1QJGA

Crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni in complex with equilenin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KETOSTEROID ISOMERASE
publication title Crystal Structure of Delta-5-3-Ketosteroid Isomerase from Pseudomonas Testosteroni in Complex with Equilenin Settles the Correct Hydrogen Scheme for Transition-State Stabilization
pubmed doi rcsb
source organism Pseudomonas testosteroni
molecule tags Isomerase
total genus 36
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1qjgA00
3GZRA 3S5CA 3KZTA 3EN8A 3EN1B 1GY5A 5AIGA 4I4KA 3MKIA 5KP3A 4K1VA 5CF2A 1ASKA 2GEYA 3HK4A 3VGNA 1EG9B 1ISKA 3JUMA 3Q90A 4L7KA 2K54A 1DMMA 4XBTA 3E99A 5AIHA 4FCJA 3DZLA 1A2KA 4LGQA 3MSOA 2A15A 3OX9A 3B4OA 3CNMA 4HM7B 4FCMA 2CKFB 1TUHA 4XBXA 2UX0A 3EBTA 3BB9A 4HZBB 4J9AA 5AEUB 3F9SA 3GZYB 3MYTA 3MG3A 2BMQB 4ORLA 1GS3A 4R9KA 1U5OA 3NUVA 4HM1B 4CDLA 3ECFA 3CNXA 3GZXB 1E97A 1HKXA 3FLJA 2Z77A 3NV0A 2HMOB 1AR0A 7STDA 4MJDA 1TP6A 5JPUA 4HM6B 2GBXB 6STDA 2RCDA 3LZAA 1OCVA 1E3RA 3CU3A 3G0KA 3NXJA 1JN5A 4X2HA 2XR8B 5IERA 3JUOA 5IG0A 3RGAA 2YFLB 4WYKB 3FF2A 4R9LA 1SJWA 4IIAA 3B4PA 3IPTA 1OHOA 3KSPA 5AIIA 1O7HB 3H51A 1JKGA 2JQ5A 1EA2A 3M8CA 1OPYA 2YFJB 1Q40B 1W01A 1JB2A 5IEOA 5CF1A 1Q42A 3F7SA 3EBYA 2STDA 4J8TA 3SEDA 5CK6A 3JUNA 3EJVA 3OV4A 4GB5A 2HMNB 3EQQB 1DMQA 2BNGA 2BMRB 1C7HA 4STDA 4L8OA 1CQSA 1O7MB 3FSDA 1GY6A 3F8XA 5KP4A 3JUQA 5IENA 4KVHA 3CPOA 2Z76A 3EC9A 3KE7A 4OVMA 1DMNA 3OWUA 1K41A 3HZPA 3MHEA 4HKVB 2HMMB 3OXAA 4HM2B 3F7XA 3ROBA 5D82A 3STDA 2F86B 4H3UA 4RZMA 1W00A 3SOYA 5KP1A 1JN5B 3F40A 3FH1A 2GEXA 2QIYA 3LYGA 1W02A 3GZBA 1BUQA 1ZX2A 3DMCA 4PEJA 4WWUC 1GYBA 2R4IA 4Q53A 4OUQA 3DXOA 4X2OA 5FW5A 1OF5A 1QJGA 1W6YA 4XDWA 4XB5A 1QMAA 5IG3A 1GY7A 4XM4A 3OWYA 5TGNA 3WMDA 4HM3B 3UJMA 2XSOB 2Z7AA 5BVBA 2B24B 3G16A 1Z1SA 4U13A 3NBRA 3RGRA 4WP5A 5IG5A 3HX8A 1IDPA 8CHOA 1NDOB 3ER7A 3DM8A 3D9RA 2F99A 3F8HA 4XDVA 3K0ZA 3A76A 2F98A 4R1KA 3F14A 2IMJA 3DUKA 2I9WA 2HMJB 1NU3A 2B1XB 1OGXA 3B8LA 3JUPA 5DRVA 1OUNA 2XRXB 3NHXA 3NM2A 3FF0A 5AI1A 4L8PA 5BXQA 4HM0B 5IEPA 1O7WB 1JB5A 1Q40A 3BLZA 2YFIB 1OGZA 2RGQA 3H3HA 1OH0A 1ULJB 5D81A 4HVNA 5DREA 1WQLB 3NV0B 5G2GA 1JB4A 1O7GB 1S5AA 1NWWA 1STDA 3FGYA 1OHSA 3FZWA 3B7CA 5IG4A 3EX9A 2GBWB 3G8ZA 4N3VA 2GXFA 3KKGA 1OF5B 3EF8A 4HM5B 3T8NA 4HM8B 3FKAA 3VSYA 1O7PB 1VZZA 3MG1A 4LEHA 1ZO2A 3UNLA 5AIFA 4LMIA 2QGUA 1UUVB 5HGRA 3GWRA 3EHCA 5EVHA 4HM4B 3K7CA 4HJLB 5AEWB 4XBYA 2INXA 2XSHB 5CLKA 5D83A 3SOAA 2RFRA 1JKGB 2CHCA 2HMLB 4K1UA 1OHPA 5IF6A 1ULIB 1E3VA 2BMOB 3MG2A 3OWSA 2W2CA 5CXOA 2PZVA 2HMKB 5STDA 3T8UA 3I0YA 1O7NB 2OWPA 1UUWB 3GRDA 4HZ9B 5JPPA 4WYKA
chains in the Genus database with same CATH superfamily
2R41A 3S67A 1IU7A 3LT8A 4EYCA 3ALAA 3GZRA 3LTDA 3PCRA 3S5CA 3ZG0A 4J5GA 3FCSB 3KZTA 1K8A4 8RNTA 2WOFA 1B3SA 3EN8A 3EN1B 1GY5A 5AIGA 1LRAA 1F8NA 2GSPA 4I4KA 3PXMA 4MMZB 3MKIA 5KP3A 1VQ73 1UGIA 1BNFA 1CYVA 4K1VA 1SQWA 1LOXA 1LXEA 1MGWA 1FGRA 5CF2A 2BIRA 1ASKA 2GEYA 3NQZA 5IW9A 1VQ63 3HK4A 3VGNA 1GMQA 1UI7A 4N6NB 3CCE3 3CC43 1BNJA 1EG9B 1W7CA 1ISKA 1DVCA 3HIGA 1VQ93 3JUMA 1J2BA 1D6YA 3CC23 3CCR3 4KFFA 3Q90A 4L7KA 3URPA 2K54A 3CPW2 1Q814 1US1A 2CIUA 4KT3B 3BNEA 1DMMA 3HOHA 3LT9A 3SLUA 2W03A 5M19A 3Q2PA 1VQK3 2SARA 4XBTA 1MGRA 3E99A 3CCQ3 3QRDA 1YGEA 2CH9A 1IVWA 1NO3A 3LMLA 4BIRA 5AIHA 1TJDA 3DZLA 4FCJA 1A2KA 4LGQA 3AMOA 3MSOA 1UCKA 3G713 2P38A 2P0MA 2A15A 3OX9A 2W56B 1IK3A 4MEIA 5M1AA 3B4OA 1GMRA 3CNMA 4HM7B 1FW7A 4FCMA 2CKFB 1YJW3 4BU4A 3SX1A 6RNTA 1NJI4 4KFDA 1TUHA 4XBXA 1T2HA 1BSDA 1RGEA 1GOYA 1ROVA 1AVKA 1GD3A 1RN7A 2CW9A 2UX0A 2ZDJA 1M1XB 3BB9A 3EBTA 3F9SA 3GZYB 4HZBB 5AEUB 3MYTA 1BNIA 3MG3A 2BMQB 3TDGA 3JVCA 1B2ZA 4FR9A 4ORLA 3V92A 1BSEA 1GS3A 4R9KA 3KIIA 1UW1A 1GD4A 1U5OA 3NUVA 4HM1B 4CDLA 1NB5I 5BIRA 5D83A 1M904 1I2GA 2E2TA 3ECFA 3SVAA 5HOHA 3CNXA 2CWVA 4EW5A 3GZXB 1LOWA 3J7Yd 1E97A 1HKXA 2K3DA 2ZA4A 2H0IA 1G0TA 2Z77A 3FLJA 1RRLA 4GL6A 4K90B 2V1LA 3BU4A 3CME3 3NV0A 3CC73 3AGOA 3LTAA 4OK0A 4CPKA 1BRSA 2AAEA 1RGCA 2HMOB 1AR0A 4CJNA 1I70A 3IMAB 1B2UA 4MJDA 7STDA 1LQMB 3X41A 1R4YA 6GSPA 1TP6A 5JPUA 2F5MA 4HM6B 4LSOA 1RDSA 2GBXB 2K0MA 2RCDA 3LZAA 6STDA 1JBTA 1L5GB 1OCVA 1E3RA 2C10A 2KF5A 2P0XA 1V58A 4O3VA 1YNVX 3CU3A 3G0KA 3D5GA 1MWUA 1W4NA 4ZM8A 2CFKA 2QEX3 1FUTA 3NXJA 5ELJA 1JN5A 