZTA 1CYUA 1TIJA 2P0XA 2F99A 2H0HA 4IT7A 2CC3A 2ML5A 1Q864 4MMYB 5IG5A 3F8XA 4HM7B 4N6V0 1IU7A 3EJVA 1V58A 4XBTA 3CMA3 2CIUA 1I2GA 4O02B 4HYZA 1G96A 2W56A 1GOYA 2CX0A 4FMAA 3DH2A 1W00A 1TRQA 2E2TA 4HM3B 2OQEA 1RRHA 2ZA4A 3V98A 1YIJ3 2D1WA 1E3RA 1IV7A 1BU4A 1LOVA 1YGEA 3PZWA 3T8NA 3PCRA 4PEJA 1N9JA 4XDVA 1OHSA 1JNQA 4CPKA 3GZRA 3I553 2W9PA 3CME3 3X42A 1VQ43 1K41A 1JB2A 4XDWA 3NUVA 4RNZA 3HOHA 1YI23 4X2OA 1JBRA 4J5GA 4GHOA 2ZHXB 2B1XB 1LQGC 3MHEA 3LTBA 4AKZA 1VQ93 1US1A 4H3UA 1HYFA 4RZMA 1VQK3 5FW5A 3D5GA 3KSPA 4FMDA 3CPW2 3DM8A 3NM7A 2K54A 5G1KA 1Q824 3G16A 3X3ZA 4RNYA 1B2XA 2Q07A 1QAFA 1PYLA 1T5YA 3S29A 3WMDA 3EBTA 4BTYA 5IEPA 1K734 1IVXA 3B8LA 3CPOA 2ZL8A 4N6TA 3G0KA 5CK6A 2BMOB 1HZ1A 1W6YA 3IPTA 3EF8A 5G1LA 3U1WA 5HOHA 1QVF2 1ASKA 1BSCA 2WGOA 3X41A 3WR2A 2XSOB 3RGAA 2O9UX 2PNCA 3NBJA 1PFPA 4EV5A 1KC84 1HKXA 2UGIA 3FZWA 5AIIA 1UCJA 4G1MB 3T8UA 4KZ1A 4GB5A 4HZBB 1BANA 5ELUA 1FW7A 3WHOA 1VQL3 3WA3A 3ROBA 4HM0B 1G0TA 1K8A4 3OX9A 4CJNA 3LTCA 1BRGA 4L7KA 3NV0A 1U8CB 3S67A 4HKVB 2FNQA 4BTWA 3JUNA 4KFFA 2QEX3 2JDIH 3MG3A 1JB5A 4LEHA 1J2BA 3EC9A 4LSOA 1VQ63 3DMCA 2GEXA 1ZX2A 1RGEA 1S723 3IJEB 3JUOA 1I70A 4L8PA 1MWRA 5AIGA 4AEQA 2WOHA 1W4NA 2BT3A 3IMAB 1RGHA 5JPPA 2KF5A 1LQMB 2YFJB 2R41A 4KVHA 1IQ8A 3ECFA 5EEOA 3D3LA 1IV9A 1DVCA 2KCDA 2CG1A 1BOXA 1LRAA 5CF2A 4HVNA 1OGZA 3SLUA 1BUJA 2XR8B 1W6CA 2A15A 1SJWA 3A76A 3GZBA 3MKIA 1T3BA 1BNJA 3Q1CA 4HZ9B 1W6GA 1RDSA 3CC23 1W7CA 1YGWA 1CQSA 4O3VA 3K9MC 4Q53A 1QJGA 3UJMA 2OTL3 2P09A 2GEYA 1GS3A 2AAEA 2Y74A 3LZAA 4BU4A 3X3XA 1B2UA 2F56A 2RFRA 5AEWB 1JN5B 2XH9A 5KP1A 1E97A 4ZM8A 1SIIA 2P05A 2XFTA 3F40A 1JV2B 1IQXA 2GBXB 5D83A 1BNSA 2F5MA 2E2VA 3T0UA 3KFQC 8CHOA 3DY5A 4CDLA 2RNTA 1TFOA 2OCTA 4HM1B 4KFDA 1DMQA 1LOYA 1AVKA 5FGOA 1UCLA 5STDA 3TDGA 4K1VA 3UNLA 4MEIA 6RNTA 4ILFA 1AQZA 2I9WA 5GSPA 6STDA 4K61A 1RJOA 4WFOA 5AEUB 1FUWA 1FGMA 1VQ83 1AVLA 1LNHA 1IYYA 1QALA 3BNEA 5ELJA 1B2SA 2C11A 3BB9A 4GSPA 3GZYB 1UW1A 5M1AA 1RGCA 1R4YA 2IUJA 4WP5A 5A0OB 1IK3A 2GU3A 1RN4A 2ML6A 2CG0A 1M1XB 2GXFA 2W03A 3F7SA 2CWVA 4FCMA 4RNTA 4DKIA 1ZS7A 1RTUA 2BNGA 2XGNA 1DVDA 3B4OA 4QWTA 3LTAA 3D5IA 3ALAA 1FA3A 2CH9A 1KD14 2QA43 4CCVA 3NQYA 1MOLA 1TP6A 2XEPA 3KSED 3DZLA 3J7Yd 1N8R4 1A67A 1M904 1IVVA 3V92A 3AGNA 4R80A 1BIRA 4BIRA 2Z7AA 1OCVA 4MMZB 3SXXA 1M1K4 1C7HA 5BIRA 3X40A 3MG2A 3URPA 1JKGB 3CCJ3 1JZDA 3EX9A 3EQQB 1Y4KA 1JB4A 3PXMA 3Q2PA 4R1KA 3VGNA 1CH0A 5JPUA 1BNFA 1EQKA 2RCDA 3Q90A 3EB8A 3ZG5A 2P38A 3EN1B 1WMOA 3OWUA 5BVBA 2BU4A 3RDEA 4I4KA 2GBWB 1G02A 5IG0A 2BHMA 1QVG2 4KT3B 1BRKA 4I5QA 3UL6A 1AY7A 2RSXA 2YFLB 5RNTA 3QK9A 1Q40A 3HI7A 4H61A 5TGNA 1F8NA 2GU1A 3EBYA 5IF6A 4HM4B 3B7CA 1SARA 1UGIA 3KN4A 1VQQA 3NBRA 2E2UA 3DGMA 5EQLA 4EXRA 1KWIA 3CC73 1STFI 2SARA 3N9HA 1BNEA 3VSYA 1A2KA 1BRIA 1STDA 1X1XA 4HJLB 4FR9A 5AIFA 3STDA 1FGRA 5CLKA 5D81A 1L5GB 3L0RA 3CCL3 3AGOA 2HMJB 7GSPA 1IVWA 1I3IA 1VQ53 1GY5A 1OH0A 2Z6BA 1V74A 3CC43 4BL2A 2SBLA 3HIGA 4O2HA 2MC8A 1OHPA 8RNTA 3FGYA 1R4CA 2P0MA 2XRXB 1YVBI 3PGBA 3B4PA 4TX4A 3OXAA 1ZO2A 1ULIB 4NREA 3HZPA 4HM8B 4FMBA 4U13A 4GL6A 3AMOB 5BXQA 1B2ZA 1BRNL 2W04A 3EN8A 1WMNA 1DETA 1MWUA 1X1UA 1YNVX 1BRJA 4HOHA 3NQZA 1YJN3 5IW9A 1RGKA 1W01A 3E99A 1EUIC 3CNXA 1D6UA 4L8OA 3NX0A 1NWWA 2GSPA 4OUQA 3X3YA 1OACA 4EV2A 4WHAA 2OOVC 1BVIA 2LYXA 3JUMA 3NBBA 2KF6A 1OPYA 1I0XA 3WDGB 7RNTA 3O8YA 4WYKB 3RGRA 1QAKA 2H0IA 3KCHA 4XM4A 2QGUA 1NDOB 2CFGA 3F9SA 1RCLA 2HMNB 3FG4A 2CFWA 1UI7A 2FXTA 1UUWB 5D82A 5IERA 3AHWA 2W9QA 3NXJA 1RNTA 2IMJA 2YFIB 3GZXB 3LT9A 1Q7Y4 2PZVA 1B27A 1TRPA 4FCZA 3FG1A 3JUQA 1W5ZA 1IDPA 3MYTA 1RKYA 4RBNA 1GMQA 2KXGA 1WNHA 1Q9EA 1D6YA 3FH1A 5DRVA 3G6E3 2W56B 1PU4A 1FGTA 3FF2A 2JQ5A 1BSBA 4N6NB 3I563 5EVHA 3S5CA 1OF5B 1UDII 