1OGZA

Crystal structure of 5-3-ketosteroid isomerase mutants p39a complexed with equilenin from pseudomonas testosteroni
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDAVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title The Conserved Cis-Pro39 Residue Plays a Crucial Role in the Proper Positioning of the Catalytic Base Asp38 in Ketosteroid Isomerase from Comamonas Testosteroni.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 33
structure length 125
sequence length 125
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ogzA00
1GYBA 5IEOA 1GS3A 3MSOA 1O7HB 5IEPA 2JQ5A 3GZBA 2QGUA 3NV0B 3CNMA 3GWRA 3KSPA 2HMJB 1JB4A 3UNLA 5CF1A 2GEYA 5STDA 1W01A 3Q90A 2HMLB 4OUQA 4X2HA 3DUKA 4ORLA 4XBYA 4GB5A 1ULIB 2F99A 2YFJB 3UJMA 2RCDA 3K0ZA 3MG3A 4HKVB 4U13A 4HZBB 4KVHA 1E3VA 4OVMA 3LZAA 2YFIB 3OWUA 5AEUB 2BNGA 1OGZA 4PEJA 2YFLB 4XDVA 3GZYB 2QIYA 1UUVB 2GBXB 4Q53A 1JN5A 1GY5A 3B7CA 3DZLA 3LYGA 1DMNA 4XM4A 2BMRB 1WQLB 3FZWA 4HM7B 3F14A 1Q40A 3NHXA 3FLJA 4HM8B 4L8OA 1O7GB 3G16A 2HMKB 2INXA 3HZPA 3JUNA 1C7HA 1ASKA 1OH0A 3ECFA 2W2CA 2RFRA 1CQSA 2A15A 4IIAA 1QMAA 5CK6A 4H3UA 4MJDA 3JUMA 1VZZA 3MG2A 4RZMA 3NBRA 1O7WB 2IMJA 1O7MB 3F7XA 3G0KA 3FH1A 3BB9A 3HK4A 3NV0A 5D81A 3T8UA 1EA2A 3D9RA 2GXFA 3OX9A 2R4IA 1TUHA 4XDWA 1IDPA 4FCMA 1OCVA 3EF8A 3FSDA 5FW5A 1OF5B 2BMQB 1Q42A 5IG4A 4WYKB 4HM2B 3T8NA 2OWPA 4N3VA 2I9WA 3CPOA 3EBYA 4WP5A 4LGQA 1TP6A 3MG1A 4R9KA 5HGRA 1OHOA 4HVNA 1OUNA 4HM0B 1NU3A 3F40A 2F98A 1OHPA 3F7SA 3EC9A 6STDA 3FKAA 4HM1B 1W02A 3DMCA 5EVHA 1W6YA 4XBXA 3FF0A 3OXAA 3GZRA 3B4PA 5JPUA 3SOYA 3WMDA 3KE7A 1O7PB 2XR8B 3M8CA 5CXOA 3JUQA 3ER7A 4X2OA 2B24B 5AIHA 3MYTA 5G2GA 1SJWA 2CHCA 1ZX2A 3H51A 3H3HA 5IG5A 3B8LA 3NXJA 2XRXB 5IF6A 1JB5A 4J8TA 3MKIA 3RGRA 