1QJGA

Crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni in complex with equilenin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KETOSTEROID ISOMERASE
publication title Crystal Structure of Delta-5-3-Ketosteroid Isomerase from Pseudomonas Testosteroni in Complex with Equilenin Settles the Correct Hydrogen Scheme for Transition-State Stabilization
pubmed doi rcsb
source organism Pseudomonas testosteroni
molecule tags Isomerase
total genus 36
structure length 125
sequence length 125
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1qjgA00
4HJLB 5IG3A 1VZZA 2GEXA 5G2GA 4HKVB 3SOAA 4L7KA 5IEPA 3RGRA 3BLZA 5KP4A 3K0ZA 2K54A 3FZWA 5IF6A 1HKXA 1STDA 2GBXB 2HMJB 2GEYA 1JN5B 3FH1A 3GZBA 1OHPA 1ZO2A 4HVNA 1DMMA 3NBRA 5BXQA 4Q53A 3FF2A 1O7WB 3CNMA 2Z7AA 3EJVA 2PZVA 3KSPA 1CQSA 5CF2A 1Q40A 1QJGA 1UUWB 4HZ9B 3Q90A 1E3VA 4XBYA 3FF0A 1JKGB 1O7PB 4HM3B 2RFRA 2STDA 4LGQA 1WQLB 1Q42A 2HMLB 3GWRA 1ISKA 5DREA 3GRDA 5IEOA 3B7CA 4HM6B 3EN1B 2XR8B 4R1KA 1JN5A 3S5CA 2CKFB 3HK4A 1GS3A 1IDPA 4L8OA 1E97A 2R4IA 3NUVA 5AIIA 4K1VA 1W01A 4WYKA 4HM5B 1O7NB 3F8HA 3B8LA 4PEJA 4WWUC 4HM1B 1GY7A 3OWUA 3MKIA 3JUQA 1GYBA 3ROBA 3EBYA 2F86B 1U5OA 3LZAA 3GZXB 4FCJA 1BUQA 3ECFA 4WP5A 3LYGA 5D82A 4KVHA 5AI1A 3SEDA 3M8CA 4R9LA 2BMOB 5HGRA 3JUOA 5JPPA 1Q40B 3OXAA 1EG9B 3JUNA 4OUQA 3NV0A 4X2HA 3F14A 5FW5A 3HZPA 2GXFA 3I0YA 5D81A 1JB2A 2F99A 3KKGA 2HMKB 4HM8B 5IG4A 1OF5A 2INXA 3OV4A 3GZYB 4K1UA 1TP6A 2BMQB 3DM8A 1OGXA 3NM2A 5IG5A 2UX0A 5CLKA 3DMCA 3G16A 1ULIB 3CPOA 4WYKB 4HM2B 2Z77A 3DXOA 1W00A 2Z76A 2HMNB 5EVHA 1GY5A 3T8UA 1C7HA 3BB9A 3F9SA 3F7SA 7STDA 3CU3A 3F7XA 1DMQA 2QGUA 1OHOA 4GB5A 4IIAA 1OH0A 4LEHA 1UUVB 2XSHB 3MYTA 4ORLA 1ZX2A 4CDLA 3JUMA 3UNLA 1NU3A 4J9AA 3F8XA 2W2CA 5IG0A 3H3HA 4I4KA 1NWWA 5AEUB 3NXJA 1EA2A 3NV0B 5JPUA 2I9WA 2BNGA 3ER7A 2B1XB 3A76A 3B4PA 1OF5B 2QIYA 5KP3A 3CNXA 3DZLA 3OWYA 3D9RA 3STDA 3MHEA 3EC9A 3B4OA 3FKAA 4U13A 2RGQA 3VSYA 3FSDA 1K41A 2YFJB 3VGNA 1GY6A 2IMJA 4R9KA 2XSOB 2A15A 5AIHA 4J8TA 3MG2A 4FCMA 3WMDA 3E99A 3OWSA 3FGYA 4HZBB 4LMIA 5IENA 3H51A 5STDA 1OGZA 1O7MB 1W02A 1S5AA 1ASKA 3DUKA 2YFIB 5AIFA 3SOYA 4HM4B 2GBWB 5AIGA 4RZMA 4XDWA 1OPYA 3EQQB 5D83A 3MSOA 3T8NA 3EF8A 3IPTA 1ULJB 1A2KA 5CF1A 4XM4A 1W6YA 3G0KA 5BVBA 3FLJA 4N3VA 4HM0B 5KP1A 4L8PA 1DMNA 4XBTA 2OWPA 3F40A 2HMMB 4H3UA 5TGNA 3EHCA 2BMRB 3NHXA 3HX8A 3KE7A 1NDOB 4XDVA 3OX9A 2YFLB 3EN8A 1JB5A 5DRVA 3JUPA 2HMOB 4X2OA 3UJMA 4XBXA 3EBTA 2XRXB 1OHSA 2CHCA 3MG3A 2B24B 4OVMA 3K7CA 1JKGA 1TUHA 8CHOA 4HM7B 1SJWA 3RGAA 2RCDA 2F98A 1OUNA 1O7HB 1Z1SA 1AR0A 3GZRA 1O7GB 4XB5A 1JB4A 3MG1A 1E3RA 1QMAA 5IERA 4MJDA 5CK6A 5CXOA 3KZTA 5AEWB 3G8ZA 2JQ5A 4STDA 3EX9A 6STDA 1OCVA
chains in the Genus database with same CATH superfamily
1BRKA 4HJLB 1BSEA 3X40A 4N6NB 1VZZA 2GEXA 3N54B 4KFDA 5IG3A 5G2GA 2CW9A 4HKVB 1MGRA 3LMLA 3SOAA 2V1LA 4L7KA 5IEPA 3RGRA 3BNEA 3AHSA 2CK3H 3JVCA 3T0UA 3BLZA 1MWTA 1N9JA 3QRDA 3DGMA 5KP4A 3K0ZA 3S67A 2K54A 3FZWA 1C54A 1EEJA 5IF6A 1HKXA 3IJEB 7RNTA 1STDA 1W2B2 1MWRA 2OQEA 4FMAA 1GOYA 2GBXB 3FG1A 1T5YA 5GSPA 2RNTA 3AMOB 2KAAA 5M1AA 2HMJB 3MWZA 3OW22 2GEYA 1RGAA 4BU4A 1ZGXA 1JN5B 2WOHA 5EEOA 4ILFA 3FH1A 1IU7A 2KXGA 2SBLA 1OHPA 1ZO2A 3GZBA 4AEQA 2K0MA 4NHFA 1BOXA 4HVNA 1I2FA 1DMMA 1Q864 6RNTA 3NBRA 3G6E3 5BXQA 1IYYA 4Q53A 1GOUA 3FF2A 5JBSA 3WA3A 1O7WB 3URPA 1BRSA 3CNMA 1TFKA 2Z7AA 3D5IA 2OOVA 1TJDA 2D42A 2SARA 4EV5A 3EJVA 4MMYB 3CD63 2PZVA 1GMPA 4CJNA 4FR9A 3CPW2 3KSPA 1CQSA 1UI7A 2LYXA 1JNQA 2LQVA 3WDGB 1AQZA 1Y4KA 4EV2A 5CF2A 1Q40A 1M1K4 2OOVC 1QJGA 1UUWB 4I5QA 1RGHA 1A2PA 2CH9A 4HZ9B 4N6TA 1RKYA 3Q90A 1E3VA 1BNFA 4XBYA 1MGWA 2XH9A 1VQQA 3FF0A 3LT9A 1IVVA 2R41A 1A67A 1JKGB 1O7PB 4HM3B 2RFRA 2STDA 1FGTA 2E2TA 4LGQA 4MMZB 1WQLB 3PS8A 1T2IA 1KSIA 1B2ZA 1Q42A 1RMSA 2HMLB 3GWRA 3UL5A 1BAOA 1ISKA 1JZOA 3BIRA 3GRDA 4JRFA 5DREA 5IEOA 2CG1A 1HU9A 1YJ93 3B7CA 2E2UA 4HM6B 3EN1B 1K28A 2W03A 2XR8B 3LTCA 4R1KA 3X3YA 1JN5A 4O2HA 1BSCA 2W56A 3AHWA 2GU3A 3S5CA 2CKFB 1RN7A 1X1UA 3HK4A 3TDGA 1CH0A 1GS3A 3CC43 1YI23 3LH4A 1IQYA 1FGQA 1IDPA 1W7CA 1E97A 1MWSA 2WGOA 4L8OA 3SLUA 5I97A 5IW9A 2R4IA 3NUVA 2OQEC 1V57A 1KQS2 2ZL8A 3CCR3 3RDEA 1FW7A 1GD3A 1VQ73 5AIIA 1M904 1UCJA 1RLSA 1UDII 1W01A 4FCZA 4K1VA 4WYKA 4HM5B 4K61A 1O7NB 3F8HA 3B8LA 5EQLA 2H0IA 2YX9A 2ZHXB 1MNLA 4GSPA 