2QA43 4X2HA 2XR8B 3KSED 5I97A 5IERA 3NX0A 3JUOA 4G1MB 4EXRA 1MNLA 1TTOA 1I0XA 1BGSA 2YX9A 4BTYA 3U97A 1X1UA 3A5EA 5IG0A 3RGAA 1IVUA 1UCIA 2YFLB 4FMDA 4WYKB 3L0RA 1N5PA 3FF2A 4TX4A 1EEJA 4R4KA 3CCL3 1Q7HA 2GU1A 4R9LA 1Q864 1SJWA 3D79A 2XFSA 4GHOA 3OW22 4IIAA 3CXC2 3B4PA 1YIT3 3IPTA 4EBGA 1OHOA 3RDEA 3KSPA 5AIIA 1O7HB 1A2VA 2BU4A 3H51A 4IT7A 1B21A 1JKGA 2JQ5A 4BL3A 2KF3A 3SXXA 3AGNA 1EA2A 1BSAA 4BTXA 2Y74A 2RNTA 4FMAA 3ZFZA 1N8R4 1IV7A 4HAAA 1CEWI 3M8CA 1QVG2 4EV5A 1RCLA 1LNIA 2RSXA 3S28A 1VQL3 1OPYA 2F56A 1EKMA 2YFJB 1Q40B 1W01A 1JB2A 5IEOA 2Q07A 1EUIC 4J5KA 5CF1A 1Q42A 5A0OB 1BVIA 3F7SA 4O8SA 2OQEA 1G02A 4FMCA 1JRQA 5GSPA 1VQ83 3DH2A 3EE1A 3NBBA 3D3LA 1VQO3 3EBYA 1RSNA 2E2VA 2STDA 4J8TA 3BIRA 3SEDA 3WA2X 1X1WA 5CK6A 3AHSA 3CMA3 4MMYB 1IQYA 1GOUA 2CG0A 3LTCA 4HOHA 3JUNA 1TU5A 3EJVA 3OV4A 1RHLA 4GB5A 3DGMA 1FUWA 1CH0A 1SIHA 3UB1A 2HMNB 2KCDA 3EQQB 1DMQA 1MOLA 2KF6A 2BNGA 5EEOA 1W2B2 2BMRB 4JRFA 1C7HA 3QK9A 4STDA 4L8OA 3SYUA 1VQN3 5EQLA 1OACA 2JDIH 1DVDA 3K63A 1B20A 2W6JH 1D6UA 1GOVA 1VQM3 1CQSA 1O7MB 1PYLA 1T5YA 1BOXA 4O02B 3WOFB 3NBJA 1YJN3 1DE3A 5RNTA 1Y4KA 2XGNA 1GY6A 3FSDA 3PGBA 1I0VA 1PFPA 1TRPA 2IA7A 3F8XA 3EB8A 3D5IA 3JUQA 4BL2A 5KP4A 1JBSA 5IENA 1BU4A 1D6ZA 1UDII 4KVHA 3I563 3K9MC 3CPOA 1BRIA 1ZS7A 2KRTA 2Z76A 3X42A 2FGTA 3EC9A 1RTUA 3MPHA 1BNSA 1RGKA 3KE7A 3UL5A 4OVMA 1RGFA 1DMNA 1IYYA 3AHWA 1QAFA 3OWUA 3GAXA 1K41A 4KFEA 1BRHA 2ML6A 3HZPA 2H0GA 4GSPA 5M18A 1KD14 1IVVA 3N54B 2IUJA 2L1SA 1A90A 1QAKA 3MHEA 1W5ZA 1K734 4HKVB 1BSBA 2HMMB 3KCHA 5G1LA 3OXAA 4HM2B 2PNCA 1PY3A 3F7XA 3RNTA 4DKIA 1IT8A 4I5QA 3MWZA 2L4VA 3GSPA 3ROBA 1S723 3CD63 5D82A 1W2ZA 2W9PA 3STDA 2F86B 1B2XA 4H3UA 1BSCA 1VQQA 1UUGB 2W56A 1BRGA 5AYSC 4RZMA 1W00A 4JF8A 3SOYA 2CFDA 5KP1A 3CCU3 1JN5B 3FG3A 2CWUA 3F40A 1ZGXA 4NPBA 3VF1A 2HOHA 2OCTA 1FGOA 3FH1A 2BT3A 1STFI 2CX0A 2GEXA 2Y73A 4QWTA 2QIYA 3X3XA 3LYGA 3NQYA 3Q1CA 5JBSA 1W02A 3GZBA 1BUQA 1ZX2A 3DMCA 4PEJA 4WWUC 1GYBA 2KXGA 2R4IA 4Q53A 4OUQA 3DXOA 4N6V0 4X2OA 5LC6A 5FW5A 1B2MA 1OF5A 3IJEB 1AV4A 1VQ43 1QJGA 1W6YA 4XDWA 1WMOA 2IUKA 4XB5A 1N9JA 1QMAA 2CFGA 2UUGC 2OOVA 2E2UA 1JV2B 2H0HA 1QVF2 5IG3A 1GY7A 3CCM3 1A67A 4XM4A 1YVSA 1HU9A 4NREA 3OWYA 4FCZA 1BNEA 1I8VA 5TGNA 3WMDA 3X3ZA 1X1YA 2ML5A 4HM3B 3CCS3 2CWTA 3UJMA 5AYRB 2XSOB 3KFQC 4RNZA 2OTJ3 2Z7AA 4EV2A 2KAAA 1RLSA 5BVBA 1FZUA 2B24B 2XGLA 1BRNL 4AEQA 3G16A 1Z1SA 1YGWA 2D42A 1NB3I 1YHQ3 4U13A 3NBRA 1RGHA 3RGRA 3KN4A 4O2HA 3BNCA 4WP5A 5IG5A 2CFWA 3HX8A 3S29A 1I2FA 1JZDA 1LNHA 1HZ1A 1WTHA 1RN4A 2M7OA 1IDPA 3DGNA 4N6UA 1UGHI 2C11A 1PU4A 1I3FA 1MWRA 4N6OB 1T3BA 8CHOA 1NDOB 2W0QA 3ER7A 5G1KA 1I2EA 1RGLA 1TFKA 5ELUA 1UI8A 2P05A 3DM8A 1MWSA 1GSPA 3D9RA 2F99A 3F8HA 4RNTA 4XDVA 1NNVA 3K0ZA 3U1WA 4N6LA 3A76A 2XH9A 9RNTA 2F98A 4R1KA 1MWTA 1LOYA 3F14A 1RN1A 2IMJA 1RNBA 1I3IA 3LTBA 7RNTA 1CYUA 1HYFA 3DUKA 2I9WA 4MMXB 1BAOA 2HMJB 2IYJA 3CCV3 1VQP3 1RKYA 3DGOA 1NU3A 2B1XB 1K9M4 1OGXA 3AMOB 3B8LA 1AVLA 3V98A 1KQS2 3WDGB 3JUPA 2W04A 1AY7A 1AQZA 5DRVA 1OUNA 2OOVC 1RCKA 2F5WA 2XRXB 2CFLA 3NHXA 3FF0A 3NM2A 1YIJ3 5AI1A 4L8PA 2UGIA 2MC8A 2W9QA 5BXQA 4HM0B 1JNQA 5IEPA 1DETA 1O7WB 1JB5A 1Q40A 1DYUA 1Q9EA 3ZG5A 1BANA 2CC3A 2RBIA 2F4YA 3BLZA 2AADA 2YFIB 1OGZA 2FNQA 3X40A 3G4S3 4R80A 2RGQA 3H3HA 4H61A 1KWIA 1OH0A 1ULJB 1B27A 2C4BA 1IVXA 3D4AA 3PYJA 1BUJA 5D81A 2D1WA 4HVNA 2SBLA 5DREA 3WA3A 1Q824 1FA3A 4RNYA 1WQLB 2WGOA 4CCVA 1V57A 2GU3A 1FGTA 3NV0B 1STDA 1JB4A 1O7GB 1S5AA 1NWWA 3FGYA 5G2GA 3WHOA 1EQKA 3DY5A 1C54A 1B2SA 1IQXA 1OHSA 3FZWA 1LVNA 1YI23 4IPBA 3B7CA 1X1XA 2IY2A 7GSPA 2XEPA 5IG4A 1QALA 1R4CA 1FGMA 1SARA 3N8BA 1G96A 3EX9A 1KC84 1RGGA 1T2IA 2GBWB 3G8ZA 3LH4A 1WNHA 1V74A 4N3VA 1IV9A 4ILFA 4WHAA 1VQ53 1KSIA 2BHMA 2GXFA 3PCSA 1BNGA 2ZHXB 1FYSA 1OF5B 3KKGA 3EF8A 1YVBI 4HM5B 3PS8A 1U8CB 3LOYA 3T8NA 1RGAA 3WR2A 2BO9B 2WO0A 4HM8B 1JZOA 3FKAA 4N6TA 1TRQA 2O9UX 3FG1A 5LC7A 3VSYA 4AKZA 4LYLB 3UL6A 2ZL8A 1O7PB 1UCJA 1VZZA 3FG4A 3HI7A 4LZIA 1N5HA 1BRKA 3MG1A 4LEHA 3T0UA 1ZO2A 3UNLA 3HIIA 3DGYA 5AIFA 1N8QA 3CCJ3 4LMIA 2XF3A 2QGUA 4NHFA 4WFOA 1UUVB 1LOVA 1TFOA 5FGOA 5HGRA 4BTWA 3PZWA 1BIRA 3GWRA 3LXUX 1YJ93 2MF7A 3EHCA 4HM4B 1K28A 5EVHA 1RRHA 5BU4A 3K7CA 3I553 4HJLB 2OTL3 2J8XB 3NM7A 5AEWB 4XBYA 2INXA 2XSHB 1IQ8A 1BRJA 4HYZA 2RFRA 1JKGB 1ROAA 5CLKA 3Q3FA 3K5TA 3SOAA 3S27A 4RBNA 1UCLA 1M9GA 1Q7Y4 1WMNA 1GMPA 2OQEC 2XFTA 1TIJA 2CHCA 3N9HA 3X3YA 2FXTA 2HMLB 1RJOA 1W6CA 1W6GA 4K1UA 3V99A 1LQGC 1SIIA 1OHPA 1WMPA 5IF6A 2CK3H 1ULIB 2CX1A 1RMSA 1RNTA 1E3VA 2BMOB 3MG2A 3OWSA 4AKYA 4FMBA 1FUSA 2W2CA 4HBRA 4J9AA 5CXOA 4KZ1A 3BNBA 1N9EA 2PZVA 1SPUA 2WGQA 2CG1A 3O8YA 1FGQA 2HMKB 5STDA 3T8UA 2O3OA 3I0YA 1O7NB 2OWPA 1UUWB 3WODG 2LQVA 1BNRA 2KF4A 2P09A 4N6MA 3WOEB 4EC6A 1A2PA 3GRDA 4K61A 2LYXA 2WOHA 4HZ9B 5JPPA 2Z6BA 1JJ22 1IT7A 1M1K4 1JBRA 4WYKA 3G6E3 3BNDA 3DGLA