3LTDA 1VQ73 3CCE3 4N6OB 2OTJ3 2W6JH 3FF0A 2L1SA 5BU4A 1RGLA 1TU5A 2F86B 5AYRB 3DGLA 1BRSA 1RSNA 3I0YA 5LC6A 1UCIA 2HOHA 3H3HA 1FZUA 1GD3A 3JUPA 2OWPA 2D42A 3BU4A 1GYBA 4BTXA 1ROVA 1U5OA 4STDA 3SYUA 2HMKB 3K7CA 1JJ22 1BSEA 5CXOA 2WOFA 2B24B 1B2MA 1NB3I 3U97A 2UX0A 3G8ZA 1WTHA 2WGQA 3SOAA 3WOEB 3WODG 1RCKA 1O7HB 4EYCA 1GY7A 3GWRA 1UI8A 1UUGB 3LYGA 5M19A 1I8VA 3OV4A 5IENA 1TTOA 2Z77A 4LMIA 1OHOA 1UUVB 1DMMA 3OW22 3PYJA 1GY6A 9RNTA 1X1WA 3DGOA 4ORLA 3VF1A 1C54A 1I2EA 3DGNA 2F4YA 1BGSA 1YJ93 1FGQA 2C10A 3LMLA 1DE3A 1NU3A 1O7MB 3K0ZA 4MJDA 1EA2A 1QMAA 1A2PA 1BRHA 1B3SA 1JRQA 2W2CA 3K63A 1FUSA 5IG3A 3UB1A 2XSHB 1GSPA 2CFDA 1LOWA 2IUKA 3S27A 3CCV3 1Q42A 2V1LA 1RGAA 1DYUA 5G2GA 1Z1SA 1X1YA 1YVSA 3NHXA 4FCJA 1T2IA 1OUNA
chains in the Genus database with same CATH topology
1O7PB 3OWYA 3F7XA 1OGXA 2W0QA 2K0MA 1TFKA 3F8HA 1VQO3 4LZIA 2OQEC 3KE7A 3S28A 2XF3A 3EE1A 3V99A 1K9M4 3G4S3 3CCR3 1N9EA 2QIYA 1RRLA 2INXA 5IG4A 4MMXB 1RN7A 4XBXA 1DMNA 3F14A 4O8SA 2RGQA 3PS8A 1Q40B 4N6UA 1ULJB 2O3OA 4NHFA 2F98A 3FLJA 1IT7A 4KFEA 2HMOB 2MF7A 3FCSB 4HBRA 4R4KA 1A2VA 1W2B2 1KQS2 3CCU3 5LC7A 3HX8A 1SQWA 3GRDA 2KRTA 3FKAA 4FMCA 4K90B 2CWTA 3BLZA 1N5PA 3GAXA 3MSOA 3CCM3 3NV0B 3K5TA 1E3VA 2R4IA 1KSIA 3WA2X 2CK3H 4J9AA 1AR0A 2YX9A 1A90A 1CYVA 3N54B 4N6LA 1VQN3 3HIIA 3LH4A 3JVCA 2HMMB 3BNDA 1K28A 5HGRA 1IT8A 2STDA 1O7GB 1NO3A 4WWUC 3LXUX 3PCSA 4XB5A 3ER7A 3QRDA 5IEOA 1LXEA 1N5HA 5I97A 3SOYA 2BO9B 5AIHA 3BNCA 4XBYA 3EHCA 3UL5A 3DXOA 1AV4A 3WOFB 3CCS3 1N8QA 1WMPA 3FG3A 4N6MA 3CU3A 1JN5A 2CHCA 7STDA 4IPBA 3CXC2 3LT8A 2OOVA 3CD63 2WO0A 3KKGA 3D9RA 3KIIA 2XFSA 1W02A 3LOYA 3G713 3CCQ3 1EKMA 1D6ZA 1IVUA 1JKGA 3SEDA 4R9KA 3SVAA 1ROAA 2HMLB 3NM2A 2LQVA 4EBGA 4J8TA 1BUQA 2IA7A 1O7WB 1GD4A 1NJI4 4HM5B 1NB5I 4X2HA 1SPUA 2XGLA 3HK4A 5CF1A 5AYSC 3AMOA 1WQLB 2CFLA 1ISKA 1SIHA 1Q814 3M8CA 1LVNA 4K1UA 1YIT3 1S5AA 1VZZA 4N3VA 1LOXA 3MG1A 1OF5A 2CFKA 1IQYA 2M7OA 4IIAA 4JF8A 2CWUA 5AI1A 5DREA 4HM6B 5KP4A 4OVMA 2Z76A 4OK0A 2Y73A 4R9LA 3OWSA 2CKFB 2BMQB 3N8BA 1EG9B 1VQP3 4LGQA 2L4VA 3DUKA 3FSDA 1MNLA 1TUHA 1HU9A 3H51A 3VGNA 1YJW3 2ZDJA 4WYKA 3SX1A 3MPHA 4EC6A 1O7NB 4AKYA 2CW9A 3CNMA 5KP3A 3BNBA 3MWZA 1YHQ3 4HM2B 1FGOA 1VQM3 5JBSA 1CEWI 1W2ZA 2BMRB 2FGTA 4JRFA 1M9GA 3KZTA 1CYUA 1TIJA 2P0XA 2F99A 4IT7A 2CC3A 2ML5A 1Q864 4MMYB 5IG5A 3F8XA 4HM7B 4N6V0 1IU7A 3EJVA 4XBTA 3CMA3 2CIUA 4O02B 4HYZA 1G96A 2W56A 4FMAA 2OQEA 1W00A 1YIJ3 2E2TA 4HM3B 1RRHA 3V98A 2D1WA 1E3RA 1IV7A 3T8NA 1YGEA 3PZWA 3PCRA 4PEJA 1N9JA 4XDVA 1OHSA 1JNQA 3I553 3GZRA 2W9PA 3CME3 3X42A 1VQ43 1K41A 1JB2A 4XDWA 3NUVA 4RNZA 1YI23 4X2OA 2B1XB 3MHEA 3LTBA 4AKZA 1VQ93 1US1A 4H3UA 4RZMA 1VQK3 5FW5A 3KSPA 4FMDA 3CPW2 3DM8A 3NM7A 2K54A 1Q824 3G16A 3X3ZA 4RNYA 2Q07A 1QAFA 1T5YA 3S29A 3WMDA 4BTYA 3EBTA 5IEPA 1K734 1IVXA 3B8LA 3CPOA 2ZL8A 4N6TA 3G0KA 5CK6A 2BMOB 1W6YA 3IPTA 1QVF2 3EF8A 3U1WA 1ASKA 2WGOA 3X41A 2XSOB 3RGAA 2O9UX 2PNCA 3NBJA 1PFPA 4EV5A 1KC84 1HKXA 3FZWA 5AIIA 4G1MB 3T8UA 4KZ1A 4GB5A 4HZBB 5ELUA 1VQL3 3WA3A 3ROBA 4HM0B 1K8A4 3OX9A 3LTCA 4L7KA 3NV0A 1U8CB 3S67A 4HKVB 2FNQA 4BTWA 3JUNA 4KFFA 2QEX3 2JDIH 3MG3A 1JB5A 4LEHA 1J2BA 3EC9A 4LSOA 1VQ63 3DMCA 2GEXA 1ZX2A 1S723 3IJEB 3JUOA 4L8PA 5AIGA 4AEQA 2WOHA 1W4NA 2BT3A 3IMAB 5JPPA 2YFJB 4KVHA 5EEOA 3ECFA 1IQ8A 3D3LA 1IV9A 1DVCA 2KCDA 2CG1A 5CF2A 4HVNA 1OGZA 3SLUA 2XR8B 1W6CA 2A15A 1SJWA 3A76A 3GZBA 3MKIA 3Q1CA 4HZ9B 1W6GA 3CC23 1W7CA 1CQSA 4O3VA 3K9MC 4Q53A 1QJGA 3UJMA 2OTL3 2P09A 2GEYA 1GS3A 2Y74A 3LZAA 3X3XA 2RFRA 5AEWB 1JN5B 2XH9A 5KP1A 1E97A 4ZM8A 1SIIA 2P05A 2XFTA 3F40A 1JV2B 1IQXA 2GBXB 5D83A 3T0UA 2E2VA 3KFQC 8CHOA 3DY5A 4CDLA 1TFOA 2OCTA 4HM1B 4KFDA 1DMQA 1AVKA 5FGOA 5STDA 3TDGA 4K1VA 3UNLA 4MEIA 2I9WA 6STDA 