5BVBA 4R1KA 1GY6A 3IPTA 5TGNA 3EBTA 3MHEA 1NWWA 3CNXA 4HM4B 3EJVA 5KP4A 1E3RA 3S5CA 3G8ZA 1W00A 4HM6B 4CDLA 3STDA 3FF2A 3HX8A 4I4KA 3F8XA 3OV4A 2STDA 3GRDA 5AEWB 3I0YA 7STDA 1OF5A 3A76A 2GBWB 1JKGB 2RGQA 1ISKA 3KZTA 1NDOB 5AI1A 3SOAA 4WYKA 3NM2A 3JUPA 5IG3A 3DM8A 3F8HA 3OWSA 3EN1B 4K1UA 5AIFA 3E99A 3EHCA 1A2KA 3OWYA 5CF2A 5JPPA 1OPYA 3CU3A 5IENA 1JB2A 2K54A 4L7KA 4HM5B 3DXOA 4J9AA 4L8PA 1OHSA 4LMIA 3RGAA 1UUWB 4HZ9B 3ROBA 5KP1A 4R9LA 3EQQB 1K41A 1O7NB 3B4OA 2HMMB 4LEHA 5DRVA 4WWUC 1E97A 1AR0A 3EX9A 1GY7A 3BLZA 4XBTA 4XB5A 5CLKA 1U5OA 4K1VA 3SEDA 4HJLB 1OGXA 5D82A 5DREA 1BUQA 3JUOA 2BMOB 1JN5B 1S5AA 2B1XB 1ULJB 3F9SA 1HKXA 2Z77A 3EN8A 8CHOA 5IERA 1Z1SA 1EG9B 4STDA 1DMQA 5IG0A 2HMNB 5AIGA 2GEXA 2XSHB 4HM3B 1Q40B 3VGNA 2HMOB 2CKFB 3VSYA 4FCJA 5D83A 3KKGA 1QJGA 2Z7AA 5KP3A 1JKGA 3FGYA 2UX0A 2PZVA 2XSOB 3NUVA 1STDA 1ZO2A 3K7CA 5BXQA 3GZXB 5AIIA 1DMMA 2F86B 2Z76A
chains in the Genus database with same CATH superfamily
1U8CB 1GYBA 5IEOA 3X41A 1GOYA 1K8A4 1GS3A 1NB3I 1O7HB 2CWVA 2ZL8A 3MSOA 5IEPA 2OCTA 2JQ5A 1V57A 4HAAA 4KFEA 4FMCA 1YGEA 1NNVA 2KF5A 3GZBA 2QGUA 3DH2A 3CNMA 3NV0B 3GWRA 4BTWA 3KSPA 1YJW3 2HMJB 1NB5I 2KF4A 1MGRA 1JB4A 3WA2X 3WODG 4G1MB 1NJI4 4H61A 3UNLA 5CF1A 1BU4A 3CCS3 1RGAA 2E2TA 1FYSA 2CIUA 2GEYA 4DKIA 1TTOA 1VQO3 1A90A 1RLSA 4JRFA 2BU4A 2AAEA 4R4KA 1B2XA 5STDA 3GSPA 1VQL3 1M904 1BRSA 1IVWA 2CFWA 4BL2A 2OTJ3 4BU4A 1FZUA 2D1WA 1W01A 3CCV3 3G713 3UJMA 2CH9A 2CFGA 2HMLB 3Q90A 4OUQA 3U97A 2E2UA 4X2HA 3BNBA 3MPHA 3DUKA 4LSOA 2IA7A 4ORLA 4XBYA 3LT8A 1ULIB 2F99A 2YFJB 4GB5A 3GAXA 3KFQC 2KCDA 3RDEA 3SVAA 2RCDA 3K0ZA 3N54B 1RKYA 1B2MA 4HBRA 1WMNA 3MG3A 3AMOB 2H0HA 1EQKA 4HKVB 2Y73A 1YVSA 3OW22 4RNYA 4FR9A 4U13A 4O3VA 4GHOA 4HZBB 4BIRA 2MC8A 1ROVA 3WHOA 1W6GA 