chains in the Genus database with same CATH topology
3S67A 1IU7A 3LT8A 4EYCA 3ALAA 3GZRA 3LTDA 3PCRA 3S5CA 3FCSB 3KZTA 1K8A4 2WOFA 3EN8A 3EN1B 1GY5A 5AIGA 1F8NA 4I4KA 3PXMA 4MMZB 3MKIA 5KP3A 1VQ73 1CYVA 4K1VA 1SQWA 1LOXA 1LXEA 1FGRA 5CF2A 1ASKA 2GEYA 3NQZA 5IW9A 1VQ63 3HK4A 3VGNA 3CCE3 1UI7A 4N6NB 3CC43 1EG9B 1W7CA 1ISKA 1DVCA 3HIGA 1VQ93 3JUMA 1J2BA 1D6YA 3CC23 3CCR3 4KFFA 3Q90A 4L7KA 2K54A 3CPW2 1Q814 1US1A 2CIUA 3BNEA 1DMMA 3SLUA 3LT9A 1VQK3 2W03A 3Q2PA 4XBTA 3E99A 3CCQ3 3QRDA 1YGEA 2CH9A 1IVWA 1NO3A 3LMLA 5AIHA 4FCJA 3DZLA 1A2KA 4LGQA 3AMOA 3MSOA 3G713 2P38A 2P0MA 2A15A 3OX9A 2W56B 1IK3A 4MEIA 3B4OA 3CNMA 4HM7B 4FCMA 2CKFB 1YJW3 3SX1A 1NJI4 4KFDA 1TUHA 4XBXA 1ROVA 2UX0A 2OOVA 4EC6A 1AVKA 1GD3A 1RN7A 2ZDJA 2CW9A 3BB9A 1M1XB 3EBTA 4HZBB 3F9SA 3GZYB 4J9AA 5AEUB 3MYTA 3MG3A 2BMQB 3TDGA 3JVCA 4FR9A 4ORLA 3V92A 1GS3A 4R9KA 3KIIA 1UW1A 1GD4A 1U5OA 3NUVA 4HM1B 4CDLA 1NB5I 1M904 2E2TA 3SVAA 3ECFA 3CNXA 2CWVA 3GZXB 3J7Yd 1E97A 1HKXA 3FLJA 2Z77A 4K90B 4GL6A 1RRLA 2V1LA 3CME3 3NV0A 3CC73 3LTAA 4OK0A 2HMOB 1AR0A 7STDA 3IMAB 4MJDA 3X41A 1TP6A 5JPUA 4HM6B 4LSOA 2GBXB 2K0MA 2RCDA 3LZAA 6STDA 1L5GB 1OCVA 1E3RA 2C10A 2P0XA 4O3VA 3CU3A 3G0KA 1W4NA 4ZM8A 2CFKA 2QEX3 3NXJA 5ELJA 1JN5A 2QA43 4X2HA 2XR8B 3KSED 5I97A 5IERA 3NX0A 3JUOA 4G1MB 4EXRA 1MNLA 2YX9A 4BTYA 3U97A 5IG0A 3RGAA 1IVUA 2YFLB 4FMDA 4WYKB 3L0RA 1N5PA 3FF2A 4TX4A 4R4KA 3CCL3 2GU1A 4R9LA 1Q864 1SJWA 2XFSA 3OW22 4IIAA 3CXC2 3B4PA 1YIT3 3IPTA 4EBGA 1OHOA 3RDEA 3KSPA 5AIIA 1O7HB 1A2VA 3H51A 4IT7A 2JQ5A 1JKGA 3SXXA 1EA2A 4BTXA 2Y74A 1N8R4 4FMAA 1IV7A 1CEWI 3M8CA 1QVG2 4EV5A 2RSXA 3S28A 1VQL3 1OPYA 1EKMA 2YFJB 1Q40B 1W01A 1JB2A 5IEOA 2Q07A 5CF1A 1Q42A 5A0OB 3F7SA 4O8SA 2OQEA 4FMCA 1JRQA 1VQ83 3EE1A 3NBBA 3D3LA 1VQO3 3EBYA 2E2VA 2STDA 4J8TA 3SEDA 3WA2X 5CK6A 3CMA3 4MMYB 1IQYA 2CG0A 3LTCA 3JUNA 1TU5A 3EJVA 3OV4A 4GB5A 3DGMA 1FUWA 1SIHA 3UB1A 2HMNB 2KCDA 3EQQB 1DMQA 1MOLA 2BNGA 5EEOA 1W2B2 2BMRB 4JRFA 1C7HA 3QK9A 4STDA 4L8OA 1VQN3 5EQLA 1OACA 2JDIH 1DVDA 3K63A 2W6JH 1M1K4 1D6UA 1VQM3 1YJN3 1CQSA 1O7MB 1T5YA 4O02B 3WOFB 3NBJA 1Y4KA 2XGNA 1GY6A 3FSDA 3PGBA 1PFPA 3F8XA 2IA7A 5KP4A 3EB8A 3JUQA 5IENA 1D6ZA 3I563 4KVHA 3K9MC 3CPOA 2KRTA 2Z76A 3X42A 2FGTA 3EC9A 3MPHA 3KE7A 3UL5A 4OVMA 1DMNA 1QAFA 3OWUA 3GAXA 1K41A 4KFEA 3HZPA 2ML6A 1KD14 1IVVA 3N54B 2IUJA 1A90A 1QAKA 3MHEA 1W5ZA 1K734 4HKVB 2HMMB 3OXAA 4HM2B 2PNCA 3F7XA 1IT8A 3MWZA 2L4VA 3ROBA 1S723 3CD63 5D82A 1W2ZA 2W9PA 3STDA 2F86B 4H3UA 2W56A 5AYSC 4RZMA 1W00A 4JF8A 3SOYA 2CFDA 5KP1A 3CCU3 1JN5B 3FG3A 2CWUA 3F40A 3VF1A 2OCTA 1FGOA 3FH1A 2BT3A 1STFI 2GEXA 2Y73A 4QWTA 3X3XA 2QIYA 3LYGA 3NQYA 3Q1CA 5JBSA 1W02A 3GZBA 1BUQA 1ZX2A 3DMCA 4PEJA 4WWUC 1GYBA 2KXGA 2R4IA 4Q53A 4OUQA 3DXOA 4N6V0 4X2OA 5LC6A 5FW5A 1VQ43 1OF5A 3IJEB 1AV4A 1QJGA 1W6YA 4XDWA 1WMOA 2IUKA 4XB5A 1N9JA 1QMAA 2CFGA 2E2UA 1JV2B 1QVF2 5IG3A 1GY7A 3CCM3 1A67A 4XM4A 1HU9A 4NREA 3OWYA 4FCZA 5TGNA 3WMDA 3X3ZA 2ML5A 4HM3B 3CCS3 2CWTA 3UJMA 5AYRB 2XSOB 3KFQC 4RNZA 2OTJ3 2Z7AA 4EV2A 5BVBA 2XGLA 2B24B 4AEQA 3G16A 1Z1SA 2D42A 1NB3I 1YHQ3 4U13A 3NBRA 3RGRA 3KN4A 4O2HA 3BNCA 4WP5A 5IG5A 2CFWA 3HX8A 3S29A 1LNHA 1WTHA 2M7OA 3DGNA 1IDPA 4N6UA 2C11A 1PU4A 4N6OB 8CHOA 1NDOB 2W0QA 3ER7A 1TFKA 5ELUA 1UI8A 2P05A 3DM8A 3D9RA 2F99A 3F8HA 4XDVA 3K0ZA 3U1WA 4N6LA 3A76A 2XH9A 2F98A 4R1KA 3F14A 2IMJA 3LTBA 1CYUA 3DUKA 2I9WA 4MMXB 2HMJB 3CCV3 1VQP3 1RKYA 3DGOA 1NU3A 2B1XB 1K9M4 1OGXA 3AMOB 3B8LA 1AVLA 3V98A 1KQS2 3WDGB 3JUPA 2W04A 5DRVA 1OUNA 2OOVC 2XRXB 3NHXA 3NM2A 2CFLA 1YIJ3 3FF0A 5AI1A 4L8PA 2MC8A 2W9QA 5BXQA 4HM0B 1JNQA 5IEPA 1O7WB 1JB5A 1Q40A 1DYUA 2CC3A 3BLZA 2YFIB 1OGZA 2FNQA 3X40A 3G4S3 4R80A 2RGQA 3H3HA 4H61A 1KWIA 1OH0A 1ULJB 1IVXA 3PYJA 5D81A 2D1WA 4HVNA 2SBLA 5DREA 3WA3A 1Q824 1FA3A 4RNYA 1WQLB 