4K61A 1RJOA 4WFOA 5AEUB 1FUWA 1FGMA 1VQ83 1AVLA 1LNHA 1QALA 3BNEA 5ELJA 2C11A 3BB9A 3GZYB 1UW1A 2IUJA 4WP5A 5A0OB 1IK3A 2GU3A 2ML6A 2CG0A 1M1XB 2GXFA 2W03A 3F7SA 2CWVA 4FCMA 2BNGA 2XGNA 1DVDA 3B4OA 4QWTA 3LTAA 1FA3A 3ALAA 2CH9A 1KD14 2QA43 4CCVA 3NQYA 1MOLA 1TP6A 2XEPA 3KSED 3DZLA 3J7Yd 1N8R4 1A67A 1M904 1IVVA 3V92A 4R80A 2Z7AA 1OCVA 4MMZB 3SXXA 1M1K4 1C7HA 3X40A 3MG2A 1JKGB 3CCJ3 3EX9A 3PXMA 3EQQB 1Y4KA 1JB4A 3Q2PA 4R1KA 5JPUA 1EQKA 2RCDA 3Q90A 3EB8A 2P38A 3EN1B 1WMOA 3OWUA 5BVBA 3RDEA 4I4KA 2GBWB 5IG0A 2BHMA 1QVG2 3UL6A 2RSXA 2YFLB 3QK9A 1Q40A 3HI7A 4H61A 5TGNA 1F8NA 2GU1A 3EBYA 5IF6A 4HM4B 3B7CA 3KN4A 3NBRA 5EQLA 2E2UA 3DGMA 4EXRA 1KWIA 3CC73 1STFI 3N9HA 3VSYA 1A2KA 1STDA 4HJLB 4FR9A 5AIFA 3STDA 1FGRA 5CLKA 5D81A 1L5GB 3L0RA 3CCL3 2HMJB 1IVWA 1VQ53 1GY5A 1OH0A 2Z6BA 1V74A 3CC43 2SBLA 3HIGA 4O2HA 2MC8A 1OHPA 3FGYA 1R4CA 2P0MA 2XRXB 1YVBI 3PGBA 3B4PA 4TX4A 3OXAA 1ZO2A 1ULIB 4NREA 3HZPA 4HM8B 4FMBA 4U13A 4GL6A 3AMOB 5BXQA 2W04A 3EN8A 1WMNA 3NQZA 1YJN3 5IW9A 1W01A 3E99A 3CNXA 1D6UA 4L8OA 3NX0A 1NWWA 4OUQA 3X3YA 1OACA 4EV2A 4WHAA 2OOVC 2LYXA 3JUMA 3NBBA 1OPYA 3WDGB 3O8YA 4WYKB 3RGRA 1QAKA 4XM4A 2QGUA 1NDOB 2CFGA 3F9SA 2HMNB 3FG4A 1UI7A 2CFWA 2FXTA 1UUWB 5D82A 5IERA 2W9QA 3NXJA 2IMJA 2YFIB 3GZXB 3LT9A 1Q7Y4 2PZVA 4FCZA 3FG1A 3JUQA 1W5ZA 1IDPA 3MYTA 1RKYA 4RBNA 3FH1A 2KXGA 1WNHA 5DRVA 1D6YA 3G6E3 2W56B 1PU4A 1FGTA 3FF2A 2JQ5A 4N6NB 3I563 5EVHA 3S5CA 1OF5B 3LTDA 1VQ73 3CCE3 4N6OB 2OTJ3 2W6JH 3FF0A 1TU5A 2F86B 5AYRB 3DGLA 3I0YA 5LC6A 3H3HA 1GD3A 3JUPA 2OWPA 2D42A 1GYBA 4BTXA 1ROVA 1U5OA 4STDA 2HMKB 3K7CA 1JJ22 5CXOA 2WOFA 2B24B 1NB3I 3U97A 2UX0A 3G8ZA 1WTHA 2WGQA 3SOAA 3WOEB 3WODG 1O7HB 4EYCA 1GY7A 3GWRA 1UI8A 3LYGA 3OV4A 5IENA 2Z77A 4LMIA 1OHOA 1UUVB 1DMMA 3OW22 3PYJA 1GY6A 3DGOA 4ORLA 3VF1A 3DGNA 1YJ93 1FGQA 2C10A 3LMLA 1NU3A 1O7MB 3K0ZA 4MJDA 1EA2A 1QMAA 3K63A 1JRQA 2W2CA 5IG3A 3UB1A 2XSHB 3S27A 2CFDA 3CCV3 2IUKA 1Q42A 2V1LA 1DYUA 5G2GA 1Z1SA 3NHXA 4FCJA 1OUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A76 A;  3GZB A;  1O7P B;  3OWY A;  3FGY A;  3F7X A;  1OGX A;  1SJW A;  3MKI A;  4HM6 B;  5DRE A;  3F8H A;  5KP4 A;  2XRX B;  4OVM A;  2Z76 A;  3B4P A;  3OXA A;  1ZO2 A;  1ULI B;  4HZ9 B;  4R9L A;  6STD A;  3HZP A;  4HM8 B;  3OWS A;  2CKF B;  4U13 A;  3KE7 A;  2BMQ B;  1CQS A;  1EG9 B;  4FCJ A;  4Q53 A;  1QJG A;  3UJM A;  4LGQ A;  5BXQ A;  3DUK A;  2GEY A;  1GS3 A;  1TUH A;  3FSD A;  3H51 A;  3EN8 A;  3LZA A;  3VGN A;  4WYK A;  2QIY A;  1O7N B;  2INX A;  5IG4 A;  3CNM A;  2RFR A;  5KP3 A;  5AEW B;  1JN5 B;  1W01 A;  3E99 A;  4XBX A;  4HM2 B;  1DMN A;  5KP1 A;  1E97 A;  3CNX A;  3F14 A;  4L8O A;  3F40 A;  1NWW A;  2RGQ A;  2BMR B;  2GBX B;  5D83 A;  3KZT A;  1Q40 B;  1ULJ B;  4OUQ A;  2F99 A;  8CHO A;  4CDL A;  4HM1 B;  2F98 A;  5IG5 A;  3F8X A;  1DMQ A;  4HM7 B;  3FLJ A;  3EJV A;  3JUM A;  4XBT A;  2HMO B;  1OPY A;  5STD A;  3UNL A;  4K1V A;  3HX8 A;  4WYK B;  2I9W A;  3RGR A;  3GRD A;  1W00 A;  2QGU A;  1NDO B;  3FKA A;  4HM3 B;  4XM4 A;  5AEU B;  3BLZ A;  2HMN B;  3F9S A;  3MSO A;  5D82 A;  1E3R A;  1UUW B;  3NV0 B;  3T8N A;  5IER A;  3BB9 A;  4PEJ A;  3GZY B;  3NXJ A;  1E3V A;  2IMJ A;  1OHS A;  2YFI B;  3GZX B;  4XDV A;  4WP5 A;  3GZR A;  2R4I A;  4FCM A;  2GXF A;  2PZV A;  3F7S A;  3JUQ A;  1K41 A;  1JB2 A;  1IDP A;  3NUV A;  4J9A A;  4XDW A;  3MYT A;  4X2O A;  3FH1 A;  2BNG A;  5DRV A;  3B4O A;  2B1X B;  1AR0 A;  3FF2 A;  3MHE A;  2JQ5 A;  4H3U A;  4RZM A;  5EVH A;  1TP6 A;  5FW5 A;  3S5C A;  1OF5 B;  3DZL A;  3KSP A;  2HMM B;  3DM8 A;  5HGR A;  2K54 A;  2STD A;  3FF0 A;  1O7G B;  4WWU C;  3G16 A;  4XB5 A;  2Z7A A;  3ER7 A;  1OCV A;  3WMD A;  2F86 B;  1C7H A;  