1KC84 1OACA 4PEJA 4WWUC 4LSOA 1NO3A 4NPBA 1ROAA 1I2GA 1LQGC 4HM1B 1GY7A 3OWUA 3MKIA 4AKYA 1RGCA 3K63A 3JUQA 2Q07A 2CFGA 1GYBA 1RGGA 1B2UA 3ROBA 4EC6A 5M19A 4GL6A 2CFWA 1LVNA 3EBYA 1BRJA 3SX1A 4DKIA 3DGYA 1QVF2 2F86B 4OK0A 3I553 1EUIC 1YGEA 3EB8A 1U5OA 3LZAA 1SPUA 2XF3A 1AY7A 1K734 3GZXB 1WMOA 4CPKA 4FCJA 2XGNA 1VQN3 1BUQA 1T3BA 1WTHA 1IK3A 3AGNA 3ECFA 4WP5A 3LYGA 1JV2B 2Z6BA 1BIRA 7GSPA 5D82A 4HBRA 4KVHA 5AI1A 4EW5A 1W6GA 3SEDA 1J2BA 1HZ1A 3M8CA 1YGWA 4R9LA 4CCVA 4N6LA 3CCM3 2ML6A 1RRLA 1G02A 2BMOB 1FGMA 1FGOA 2L1SA 1RDSA 3D3LA 5HGRA 4K90B 3JUOA 5JPPA 1G96A 3QK9A 4H61A 1Q40B 1PY3A 3OXAA 1DVDA 2CWTA 1EG9B 3JUNA 1JBRA 2J8XB 3ALAA 1BSBA 4OUQA 1LOVA 5AYSC 1YJW3 1RRHA 1GOVA 1R4CA 1ZS7A 3KIIA 1RN4A 3NV0A 4X2HA 3NM7A 3F14A 3HI7A 2MC8A 8RNTA 1BNRA 5FW5A 4N6MA 2XGLA 2RBIA 3HZPA 3DGOA 2GXFA 2OCTA 2W04A 1I3IA 2WOFA 1K8A4 3I0YA 1VQ63 5D81A 4J5GA 1BNSA 1JB2A 2F99A 3KKGA 2BT3A 1RJOA 2HMKB 4HM8B 1WMNA 5IG4A 2W9PA 1OF5A 3WOFB 2INXA 3PYJA 3OV4A 3GSPA 3GZYB 2W56B 4K1UA 5BIRA 4RNYA 1TP6A 2XFTA 3S29A 3UB1A 2CFKA 2F5WA 2BMQB 4WFOA 3DM8A 1OGXA 2AAEA 1BSDA 1BRGA 1BGSA 3NM2A 3WOEB 5IG5A 2UX0A 5CLKA 3G713 3DMCA 3G16A 4EYCA 4BTXA 1VQO3 1ULIB 1V74A 3CPOA 2CIUA 4R4KA 1RNBA 3MPHA 4WYKB 3X3XA 2XFSA 1TIJA 4HM2B 2Z77A 2F4YA 1UGIA 1QAKA 2BHMA 1W6CA 2IYJA 3DXOA 3S27A 3BNCA 3CCJ3 4O3VA 1FUTA 1Q7HA 1I0VA 2CC3A 1JRQA 3UL6A 1Q7Y4 1VQL3 2P09A 1W00A 2Z76A 2HMNB 3PZWA 3S28A 2KF5A 1BNIA 1BRIA 1D6YA 5EVHA 1GY5A 3T8UA 1C7HA 3A5EA 3BB9A 3K9MC 3EE1A 3F9SA 5LC6A 4G1MB 1BNEA 1HYFA 3J7Yd 1I70A 2HOHA 3I563 1JBSA 1D6ZA 3F7SA 2ZDJA 7STDA 4RNTA 1RGKA 1IQXA 2W6JH 1BSAA 3CU3A 3F7XA 1YIT3 1DVCA 3IMAB 3CC23 1BUJA 1DMQA 1W4NA 2C4BA 2QGUA 1OHOA 4GB5A 4IIAA 3SVAA 1OH0A 3WODG 2CWUA 4LEHA 4QWTA 1UUVB 1QALA 1FA3A 2XSHB 3MYTA 1T2HA 1SIHA 2IY2A 3BU4A 1GSPA 4IPBA 1ZX2A 4ORLA 3RNTA 1IV9A 1RTUA 4CDLA 1VQ83 3JUMA 1N9EA 2MF7A 3CCE3 3CCL3 1RCKA 4KT3B 3X41A 3UNLA 1N8R4 1NU3A 2H0HA 4TX4A 4HAAA 4J9AA 1BVIA 3F8XA 3V92A 2W2CA 3PXMA 5IG0A 3H3HA 4I4KA 5G1LA 2AADA 4WHAA 1NWWA 5AEUB 3NXJA 4BL3A 1JJ22 1EA2A 5ELUA 3CMA3 2L4VA 3DY5A 1IV7A 1NB3I 1UCIA 1LRAA 1IVXA 2CFLA 1RNTA 3NV0B 1G0TA 5LC7A 5JPUA 2ML5A 1CYUA 2UGIA 1N8QA 2D1WA 2I9WA 2BNGA 3O8YA 3KSED 3ER7A 1YIJ3 1L5GB 3GAXA 1B27A 3CME3 2B1XB 2CG0A 4KFFA 1RHLA 3SYUA 1BRNL 3LXUX 1S723 3A76A 1A2VA 3B4PA 4LZIA 1OF5B 2QIYA 1AVKA 2CX1A 5KP3A 4BTWA 3WR2A 3CNXA 1U8CB 3DZLA 3OWYA 3D9RA 3STDA 5G1KA 4N6V0 1CYVA 3EC9A 3MHEA 3CC73 3U1WA 3B4OA 1NNVA 3FKAA 4HOHA 5HOHA 1BRHA 2M7OA 4U13A 1I2EA 1GMRA 2WGQA 3NBJA 1ROVA 2RGQA 1MOLA 3VSYA 3FSDA 4BTYA 1K41A 3PGBA 4N6OB 1PU4A 2YFJB 1IVUA 3VGNA 1LQMB 3CCS3 1GY6A 1RN1A 2IMJA 1TU5A 3HIIA 1UCKA 4KZ1A 2CWVA 2XEPA 3PCSA 4R9KA 1VQK3 1IVWA 1W2ZA 1YJN3 2XSOB 1JBTA 4FMCA 2A15A 4FMBA 1FUWA 1LNHA 5AIHA 4EXRA 4J8TA 4O02B 6GSPA 5M18A 1NJI4 3KFQC 3MG2A 4FCMA 3WMDA 3BNDA 3E99A 3OWSA 3FGYA 2ZA4A 2IA7A 1CEWI 4HZBB 4LMIA 1R4YA 2E2VA 3FG4A 2F5MA 1D6UA 1UCLA 5IENA 3H51A 1F8NA 5STDA 1OGZA 1O7MB 1RSNA 3FG3A 3KCHA 3KN4A 3D79A 1W02A 2PNCA 2RSXA 2W9QA 1S5AA 1UI8A 1ASKA 4MMXB 3DUKA 1PYLA 3ZG0A 2W0QA 1UGHI 2YFIB 2BO9B 2KCDA 4JF8A 3DGLA 1WNHA 1EKMA 1SARA 3NX0A 5AIFA 2P38A 1X1YA 3SOYA 1RGLA 3DH2A 3WA2X 3ZFZA 4HM4B 2CX0A 2IUJA 2GBWB 5AIGA 3G4S3 2KF3A 4RZMA 4XDWA 1OPYA 1B2MA 3FCSB 3EQQB 2OTL3 2QEX3 1LXEA 5RNTA 1IT8A 5D83A 9RNTA 1RGFA 3BNBA 1B2SA 1M1XB 3D5GA 3NQZA 3MSOA 3T8NA 1VQ93 3EF8A 2JDIH 1B3SA 4J5KA 1JZDA 1RGEA 3ZG5A 4RNZA 1FYSA 4KFEA 2WO0A 1BNGA 1QAFA 1STFI 2P0MA 1N5HA 1VQM3 4NREA 1Q9EA 3IPTA 1ULJB 1GD4A 4EBGA 2IUKA 1A2KA 4RBNA 3N8BA 1IT7A 1BU4A 1YHQ3 1EQKA 1PFPA 2CFDA 3D4AA 3Q3FA 3X42A 3WHOA 5CF1A 4XM4A 4HYZA 1FZUA 1TRPA 1W6YA 1X1WA 1V58A 3X3ZA 3G0KA 1BNJA 5BVBA 1TRQA 3FLJA 1Q814 2FNQA 3CCQ3 4N3VA 2KF6A 3Q2PA 3HOHA 4HM0B 4BL2A 5KP1A 1YVSA 1B21A 3CXC2 4L8PA 1DMNA 3LTBA 2P0XA 1VQP3 1SIIA 2Y73A 3AMOA 4XBTA 1DE3A 1UW1A 3V98A 3NQYA 1M9GA 1WMPA 1N5PA 1LNIA 2OWPA 3F40A 1LOWA 1YNVX 2HMMB 4H3UA 4R80A 5TGNA 1FUSA 3EHCA 3HIGA 3LOYA 3CCU3 3LTDA 2BMRB 2UUGC 3DGNA 3NHXA 3HX8A 3L0RA 1X1XA 4GHOA 3KE7A 1NDOB 4XDVA 1UUGB 1VQ43 3OX9A 1TFOA 2YFLB 2FGTA 3EN8A 1JB5A 5DRVA 3JUPA 1KWIA 2HMOB 1B2XA 4IT7A 1DETA 1B20A 4N6UA 4X2OA 3AGOA 3UJMA 2P05A 1W5ZA 4XBXA 4AKZA 3K5TA 4MEIA 3CCV3 3SXXA 3EBTA 2XRXB 1KD14 1OHSA 2FXTA 1VQ53 2CHCA 5FGOA 3MG3A 3N9HA 1GMQA 1BANA 3U97A 3VF1A 2B24B 3LT8A 3V99A 1AVLA 4BIRA 4O8SA 2GSPA 2K3DA 2GU1A 1US1A 2C11A 4ZM8A 1LOXA 2QA43 4OVMA 1I8VA 3K7CA 1A90A 1TTOA 1JKGA 1TUHA 2Y74A 8CHOA 4HM7B 1SJWA 4LYLB 3RGAA 2RCDA 1NB5I 2F98A 1OUNA 1I0XA 1I3FA 2BIRA 1O7HB 1DYUA 3NBBA 3LTAA 3PCRA 2BU4A 2OTJ3 1Z1SA 1QVG2 1AR0A 1AV4A 3GZRA 2F56A 1O7GB 4XB5A 1JB4A 3MG1A 1E3RA 1SQWA 5A0OB 1Q824 1YVBI 1QMAA 5AYRB 1IQ8A 4MJDA 3Q1CA 5CK6A 5CXOA 2KF4A 3KZTA 5IERA 2O3OA 1MWUA 5AEWB 1LOYA 2C10A 1FGRA 5ELJA 2KRTA 2O9UX 2H0GA 3G8ZA 2JQ5A 1RCLA 4STDA 5BU4A 4FMDA 3EX9A 6STDA 1K9M4 1OCVA