2WGOA 4CCVA 2GU3A 1FGTA 3NV0B 1STDA 1JB4A 1O7GB 1S5AA 1NWWA 3FGYA 5G2GA 1EQKA 3DY5A 1IQXA 1OHSA 3FZWA 1LVNA 1YI23 4IPBA 3B7CA 5IG4A 2XEPA 1QALA 1R4CA 1FGMA 3N8BA 1G96A 3EX9A 1KC84 2GBWB 4WHAA 3G8ZA 3LH4A 1WNHA 1V74A 4N3VA 1IV9A 1VQ53 1KSIA 2BHMA 2GXFA 3PCSA 3KKGA 1OF5B 3EF8A 1YVBI 4HM5B 3PS8A 1U8CB 3LOYA 3T8NA 2BO9B 2WO0A 4HM8B 3FKAA 4N6TA 3FG1A 2O9UX 5LC7A 3VSYA 4AKZA 3UL6A 2ZL8A 1O7PB 1VZZA 3FG4A 3HI7A 4LZIA 1N5HA 3MG1A 4LEHA 3T0UA 1ZO2A 3UNLA 3HIIA 5AIFA 1N8QA 3CCJ3 4LMIA 2XF3A 2QGUA 4NHFA 4WFOA 1UUVB 5FGOA 1TFOA 5HGRA 4BTWA 3PZWA 3GWRA 3LXUX 1YJ93 2MF7A 3EHCA 4HM4B 1K28A 5EVHA 1RRHA 3I553 3K7CA 2OTL3 4HJLB 3NM7A 5AEWB 4XBYA 2INXA 2XSHB 1IQ8A 5CLKA 4HYZA 2RFRA 1JKGB 1ROAA 5D83A 3SOAA 3K5TA 3S27A 4RBNA 1M9GA 1Q7Y4 1WMNA 2OQEC 2XFTA 3X3YA 1TIJA 2CHCA 3N9HA 2FXTA 2HMLB 1RJOA 1W6CA 1W6GA 4K1UA 3V99A 1SIIA 1OHPA 1WMPA 5IF6A 2CK3H 1ULIB 1E3VA 2BMOB 3MG2A 3OWSA 4AKYA 4FMBA 2W2CA 4HBRA 5CXOA 4KZ1A 3BNBA 1N9EA 2PZVA 1SPUA 2WGQA 2CG1A 3O8YA 1FGQA 2HMKB 5STDA 3T8UA 2O3OA 3I0YA 1O7NB 2OWPA 1UUWB 3WODG 2LQVA 2P09A 4N6MA 3WOEB 3GRDA 4K61A 2LYXA 2WOHA 4HZ9B 5JPPA 2Z6BA 1JJ22 1IT7A 4WYKA 3G6E3 3BNDA 3DGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZR A;  3S5C A;  3KZT A;  3EN8 A;  3EN1 B;  1GY5 A;  5AIG A;  4I4K A;  3MKI A;  5KP3 A;  4K1V A;  5CF2 A;  1ASK A;  2GEY A;  3HK4 A;  3VGN A;  1EG9 B;  1ISK A;  3JUM A;  3Q90 A;  4L7K A;  2K54 A;  1DMM A;  4XBT A;  3E99 A;  5AIH A;  4FCJ A;  3DZL A;  1A2K A;  4LGQ A;  3MSO A;  2A15 A;  3OX9 A;  3B4O A;  3CNM A;  4HM7 B;  4FCM A;  2CKF B;  1TUH A;  4XBX A;  2UX0 A;  3EBT A;  3BB9 A;  4HZB B;  4J9A A;  5AEU B;  3F9S A;  3GZY B;  3MYT A;  3MG3 A;  2BMQ B;  4ORL A;  1GS3 A;  4R9K A;  1U5O A;  3NUV A;  4HM1 B;  4CDL A;  3ECF A;  3CNX A;  3GZX B;  1E97 A;  1HKX A;  3FLJ A;  2Z77 A;  3NV0 A;  2HMO B;  1AR0 A;  7STD A;  4MJD A;  1TP6 A;  5JPU A;  4HM6 B;  2GBX B;  6STD A;  2RCD A;  3LZA A;  1OCV A;  1E3R A;  3CU3 A;  3G0K A;  3NXJ A;  1JN5 A;  4X2H A;  2XR8 B;  5IER A;  3JUO A;  5IG0 A;  3RGA A;  2YFL B;  4WYK B;  3FF2 A;  4R9L A;  1SJW A;  4IIA A;  3B4P A;  3IPT A;  1OHO A;  3KSP A;  5AII A;  1O7H B;  3H51 A;  1JKG A;  2JQ5 A;  1EA2 A;  3M8C A;  1OPY A;  2YFJ B;  1Q40 B;  1W01 A;  1JB2 A;  5IEO A;  5CF1 A;  1Q42 A;  3F7S A;  3EBY A;  2STD A;  4J8T A;  3SED A;  5CK6 A;  3JUN A;  3EJV A;  3OV4 A;  4GB5 A;  2HMN B;  3EQQ B;  1DMQ A;  2BNG A;  2BMR B;  1C7H A;  4STD A;  4L8O A;  1CQS A;  1O7M B;  3FSD A;  1GY6 A;  3F8X A;  5KP4 A;  3JUQ A;  5IEN A;  4KVH A;  3CPO A;  2Z76 A;  3EC9 A;  3KE7 A;  4OVM A;  1DMN A;  3OWU A;  1K41 A;  3HZP A;  3MHE A;  4HKV B;  2HMM B;  3OXA A;  4HM2 B;  3F7X A;  3ROB A;  5D82 A;  3STD A;  2F86 B;  4H3U A;  4RZM A;  1W00 A;  3SOY A;  5KP1 A;  1JN5 B;  3F40 A;  3FH1 A;  2GEX A;  2QIY A;  3LYG A;  1W02 A;  3GZB A;  1BUQ A;  1ZX2 A;  3DMC A;  4PEJ A;  4WWU C;  1GYB A;  2R4I A;  4Q53 A;  4OUQ A;  3DXO A;  4X2O A;  5FW5 A;  1OF5 A;  1QJG A;  1W6Y A;  4XDW A;  4XB5 A;  1QMA A;  5IG3 A;  1GY7 A;  4XM4 A;  3OWY A;  5TGN A;  3WMD A;  4HM3 B;  3UJM A;  2XSO B;  2Z7A A;  5BVB A;  2B24 B;  3G16 A;  1Z1S A;  4U13 A;  3NBR A;  3RGR A;  4WP5 A;  5IG5 A;  3HX8 A;  1IDP A;  8CHO A;  1NDO B;  3ER7 A;  3DM8 A;  3D9R A;  2F99 A;  3F8H A;  4XDV A;  3K0Z A;  3A76 A;  2F98 A;  4R1K A;  3F14 A;  2IMJ A;  3DUK A;  2I9W A;  2HMJ B;  1NU3 A;  2B1X B;  1OGX A;  3B8L A;  3JUP A;  5DRV A;  1OUN A;  2XRX B;  3NHX A;  3NM2 A;  3FF0 A;  5AI1 A;  4L8P A;  5BXQ A;  4HM0 B;  5IEP A;  1O7W B;  1JB5 A;  1Q40 A;  3BLZ A;  2YFI B;  1OGZ A;  2RGQ A;  3H3H A;  1OH0 A;  1ULJ B;  5D81 A;  4HVN A;  5DRE A;  1WQL B;  3NV0 B;  5G2G A;  1JB4 A;  1O7G B;  1S5A A;  1NWW A;  1STD A;  3FGY A;  1OHS A;  3FZW A;  3B7C A;  5IG4 A;  3EX9 A;  2GBW B;  3G8Z A;  4N3V A;  2GXF A;  3KKG A;  1OF5 B;  3EF8 A;  4HM5 B;  3T8N A;  4HM8 B;  3FKA A;  3VSY A;  1O7P B;  1VZZ A;  3MG1 A;  4LEH A;  1ZO2 A;  3UNL A;  5AIF A;  4LMI A;  2QGU A;  1UUV B;  5HGR A;  3GWR A;  3EHC A;  5EVH A;  4HM4 B;  3K7C A;  4HJL B;  5AEW B;  4XBY A;  2INX A;  2XSH B;  5CLK A;  5D83 A;  3SOA A;  2RFR A;  1JKG B;  2CHC A;  2HML B;  4K1U A;  1OHP A;  5IF6 A;  1ULI B;  1E3V A;  2BMO B;  3MG2 A;  3OWS A;  2W2C A;  5CXO A;  2PZV A;  2HMK B;  5STD A;  3T8U A;  3I0Y A;  1O7N B;  2OWP A;  1UUW B;  3GRD A;  4HZ9 B;  5JPP A;  4WYK A; 