1E3VA 3LTAA 4KVHA 5LC6A 1JBRA 4OVMA 1GD4A 3LZAA 2M7OA 1I0VA 1LOYA 2YFIB 2WGOA 3OWUA 5AEUB 1GOVA 1OACA 1IV7A 1OGZA 1QAFA 2BNGA 1N8QA 2YFLB 4PEJA 5G1KA 3X3YA 2F4YA 1WTHA 1IVXA 4XDVA 1SQWA 1GSPA 2BO9B 4TX4A 1KC84 3Q2PA 1D6UA 3GZYB 6GSPA 2QEX3 1VQP3 2QIYA 4O02B 1KD14 3UB1A 3VF1A 1UUVB 1JZDA 2GBXB 4Q53A 1JN5A 2GU3A 2P05A 1RCLA 1GY5A 1ROAA 2KF3A 2WOFA 4BL3A 1I70A 3B7CA 1FW7A 1GMPA 3KSED 4KT3B 3EB8A 1DE3A 3DZLA 1TU5A 3LYGA 1DMNA 1UCJA 4XM4A 1UW1A 1DVCA 1EKMA 2BMRB 1WQLB 4AEQA 3FZWA 1VQN3 1Q814 4HM7B 3PXMA 3F14A 1PU4A 2XFTA 3WOEB 1JNQA 3RNTA 2UUGC 1LRAA 1MNLA 1Q40A 2J8XB 3WA3A 3NHXA 4EV2A 2XF3A 3AHSA 4IPBA 3FLJA 5M18A 4HM8B 4L8OA 3CCM3 1JRQA 1O7GB 3KN4A 1RGCA 1SIHA 2IUKA 3G16A 3WDGB 4FMBA 2HMKB 2INXA 3HZPA 5FGOA 1X1XA 1C7HA 3JUNA 1FGOA 1ASKA 1UUGB 1M1K4 4HOHA 1OH0A 3NQYA 3ECFA 3CXC2 2W2CA 2RFRA 4K90B 2CG1A 3BNDA 1CQSA 1SPUA 2A15A 3CCR3 2WO0A 1BNGA 4IIAA 1QMAA 2Z6BA 2W04A 2YX9A 1GOUA 4H3UA 1DETA 5CK6A 1TFOA 5BU4A 4MJDA 1W2ZA 2W56A 3PS8A 3PZWA 3JUMA 4N6MA 4AKYA 1UCIA 1VZZA 1W2B2 1YIT3 1MWTA 3MG2A 1JZOA 4J5KA 1T5YA 4RZMA 4EBGA 1RGKA 5AYSC 3NBRA 1FA3A 1O7WB 2IMJA 1O7MB 2W6JH 1RCKA 3F7XA 4MMZB 1UDII 4IT7A 1IV9A 5HOHA 3G0KA 3FH1A 1QVF2 3BB9A 1YGWA 3HK4A 1X1YA 3IMAB 3NV0A 5D81A 4RNTA 1RGFA 3UL6A 3T8UA 4FCZA 3LXUX 1VQM3 1EA2A 2P0MA 3WOFB 3U1WA 1TJDA 1B2UA 2XGNA 3N8BA 1FGMA 1IT8A 2GXFA 3D9RA 2R4IA 3FG1A 1TUHA 3D4AA 2O9UX 3HOHA 3OX9A 4XDWA 3URPA 1TIJA 1BRJA 1B27A 2JDIH 4N6LA 1IDPA 2L4VA 4LYLB 4FCMA 1OCVA 1RN1A 4FMDA 1V74A 3NQZA 1L5GB 1SIIA 4MMYB 3EF8A 3K63A 3NBBA 3K5TA 1US1A 3FSDA 3V92A 5FW5A 3HI7A 4WHAA 1S723 1J2BA 1TFKA 1Q9EA 1OF5B 2GSPA 2P0XA 1EUIC 2BMQB 1R4YA 1IVVA 1EEJA 1FGQA 1FUTA 2CC3A 3D5IA 3N9HA 1BSBA 3CCJ3 1CH0A 1Q42A 1TRPA 3HIGA 3A5EA 4EYCA 1N5PA 2C10A 5IG4A 3PGBA 