chains in the Genus database with same CATH topology
4HJLB 3X40A 4N6NB 1VZZA 2GEXA 3N54B 4KFDA 5IG3A 5G2GA 2CW9A 4HKVB 3LMLA 3SOAA 2V1LA 4L7KA 5IEPA 3RGRA 3BNEA 3JVCA 2CK3H 3T0UA 3BLZA 1N9JA 3QRDA 3DGMA 5KP4A 3K0ZA 3S67A 2K54A 3FZWA 5IF6A 1HKXA 3IJEB 1W2B2 1STDA 2OQEA 4FMAA 2GBXB 3FG1A 1T5YA 3AMOB 2HMJB 3MWZA 3OW22 2GEYA 1JN5B 2WOHA 5EEOA 3FH1A 1IU7A 2KXGA 2SBLA 1OHPA 1ZO2A 3GZBA 4AEQA 2K0MA 4NHFA 4HVNA 1DMMA 1Q864 3NBRA 3G6E3 5BXQA 4Q53A 3FF2A 5JBSA 3WA3A 1O7WB 3CNMA 1TFKA 2Z7AA 2OOVA 2D42A 4EV5A 3EJVA 4MMYB 3CD63 2PZVA 3CPW2 4FR9A 3KSPA 1CQSA 1UI7A 2LYXA 2LQVA 1JNQA 3WDGB 1Y4KA 4EV2A 5CF2A 1M1K4 1Q40A 2OOVC 1QJGA 1UUWB 2CH9A 4HZ9B 4N6TA 1RKYA 3Q90A 1E3VA 4XBYA 2XH9A 3LT9A 3FF0A 1A67A 1IVVA 1JKGB 1O7PB 4HM3B 2RFRA 2STDA 1FGTA 2E2TA 4LGQA 4MMZB 1WQLB 3PS8A 1KSIA 1Q42A 2HMLB 3GWRA 3UL5A 1ISKA 4JRFA 5DREA 3GRDA 5IEOA 2CG1A 1HU9A 1YJ93 3B7CA 2E2UA 4HM6B 3EN1B 1K28A 2W03A 2XR8B 3LTCA 4R1KA 3X3YA 1JN5A 4O2HA 2W56A 2GU3A 3S5CA 2CKFB 1RN7A 3HK4A 3TDGA 1GS3A 3CC43 1YI23 3LH4A 1IQYA 1FGQA 1IDPA 1W7CA 1E97A 4L8OA 2WGOA 3SLUA 5I97A 5IW9A 1KQS2 2R4IA 3NUVA 2OQEC 2ZL8A 3CCR3 3RDEA 1GD3A 1VQ73 5AIIA 1M904 4K1VA 1W01A 4FCZA 4WYKA 4HM5B 4K61A 1O7NB 3F8HA 3B8LA 5EQLA 2YX9A 1MNLA 1KC84 1OACA 4PEJA 4WWUC 4LSOA 1NO3A 1ROAA 4HM1B 1GY7A 3OWUA 3MKIA 4AKYA 3K63A 3JUQA 2Q07A 2CFGA 1GYBA 3ROBA 4EC6A 4GL6A 2CFWA 1LVNA 3EBYA 1QVF2 2F86B 4OK0A 3I553 1YGEA 3EB8A 1U5OA 3LZAA 1SPUA 2XF3A 1K734 3GZXB 1WMOA 4FCJA 2XGNA 1VQN3 1BUQA 1WTHA 1IK3A 3ECFA 4WP5A 3LYGA 1JV2B 2Z6BA 5D82A 4HBRA 4KVHA 5AI1A 1W6GA 3SEDA 1J2BA 3M8CA 4R9LA 4CCVA 4N6LA 3CCM3 2ML6A 1RRLA 2BMOB 1FGMA 1FGOA 3D3LA 5HGRA 4K90B 3JUOA 5JPPA 1G96A 3QK9A 4H61A 1Q40B 3OXAA 1DVDA 2CWTA 1EG9B 3JUNA 3ALAA 5AYSC 1YJW3 4OUQA 1RRHA 1R4CA 3KIIA 3NV0A 4X2HA 3NM7A 3F14A 3HI7A 2MC8A 5FW5A 4N6MA 2XGLA 3HZPA 3DGOA 2GXFA 2OCTA 2W04A 2WOFA 1K8A4 3I0YA 1VQ63 5D81A 1JB2A 2F99A 3KKGA 2BT3A 1RJOA 2HMKB 4HM8B 1WMNA 5IG4A 2W9PA 1OF5A 3WOFB 2INXA 3PYJA 3OV4A 3GZYB 4K1UA 2W56B 4RNYA 1TP6A 2XFTA 3S29A 3UB1A 2CFKA 2BMQB 4WFOA 3DM8A 1OGXA 3NM2A 3WOEB 5IG5A 2UX0A 5CLKA 3G713 3DMCA 3G16A 4EYCA 4BTXA 1VQO3 1ULIB 1V74A 3CPOA 2CIUA 4R4KA 3MPHA 4WYKB 3X3XA 2XFSA 1TIJA 4HM2B 2Z77A 1QAKA 2BHMA 1W6CA 3DXOA 3S27A 3BNCA 3CCJ3 4O3VA 2CC3A 1JRQA 3UL6A 1Q7Y4 1VQL3 2P09A 1W00A 2Z76A 2HMNB 3PZWA 3S28A 1D6YA 5EVHA 1GY5A 3T8UA 1C7HA 3BB9A 5LC6A 3K9MC 3EE1A 3F9SA 4G1MB 3J7Yd 3I563 1D6ZA 3F7SA 2ZDJA 7STDA 1IQXA 2W6JH 3CU3A 3F7XA 1YIT3 1DVCA 3IMAB 3CC23 1DMQA 1W4NA 2QGUA 1OHOA 4GB5A 4IIAA 3SVAA 1OH0A 3WODG 2CWUA 4LEHA 4QWTA 1UUVB 1QALA 1FA3A 2XSHB 3MYTA 1SIHA 4ORLA 4IPBA 1ZX2A 4CDLA 1IV9A 1VQ83 3JUMA 1N9EA 2MF7A 3CCE3 3CCL3 3X41A 3UNLA 1N8R4 1NU3A 4TX4A 4J9AA 3F8XA 3V92A 2W2CA 3PXMA 5IG0A 3H3HA 4I4KA 4WHAA 1NWWA 5AEUB 3NXJA 1JJ22 1EA2A 5ELUA 3CMA3 2L4VA 3DY5A 1IV7A 1NB3I 1IVXA 2CFLA 3NV0B 5LC7A 5JPUA 1CYUA 2ML5A 1N8QA 2D1WA 2I9WA 2BNGA 3O8YA 3KSED 3ER7A 1YIJ3 3GAXA 3CME3 2B1XB 2CG0A 4KFFA 3LXUX 1S723 3A76A 1A2VA 3B4PA 4LZIA 1OF5B 2QIYA 1AVKA 5KP3A 4BTWA 3CNXA 1U8CB 3DZLA 3OWYA 3D9RA 3STDA 4N6V0 1CYVA 3EC9A 3MHEA 3CC73 3U1WA 3B4OA 3FKAA 2M7OA 4U13A 2WGQA 3NBJA 1ROVA 2RGQA 1MOLA 3VSYA 3FSDA 4BTYA 1K41A 3PGBA 4N6OB 1PU4A 2YFJB 1IVUA 3VGNA 3CCS3 1GY6A 2IMJA 1TU5A 3HIIA 4KZ1A 2CWVA 2XEPA 3PCSA 4R9KA 1VQK3 1IVWA 1W2ZA 1YJN3 2XSOB 4FMCA 2A15A 4FMBA 1FUWA 1LNHA 5AIHA 4EXRA 4J8TA 4O02B 1NJI4 3KFQC 3MG2A 4FCMA 3WMDA 3BNDA 3E99A 3OWSA 3FGYA 2IA7A 1CEWI 4HZBB 4LMIA 2E2VA 3FG4A 1D6UA 5IENA 3H51A 1F8NA 5STDA 1OGZA 1O7MB 3FG3A 3KN4A 1W02A 2PNCA 2RSXA 2W9QA 1S5AA 1UI8A 1ASKA 4MMXB 3DUKA 2W0QA 2YFIB 2BO9B 2KCDA 4JF8A 3DGLA 1EKMA 1WNHA 5AIFA 3NX0A 3SX1A 2P38A 3SOYA 3WA2X 4HM4B 2IUJA 2GBWB 5AIGA 3G4S3 4RZMA 4XDWA 1OPYA 3FCSB 3EQQB 2OTL3 2QEX3 