#chains in the Genus database with same CATH topology
 2R41 A;  3S67 A;  1IU7 A;  3LT8 A;  4EYC A;  3ALA A;  3GZR A;  3LTD A;  3PCR A;  3S5C A;  3ZG0 A;  4J5G A;  3FCS B;  3KZT A;  1K8A 4;  8RNT A;  2WOF A;  1B3S A;  3EN8 A;  3EN1 B;  1GY5 A;  5AIG A;  1LRA A;  1F8N A;  2GSP A;  4I4K A;  3PXM A;  4MMZ B;  3MKI A;  5KP3 A;  1VQ7 3;  1UGI A;  1BNF A;  1CYV A;  4K1V A;  1SQW A;  1LOX A;  1LXE A;  1MGW A;  1FGR A;  5CF2 A;  2BIR A;  1ASK A;  2GEY A;  3NQZ A;  5IW9 A;  1VQ6 3;  3HK4 A;  3VGN A;  1GMQ A;  1UI7 A;  4N6N B;  3CCE 3;  3CC4 3;  1BNJ A;  1EG9 B;  1W7C A;  1ISK A;  1DVC A;  3HIG A;  1VQ9 3;  3JUM A;  1J2B A;  1D6Y A;  3CC2 3;  3CCR 3;  4KFF A;  3Q90 A;  4L7K A;  3URP A;  2K54 A;  3CPW 2;  1Q81 4;  1US1 A;  2CIU A;  4KT3 B;  3BNE A;  1DMM A;  3HOH A;  3LT9 A;  3SLU A;  2W03 A;  5M19 A;  3Q2P A;  1VQK 3;  2SAR A;  4XBT A;  1MGR A;  3E99 A;  3CCQ 3;  3QRD A;  1YGE A;  2CH9 A;  1IVW A;  1NO3 A;  3LML A;  4BIR A;  5AIH A;  1TJD A;  3DZL A;  4FCJ A;  1A2K A;  4LGQ A;  3AMO A;  3MSO A;  1UCK A;  3G71 3;  2P38 A;  2P0M A;  2A15 A;  3OX9 A;  2W56 B;  1IK3 A;  4MEI A;  5M1A A;  3B4O A;  1GMR A;  3CNM A;  4HM7 B;  1FW7 A;  4FCM A;  2CKF B;  1YJW 3;  4BU4 A;  3SX1 A;  6RNT A;  1NJI 4;  4KFD A;  1TUH A;  4XBX A;  1T2H A;  1BSD A;  1RGE A;  1GOY A;  1ROV A;  1AVK A;  1GD3 A;  1RN7 A;  2CW9 A;  2UX0 A;  2ZDJ A;  1M1X B;  3BB9 A;  3EBT A;  3F9S A;  3GZY B;  4HZB B;  5AEU B;  3MYT A;  1BNI A;  3MG3 A;  2BMQ B;  3TDG A;  3JVC A;  1B2Z A;  4FR9 A;  4ORL A;  3V92 A;  1BSE A;  1GS3 A;  4R9K A;  3KII A;  1UW1 A;  1GD4 A;  1U5O A;  3NUV A;  4HM1 B;  4CDL A;  1NB5 I;  5BIR A;  5D83 A;  1M90 4;  1I2G A;  2E2T A;  3ECF A;  3SVA A;  5HOH A;  3CNX A;  2CWV A;  4EW5 A;  3GZX B;  1LOW A;  3J7Y d;  1E97 A;  1HKX A;  2K3D A;  2ZA4 A;  2H0I A;  1G0T A;  2Z77 A;  3FLJ A;  1RRL A;  4GL6 A;  4K90 B;  2V1L A;  3BU4 A;  3CME 3;  3NV0 A;  3CC7 3;  3AGO A;  3LTA A;  4OK0 A;  4CPK A;  1BRS A;  2AAE A;  1RGC A;  2HMO B;  1AR0 A;  4CJN A;  1I70 A;  3IMA B;  1B2U A;  4MJD A;  7STD A;  1LQM B;  3X41 A;  1R4Y A;  6GSP A;  1TP6 A;  5JPU A;  2F5M A;  4HM6 B;  4LSO A;  1RDS A;  2GBX B;  2K0M A;  2RCD A;  3LZA A;  6STD A;  1JBT A;  1L5G B;  1OCV A;  1E3R A;  2C10 A;  2KF5 A;  2P0X A;  1V58 A;  4O3V A;  1YNV X;  3CU3 A;  3G0K A;  3D5G A;  1MWU A;  1W4N A;  4ZM8 A;  2CFK A;  2QEX 3;  1FUT A;  3NXJ A;  5ELJ A;  1JN5 A;  2QA4 3;  4X2H A;  2XR8 B;  3KSE D;  5I97 A;  5IER A;  3NX0 A;  3JUO A;  4G1M B;  4EXR A;  1MNL A;  1TTO A;  1I0X A;  1BGS A;  2YX9 A;  4BTY A;  3U97 A;  1X1U A;  3A5E A;  5IG0 A;  3RGA A;  1IVU A;  1UCI A;  2YFL B;  4FMD A;  4WYK B;  3L0R A;  1N5P A;  3FF2 A;  4TX4 A;  1EEJ A;  4R4K A;  3CCL 3;  1Q7H A;  2GU1 A;  4R9L A;  1Q86 4;  1SJW A;  3D79 A;  2XFS A;  4GHO A;  3OW2 2;  4IIA A;  3CXC 2;  3B4P A;  1YIT 3;  3IPT A;  4EBG A;  1OHO A;  3RDE A;  3KSP A;  5AII A;  1O7H B;  1A2V A;  2BU4 A;  3H51 A;  4IT7 A;  1B21 A;  1JKG A;  2JQ5 A;  4BL3 A;  2KF3 A;  3SXX A;  3AGN A;  1EA2 A;  1BSA A;  4BTX A;  2Y74 A;  2RNT A;  4FMA A;  3ZFZ A;  1N8R 4;  1IV7 A;  4HAA A;  1CEW I;  3M8C A;  1QVG 2;  4EV5 A;  1RCL A;  1LNI A;  2RSX A;  3S28 A;  1VQL 3;  1OPY A;  2F56 A;  1EKM A;  2YFJ B;  1Q40 B;  1W01 A;  1JB2 A;  5IEO A;  2Q07 A;  1EUI C;  4J5K A;  5CF1 A;  1Q42 A;  5A0O B;  1BVI A;  3F7S A;  4O8S A;  2OQE A;  1G02 A;  4FMC A;  1JRQ A;  5GSP A;  1VQ8 3;  3DH2 A;  3EE1 A;  3NBB A;  3D3L A;  1VQO 3;  3EBY A;  1RSN A;  2E2V A;  2STD A;  4J8T A;  3BIR A;  3SED A;  3WA2 X;  1X1W A;  5CK6 A;  3AHS A;  3CMA 3;  4MMY B;  1IQY A;  1GOU A;  2CG0 A;  3LTC A;  4HOH A;  3JUN A;  1TU5 A;  3EJV A;  3OV4 A;  1RHL A;  4GB5 A;  3DGM A;  1FUW A;  1CH0 A;  1SIH A;  3UB1 A;  2HMN B;  2KCD A;  3EQQ B;  1DMQ A;  1MOL A;  2KF6 A;  2BNG A;  5EEO A;  1W2B 2;  2BMR B;  4JRF A;  1C7H A;  3QK9 A;  4STD A;  4L8O A;  3SYU A;  1VQN 3;  5EQL A;  1OAC A;  2JDI H;  1DVD A;  3K63 A;  1B20 A;  2W6J H;  1D6U A;  1GOV A;  1VQM 3;  1CQS A;  1O7M B;  1PYL A;  1T5Y A;  1BOX A;  4O02 B;  3WOF B;  3NBJ A;  1YJN 3;  1DE3 A;  5RNT A;  1Y4K A;  2XGN A;  1GY6 A;  3FSD A;  3PGB A;  1I0V A;  1PFP A;  1TRP A;  2IA7 A;  3F8X