4WYKB 4HM2B 3T8NA 9RNTA 2OWPA 4N3VA 2P09A 2I9WA 1IK3A 5JBSA 2CG0A 1BNIA 2GU1A 3CPOA 3EBYA 4WP5A 1VQ83 3PYJA 4LGQA 4NPBA 5EEOA 1TP6A 3MG1A 4R9KA 1UI7A 1G96A 5HGRA 7RNTA 1BVIA 2SARA 1N9JA 1HU9A 4QWTA 3X42A 2OOVC 1JV2B 1RNBA 1BRIA 1OHOA 1UCLA 4HVNA 5G1LA 3SLUA 5A0OB 1I0XA 2RSXA 3BIRA 3HIIA 1OUNA 4HM0B 4O2HA 2KAAA 1NU3A 1BNSA 3F40A 1X1UA 3BNEA 5EQLA 4K61A 2F98A 1OHPA 2C11A 1TRQA 3F7SA 3EC9A 1IQXA 3BNCA 3G6E3 1BSAA 1JJ22 6STDA 4MEIA 1DVDA 3FKAA 2MF7A 1D6ZA 3D3LA 4OK0A 3ZG5A 3D79A 4HM1B 1W02A 1BUJA 3FG3A 3DMCA 1VQ73 5EVHA 1BNJA 1YVBI 3NX0A 5M1AA 1W6YA 2O3OA 4XBXA 3LMLA 1BAOA 3CCU3 1MOLA 1IVUA 1B2ZA 3FF0A 3OXAA 3CD63 3GZRA 2F5WA 3B4PA 1Q824 5JPUA 2LYXA 1IQYA 1I2GA 1FUSA 3SOYA 3WMDA 1K734 1B3SA 1B2SA 1ZGXA 1O7PB 2XR8B 2CWUA 2ZA4A 3KE7A 3O8YA 1RHLA 1YIJ3 1QVG2 3M8CA 1AV4A 2D42A 5CXOA 1I8VA 3JUQA 1Y4KA 2KXGA 3ER7A 1BANA 2L1SA 1RTUA 1BNFA 1LOVA 3Q1CA 4X2OA 2V1LA 2B24B 5AIHA 1VQK3 1FGRA 4R80A 1T2HA 1W4NA 3MYTA 3S28A 1GMQA 1I3FA 1RSNA 2FNQA 7GSPA 3SYUA 5G2GA 1SJWA 3S29A 2CX0A 3BU4A 1DYUA 1MWRA 1D6YA 2CHCA 1A67A 1ZX2A 1K9M4 3DGNA 5GSPA 2XGLA 2ML6A 3H51A 2OOVA 2CFDA 2PNCA 3H3HA 2OQEA 1RN7A 5IG5A 3B8LA 3NXJA 5ELJA 1FUWA 1WMPA 2XRXB 5IF6A 1B20A 1WNHA 2W9QA 4NHFA 1JB5A 1YNVX 1T2IA 1AVKA 1BRGA 1LVNA 1RGGA 3SX1A 4J8TA 2W0QA 3MKIA 1VQ53 2H0GA 3RGRA 5BVBA 3MWZA 4R1KA 1GY6A 1RJOA 3IPTA 2XEPA 5TGNA 2QA43 4EV5A 1A2PA 3J7Yd 2IY2A 2CX1A 3EBTA 3EE1A 3MHEA 3CPW2 3CCQ3 1BGSA 1NWWA 3CNXA 4HM4B 3EJVA 5KP4A 1PYLA 1E3RA 2FGTA 3S5CA 3G8ZA 1W00A 1BRKA 3V99A 4HM6B 1RRHA 4CDLA 4KZ1A 5I97A 3STDA 2W03A 1F8NA 3FF2A 3HX8A 4AKZA 4I4KA 4KFDA 3F8XA 3OV4A 1BNRA 2K0MA 2STDA 3LTBA 1VQ93 2IYJA 1X1WA 1Q7Y4 1LNIA 3GRDA 5AEWB 1N8R4 3I0YA 1T3BA 2AADA 2BHMA 4KFFA 7STDA 1AQZA 2CK3H 4N6TA 3S67A 1OF5A 3A76A 8RNTA 