3EBT A;  3I0Y A;  3MG2 A;  5IEO A;  3B8L A;  3CPO A;  5IEP A;  1JKG B;  3EX9 A;  3EQQ B;  3H3H A;  1JB4 A;  4R1K A;  3SOY A;  3G0K A;  3JUP A;  5CK6 A;  2BMO B;  1W6Y A;  2OWP A;  3IPT A;  3EF8 A;  3EHC A;  4XBY A;  5AIH A;  5JPU A;  1ASK A;  2RCD A;  3DXO A;  3Q90 A;  1GYB A;  3EN1 B;  2XSO B;  3RGA A;  1U5O A;  3OWU A;  4STD A;  2HMK B;  3K7C A;  5BVB A;  1HKX A;  3FZW A;  3CU3 A;  5CXO A;  5AII A;  2B24 B;  1JN5 A;  3T8U A;  4I4K A;  2GBW B;  2CHC A;  4GB5 A;  4HZB B;  5IG0 A;  2UX0 A;  7STD A;  3G8Z A;  3KKG A;  3D9R A;  3SOA A;  2YFL B;  3ROB A;  1O7H B;  4HM0 B;  1GY7 A;  1Q40 A;  1W02 A;  3GWR A;  3OX9 A;  5TGN A;  3EBY A;  3LYG A;  3OV4 A;  5IF6 A;  4HM4 B;  4L7K A;  3B7C A;  3NV0 A;  1JKG A;  5IEN A;  3SED A;  2Z77 A;  3NBR A;  4LMI A;  4R9K A;  1OHO A;  1UUV B;  1DMM A;  2HML B;  3NM2 A;  1GY6 A;  4HKV B;  3JUN A;  4J8T A;  4ORL A;  1O7W B;  1BUQ A;  3MG3 A;  1JB5 A;  4HM5 B;  4LEH A;  4X2H A;  3EC9 A;  3DMC A;  1A2K A;  1STD A;  2GEX A;  3HK4 A;  1ZX2 A;  4HJL B;  3VSY A;  5CF1 A;  1NU3 A;  1O7M B;  1WQL B;  3JUO A;  3K0Z A;  1EA2 A;  1QMA A;  4L8P A;  4MJD A;  5AIG A;  5AIF A;  3STD A;  1ISK A;  2W2C A;  3M8C A;  5CLK A;  4K1U A;  5D81 A;  1S5A A;  1VZZ A;  2XSH B;  5IG3 A;  4N3V A;  2HMJ B;  2YFJ B;  3MG1 A;  4KVH A;  5JPP A;  3ECF A;  1Q42 A;  1GY5 A;  1OF5 A;  1OH0 A;  1Z1S A;  5G2G A;  5CF2 A;  4HVN A;  4IIA A;  1OGZ A;  2XR8 B;  3NHX A;  2A15 A;  5AI1 A;  1OHP A;  1OUN A; 
#chains in the Genus database with same CATH topology
 1Q7H A;  1O7P B;  3OWY A;  3F7X A;  1OGX A;  2W0Q A;  2K0M A;  1TFK A;  3F8H A;  1VQO 3;  3GSP A;  4LZI A;  2RBI A;  2KF4 A;  2OQE C;  1RNB A;  1PY3 A;  2AAD A;  3KE7 A;  3S28 A;  3D79 A;  1BNG A;  2XF3 A;  3EE1 A;  4NPB A;  1MGW A;  3V99 A;  3A5E A;  1BSD A;  3G4S 3;  1GMP A;  1K9M 4;  3CCR 3;  1N9E A;  2QIY A;  4J5K A;  1FYS A;  1RRL A;  2INX A;  5IG4 A;  4MMX B;  1RN7 A;  1I0V A;  4XBX A;  1DMN A;  3F14 A;  4O8S A;  2RGQ A;  1GMR A;  3PS8 A;  1Q40 B;  4N6U A;  1I3F A;  1ULJ B;  2O3O A;  4NHF A;  2F98 A;  3FLJ A;  1IT7 A;  4KFE A;  2HMO B;  2MF7 A;  1RLS A;  3FCS B;  4LYL B;  4HBR A;  4R4K A;  1A2V A;  1W2B 2;  1JBS A;  3CCU 3;  5LC7 A;  3HX8 A;  1KQS 2;  1RMS A;  1SQW A;  1BNR A;  3ZFZ A;  3GRD A;  2KRT A;  3FKA A;  4FMC A;  4K90 B;  2CWT A;  3BLZ A;  1N5P A;  2J8X B;  3GAX A;  3MSO A;  1V57 A;  3CCM 3;  3NV0 B;  3K5T A;  1E3V A;  2UUG C;  6GSP A;  1UGH I;  2CX1 A;  2R4I A;  1KSI A;  3WA2 X;  2CK3 H;  4J9A A;  3ZG0 A;  3RNT A;  2IYJ A;  1MWS A;  1AR0 A;  2YX9 A;  1A90 A;  1CYV A;  3N54 B;  4N6L A;  1VQN 3;  3HII A;  3LH4 A;  4HAA A;  1B21 A;  3JVC A;  2HMM B;  3BND A;  1K28 A;  5HGR A;  1IT8 A;  2STD A;  1O7G B;  1NO3 A;  2F5W A;  1T2H A;  4WWU C;  3LXU X;  3PCS A;  4XB5 A;  3ER7 A;  1EEJ A;  3QRD A;  3D4A A;  5IEO A;  1LXE A;  1N5H A;  5I97 A;  1B20 A;  3SOY A;  2BO9 B;  5AIH A;  3BNC A;  4XBY A;  3EHC A;  3Q3F A;  1LNI A;  3DXO A;  1AV4 A;  3UL5 A;  3WOF B;  2IY2 A;  1N8Q A;  3CCS 3;  1WMP A;  3FG3 A;  1RHL A;  4N6M A;  3CU3 A;  1JN5 A;  1BSA A;  2KF3 A;  2CHC A;  7STD A;  4IPB A;  3CXC 2;  3LT8 A;  2OOV A;  1I2F A;  2WO0 A;  1GOU A;  3D9R A;  3KKG A;  3CD6 3;  3KII A;  2XFS A;  1W02 A;  3LOY A;  1JBT A;  3G71 3;  3CCQ 3;  1EKM A;  1RN1 A;  1MWT A;  1D6Z A;  1IVU A;  1JKG A;  3SED A;  4R9K A;  3SVA A;  1ROA A;  1BAO A;  2HML B;  3NM2 A;  2LQV A;  3AHS A;  4EBG A;  4J8T A;  1BUQ A;  2IA7 A;  1O7W B;  1GD4 A;  1NJI 4;  4HM5 B;  1NB5 I;  4X2H A;  1SPU A;  2XGL A;  1RGF A;  3HK4 A;  2BIR A;  5CF1 A;  5AYS C;  3AMO A;  1WQL B;  4EW5 A;  1MGR A;  2CFL A;  1ISK A;  1SIH A;  1Q81 4;  3DGY A;  3M8C A;  1FUT A;  1LVN A;  4K1U A;  1YIT 