A;  3EB8 A;  3D5I A;  3JUQ A;  4BL2 A;  5KP4 A;  1JBS A;  5IEN A;  1BU4 A;  1D6Z A;  1UDI I;  4KVH A;  3I56 3;  3K9M C;  3CPO A;  1BRI A;  1ZS7 A;  2KRT A;  2Z76 A;  3X42 A;  2FGT A;  3EC9 A;  1RTU A;  3MPH A;  1BNS A;  1RGK A;  3KE7 A;  3UL5 A;  4OVM A;  1RGF A;  1DMN A;  1IYY A;  3AHW A;  1QAF A;  3OWU A;  3GAX A;  1K41 A;  4KFE A;  1BRH A;  2ML6 A;  3HZP A;  2H0G A;  4GSP A;  5M18 A;  1KD1 4;  1IVV A;  3N54 B;  2IUJ A;  2L1S A;  1A90 A;  1QAK A;  3MHE A;  1W5Z A;  1K73 4;  4HKV B;  1BSB A;  2HMM B;  3KCH A;  5G1L A;  3OXA A;  4HM2 B;  2PNC A;  1PY3 A;  3F7X A;  3RNT A;  4DKI A;  1IT8 A;  4I5Q A;  3MWZ A;  2L4V A;  3GSP A;  3ROB A;  1S72 3;  3CD6 3;  5D82 A;  1W2Z A;  2W9P A;  3STD A;  2F86 B;  1B2X A;  4H3U A;  1BSC A;  1VQQ A;  1UUG B;  2W56 A;  1BRG A;  5AYS C;  4RZM A;  1W00 A;  4JF8 A;  3SOY A;  2CFD A;  5KP1 A;  3CCU 3;  1JN5 B;  3FG3 A;  2CWU A;  3F40 A;  1ZGX A;  4NPB A;  3VF1 A;  2HOH A;  2OCT A;  1FGO A;  3FH1 A;  2BT3 A;  1STF I;  2CX0 A;  2GEX A;  2Y73 A;  4QWT A;  2QIY A;  3X3X A;  3LYG A;  3NQY A;  3Q1C A;  5JBS A;  1W02 A;  3GZB A;  1BUQ A;  1ZX2 A;  3DMC A;  4PEJ A;  4WWU C;  1GYB A;  2KXG A;  2R4I A;  4Q53 A;  4OUQ A;  3DXO A;  4N6V 0;  4X2O A;  5LC6 A;  5FW5 A;  1B2M A;  1OF5 A;  3IJE B;  1AV4 A;  1VQ4 3;  1QJG A;  1W6Y A;  4XDW A;  1WMO A;  2IUK A;  4XB5 A;  1N9J A;  1QMA A;  2CFG A;  2UUG C;  2OOV A;  2E2U A;  1JV2 B;  2H0H A;  1QVF 2;  5IG3 A;  1GY7 A;  3CCM 3;  1A67 A;  4XM4 A;  1YVS A;  1HU9 A;  4NRE A;  3OWY A;  4FCZ A;  1BNE A;  1I8V A;  5TGN A;  3WMD A;  3X3Z A;  1X1Y A;  2ML5 A;  4HM3 B;  3CCS 3;  2CWT A;  3UJM A;  5AYR B;  2XSO B;  3KFQ C;  4RNZ A;  2OTJ 3;  2Z7A A;  4EV2 A;  2KAA A;  1RLS A;  5BVB A;  1FZU A;  2B24 B;  2XGL A;  1BRN L;  4AEQ A;  3G16 A;  1Z1S A;  1YGW A;  2D42 A;  1NB3 I;  1YHQ 3;  4U13 A;  3NBR A;  1RGH A;  3RGR A;  3KN4 A;  4O2H A;  3BNC A;  4WP5 A;  5IG5 A;  2CFW A;  3HX8 A;  3S29 A;  1I2F A;  1JZD A;  1LNH A;  1HZ1 A;  1WTH A;  1RN4 A;  2M7O A;  1IDP A;  3DGN A;  4N6U A;  1UGH I;  2C11 A;  1PU4 A;  1I3F A;  1MWR A;  4N6O B;  1T3B A;  8CHO A;  1NDO B;  2W0Q A;  3ER7 A;  5G1K A;  1I2E A;  1RGL A;  1TFK A;  5ELU A;  1UI8 A;  2P05 A;  3DM8 A;  1MWS A;  1GSP A;  3D9R A;  2F99 A;  3F8H A;  4RNT A;  4XDV A;  1NNV A;  3K0Z A;  3U1W A;  4N6L A;  3A76 A;  2XH9 A;  9RNT A;  2F98 A;  4R1K A;  1MWT A;  1LOY A;  3F14 A;  1RN1 A;  2IMJ A;  1RNB A;  1I3I A;  3LTB A;  7RNT A;  1CYU A;  1HYF A;  3DUK A;  2I9W A;  4MMX B;  1BAO A;  2HMJ B;  2IYJ A;  3CCV 3;  1VQP 3;  1RKY A;  3DGO A;  1NU3 A;  2B1X B;  1K9M 4;  1OGX A;  3AMO B;  3B8L A;  1AVL A;  3V98 A;  1KQS 2;  3WDG B;  3JUP A;  2W04 A;  1AY7 A;  1AQZ A;  5DRV A;  1OUN A;  2OOV C;  1RCK A;  2F5W A;  2XRX B;  2CFL A;  3NHX A;  3FF0 A;  3NM2 A;  1YIJ 3;  5AI1 A;  4L8P A;  2UGI A;  2MC8 A;  2W9Q A;  5BXQ A;  4HM0 B;  1JNQ A;  5IEP A;  1DET A;  1O7W B;  1JB5 A;  1Q40 A;  1DYU A;  1Q9E A;  3ZG5 A;  1BAN A;  2CC3 A;  2RBI A;  2F4Y A;  3BLZ A;  2AAD A;  2YFI B;  1OGZ A;  2FNQ A;  3X40 A;  3G4S 3;  4R80 A;  2RGQ A;  3H3H A;  4H61 A;  1KWI A;  1OH0 A;  1ULJ B;  1B27 A;  2C4B A;  1IVX A;  3D4A A;  3PYJ A;  1BUJ A;  5D81 A;  2D1W A;  4HVN A;  2SBL A;  5DRE A;  3WA3 A;  1Q82 4;  1FA3 A;  4RNY A;  1WQL B;  2WGO A;  4CCV A;  1V57 A;  2GU3 A;  1FGT A;  3NV0 B;  1STD A;  1JB4 A;  1O7G B;  1S5A A;  1NWW A;  3FGY A;  5G2G A;  3WHO A;  1EQK A;  3DY5 A;  1C54 A;  1B2S A;  1IQX A;  1OHS A;  3FZW A;  1LVN A;  1YI2 3;  4IPB A;  3B7C A;  1X1X A;  2IY2 A;  7GSP A;  2XEP A;  5IG4 A;  1QAL A;  1R4C A;  1FGM A;  1SAR A;  3N8B A;  1G96 A;  3EX9 A;  1KC8 4;  1RGG A;  1T2I A;  2GBW B;  3G8Z A;  3LH4 A;  1WNH A;  1V74 A;  4N3V A;  1IV9 A;  4ILF A;  4WHA A;  1VQ5 3;  1KSI A;  2BHM A;  2GXF A;  3PCS A;  1BNG A;  2ZHX B;  1FYS A;  1OF5 B;  3KKG A;  3EF8 A;  1YVB I;  4HM5 B;  3PS8 A;  1U8C B;  3LOY A;  3T8N A;  1RGA A;  3WR2 A;  2BO9 B;  2WO0 A;  4HM8 B;  1JZO A;  3FKA A;  4N6T A;  1TRQ A;  2O9U X;  3FG1 A;  5LC7 A;  3VSY A;  4AKZ A;  4LYL B;  3UL6 A;  2ZL8 A;  1O7P B;  1UCJ A;  1VZZ A;  3FG4 A;  3HI7 A;  4LZI A;  1N5H A;  1BRK A;  3MG1 A;  4LEH A;  3T0U A;  1ZO2 A;  3UNL A;  3HII A;  3DGY A;  5AIF A;  1N8Q A;  3CCJ 3;  4LMI A;  2XF3 A;  2QGU A;  4NHF A;  