1LXEA 1IT8A 5D83A 3BNBA 1M1XB 3NQZA 3MSOA 3T8NA 1VQ93 3EF8A 2JDIH 4RNZA 4KFEA 2WO0A 1QAFA 1STFI 2P0MA 1N5HA 1VQM3 4NREA 3IPTA 1ULJB 1GD4A 4EBGA 2IUKA 1A2KA 4RBNA 3N8BA 1IT7A 1EQKA 1YHQ3 1PFPA 2CFDA 3X42A 5CF1A 4XM4A 4HYZA 1W6YA 3X3ZA 3G0KA 5BVBA 3FLJA 1Q814 2FNQA 3CCQ3 4N3VA 3Q2PA 4HM0B 5KP1A 3CXC2 4L8PA 1DMNA 3LTBA 2P0XA 1VQP3 1SIIA 2Y73A 3AMOA 4XBTA 1UW1A 3V98A 3NQYA 1M9GA 1WMPA 1N5PA 2OWPA 3F40A 2HMMB 4H3UA 4R80A 5TGNA 3EHCA 3HIGA 3LOYA 3CCU3 3LTDA 2BMRB 3NHXA 3DGNA 3HX8A 3L0RA 3KE7A 1NDOB 4XDVA 1VQ43 3OX9A 1TFOA 2YFLB 2FGTA 3EN8A 1JB5A 5DRVA 3JUPA 1KWIA 2HMOB 4IT7A 4X2OA 4N6UA 3UJMA 2P05A 1W5ZA 4XBXA 4AKZA 3K5TA 4MEIA 3CCV3 3SXXA 3EBTA 2XRXB 1KD14 1OHSA 2FXTA 1VQ53 2CHCA 5FGOA 3MG3A 3N9HA 3U97A 3VF1A 2B24B 3LT8A 3V99A 1AVLA 4O8SA 2GU1A 1US1A 2C11A 4ZM8A 1LOXA 2QA43 4OVMA 3K7CA 1A90A 1JKGA 1TUHA 2Y74A 8CHOA 4HM7B 1SJWA 3RGAA 2RCDA 1NB5I 2F98A 1OUNA 1O7HB 1DYUA 3NBBA 3LTAA 3PCRA 2OTJ3 1Z1SA 1QVG2 1AR0A 1AV4A 3GZRA 1O7GB 4XB5A 1JB4A 3MG1A 1E3RA 1SQWA 5A0OB 1Q824 1YVBI 1QMAA 5AYRB 1IQ8A 4MJDA 3Q1CA 5CK6A 5CXOA 3KZTA 1L5GB 5IERA 2O3OA 5AEWB 2C10A 1FGRA 5ELJA 2KRTA 2O9UX 3G8ZA 2JQ5A 4STDA 4FMDA 3EX9A 6STDA 1K9M4 1OCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJL B;  5IG3 A;  1VZZ A;  2GEX A;  5G2G A;  4HKV B;  3SOA A;  4L7K A;  5IEP A;  3RGR A;  3BLZ A;  5KP4 A;  3K0Z A;  2K54 A;  3FZW A;  5IF6 A;  1HKX A;  1STD A;  2GBX B;  2HMJ B;  2GEY A;  1JN5 B;  3FH1 A;  3GZB A;  1OHP A;  1ZO2 A;  4HVN A;  1DMM A;  3NBR A;  5BXQ A;  4Q53 A;  3FF2 A;  1O7W B;  3CNM A;  2Z7A A;  3EJV A;  2PZV A;  3KSP A;  1CQS A;  5CF2 A;  1Q40 A;  1QJG A;  1UUW B;  4HZ9 B;  3Q90 A;  1E3V A;  4XBY A;  3FF0 A;  1JKG B;  1O7P B;  4HM3 B;  2RFR A;  2STD A;  4LGQ A;  1WQL B;  1Q42 A;  2HML B;  3GWR A;  1ISK A;  5DRE A;  3GRD A;  5IEO A;  3B7C A;  4HM6 B;  3EN1 B;  2XR8 B;  4R1K A;  1JN5 A;  3S5C A;  2CKF B;  3HK4 A;  1GS3 A;  1IDP A;  4L8O A;  1E97 A;  2R4I A;  3NUV A;  5AII A;  4K1V A;  1W01 A;  4WYK A;  4HM5 B;  1O7N B;  3F8H A;  3B8L A;  4PEJ A;  4WWU C;  4HM1 B;  1GY7 A;  3OWU A;  3MKI A;  3JUQ A;  1GYB A;  3ROB A;  3EBY A;  2F86 B;  1U5O A;  3LZA A;  3GZX B;  4FCJ A;  1BUQ A;  3ECF A;  4WP5 A;  3LYG A;  5D82 A;  4KVH A;  5AI1 A;  3SED A;  3M8C A;  4R9L A;  2BMO B;  5HGR A;  3JUO A;  5JPP A;  1Q40 B;  3OXA A;  1EG9 B;  3JUN A;  4OUQ A;  3NV0 A;  4X2H A;  3F14 A;  5FW5 A;  3HZP A;  2GXF A;  3I0Y A;  5D81 A;  1JB2 A;  2F99 A;  3KKG A;  2HMK B;  4HM8 B;  5IG4 A;  1OF5 A;  2INX A;  3OV4 A;  3GZY B;  4K1U A;  1TP6 A;  2BMQ B;  3DM8 A;  1OGX A;  3NM2 A;  5IG5 A;  2UX0 A;  5CLK A;  3DMC A;  3G16 A;  1ULI B;  3CPO A;  4WYK B;  4HM2 B;  2Z77 A;  3DXO A;  1W00 A;  2Z76 A;  2HMN B;  5EVH A;  1GY5 A;  3T8U A;  1C7H A;  3BB9 A;  3F9S A;  3F7S A;  7STD A;  3CU3 A;  3F7X A;  1DMQ A;  2QGU A;  1OHO A;  4GB5 A;  4IIA A;  1OH0 A;  4LEH A;  1UUV B;  2XSH B;  3MYT A;  4ORL A;  1ZX2 A;  4CDL A;  3JUM A;  3UNL A;  1NU3 A;  4J9A A;  3F8X A;  2W2C A;  5IG0 A;  3H3H A;  4I4K A;  1NWW A;  5AEU B;  3NXJ A;  1EA2 A;  3NV0 B;  5JPU A;  2I9W A;  2BNG A;  3ER7 A;  2B1X B;  3A76 A;  3B4P A;  1OF5 B;  2QIY A;  5KP3 A;  3CNX A;  3DZL A;  3OWY A;  3D9R A;  3STD A;  3MHE A;  3EC9 A;  3B4O A;  3FKA A;  4U13 A;  2RGQ A;  3VSY A;  3FSD A;  1K41 A;  2YFJ B;  3VGN A;  1GY6 A;  2IMJ A;  4R9K A;  2XSO B;  2A15 A;  5AIH A;  4J8T A;  3MG2 A;  4FCM A;  3WMD A;  3E99 A;  3OWS A;  3FGY A;  4HZB B;  4LMI A;  5IEN A;  3H51 A;  5STD A;  1OGZ A;  1O7M B;  1W02 A;  1S5A A;  1ASK A;  3DUK A;  2YFI B;  5AIF A;  3SOY A;  4HM4 B;  2GBW B;  5AIG A;  4RZM A;  4XDW A;  1OPY A;  3EQQ B;  5D83 A;  3MSO A;  3T8N A;  3EF8 A;  3IPT A;  1ULJ B;  1A2K A;  5CF1 A;  4XM4 A;  1W6Y A;  3G0K A;  5BVB A;  3FLJ A;  4N3V A;  4HM0 B;  5KP1 A;  4L8P A;  1DMN A;  4XBT A;  2OWP A;  3F40 A;  2HMM B;  4H3U A;  5TGN A;  3EHC A;  2BMR B;  3NHX A;  3HX8 A;  3KE7 A;  1NDO B;  4XDV A;  3OX9 A;  2YFL B;  3EN8 A;  1JB5 A;  5DRV A;  3JUP A;  2HMO B;  4X2O A;  3UJM A;  4XBX A;  3EBT A;  2XRX B;  1OHS A;  2CHC A;  3MG3 A;  2B24 B;  4OVM A;  3K7C A;  1JKG A;  1TUH A;  8CHO A;  4HM7 B;  1SJW A;  3RGA A;  2RCD A;  2F98 A;  1OUN A;  1O7H B;  1Z1S A;  1AR0 A;  3GZR A;  1O7G B;  4XB5 A;  1JB4 A;  3MG1 A;  1E3R A;  1QMA A;  5IER A;  4MJD A;  5CK6 A;  5CXO A;  3KZT A;  5AEW B;  3G8Z A;  2JQ5 A;  4STD A;  3EX9 A;  6STD A;  1OCV A; 