3;  1S5A A;  1VZZ A;  4N3V A;  1LOX A;  3MG1 A;  1RGG A;  1OF5 A;  2H0G A;  1NNV A;  2CFK A;  1IQY A;  2M7O A;  4IIA A;  4JF8 A;  2CWU A;  5AI1 A;  5DRE A;  4HM6 B;  5KP4 A;  4OVM A;  2K3D A;  5M18 A;  2Z76 A;  4OK0 A;  2Y73 A;  4R9L A;  3OWS A;  2CKF B;  1TJD A;  1JZO A;  2BMQ B;  3N8B A;  1EG9 B;  1VQP 3;  4LGQ A;  2L4V A;  3DUK A;  3FSD A;  1MNL A;  1TUH A;  1HU9 A;  1UCK A;  1ZGX A;  3BIR A;  3H51 A;  1YJW 3;  2ZDJ A;  4WYK A;  3SX1 A;  3MPH A;  4EC6 A;  1O7N B;  1GOV A;  4AKY A;  2CW9 A;  2KAA A;  3CNM A;  5KP3 A;  3BNB A;  3MWZ A;  1YHQ 3;  2C4B A;  4HM2 B;  1FGO A;  1VQM 3;  5JBS A;  1CEW I;  1W2Z A;  1BNI A;  2BMR B;  2FGT A;  4JRF A;  4BL3 A;  1M9G A;  3KZT A;  1CYU A;  1TIJ A;  2P0X A;  2F99 A;  2H0H A;  4IT7 A;  2CC3 A;  2ML5 A;  1Q86 4;  4MMY B;  5IG5 A;  3F8X A;  4HM7 B;  4N6V 0;  1IU7 A;  3EJV A;  1V58 A;  4XBT A;  3CMA 3;  2CIU A;  1I2G A;  4O02 B;  4HYZ A;  1G96 A;  2W56 A;  1GOY A;  2CX0 A;  4FMA A;  3DH2 A;  1W00 A;  1TRQ A;  2E2T A;  4HM3 B;  2OQE A;  1RRH A;  2ZA4 A;  3V98 A;  1YIJ 3;  2D1W A;  1E3R A;  1IV7 A;  1BU4 A;  1LOV A;  1YGE A;  3PZW A;  3T8N A;  3PCR A;  4PEJ A;  1N9J A;  4XDV A;  1OHS A;  1JNQ A;  4CPK A;  3GZR A;  3I55 3;  2W9P A;  3CME 3;  3X42 A;  1VQ4 3;  1K41 A;  1JB2 A;  4XDW A;  3NUV A;  4RNZ A;  3HOH A;  1YI2 3;  4X2O A;  1JBR A;  4J5G A;  4GHO A;  2ZHX B;  2B1X B;  1LQG C;  3MHE A;  3LTB A;  4AKZ A;  1VQ9 3;  1US1 A;  4H3U A;  1HYF A;  4RZM A;  1VQK 3;  5FW5 A;  3D5G A;  3KSP A;  4FMD A;  3CPW 2;  3DM8 A;  3NM7 A;  2K54 A;  5G1K A;  1Q82 4;  3G16 A;  3X3Z A;  4RNY A;  1B2X A;  2Q07 A;  1QAF A;  1PYL A;  1T5Y A;  3S29 A;  3WMD A;  3EBT A;  4BTY A;  5IEP A;  1K73 4;  1IVX A;  3B8L A;  3CPO A;  2ZL8 A;  4N6T A;  3G0K A;  5CK6 A;  2BMO B;  1HZ1 A;  1W6Y A;  3IPT A;  3EF8 A;  5G1L A;  3U1W A;  5HOH A;  1QVF 2;  1ASK A;  1BSC A;  2WGO A;  3X41 A;  3WR2 A;  2XSO B;  3RGA A;  2O9U X;  2PNC A;  3NBJ A;  1PFP A;  4EV5 A;  1KC8 4;  1HKX A;  2UGI A;  3FZW A;  5AII A;  1UCJ A;  4G1M B;  3T8U A;  4KZ1 A;  4GB5 A;  4HZB B;  1BAN A;  5ELU A;  1FW7 A;  3WHO A;  1VQL 3;  3WA3 A;  3ROB A;  4HM0 B;  1G0T A;  1K8A 4;  3OX9 A;  4CJN A;  3LTC A;  1BRG A;  4L7K A;  3NV0 A;  1U8C B;  3S67 A;  4HKV B;  2FNQ A;  4BTW A;  3JUN A;  4KFF A;  2QEX 3;  2JDI H;  3MG3 A;  1JB5 A;  4LEH A;  1J2B A;  3EC9 A;  4LSO A;  1VQ6 3;  3DMC A;  2GEX A;  1ZX2 A;  1RGE A;  1S72 3;  3IJE B;  3JUO A;  1I70 A;  4L8P A;  1MWR A;  5AIG A;  4AEQ A;  2WOH A;  1W4N A;  2BT3 A;  3IMA B;  1RGH A;  5JPP A;  2KF5 A;  1LQM B;  2YFJ B;  2R41 A;  4KVH A;  1IQ8 A;  3ECF A;  5EEO A;  3D3L A;  1IV9 A;  1DVC A;  2KCD A;  2CG1 A;  1BOX A;  1LRA A;  5CF2 A;  4HVN A;  1OGZ A;  3SLU A;  1BUJ A;  2XR8 B;  1W6C A;  2A15 A;  1SJW A;  3A76 A;  3GZB A;  3MKI A;  1T3B A;  1BNJ A;  3Q1C A;  4HZ9 B;  1W6G A;  1RDS A;  3CC2 3;  1W7C A;  1YGW A;  1CQS A;  4O3V A;  3K9M C;  4Q53 A;  1QJG A;  3UJM A;  2OTL 3;  2P09 A;  2GEY A;  1GS3 A;  2AAE A;  2Y74 A;  3LZA A;  4BU4 A;  3X3X A;  1B2U A;  2F56 A;  2RFR A;  5AEW B;  1JN5 B;  2XH9 A;  5KP1 A;  1E97 A;  4ZM8 A;  1SII A;  2P05 A;  2XFT A;  3F40 A;  1JV2 B;  1IQX A;  2GBX B;  5D83 A;  1BNS A;  2F5M A;  2E2V A;  3T0U A;  3KFQ C;  8CHO A;  3DY5 A;  4CDL A;  2RNT A;  1TFO A;  2OCT A;  4HM1 B;  4KFD A;  1DMQ A;  1LOY A;  1AVK A;  5FGO A;  1UCL A;  5STD A;  3TDG A;  4K1V A;  3UNL A;  4MEI A;  6RNT A;  4ILF A;  1AQZ A;  2I9W A;  5GSP A;  6STD A;  4K61 A;  1RJO A;  4WFO A;  5AEU B;  1FUW A;  1FGM A;  1VQ8 3;  1AVL A;  1LNH A;  1IYY A;  1QAL A;  3BNE A;  5ELJ A;  1B2S A;  2C11 A;  3BB9 A;  4GSP A;  3GZY B;  1UW1 A;  5M1A A;  1RGC A;  1R4Y A;  2IUJ A;  4WP5 A;  5A0O B;  