4WFO A;  1UUV B;  1LOV A;  1TFO A;  5FGO A;  5HGR A;  4BTW A;  3PZW A;  1BIR A;  3GWR A;  3LXU X;  1YJ9 3;  2MF7 A;  3EHC A;  4HM4 B;  1K28 A;  5EVH A;  1RRH A;  5BU4 A;  3K7C A;  3I55 3;  4HJL B;  2OTL 3;  2J8X B;  3NM7 A;  5AEW B;  4XBY A;  2INX A;  2XSH B;  1IQ8 A;  1BRJ A;  4HYZ A;  2RFR A;  1JKG B;  1ROA A;  5CLK A;  3Q3F A;  3K5T A;  3SOA A;  3S27 A;  4RBN A;  1UCL A;  1M9G A;  1Q7Y 4;  1WMN A;  1GMP A;  2OQE C;  2XFT A;  1TIJ A;  2CHC A;  3N9H A;  3X3Y A;  2FXT A;  2HML B;  1RJO A;  1W6C A;  1W6G A;  4K1U A;  3V99 A;  1LQG C;  1SII A;  1OHP A;  1WMP A;  5IF6 A;  2CK3 H;  1ULI B;  2CX1 A;  1RMS A;  1RNT A;  1E3V A;  2BMO B;  3MG2 A;  3OWS A;  4AKY A;  4FMB A;  1FUS A;  2W2C A;  4HBR A;  4J9A A;  5CXO A;  4KZ1 A;  3BNB A;  1N9E A;  2PZV A;  1SPU A;  2WGQ A;  2CG1 A;  3O8Y A;  1FGQ A;  2HMK B;  5STD A;  3T8U A;  2O3O A;  3I0Y A;  1O7N B;  2OWP A;  1UUW B;  3WOD G;  2LQV A;  1BNR A;  2KF4 A;  2P09 A;  4N6M A;  3WOE B;  4EC6 A;  1A2P A;  3GRD A;  4K61 A;  2LYX A;  2WOH A;  4HZ9 B;  5JPP A;  2Z6B A;  1JJ2 2;  1IT7 A;  1M1K 4;  1JBR A;  4WYK A;  3G6E 3;  3BND A;  3DGL A; 
#chains in the Genus database with same CATH homology
 3S67 A;  1IU7 A;  3LT8 A;  4EYC A;  3ALA A;  3GZR A;  3LTD A;  3PCR A;  3S5C A;  3FCS B;  3KZT A;  1K8A 4;  2WOF A;  3EN8 A;  3EN1 B;  1GY5 A;  5AIG A;  1F8N A;  4I4K A;  3PXM A;  4MMZ B;  3MKI A;  5KP3 A;  1VQ7 3;  1CYV A;  4K1V A;  1SQW A;  1LOX A;  1LXE A;  1FGR A;  5CF2 A;  1ASK A;  2GEY A;  3NQZ A;  5IW9 A;  1VQ6 3;  3HK4 A;  3VGN A;  3CCE 3;  1UI7 A;  4N6N B;  3CC4 3;  1EG9 B;  1W7C A;  1ISK A;  1DVC A;  3HIG A;  1VQ9 3;  3JUM A;  1J2B A;  1D6Y A;  3CC2 3;  3CCR 3;  4KFF A;  3Q90 A;  4L7K A;  2K54 A;  3CPW 2;  1Q81 4;  1US1 A;  2CIU A;  3BNE A;  1DMM A;  3SLU A;  3LT9 A;  1VQK 3;  2W03 A;  3Q2P A;  4XBT A;  3E99 A;  3CCQ 3;  3QRD A;  1YGE A;  2CH9 A;  1IVW A;  1NO3 A;  3LML A;  5AIH A;  4FCJ A;  3DZL A;  1A2K A;  4LGQ A;  3AMO A;  3MSO A;  3G71 3;  2P38 A;  2P0M A;  2A15 A;  3OX9 A;  2W56 B;  1IK3 A;  4MEI A;  3B4O A;  3CNM A;  4HM7 B;  4FCM A;  2CKF B;  1YJW 3;  3SX1 A;  1NJI 4;  4KFD A;  1TUH A;  4XBX A;  1ROV A;  2UX0 A;  2OOV A;  4EC6 A;  1AVK A;  1GD3 A;  1RN7 A;  2ZDJ A;  2CW9 A;  3BB9 A;  1M1X B;  3EBT A;  4HZB B;  3F9S A;  3GZY B;  4J9A A;  5AEU B;  3MYT A;  3MG3 A;  2BMQ B;  3TDG A;  3JVC A;  4FR9 A;  4ORL A;  3V92 A;  1GS3 A;  4R9K A;  3KII A;  1UW1 A;  1GD4 A;  1U5O A;  3NUV A;  4HM1 B;  4CDL A;  1NB5 I;  1M90 4;  2E2T A;  3SVA A;  3ECF A;  3CNX A;  2CWV A;  3GZX B;  3J7Y d;  1E97 A;  1HKX A;  3FLJ A;  2Z77 A;  4K90 B;  4GL6 A;  1RRL A;  2V1L A;  3CME 3;  3NV0 A;  3CC7 3;  3LTA A;  4OK0 A;  2HMO B;  1AR0 A;  7STD A;  3IMA B;  4MJD A;  3X41 A;  1TP6 A;  5JPU A;  4HM6 B;  4LSO A;  2GBX B;  2K0M A;  2RCD A;  3LZA A;  6STD A;  1L5G B;  1OCV A;  1E3R A;  2C10 A;  2P0X A;  4O3V A;  3CU3 A;  3G0K A;  1W4N A;  4ZM8 A;  2CFK A;  2QEX 3;  3NXJ A;  5ELJ A;  1JN5 A;  2QA4 3;  4X2H A;  2XR8 B;  3KSE D;  5I97 A;  5IER A;  3NX0 A;  3JUO A;  4G1M B;  4EXR A;  1MNL A;  2YX9 A;  4BTY A;  3U97 A;  5IG0 A;  3RGA A;  1IVU A;  2YFL B;  4FMD A;  4WYK B;  3L0R A;  1N5P A;  3FF2 A;  4TX4 A;  4R4K A;  3CCL 3;  2GU1 A;  4R9L A;  1Q86 4;  1SJW A;  2XFS A;  3OW2 2;  4IIA A;  3CXC 2;  3B4P A;  1YIT 3;  3IPT A;  4EBG A;  1OHO A;  3RDE A;  3KSP A;  5AII A;  1O7H B;  1A2V A;  3H51 A;  4IT7 A;  2JQ5 A;  1JKG A;  3SXX A;  1EA2 A;  4BTX A;  2Y74 A;  1N8R 4;  4FMA A;  1IV7 A;  1CEW I;  3M8C A;  1QVG 2;  4EV5 A;  2RSX A;  3S28 A;  1VQL 3;  1OPY A;  1EKM A;  2YFJ B;  1Q40 B;  1W01 A;  1JB2 A;  5IEO A;  2Q07 A;  5CF1 A;  1Q42 A;  5A0O B;  3F7S A;  4O8S A;  2OQE A;  4FMC A;  1JRQ A;  1VQ8 3;  3EE1 A;  3NBB A;  3D3L A;  1VQO 3;  3EBY A;  2E2V A;  2STD A;  4J8T A;  3SED A;  3WA2 X;  5CK6 A;  3CMA 3;  4MMY B;  1IQY A;  2CG0 A;  3LTC A;  3JUN A;  1TU5 A;  3EJV A;  3OV4 A;  4GB5 A;  3DGM A;  1FUW A;  1SIH A;  3UB1 A;  2HMN B;  2KCD A;  3EQQ B;  1DMQ A;  1MOL A;  2BNG A;  5EEO A;  1W2B 2;  2BMR B;  4JRF A;  1C7H A;  3QK9 A;  4STD A;  4L8O A;  1VQN 3;  5EQL A;  1OAC A;  2JDI H;  1DVD A;  3K63 A;  2W6J H;  1M1K 4;  1D6U A;  1VQM 3;  1YJN 3;  1CQS A;  1O7M B;  1T5Y A;  4O02 B;  3WOF B;  3NBJ A;  1Y4K A;  2XGN A;  1GY6 A;  