#chains in the Genus database with same CATH topology
 1BRK A;  4HJL B;  1BSE A;  3X40 A;  4N6N B;  1VZZ A;  2GEX A;  3N54 B;  4KFD A;  5IG3 A;  5G2G A;  2CW9 A;  4HKV B;  1MGR A;  3LML A;  3SOA A;  2V1L A;  4L7K A;  5IEP A;  3RGR A;  3BNE A;  3AHS A;  2CK3 H;  3JVC A;  3T0U A;  3BLZ A;  1MWT A;  1N9J A;  3QRD A;  3DGM A;  5KP4 A;  3K0Z A;  3S67 A;  2K54 A;  3FZW A;  1C54 A;  1EEJ A;  5IF6 A;  1HKX A;  3IJE B;  7RNT A;  1STD A;  1W2B 2;  1MWR A;  2OQE A;  4FMA A;  1GOY A;  2GBX B;  3FG1 A;  1T5Y A;  5GSP A;  2RNT A;  3AMO B;  2KAA A;  5M1A A;  2HMJ B;  3MWZ A;  3OW2 2;  2GEY A;  1RGA A;  4BU4 A;  1ZGX A;  1JN5 B;  2WOH A;  5EEO A;  4ILF A;  3FH1 A;  1IU7 A;  2KXG A;  2SBL A;  1OHP A;  1ZO2 A;  3GZB A;  4AEQ A;  2K0M A;  4NHF A;  1BOX A;  4HVN A;  1I2F A;  1DMM A;  1Q86 4;  6RNT A;  3NBR A;  3G6E 3;  5BXQ A;  1IYY A;  4Q53 A;  1GOU A;  3FF2 A;  5JBS A;  3WA3 A;  1O7W B;  3URP A;  1BRS A;  3CNM A;  1TFK A;  2Z7A A;  3D5I A;  2OOV A;  1TJD A;  2D42 A;  2SAR A;  4EV5 A;  3EJV A;  4MMY B;  3CD6 3;  2PZV A;  1GMP A;  4CJN A;  4FR9 A;  3CPW 2;  3KSP A;  1CQS A;  1UI7 A;  2LYX A;  1JNQ A;  2LQV A;  3WDG B;  1AQZ A;  1Y4K A;  4EV2 A;  5CF2 A;  1Q40 A;  1M1K 4;  2OOV C;  1QJG A;  1UUW B;  4I5Q A;  1RGH A;  1A2P A;  2CH9 A;  4HZ9 B;  4N6T A;  1RKY A;  3Q90 A;  1E3V A;  1BNF A;  4XBY A;  1MGW A;  2XH9 A;  1VQQ A;  3FF0 A;  3LT9 A;  1IVV A;  2R41 A;  1A67 A;  1JKG B;  1O7P B;  4HM3 B;  2RFR A;  2STD A;  1FGT A;  2E2T A;  4LGQ A;  4MMZ B;  1WQL B;  3PS8 A;  1T2I A;  1KSI A;  1B2Z A;  1Q42 A;  1RMS A;  2HML B;  3GWR A;  3UL5 A;  1BAO A;  1ISK A;  1JZO A;  3BIR A;  3GRD A;  4JRF A;  5DRE A;  5IEO A;  2CG1 A;  1HU9 A;  1YJ9 3;  3B7C A;  2E2U A;  4HM6 B;  3EN1 B;  1K28 A;  2W03 A;  2XR8 B;  3LTC A;  4R1K A;  3X3Y A;  1JN5 A;  4O2H A;  1BSC A;  2W56 A;  3AHW A;  2GU3 A;  3S5C A;  2CKF B;  1RN7 A;  1X1U A;  3HK4 A;  3TDG A;  1CH0 A;  1GS3 A;  3CC4 3;  1YI2 3;  3LH4 A;  1IQY A;  1FGQ A;  1IDP A;  1W7C A;  1E97 A;  1MWS A;  2WGO A;  4L8O A;  3SLU A;  5I97 A;  5IW9 A;  2R4I A;  3NUV A;  2OQE C;  1V57 A;  1KQS 2;  2ZL8 A;  3CCR 3;  3RDE A;  1FW7 A;  1GD3 A;  1VQ7 3;  5AII A;  1M90 4;  1UCJ A;  1RLS A;  1UDI I;  1W01 A;  4FCZ A;  4K1V A;  4WYK A;  4HM5 B;  4K61 A;  1O7N B;  3F8H A;  3B8L A;  5EQL A;  2H0I A;  2YX9 A;  2ZHX B;  1MNL A;  4GSP A;  1KC8 4;  1OAC A;  4PEJ A;  4WWU C;  4LSO A;  1NO3 A;  4NPB A;  1ROA A;  1I2G A;  1LQG C;  4HM1 B;  1GY7 A;  3OWU A;  3MKI A;  4AKY A;  1RGC A;  3K63 A;  3JUQ A;  2Q07 A;  2CFG A;  1GYB A;  1RGG A;  1B2U A;  3ROB A;  4EC6 A;  5M19 A;  4GL6 A;  2CFW A;  1LVN A;  3EBY A;  1BRJ A;  3SX1 A;  4DKI A;  3DGY A;  1QVF 2;  2F86 B;  4OK0 A;  3I55 3;  1EUI C;  1YGE A;  3EB8 A;  1U5O A;  3LZA A;  1SPU A;  2XF3 A;  1AY7 A;  1K73 4;  3GZX B;  1WMO A;  4CPK A;  4FCJ A;  2XGN A;  1VQN 3;  1BUQ A;  1T3B A;  1WTH A;  1IK3 A;  3AGN A;  3ECF A;  4WP5 A;  3LYG A;  1JV2 B;  2Z6B A;  1BIR A;  7GSP A;  5D82 A;  4HBR A;  4KVH A;  5AI1 A;  4EW5 A;  1W6G A;  3SED A;  1J2B A;  1HZ1 A;  3M8C A;  1YGW A;  4R9L A;  4CCV A;  4N6L A;  3CCM 3;  2ML6 A;  1RRL A;  1G02 A;  2BMO B;  1FGM A;  1FGO A;  2L1S A;  1RDS A;  3D3L A;  5HGR A;  4K90 B;  3JUO A;  5JPP A;  1G96 A;  3QK9 A;  4H61 A;  1Q40 B;  1PY3 A;  3OXA A;  1DVD A;  2CWT A;  1EG9 B;  3JUN A;  1JBR A;  2J8X B;  3ALA A;  1BSB A;  4OUQ A;  1LOV A;  5AYS C;  1YJW 3;  1RRH A;  1GOV A;  1R4C A;  1ZS7 A;  3KII A;  1RN4 A;  3NV0 A;  4X2H A;  3NM7 A;  3F14 A;  3HI7 A;  2MC8 A;  8RNT A;  1BNR A;  5FW5 A;  4N6M A;  2XGL A;  2RBI A;  3HZP A;  3DGO A;  2GXF A;  2OCT A;  2W04 A;  1I3I A;  2WOF A;  1K8A 4;  3I0Y A;  1VQ6 3;  5D81 A;  4J5G A;  1BNS A;  1JB2 A;  2F99 A;  3KKG A;  2BT3 A;  1RJO A;  2HMK B;  4HM8 B;  1WMN A;  5IG4 A;  2W9P A;  1OF5 A;  3WOF B;  2INX A;  3PYJ A;  3OV4 A;  3GSP A;  3GZY B;  2W56 B;  4K1U A;  5BIR A;  4RNY A;  1TP6 A;  2XFT A;  3S29 A;  3UB1 A;  2CFK A;  2F5W A;  2BMQ B;  4WFO A;  3DM8 A;  1OGX A;  2AAE A;  1BSD A;  1BRG A;  1BGS A;  3NM2 A;  3WOE B;  5IG5 A;  2UX0 A;  5CLK A;  3G71 3;  3DMC A;  3G16 A;  4EYC A;  4BTX A;  1VQO 3;  1ULI B;  1V74 A;  3CPO A;  2CIU A;  