1IK3 A;  2GU3 A;  1RN4 A;  2ML6 A;  2CG0 A;  1M1X B;  2GXF A;  2W03 A;  3F7S A;  2CWV A;  4FCM A;  4RNT A;  4DKI A;  1ZS7 A;  1RTU A;  2BNG A;  2XGN A;  1DVD A;  3B4O A;  4QWT A;  3LTA A;  3D5I A;  3ALA A;  1FA3 A;  2CH9 A;  1KD1 4;  2QA4 3;  4CCV A;  3NQY A;  1MOL A;  1TP6 A;  2XEP A;  3KSE D;  3DZL A;  3J7Y d;  1N8R 4;  1A67 A;  1M90 4;  1IVV A;  3V92 A;  3AGN A;  4R80 A;  1BIR A;  4BIR A;  2Z7A A;  1OCV A;  4MMZ B;  3SXX A;  1M1K 4;  1C7H A;  5BIR A;  3X40 A;  3MG2 A;  3URP A;  1JKG B;  3CCJ 3;  1JZD A;  3EX9 A;  3EQQ B;  1Y4K A;  1JB4 A;  3PXM A;  3Q2P A;  4R1K A;  3VGN A;  1CH0 A;  5JPU A;  1BNF A;  1EQK A;  2RCD A;  3Q90 A;  3EB8 A;  3ZG5 A;  2P38 A;  3EN1 B;  1WMO A;  3OWU A;  5BVB A;  2BU4 A;  3RDE A;  4I4K A;  2GBW B;  1G02 A;  5IG0 A;  2BHM A;  1QVG 2;  4KT3 B;  1BRK A;  4I5Q A;  3UL6 A;  1AY7 A;  2RSX A;  2YFL B;  5RNT A;  3QK9 A;  1Q40 A;  3HI7 A;  4H61 A;  5TGN A;  1F8N A;  2GU1 A;  3EBY A;  5IF6 A;  4HM4 B;  3B7C A;  1SAR A;  1UGI A;  3KN4 A;  1VQQ A;  3NBR A;  2E2U A;  3DGM A;  5EQL A;  4EXR A;  1KWI A;  3CC7 3;  1STF I;  2SAR A;  3N9H A;  1BNE A;  3VSY A;  1A2K A;  1BRI A;  1STD A;  1X1X A;  4HJL B;  4FR9 A;  5AIF A;  3STD A;  1FGR A;  5CLK A;  5D81 A;  1L5G B;  3L0R A;  3CCL 3;  3AGO A;  2HMJ B;  7GSP A;  1IVW A;  1I3I A;  1VQ5 3;  1GY5 A;  1OH0 A;  2Z6B A;  1V74 A;  3CC4 3;  4BL2 A;  2SBL A;  3HIG A;  4O2H A;  2MC8 A;  1OHP A;  8RNT A;  3FGY A;  1R4C A;  2P0M A;  2XRX B;  1YVB I;  3PGB A;  3B4P A;  4TX4 A;  3OXA A;  1ZO2 A;  1ULI B;  4NRE A;  3HZP A;  4HM8 B;  4FMB A;  4U13 A;  4GL6 A;  3AMO B;  5BXQ A;  1B2Z A;  1BRN L;  2W04 A;  3EN8 A;  1WMN A;  1DET A;  1MWU A;  1X1U A;  1YNV X;  1BRJ A;  4HOH A;  3NQZ A;  1YJN 3;  5IW9 A;  1RGK A;  1W01 A;  3E99 A;  1EUI C;  3CNX A;  1D6U A;  4L8O A;  3NX0 A;  1NWW A;  2GSP A;  4OUQ A;  3X3Y A;  1OAC A;  4EV2 A;  4WHA A;  2OOV C;  1BVI A;  2LYX A;  3JUM A;  3NBB A;  2KF6 A;  1OPY A;  1I0X A;  3WDG B;  7RNT A;  3O8Y A;  4WYK B;  3RGR A;  1QAK A;  2H0I A;  3KCH A;  4XM4 A;  2QGU A;  1NDO B;  2CFG A;  3F9S A;  1RCL A;  2HMN B;  3FG4 A;  2CFW A;  1UI7 A;  2FXT A;  1UUW B;  5D82 A;  5IER A;  3AHW A;  2W9Q A;  3NXJ A;  1RNT A;  2IMJ A;  2YFI B;  3GZX B;  3LT9 A;  1Q7Y 4;  2PZV A;  1B27 A;  1TRP A;  4FCZ A;  3FG1 A;  3JUQ A;  1W5Z A;  1IDP A;  3MYT A;  1RKY A;  4RBN A;  1GMQ A;  2KXG A;  1WNH A;  1Q9E A;  1D6Y A;  3FH1 A;  5DRV A;  3G6E 3;  2W56 B;  1PU4 A;  1FGT A;  3FF2 A;  2JQ5 A;  1BSB A;  4N6N B;  3I56 3;  5EVH A;  3S5C A;  1OF5 B;  1UDI I;  3LTD A;  1VQ7 3;  3CCE 3;  4N6O B;  2OTJ 3;  2W6J H;  3FF0 A;  2L1S A;  5BU4 A;  1RGL A;  1TU5 A;  2F86 B;  5AYR B;  3DGL A;  1BRS A;  1RSN A;  3I0Y A;  5LC6 A;  1UCI A;  2HOH A;  3H3H A;  1FZU A;  1GD3 A;  3JUP A;  2OWP A;  2D42 A;  3BU4 A;  1GYB A;  4BTX A;  1ROV A;  1U5O A;  4STD A;  3SYU A;  2HMK B;  3K7C A;  1JJ2 2;  1BSE A;  5CXO A;  2WOF A;  2B24 B;  1B2M A;  1NB3 I;  3U97 A;  2UX0 A;  3G8Z A;  1WTH A;  2WGQ A;  3SOA A;  3WOE B;  3WOD G;  1RCK A;  1O7H B;  4EYC A;  1GY7 A;  3GWR A;  1UI8 A;  1UUG B;  3LYG A;  5M19 A;  1I8V A;  3OV4 A;  5IEN A;  1TTO A;  2Z77 A;  4LMI A;  1OHO A;  1UUV B;  1DMM A;  3OW2 2;  3PYJ A;  1GY6 A;  9RNT A;  1X1W A;  3DGO A;  4ORL A;  3VF1 A;  1C54 A;  1I2E A;  3DGN A;  2F4Y A;  1BGS A;  1YJ9 3;  1FGQ A;  2C10 A;  3LML A;  1DE3 A;  1NU3 A;  1O7M B;  3K0Z A;  4MJD A;  1EA2 A;  1QMA A;  1A2P A;  1BRH A;  1B3S A;  1JRQ A;  2W2C A;  3K63 A;  1FUS A;  5IG3 A;  3UB1 A;  2XSH B;  1GSP A;  2CFD A;  1LOW A;  2IUK A;  3S27 A;  3CCV 3;  1Q42 A;  2V1L A;  1RGA A;  1DYU A;  5G2G A;  1Z1S A;  1X1Y A;  1YVS A;  3NHX A;  4FCJ A;  1T2I A;  1OUN A; 