2UGIA 2GBWB 1JKGB 1GMRA 2RGQA 4NREA 1Q7HA 1ISKA 3DGLA 1M9GA 3KZTA 4BTXA 5AYRB 2BIRA 2P38A 1KWIA 1NDOB 5AI1A 3SOAA 4WYKA 4ZM8A 4GL6A 3NM2A 1LXEA 3DGOA 3FG4A 1RN4A 3JUPA 3ZFZA 2R41A 3DM8A 5IG3A 3CC23 1KQS2 3F8HA 4HYZA 3OWSA 1RGEA 1QALA 1RNTA 3EN1B 3CC73 4K1UA 2XFSA 1JBSA 3AGNA 3AMOA 3FCSB 5AIFA 3E99A 3LH4A 1NO3A 3EHCA 3LOYA 1RGHA 1YJ93 1IU7A 2ZHXB 1A2KA 3OWYA 5CF2A 1IYYA 1C54A 1RGLA 5JPPA 3DY5A 1MGWA 1OPYA 2OQEC 2WGQA 4J5GA 3CU3A 5IENA 1N5HA 3X3ZA 3AHWA 1JB2A 1VQ43 1BIRA 2K54A 4N6NB 3V98A 4MMXB 4CCVA 3L0RA 2KF6A 4L7KA 3K9MC 4HM5B 3QK9A 3DXOA 4J9AA 1V58A 4L8PA 1OHSA 4LMIA 3RGAA 2CFLA 1UGIA 3WR2A 1CYUA 1UUWB 2XH9A 4HZ9B 3ROBA 1K28A 3LT9A 1BSEA 5KP1A 4R9LA 3CC43 3X40A 3EQQB 1K41A 1O7NB 2CWTA 3NM7A 4RNZA 1IQ8A 5RNTA 4EC6A 3B4OA 2LQVA 1STFI 1N9EA 4N6OB 1QAKA 2HMMB 3SXXA 6RNTA 2F56A 1HYFA 3G4S3 1BOXA 4LEHA 1W5ZA 5DRVA 1W7CA 1CYVA 3T0UA 2BT3A 3AGOA 4WWUC 2SBLA 3DGYA 3ZG0A 1I2EA 2ZDJA 4ILFA 3ALAA 1E97A 1AR0A 4N6V0 3I563 2KRTA 1LQMB 1JBTA 3IJEB 1UGHI 2IUJA 3NBJA 2ML5A 3EX9A 3KIIA 3D5GA 1AY7A 1GY7A 1PFPA 3BLZA 4XBTA 4XB5A 1BSDA 5CLKA 5BIRA 1YJN3 1PY3A 1U5OA 2FXTA 4K1VA 4RBNA 4LZIA 4EW5A 2W9PA 4BTYA 2Q07A 4O8SA 3SEDA 2Y74A 4HJLB 5IW9A 1OGXA 2F5MA 5D82A 5DREA 1BUQA 3JUOA 1IT7A 2BMOB 4CPKA 1JN5B 1S5AA 1FGTA 2B1XB 1ULJB 1Q864 1LQGC 1BRNL 3F9SA 1RMSA 1RDSA 2CFKA 1HKXA 1KSIA 1WMOA 2RBIA 2Z77A 3EN8A 8CHOA 5IERA 1Z1SA 1EG9B 1HZ1A 1B21A 4STDA 5LC7A 5M19A 4JF8A 1DMQA 2WOHA 4GSPA 1LOWA 1VQQA 5IG0A 1MWSA 2HMNB 3CMA3 5AIGA 4FMAA 3KCHA 1BRHA 1LOXA 2GEXA 2XSHB 1ZS7A 4HM3B 1CEWI 1Q40B 2K3DA 3VGNA 3PCRA 2HMOB 1BNEA 1VQ63 2CKFB 3VSYA 3TDGA 1RRLA 3QRDA 4I5QA 3I553 4FCJA 5D83A 1UI8A 5ELUA 1MWUA 2OTL3 1SARA 1I2FA 3LTDA 3CME3 1LNHA 3DGMA 3KKGA 1BSCA 1QJGA 2Z7AA 5KP3A 1JKGA 3LTCA 1YI23 1AVLA 