4R4K A;  1RNB A;  3MPH A;  4WYK B;  3X3X A;  2XFS A;  1TIJ A;  4HM2 B;  2Z77 A;  2F4Y A;  1UGI A;  1QAK A;  2BHM A;  1W6C A;  2IYJ A;  3DXO A;  3S27 A;  3BNC A;  3CCJ 3;  4O3V A;  1FUT A;  1Q7H A;  1I0V A;  2CC3 A;  1JRQ A;  3UL6 A;  1Q7Y 4;  1VQL 3;  2P09 A;  1W00 A;  2Z76 A;  2HMN B;  3PZW A;  3S28 A;  2KF5 A;  1BNI A;  1BRI A;  1D6Y A;  5EVH A;  1GY5 A;  3T8U A;  1C7H A;  3A5E A;  3BB9 A;  3K9M C;  3EE1 A;  3F9S A;  5LC6 A;  4G1M B;  1BNE A;  1HYF A;  3J7Y d;  1I70 A;  2HOH A;  3I56 3;  1JBS A;  1D6Z A;  3F7S A;  2ZDJ A;  7STD A;  4RNT A;  1RGK A;  1IQX A;  2W6J H;  1BSA A;  3CU3 A;  3F7X A;  1YIT 3;  1DVC A;  3IMA B;  3CC2 3;  1BUJ A;  1DMQ A;  1W4N A;  2C4B A;  2QGU A;  1OHO A;  4GB5 A;  4IIA A;  3SVA A;  1OH0 A;  3WOD G;  2CWU A;  4LEH A;  4QWT A;  1UUV B;  1QAL A;  1FA3 A;  2XSH B;  3MYT A;  1T2H A;  1SIH A;  2IY2 A;  3BU4 A;  1GSP A;  4IPB A;  1ZX2 A;  4ORL A;  3RNT A;  1IV9 A;  1RTU A;  4CDL A;  1VQ8 3;  3JUM A;  1N9E A;  2MF7 A;  3CCE 3;  3CCL 3;  1RCK A;  4KT3 B;  3X41 A;  3UNL A;  1N8R 4;  1NU3 A;  2H0H A;  4TX4 A;  4HAA A;  4J9A A;  1BVI A;  3F8X A;  3V92 A;  2W2C A;  3PXM A;  5IG0 A;  3H3H A;  4I4K A;  5G1L A;  2AAD A;  4WHA A;  1NWW A;  5AEU B;  3NXJ A;  4BL3 A;  1JJ2 2;  1EA2 A;  5ELU A;  3CMA 3;  2L4V A;  3DY5 A;  1IV7 A;  1NB3 I;  1UCI A;  1LRA A;  1IVX A;  2CFL A;  1RNT A;  3NV0 B;  1G0T A;  5LC7 A;  5JPU A;  2ML5 A;  1CYU A;  2UGI A;  1N8Q A;  2D1W A;  2I9W A;  2BNG A;  3O8Y A;  3KSE D;  3ER7 A;  1YIJ 3;  1L5G B;  3GAX A;  1B27 A;  3CME 3;  2B1X B;  2CG0 A;  4KFF A;  1RHL A;  3SYU A;  1BRN L;  3LXU X;  1S72 3;  3A76 A;  1A2V A;  3B4P A;  4LZI A;  1OF5 B;  2QIY A;  1AVK A;  2CX1 A;  5KP3 A;  4BTW A;  3WR2 A;  3CNX A;  1U8C B;  3DZL A;  3OWY A;  3D9R A;  3STD A;  5G1K A;  4N6V 0;  1CYV A;  3EC9 A;  3MHE A;  3CC7 3;  3U1W A;  3B4O A;  1NNV A;  3FKA A;  4HOH A;  5HOH A;  1BRH A;  2M7O A;  4U13 A;  1I2E A;  1GMR A;  2WGQ A;  3NBJ A;  1ROV A;  2RGQ A;  1MOL A;  3VSY A;  3FSD A;  4BTY A;  1K41 A;  3PGB A;  4N6O B;  1PU4 A;  2YFJ B;  1IVU A;  3VGN A;  1LQM B;  3CCS 3;  1GY6 A;  1RN1 A;  2IMJ A;  1TU5 A;  3HII A;  1UCK A;  4KZ1 A;  2CWV A;  2XEP A;  3PCS A;  4R9K A;  1VQK 3;  1IVW A;  1W2Z A;  1YJN 3;  2XSO B;  1JBT A;  4FMC A;  2A15 A;  4FMB A;  1FUW A;  1LNH A;  5AIH A;  4EXR A;  4J8T A;  4O02 B;  6GSP A;  5M18 A;  1NJI 4;  3KFQ C;  3MG2 A;  4FCM A;  3WMD A;  3BND A;  3E99 A;  3OWS A;  3FGY A;  2ZA4 A;  2IA7 A;  1CEW I;  4HZB B;  4LMI A;  1R4Y A;  2E2V A;  3FG4 A;  2F5M A;  1D6U A;  1UCL A;  5IEN A;  3H51 A;  1F8N A;  5STD A;  1OGZ A;  1O7M B;  1RSN A;  3FG3 A;  3KCH A;  3KN4 A;  3D79 A;  1W02 A;  2PNC A;  2RSX A;  2W9Q A;  1S5A A;  1UI8 A;  1ASK A;  4MMX B;  3DUK A;  1PYL A;  3ZG0 A;  2W0Q A;  1UGH I;  2YFI B;  2BO9 B;  2KCD A;  4JF8 A;  3DGL A;  1WNH A;  1EKM A;  1SAR A;  3NX0 A;  5AIF A;  2P38 A;  1X1Y A;  3SOY A;  1RGL A;  3DH2 A;  3WA2 X;  3ZFZ A;  4HM4 B;  2CX0 A;  2IUJ A;  2GBW B;  5AIG A;  3G4S 3;  2KF3 A;  4RZM A;  4XDW A;  1OPY A;  1B2M A;  3FCS B;  3EQQ B;  2OTL 3;  2QEX 3;  1LXE A;  5RNT A;  1IT8 A;  5D83 A;  9RNT A;  1RGF A;  3BNB A;  1B2S A;  1M1X B;  3D5G A;  3NQZ A;  3MSO A;  3T8N A;  1VQ9 3;  3EF8 A;  2JDI H;  1B3S A;  4J5K A;  1JZD A;  1RGE A;  3ZG5 A;  4RNZ A;  1FYS A;  4KFE A;  2WO0 A;  1BNG A;  1QAF A;  1STF I;  2P0M A;  1N5H A;  1VQM 3;  4NRE A;  1Q9E A;  3IPT A;  1ULJ B;  1GD4 A;  4EBG A;  2IUK A;  1A2K A;  4RBN A;  3N8B A;  1IT7 A;  1BU4 A;  1YHQ 3;  1EQK A;  1PFP A;  2CFD A;  3D4A A;  3Q3F A;  3X42 A;  3WHO A;  5CF1 A;  4XM4 A;  4HYZ A;  1FZU A;  1TRP A;  1W6Y A;  1X1W A;  1V58 A;  3X3Z A;  3G0K A;  1BNJ A;  5BVB A;  1TRQ A;  3FLJ A;  1Q81 4;  2FNQ A;  3CCQ 3;  4N3V A;  2KF6 A;  3Q2P A;  3HOH A;  4HM0 B;  4BL2 A;  5KP1 A;  1YVS A;  1B21 A;  3CXC 2;  4L8P A;  1DMN A;  3LTB A;  2P0X A;  1VQP 3;  1SII A;  2Y73 A;  3AMO A;  4XBT A;  1DE3 A;  1UW1 A;  3V98 A;  3NQY A;  1M9G A;  1WMP A;  1N5P A;  1LNI A;  2OWP A;  3F40 A;  1LOW A;  1YNV X;  2HMM B;  4H3U A;  4R80 A;  5TGN A;  1FUS A;  3EHC A;  3HIG A;  3LOY A;  3CCU 3;  3LTD A;  2BMR B;  2UUG C;  3DGN A;  3NHX A;  3HX8 A;  3L0R A;  1X1X A;  4GHO A;  3KE7 A;  1NDO B;  4XDV A;  1UUG B;  1VQ4 3;  3OX9 A;  1TFO A;  2YFL B;  2FGT A;  