#chains in the Genus database with same CATH homology
 1O7P B;  3OWY A;  3F7X A;  1OGX A;  2W0Q A;  2K0M A;  1TFK A;  3F8H A;  1VQO 3;  4LZI A;  2OQE C;  3KE7 A;  3S28 A;  2XF3 A;  3EE1 A;  3V99 A;  1K9M 4;  3G4S 3;  3CCR 3;  1N9E A;  2QIY A;  1RRL A;  2INX A;  5IG4 A;  4MMX B;  1RN7 A;  4XBX A;  1DMN A;  3F14 A;  4O8S A;  2RGQ A;  3PS8 A;  1Q40 B;  4N6U A;  1ULJ B;  2O3O A;  4NHF A;  2F98 A;  3FLJ A;  1IT7 A;  4KFE A;  2HMO B;  2MF7 A;  3FCS B;  4HBR A;  4R4K A;  1A2V A;  1W2B 2;  1KQS 2;  3CCU 3;  5LC7 A;  3HX8 A;  1SQW A;  3GRD A;  2KRT A;  3FKA A;  4FMC A;  4K90 B;  2CWT A;  3BLZ A;  1N5P A;  3GAX A;  3MSO A;  3CCM 3;  3NV0 B;  3K5T A;  1E3V A;  2R4I A;  1KSI A;  3WA2 X;  2CK3 H;  4J9A A;  1AR0 A;  2YX9 A;  1A90 A;  1CYV A;  3N54 B;  4N6L A;  1VQN 3;  3HII A;  3LH4 A;  3JVC A;  2HMM B;  3BND A;  1K28 A;  5HGR A;  1IT8 A;  2STD A;  1O7G B;  1NO3 A;  4WWU C;  3LXU X;  3PCS A;  4XB5 A;  3ER7 A;  3QRD A;  5IEO A;  1LXE A;  1N5H A;  5I97 A;  3SOY A;  2BO9 B;  5AIH A;  3BNC A;  4XBY A;  3EHC A;  3UL5 A;  3DXO A;  1AV4 A;  3WOF B;  3CCS 3;  1N8Q A;  1WMP A;  3FG3 A;  4N6M A;  3CU3 A;  1JN5 A;  2CHC A;  7STD A;  4IPB A;  3CXC 2;  3LT8 A;  2OOV A;  3CD6 3;  2WO0 A;  3KKG A;  3D9R A;  3KII A;  2XFS A;  1W02 A;  3LOY A;  3G71 3;  3CCQ 3;  1EKM A;  1D6Z A;  1IVU A;  1JKG A;  3SED A;  4R9K A;  3SVA A;  1ROA A;  2HML B;  3NM2 A;  2LQV A;  4EBG A;  4J8T A;  1BUQ A;  2IA7 A;  1O7W B;  1GD4 A;  1NJI 4;  4HM5 B;  1NB5 I;  4X2H A;  1SPU A;  2XGL A;  3HK4 A;  5CF1 A;  5AYS C;  3AMO A;  1WQL B;  2CFL A;  1ISK A;  1SIH A;  1Q81 4;  3M8C A;  1LVN A;  4K1U A;  1YIT 3;  1S5A A;  1VZZ A;  4N3V A;  1LOX A;  3MG1 A;  1OF5 A;  2CFK A;  1IQY A;  2M7O A;  4IIA A;  4JF8 A;  2CWU A;  5AI1 A;  5DRE A;  4HM6 B;  5KP4 A;  4OVM A;  2Z76 A;  4OK0 A;  2Y73 A;  4R9L A;  3OWS A;  2CKF B;  2BMQ B;  3N8B A;  1EG9 B;  1VQP 3;  4LGQ A;  2L4V A;  3DUK A;  3FSD A;  1MNL A;  1TUH A;  1HU9 A;  3H51 A;  3VGN A;  1YJW 3;  2ZDJ A;  4WYK A;  3SX1 A;  3MPH A;  4EC6 A;  1O7N B;  4AKY A;  2CW9 A;  3CNM A;  5KP3 A;  3BNB A;  3MWZ A;  1YHQ 3;  4HM2 B;  1FGO A;  1VQM 3;  5JBS A;  1CEW I;  1W2Z A;  2BMR B;  2FGT A;  4JRF A;  1M9G A;  3KZT A;  1CYU A;  1TIJ A;  2P0X A;  2F99 A;  4IT7 A;  2CC3 A;  2ML5 A;  1Q86 4;  4MMY B;  5IG5 A;  3F8X A;  4HM7 B;  4N6V 0;  1IU7 A;  3EJV A;  4XBT A;  3CMA 3;  2CIU A;  4O02 B;  4HYZ A;  1G96 A;  2W56 A;  4FMA A;  2OQE A;  1W00 A;  1YIJ 3;  2E2T A;  4HM3 B;  1RRH A;  3V98 A;  2D1W A;  1E3R A;  1IV7 A;  3T8N A;  1YGE A;  3PZW A;  3PCR A;  4PEJ A;  1N9J A;  4XDV A;  1OHS A;  1JNQ A;  3I55 3;  3GZR A;  2W9P A;  3CME 3;  3X42 A;  1VQ4 3;  1K41 A;  1JB2 A;  4XDW A;  3NUV A;  4RNZ A;  1YI2 3;  4X2O A;  2B1X B;  3MHE A;  3LTB A;  4AKZ A;  1VQ9 3;  1US1 A;  4H3U A;  4RZM A;  1VQK 3;  5FW5 A;  3KSP A;  4FMD A;  3CPW 2;  3DM8 A;  3NM7 A;  2K54 A;  1Q82 4;  3G16 A;  3X3Z A;  4RNY A;  2Q07 A;  1QAF A;  1T5Y A;  3S29 A;  3WMD A;  4BTY A;  3EBT A;  5IEP A;  1K73 4;  1IVX A;  3B8L A;  3CPO A;  2ZL8 A;  4N6T A;  3G0K A;  5CK6 A;  2BMO B;  1W6Y A;  3IPT A;  1QVF 2;  3EF8 A;  3U1W A;  1ASK A;  2WGO A;  3X41 A;  2XSO B;  3RGA A;  2O9U X;  2PNC A;  3NBJ A;  1PFP A;  4EV5 A;  1KC8 4;  1HKX A;  3FZW A;  5AII A;  4G1M B;  3T8U A;  4KZ1 A;  4GB5 A;  4HZB B;  5ELU A;  1VQL 3;  3WA3 A;  3ROB A;  4HM0 B;  1K8A 4;  3OX9 A;  3LTC A;  4L7K A;  3NV0 A;  1U8C B;  3S67 A;  4HKV B;  2FNQ A;  4BTW A;  3JUN A;  4KFF A;  2QEX 3;  2JDI H;  3MG3 A;  1JB5 A;  4LEH A;  1J2B A;  3EC9 A;  4LSO A;  1VQ6 3;  3DMC A;  2GEX A;  1ZX2 A;  1S72 3;  3IJE B;  3JUO A;  4L8P A;  5AIG A;  4AEQ A;  2WOH A;  1W4N A;  2BT3 A;  3IMA B;  5JPP A;  2YFJ B;  4KVH A;  