3FSD A;  3PGB A;  1PFP A;  3F8X A;  2IA7 A;  5KP4 A;  3EB8 A;  3JUQ A;  5IEN A;  1D6Z A;  3I56 3;  4KVH A;  3K9M C;  3CPO A;  2KRT A;  2Z76 A;  3X42 A;  2FGT A;  3EC9 A;  3MPH A;  3KE7 A;  3UL5 A;  4OVM A;  1DMN A;  1QAF A;  3OWU A;  3GAX A;  1K41 A;  4KFE A;  3HZP A;  2ML6 A;  1KD1 4;  1IVV A;  3N54 B;  2IUJ A;  1A90 A;  1QAK A;  3MHE A;  1W5Z A;  1K73 4;  4HKV B;  2HMM B;  3OXA A;  4HM2 B;  2PNC A;  3F7X A;  1IT8 A;  3MWZ A;  2L4V A;  3ROB A;  1S72 3;  3CD6 3;  5D82 A;  1W2Z A;  2W9P A;  3STD A;  2F86 B;  4H3U A;  2W56 A;  5AYS C;  4RZM A;  1W00 A;  4JF8 A;  3SOY A;  2CFD A;  5KP1 A;  3CCU 3;  1JN5 B;  3FG3 A;  2CWU A;  3F40 A;  3VF1 A;  2OCT A;  1FGO A;  3FH1 A;  2BT3 A;  1STF I;  2GEX A;  2Y73 A;  4QWT A;  3X3X A;  2QIY A;  3LYG A;  3NQY A;  3Q1C A;  5JBS A;  1W02 A;  3GZB A;  1BUQ A;  1ZX2 A;  3DMC A;  4PEJ A;  4WWU C;  1GYB A;  2KXG A;  2R4I A;  4Q53 A;  4OUQ A;  3DXO A;  4N6V 0;  4X2O A;  5LC6 A;  5FW5 A;  1VQ4 3;  1OF5 A;  3IJE B;  1AV4 A;  1QJG A;  1W6Y A;  4XDW A;  1WMO A;  2IUK A;  4XB5 A;  1N9J A;  1QMA A;  2CFG A;  2E2U A;  1JV2 B;  1QVF 2;  5IG3 A;  1GY7 A;  3CCM 3;  1A67 A;  4XM4 A;  1HU9 A;  4NRE A;  3OWY A;  4FCZ A;  5TGN A;  3WMD A;  3X3Z A;  2ML5 A;  4HM3 B;  3CCS 3;  2CWT A;  3UJM A;  5AYR B;  2XSO B;  3KFQ C;  4RNZ A;  2OTJ 3;  2Z7A A;  4EV2 A;  5BVB A;  2XGL A;  2B24 B;  4AEQ A;  3G16 A;  1Z1S A;  2D42 A;  1NB3 I;  1YHQ 3;  4U13 A;  3NBR A;  3RGR A;  3KN4 A;  4O2H A;  3BNC A;  4WP5 A;  5IG5 A;  2CFW A;  3HX8 A;  3S29 A;  1LNH A;  1WTH A;  2M7O A;  3DGN A;  1IDP A;  4N6U A;  2C11 A;  1PU4 A;  4N6O B;  8CHO A;  1NDO B;  2W0Q A;  3ER7 A;  1TFK A;  5ELU A;  1UI8 A;  2P05 A;  3DM8 A;  3D9R A;  2F99 A;  3F8H A;  4XDV A;  3K0Z A;  3U1W A;  4N6L A;  3A76 A;  2XH9 A;  2F98 A;  4R1K A;  3F14 A;  2IMJ A;  3LTB A;  1CYU A;  3DUK A;  2I9W A;  4MMX B;  2HMJ B;  3CCV 3;  1VQP 3;  1RKY A;  3DGO A;  1NU3 A;  2B1X B;  1K9M 4;  1OGX A;  3AMO B;  3B8L A;  1AVL A;  3V98 A;  1KQS 2;  3WDG B;  3JUP A;  2W04 A;  5DRV A;  1OUN A;  2OOV C;  2XRX B;  3NHX A;  3NM2 A;  2CFL A;  1YIJ 3;  3FF0 A;  5AI1 A;  4L8P A;  2MC8 A;  2W9Q A;  5BXQ A;  4HM0 B;  1JNQ A;  5IEP A;  1O7W B;  1JB5 A;  1Q40 A;  1DYU A;  2CC3 A;  3BLZ A;  2YFI B;  1OGZ A;  2FNQ A;  3X40 A;  3G4S 3;  4R80 A;  2RGQ A;  3H3H A;  4H61 A;  1KWI A;  1OH0 A;  1ULJ B;  1IVX A;  3PYJ A;  5D81 A;  2D1W A;  4HVN A;  2SBL A;  5DRE A;  3WA3 A;  1Q82 4;  1FA3 A;  4RNY A;  1WQL B;  2WGO A;  4CCV A;  2GU3 A;  1FGT A;  3NV0 B;  1STD A;  1JB4 A;  1O7G B;  1S5A A;  1NWW A;  3FGY A;  5G2G A;  1EQK A;  3DY5 A;  1IQX A;  1OHS A;  3FZW A;  1LVN A;  1YI2 3;  4IPB A;  3B7C A;  5IG4 A;  2XEP A;  1QAL A;  1R4C A;  1FGM A;  3N8B A;  1G96 A;  3EX9 A;  1KC8 4;  2GBW B;  4WHA A;  3G8Z A;  3LH4 A;  1WNH A;  1V74 A;  4N3V A;  1IV9 A;  1VQ5 3;  1KSI A;  2BHM A;  2GXF A;  3PCS A;  3KKG A;  1OF5 B;  3EF8 A;  1YVB I;  4HM5 B;  3PS8 A;  1U8C B;  3LOY A;  3T8N A;  2BO9 B;  2WO0 A;  4HM8 B;  3FKA A;  4N6T A;  3FG1 A;  2O9U X;  5LC7 A;  3VSY A;  4AKZ A;  3UL6 A;  2ZL8 A;  1O7P B;  1VZZ A;  3FG4 A;  3HI7 A;  4LZI A;  1N5H A;  3MG1 A;  4LEH A;  3T0U A;  1ZO2 A;  3UNL A;  3HII A;  5AIF A;  1N8Q A;  3CCJ 3;  4LMI A;  2XF3 A;  2QGU A;  4NHF A;  4WFO A;  1UUV B;  5FGO A;  1TFO A;  5HGR A;  4BTW A;  3PZW A;  3GWR A;  3LXU X;  1YJ9 3;  2MF7 A;  3EHC A;  4HM4 B;  1K28 A;  5EVH A;  1RRH A;  3I55 3;  3K7C A;  2OTL 3;  4HJL B;  3NM7 A;  5AEW B;  4XBY A;  2INX A;  2XSH B;  1IQ8 A;  5CLK A;  4HYZ A;  2RFR A;  1JKG B;  1ROA A;  5D83 A;  3SOA A;  3K5T A;  3S27 A;  4RBN A;  1M9G A;  1Q7Y 4;  1WMN A;  2OQE C;  2XFT A;  3X3Y A;  1TIJ A;  2CHC A;  3N9H A;  2FXT A;  2HML B;  1RJO A;  1W6C A;  1W6G A;  4K1U A;  3V99 A;  1SII A;  1OHP A;  1WMP A;  5IF6 A;  2CK3 H;  1ULI B;  1E3V A;  2BMO B;  3MG2 A;  3OWS A;  4AKY A;  4FMB A;  2W2C A;  4HBR A;  5CXO A;  4KZ1 A;  3BNB A;  1N9E A;  2PZV A;  1SPU A;  2WGQ A;  2CG1 A;  3O8Y A;  1FGQ A;  2HMK B;  5STD A;  3T8U A;  2O3O A;  3I0Y A;  1O7N B;  2OWP A;  1UUW B;  3WOD G;  2LQV A;  2P09 A;  4N6M A;  3WOE B;  3GRD A;  4K61 A;  2LYX A;  2WOH A;  4HZ9 B;  5JPP A;  2Z6B A;  1JJ2 2;  1IT7 A;  4WYK A;  3G6E 3;  3BND A;  3DGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...