3EN8 A;  1JB5 A;  5DRV A;  3JUP A;  1KWI A;  2HMO B;  1B2X A;  4IT7 A;  1DET A;  1B20 A;  4N6U A;  4X2O A;  3AGO A;  3UJM A;  2P05 A;  1W5Z A;  4XBX A;  4AKZ A;  3K5T A;  4MEI A;  3CCV 3;  3SXX A;  3EBT A;  2XRX B;  1KD1 4;  1OHS A;  2FXT A;  1VQ5 3;  2CHC A;  5FGO A;  3MG3 A;  3N9H A;  1GMQ A;  1BAN A;  3U97 A;  3VF1 A;  2B24 B;  3LT8 A;  3V99 A;  1AVL A;  4BIR A;  4O8S A;  2GSP A;  2K3D A;  2GU1 A;  1US1 A;  2C11 A;  4ZM8 A;  1LOX A;  2QA4 3;  4OVM A;  1I8V A;  3K7C A;  1A90 A;  1TTO A;  1JKG A;  1TUH A;  2Y74 A;  8CHO A;  4HM7 B;  1SJW A;  4LYL B;  3RGA A;  2RCD A;  1NB5 I;  2F98 A;  1OUN A;  1I0X A;  1I3F A;  2BIR A;  1O7H B;  1DYU A;  3NBB A;  3LTA A;  3PCR A;  2BU4 A;  2OTJ 3;  1Z1S A;  1QVG 2;  1AR0 A;  1AV4 A;  3GZR A;  2F56 A;  1O7G B;  4XB5 A;  1JB4 A;  3MG1 A;  1E3R A;  1SQW A;  5A0O B;  1Q82 4;  1YVB I;  1QMA A;  5AYR B;  1IQ8 A;  4MJD A;  3Q1C A;  5CK6 A;  5CXO A;  2KF4 A;  3KZT A;  5IER A;  2O3O A;  1MWU A;  5AEW B;  1LOY A;  2C10 A;  1FGR A;  5ELJ A;  2KRT A;  2O9U X;  2H0G A;  3G8Z A;  2JQ5 A;  1RCL A;  4STD A;  5BU4 A;  4FMD A;  3EX9 A;  6STD A;  1K9M 4;  1OCV A; 
#chains in the Genus database with same CATH homology
 4HJL B;  3X40 A;  4N6N B;  1VZZ A;  2GEX A;  3N54 B;  4KFD A;  5IG3 A;  5G2G A;  2CW9 A;  4HKV B;  3LML A;  3SOA A;  2V1L A;  4L7K A;  5IEP A;  3RGR A;  3BNE A;  3JVC A;  2CK3 H;  3T0U A;  3BLZ A;  1N9J A;  3QRD A;  3DGM A;  5KP4 A;  3K0Z A;  3S67 A;  2K54 A;  3FZW A;  5IF6 A;  1HKX A;  3IJE B;  1W2B 2;  1STD A;  2OQE A;  4FMA A;  2GBX B;  3FG1 A;  1T5Y A;  3AMO B;  2HMJ B;  3MWZ A;  3OW2 2;  2GEY A;  1JN5 B;  2WOH A;  5EEO A;  3FH1 A;  1IU7 A;  2KXG A;  2SBL A;  1OHP A;  1ZO2 A;  3GZB A;  4AEQ A;  2K0M A;  4NHF A;  4HVN A;  1DMM A;  1Q86 4;  3NBR A;  3G6E 3;  5BXQ A;  4Q53 A;  3FF2 A;  5JBS A;  3WA3 A;  1O7W B;  3CNM A;  1TFK A;  2Z7A A;  2OOV A;  2D42 A;  4EV5 A;  3EJV A;  4MMY B;  3CD6 3;  2PZV A;  3CPW 2;  4FR9 A;  3KSP A;  1CQS A;  1UI7 A;  2LYX A;  2LQV A;  1JNQ A;  3WDG B;  1Y4K A;  4EV2 A;  5CF2 A;  1M1K 4;  1Q40 A;  2OOV C;  1QJG A;  1UUW B;  2CH9 A;  4HZ9 B;  4N6T A;  1RKY A;  3Q90 A;  1E3V A;  4XBY A;  2XH9 A;  3LT9 A;  3FF0 A;  1A67 A;  1IVV A;  1JKG B;  1O7P B;  4HM3 B;  2RFR A;  2STD A;  1FGT A;  2E2T A;  4LGQ A;  4MMZ B;  1WQL B;  3PS8 A;  1KSI A;  1Q42 A;  2HML B;  3GWR A;  3UL5 A;  1ISK A;  4JRF A;  5DRE A;  3GRD A;  5IEO A;  2CG1 A;  1HU9 A;  1YJ9 3;  3B7C A;  2E2U A;  4HM6 B;  3EN1 B;  1K28 A;  2W03 A;  2XR8 B;  3LTC A;  4R1K A;  3X3Y A;  1JN5 A;  4O2H A;  2W56 A;  2GU3 A;  3S5C A;  2CKF B;  1RN7 A;  3HK4 A;  3TDG A;  1GS3 A;  3CC4 3;  1YI2 3;  3LH4 A;  1IQY A;  1FGQ A;  1IDP A;  1W7C A;  1E97 A;  4L8O A;  2WGO A;  3SLU A;  5I97 A;  5IW9 A;  1KQS 2;  2R4I A;  3NUV A;  2OQE C;  2ZL8 A;  3CCR 3;  3RDE A;  1GD3 A;  1VQ7 3;  5AII A;  1M90 4;  4K1V A;  1W01 A;  4FCZ A;  4WYK A;  4HM5 B;  4K61 A;  1O7N B;  3F8H A;  3B8L A;  5EQL A;  2YX9 A;  1MNL A;  1KC8 4;  1OAC A;  4PEJ A;  4WWU C;  4LSO A;  1NO3 A;  1ROA A;  4HM1 B;  1GY7 A;  3OWU A;  3MKI A;  4AKY A;  3K63 A;  3JUQ A;  2Q07 A;  2CFG A;  1GYB A;  3ROB A;  4EC6 A;  4GL6 A;  2CFW A;  1LVN A;  3EBY A;  1QVF 2;  2F86 B;  4OK0 A;  3I55 3;  1YGE A;  3EB8 A;  1U5O A;  3LZA A;  1SPU A;  2XF3 A;  1K73 4;  3GZX B;  1WMO A;  4FCJ A;  2XGN A;  1VQN 3;  1BUQ A;  1WTH A;  1IK3 A;  3ECF A;  4WP5 A;  3LYG A;  1JV2 B;  2Z6B A;  5D82 A;  4HBR A;  4KVH A;  5AI1 A;  1W6G A;  3SED A;  1J2B A;  3M8C A;  4R9L A;  4CCV A;  4N6L A;  3CCM 3;  2ML6 A;  1RRL A;  2BMO B;  1FGM A;  1FGO A;  3D3L A;  5HGR A;  4K90 B;  3JUO A;  5JPP A;  1G96 A;  3QK9 A;  4H61 A;  1Q40 B;  3OXA A;  1DVD A;  2CWT A;  1EG9 B;  3JUN A;  3ALA A;  5AYS C;  1YJW 3;  4OUQ A;  1RRH A;  1R4C A;  3KII A;  3NV0 A;  4X2H A;  3NM7 A;  3F14 A;  3HI7 A;  2MC8 A;  5FW5 A;  4N6M A;  2XGL A;  3HZP A;  3DGO A;  2GXF A;  2OCT A;  2W04 A;  2WOF A;  1K8A 4;  3I0Y A;  1VQ6 3;  5D81 A;  1JB2 A;  2F99 A;  3KKG A;  2BT3 A;  1RJO A;  2HMK B;  4HM8 B;  1WMN A;  5IG4 A;  2W9P A;  1OF5 A;  3WOF B;  2INX A;  3PYJ A;  3OV4 A;  3GZY B;  4K1U A;  2W56 B;  4RNY A;  1TP6 A;  2XFT A;  3S29 A;  3UB1 A;  2CFK A;  2BMQ B;  4WFO A;  3DM8 A;  1OGX A;  3NM2 A;  3WOE B;  5IG5 A;  2UX0 A;  5CLK A;  3G71 3;  