5EEO A;  3ECF A;  1IQ8 A;  3D3L A;  1IV9 A;  1DVC A;  2KCD A;  2CG1 A;  5CF2 A;  4HVN A;  1OGZ A;  3SLU A;  2XR8 B;  1W6C A;  2A15 A;  1SJW A;  3A76 A;  3GZB A;  3MKI A;  3Q1C A;  4HZ9 B;  1W6G A;  3CC2 3;  1W7C A;  1CQS A;  4O3V A;  3K9M C;  4Q53 A;  1QJG A;  3UJM A;  2OTL 3;  2P09 A;  2GEY A;  1GS3 A;  2Y74 A;  3LZA A;  3X3X A;  2RFR A;  5AEW B;  1JN5 B;  2XH9 A;  5KP1 A;  1E97 A;  4ZM8 A;  1SII A;  2P05 A;  2XFT A;  3F40 A;  1JV2 B;  1IQX A;  2GBX B;  5D83 A;  3T0U A;  2E2V A;  3KFQ C;  8CHO A;  3DY5 A;  4CDL A;  1TFO A;  2OCT A;  4HM1 B;  4KFD A;  1DMQ A;  1AVK A;  5FGO A;  5STD A;  3TDG A;  4K1V A;  3UNL A;  4MEI A;  2I9W A;  6STD A;  4K61 A;  1RJO A;  4WFO A;  5AEU B;  1FUW A;  1FGM A;  1VQ8 3;  1AVL A;  1LNH A;  1QAL A;  3BNE A;  5ELJ A;  2C11 A;  3BB9 A;  3GZY B;  1UW1 A;  2IUJ A;  4WP5 A;  5A0O B;  1IK3 A;  2GU3 A;  2ML6 A;  2CG0 A;  1M1X B;  2GXF A;  2W03 A;  3F7S A;  2CWV A;  4FCM A;  2BNG A;  2XGN A;  1DVD A;  3B4O A;  4QWT A;  3LTA A;  1FA3 A;  3ALA A;  2CH9 A;  1KD1 4;  2QA4 3;  4CCV A;  3NQY A;  1MOL A;  1TP6 A;  2XEP A;  3KSE D;  3DZL A;  3J7Y d;  1N8R 4;  1A67 A;  1M90 4;  1IVV A;  3V92 A;  4R80 A;  2Z7A A;  1OCV A;  4MMZ B;  3SXX A;  1M1K 4;  1C7H A;  3X40 A;  3MG2 A;  1JKG B;  3CCJ 3;  3EX9 A;  3PXM A;  3EQQ B;  1Y4K A;  1JB4 A;  3Q2P A;  4R1K A;  5JPU A;  1EQK A;  2RCD A;  3Q90 A;  3EB8 A;  2P38 A;  3EN1 B;  1WMO A;  3OWU A;  5BVB A;  3RDE A;  4I4K A;  2GBW B;  5IG0 A;  2BHM A;  1QVG 2;  3UL6 A;  2RSX A;  2YFL B;  3QK9 A;  1Q40 A;  3HI7 A;  4H61 A;  5TGN A;  1F8N A;  2GU1 A;  3EBY A;  5IF6 A;  4HM4 B;  3B7C A;  3KN4 A;  3NBR A;  5EQL A;  2E2U A;  3DGM A;  4EXR A;  1KWI A;  3CC7 3;  1STF I;  3N9H A;  3VSY A;  1A2K A;  1STD A;  4HJL B;  4FR9 A;  5AIF A;  3STD A;  1FGR A;  5CLK A;  5D81 A;  1L5G B;  3L0R A;  3CCL 3;  2HMJ B;  1IVW A;  1VQ5 3;  1GY5 A;  1OH0 A;  2Z6B A;  1V74 A;  3CC4 3;  2SBL A;  3HIG A;  4O2H A;  2MC8 A;  1OHP A;  3FGY A;  1R4C A;  2P0M A;  2XRX B;  1YVB I;  3PGB A;  3B4P A;  4TX4 A;  3OXA A;  1ZO2 A;  1ULI B;  4NRE A;  3HZP A;  4HM8 B;  4FMB A;  4U13 A;  4GL6 A;  3AMO B;  5BXQ A;  2W04 A;  3EN8 A;  1WMN A;  3NQZ A;  1YJN 3;  5IW9 A;  1W01 A;  3E99 A;  3CNX A;  1D6U A;  4L8O A;  3NX0 A;  1NWW A;  4OUQ A;  3X3Y A;  1OAC A;  4EV2 A;  4WHA A;  2OOV C;  2LYX A;  3JUM A;  3NBB A;  1OPY A;  3WDG B;  3O8Y A;  4WYK B;  3RGR A;  1QAK A;  4XM4 A;  2QGU A;  1NDO B;  2CFG A;  3F9S A;  2HMN B;  3FG4 A;  1UI7 A;  2CFW A;  2FXT A;  1UUW B;  5D82 A;  5IER A;  2W9Q A;  3NXJ A;  2IMJ A;  2YFI B;  3GZX B;  3LT9 A;  1Q7Y 4;  2PZV A;  4FCZ A;  3FG1 A;  3JUQ A;  1W5Z A;  1IDP A;  3MYT A;  1RKY A;  4RBN A;  3FH1 A;  2KXG A;  1WNH A;  5DRV A;  1D6Y A;  3G6E 3;  2W56 B;  1PU4 A;  1FGT A;  3FF2 A;  2JQ5 A;  4N6N B;  3I56 3;  5EVH A;  3S5C A;  1OF5 B;  3LTD A;  1VQ7 3;  3CCE 3;  4N6O B;  2OTJ 3;  2W6J H;  3FF0 A;  1TU5 A;  2F86 B;  5AYR B;  3DGL A;  3I0Y A;  5LC6 A;  3H3H A;  1GD3 A;  3JUP A;  2OWP A;  2D42 A;  1GYB A;  4BTX A;  1ROV A;  1U5O A;  4STD A;  2HMK B;  3K7C A;  1JJ2 2;  5CXO A;  2WOF A;  2B24 B;  1NB3 I;  3U97 A;  2UX0 A;  3G8Z A;  1WTH A;  2WGQ A;  3SOA A;  3WOE B;  3WOD G;  1O7H B;  4EYC A;  1GY7 A;  3GWR A;  1UI8 A;  3LYG A;  3OV4 A;  5IEN A;  2Z77 A;  4LMI A;  1OHO A;  1UUV B;  1DMM A;  3OW2 2;  3PYJ A;  1GY6 A;  3DGO A;  4ORL A;  3VF1 A;  3DGN A;  1YJ9 3;  1FGQ A;  2C10 A;  3LML A;  1NU3 A;  1O7M B;  3K0Z A;  4MJD A;  1EA2 A;  1QMA A;  3K63 A;  1JRQ A;  2W2C A;  5IG3 A;  3UB1 A;  2XSH B;  3S27 A;  2CFD A;  3CCV 3;  2IUK A;  1Q42 A;  2V1L A;  1DYU A;  5G2G A;  1Z1S A;  3NHX A;  4FCJ A;  1OUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...