3DMC A;  3G16 A;  4EYC A;  4BTX A;  1VQO 3;  1ULI B;  1V74 A;  3CPO A;  2CIU A;  4R4K A;  3MPH A;  4WYK B;  3X3X A;  2XFS A;  1TIJ A;  4HM2 B;  2Z77 A;  1QAK A;  2BHM A;  1W6C A;  3DXO A;  3S27 A;  3BNC A;  3CCJ 3;  4O3V A;  2CC3 A;  1JRQ A;  3UL6 A;  1Q7Y 4;  1VQL 3;  2P09 A;  1W00 A;  2Z76 A;  2HMN B;  3PZW A;  3S28 A;  1D6Y A;  5EVH A;  1GY5 A;  3T8U A;  1C7H A;  3BB9 A;  5LC6 A;  3K9M C;  3EE1 A;  3F9S A;  4G1M B;  3J7Y d;  3I56 3;  1D6Z A;  3F7S A;  2ZDJ A;  7STD A;  1IQX A;  2W6J H;  3CU3 A;  3F7X A;  1YIT 3;  1DVC A;  3IMA B;  3CC2 3;  1DMQ A;  1W4N A;  2QGU A;  1OHO A;  4GB5 A;  4IIA A;  3SVA A;  1OH0 A;  3WOD G;  2CWU A;  4LEH A;  4QWT A;  1UUV B;  1QAL A;  1FA3 A;  2XSH B;  3MYT A;  1SIH A;  4ORL A;  4IPB A;  1ZX2 A;  4CDL A;  1IV9 A;  1VQ8 3;  3JUM A;  1N9E A;  2MF7 A;  3CCE 3;  3CCL 3;  3X41 A;  3UNL A;  1N8R 4;  1NU3 A;  4TX4 A;  4J9A A;  3F8X A;  3V92 A;  2W2C A;  3PXM A;  5IG0 A;  3H3H A;  4I4K A;  4WHA A;  1NWW A;  5AEU B;  3NXJ A;  1JJ2 2;  1EA2 A;  5ELU A;  3CMA 3;  2L4V A;  3DY5 A;  1IV7 A;  1NB3 I;  1IVX A;  2CFL A;  3NV0 B;  5LC7 A;  5JPU A;  1CYU A;  2ML5 A;  1N8Q A;  2D1W A;  2I9W A;  2BNG A;  3O8Y A;  3KSE D;  3ER7 A;  1YIJ 3;  3GAX A;  3CME 3;  2B1X B;  2CG0 A;  4KFF A;  3LXU X;  1S72 3;  3A76 A;  1A2V A;  3B4P A;  4LZI A;  1OF5 B;  2QIY A;  1AVK A;  5KP3 A;  4BTW A;  3CNX A;  1U8C B;  3DZL A;  3OWY A;  3D9R A;  3STD A;  4N6V 0;  1CYV A;  3EC9 A;  3MHE A;  3CC7 3;  3U1W A;  3B4O A;  3FKA A;  2M7O A;  4U13 A;  2WGQ A;  3NBJ A;  1ROV A;  2RGQ A;  1MOL A;  3VSY A;  3FSD A;  4BTY A;  1K41 A;  3PGB A;  4N6O B;  1PU4 A;  2YFJ B;  1IVU A;  3VGN A;  3CCS 3;  1GY6 A;  2IMJ A;  1TU5 A;  3HII A;  4KZ1 A;  2CWV A;  2XEP A;  3PCS A;  4R9K A;  1VQK 3;  1IVW A;  1W2Z A;  1YJN 3;  2XSO B;  4FMC A;  2A15 A;  4FMB A;  1FUW A;  1LNH A;  5AIH A;  4EXR A;  4J8T A;  4O02 B;  1NJI 4;  3KFQ C;  3MG2 A;  4FCM A;  3WMD A;  3BND A;  3E99 A;  3OWS A;  3FGY A;  2IA7 A;  1CEW I;  4HZB B;  4LMI A;  2E2V A;  3FG4 A;  1D6U A;  5IEN A;  3H51 A;  1F8N A;  5STD A;  1OGZ A;  1O7M B;  3FG3 A;  3KN4 A;  1W02 A;  2PNC A;  2RSX A;  2W9Q A;  1S5A A;  1UI8 A;  1ASK A;  4MMX B;  3DUK A;  2W0Q A;  2YFI B;  2BO9 B;  2KCD A;  4JF8 A;  3DGL A;  1EKM A;  1WNH A;  5AIF A;  3NX0 A;  3SX1 A;  2P38 A;  3SOY A;  3WA2 X;  4HM4 B;  2IUJ A;  2GBW B;  5AIG A;  3G4S 3;  4RZM A;  4XDW A;  1OPY A;  3FCS B;  3EQQ B;  2OTL 3;  2QEX 3;  1LXE A;  1IT8 A;  5D83 A;  3BNB A;  1M1X B;  3NQZ A;  3MSO A;  3T8N A;  1VQ9 3;  3EF8 A;  2JDI H;  4RNZ A;  4KFE A;  2WO0 A;  1QAF A;  1STF I;  2P0M A;  1N5H A;  1VQM 3;  4NRE A;  3IPT A;  1ULJ B;  1GD4 A;  4EBG A;  2IUK A;  1A2K A;  4RBN A;  3N8B A;  1IT7 A;  1EQK A;  1YHQ 3;  1PFP A;  2CFD A;  3X42 A;  5CF1 A;  4XM4 A;  4HYZ A;  1W6Y A;  3X3Z A;  3G0K A;  5BVB A;  3FLJ A;  1Q81 4;  2FNQ A;  3CCQ 3;  4N3V A;  3Q2P A;  4HM0 B;  5KP1 A;  3CXC 2;  4L8P A;  1DMN A;  3LTB A;  2P0X A;  1VQP 3;  1SII A;  2Y73 A;  3AMO A;  4XBT A;  1UW1 A;  3V98 A;  3NQY A;  1M9G A;  1WMP A;  1N5P A;  2OWP A;  3F40 A;  2HMM B;  4H3U A;  4R80 A;  5TGN A;  3EHC A;  3HIG A;  3LOY A;  3CCU 3;  3LTD A;  2BMR B;  3NHX A;  3DGN A;  3HX8 A;  3L0R A;  3KE7 A;  1NDO B;  4XDV A;  1VQ4 3;  3OX9 A;  1TFO A;  2YFL B;  2FGT A;  3EN8 A;  1JB5 A;  5DRV A;  3JUP A;  1KWI A;  2HMO B;  4IT7 A;  4X2O A;  4N6U A;  3UJM A;  2P05 A;  1W5Z A;  4XBX A;  4AKZ A;  3K5T A;  4MEI A;  3CCV 3;  3SXX A;  3EBT A;  2XRX B;  1KD1 4;  1OHS A;  2FXT A;  1VQ5 3;  2CHC A;  5FGO A;  3MG3 A;  3N9H A;  3U97 A;  3VF1 A;  2B24 B;  3LT8 A;  3V99 A;  1AVL A;  4O8S A;  2GU1 A;  1US1 A;  2C11 A;  4ZM8 A;  1LOX A;  2QA4 3;  4OVM A;  3K7C A;  1A90 A;  1JKG A;  1TUH A;  2Y74 A;  8CHO A;  4HM7 B;  1SJW A;  3RGA A;  2RCD A;  1NB5 I;  2F98 A;  1OUN A;  1O7H B;  1DYU A;  3NBB A;  3LTA A;  3PCR A;  2OTJ 3;  1Z1S A;  1QVG 2;  1AR0 A;  1AV4 A;  3GZR A;  1O7G B;  4XB5 A;  1JB4 A;  3MG1 A;  1E3R A;  1SQW A;  5A0O B;  1Q82 4;  1YVB I;  1QMA A;  5AYR B;  1IQ8 A;  4MJD A;  3Q1C A;  5CK6 A;  5CXO A;  3KZT A;  1L5G B;  5IER A;  2O3O A;  5AEW B;  2C10 A;  1FGR A;  5ELJ A;  2KRT A;  2O9U X;  3G8Z A;  2JQ5 A;  4STD A;  4FMD A;  3EX9 A;  6STD A;  1K9M 4;  1OCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...