1YHQ3 1M1XB 1G02A 1G0TA 2H0IA 2PZVA 2UX0A 1GD3A 2XSOB 3FGYA 3NUVA 1W6CA 2HOHA 3Q3FA 4N6UA 4WFOA 3CCL3 1R4CA 1STDA 3PCSA 3S27A 3CCE3 1A2VA 2C4BA 1ZO2A 3JVCA 4EXRA 3UL5A 3K7CA 2CW9A 5BXQA 4CJNA 3GZXB 5AIIA 1DMMA 2E2VA 2RNTA 2F86B 3X3XA 2W56B 2Z76A 1UCKA 1I3IA
chains in the Genus database with same CATH topology
1U8CB 1GYBA 5IEOA 3X41A 1K8A4 1GS3A 1NB3I 1O7HB 2CWVA 2ZL8A 3MSOA 5IEPA 2OCTA 2JQ5A 4KFEA 4FMCA 1YGEA 3GZBA 2QGUA 3NV0B 3CNMA 1YJW3 3GWRA 4BTWA 3KSPA 2HMJB 1NB5I 3WODG 1JB4A 3WA2X 4G1MB 1NJI4 4H61A 3UNLA 5CF1A 2E2TA 2GEYA 2CIUA 1VQO3 1A90A 4JRFA 4R4KA 5STDA 1VQL3 1M904 1IVWA 2CFWA 2OTJ3 2D1WA 1W01A 3G713 3UJMA 2CH9A 2CFGA 2HMLB 3Q90A 4OUQA 3U97A 2E2UA 4X2HA 3BNBA 3MPHA 3DUKA 4LSOA 2IA7A 4ORLA 4XBYA 3LT8A 1ULIB 2F99A 2YFJB 4GB5A 3GAXA 3KFQC 2KCDA 3RDEA 3SVAA 2RCDA 3K0ZA 3N54B 1RKYA 4HBRA 1WMNA 3MG3A 3AMOB 1EQKA 4HKVB 2Y73A 3OW22 4RNYA 4FR9A 4U13A 4O3VA 4HZBB 2MC8A 1ROVA 1W6GA 1E3VA 3LTAA 4KVHA 5LC6A 4OVMA 1GD4A 3LZAA 2M7OA 1VQ63 2YFIB 3OWUA 2WGOA 5AEUB 2BNGA 1OACA 1IV7A 1OGZA 1QAFA 2YFLB 1N8QA 4PEJA 3CCS3 3X3YA 1WTHA 1IVXA 4XDVA 1SQWA 4TX4A 2BO9B 1KC84 3Q2PA 1D6UA 3GZYB 2QEX3 1VQP3 2QIYA 4O02B 1KD14 3UB1A 3VF1A 1UUVB 2GBXB 4Q53A 1JN5A 2GU3A 2P05A 2WOFA 1GY5A 1ROAA 3B7CA 3KSED 3EB8A 3DZLA 1TU5A 3LYGA 1DMNA 4XM4A 1UW1A 1DVCA 1EKMA 2BMRB 1WQLB 4AEQA 3FZWA 1VQN3 1Q814 4HM7B 3PXMA 3F14A 1PU4A 2XFTA 3WOEB 1JNQA 1MNLA 1Q40A 3WA3A 3NHXA 4EV2A 2XF3A 4IPBA 3FLJA 4HM8B 4L8OA 3CCM3 1JRQA 1O7GB 3KN4A 2IUKA 1SIHA 3G16A 3WDGB 4FMBA 2HMKB 2INXA 3HZPA 5FGOA 1C7HA 3JUNA 1FGOA 1ASKA 1M1K4 1OH0A 3NQYA 3ECFA 3CXC2 2W2CA 2RFRA 4K90B 2CG1A 3BNDA 1CQSA 1SPUA 2A15A 3CCR3 2WO0A 4IIAA 1QMAA 2Z6BA 2W04A 2YX9A 5CK6A 4H3UA 1TFOA 4MJDA 1W2ZA 2W56A 3PS8A 3PZWA 3JUMA 4N6MA 4AKYA 1VZZA 1W2B2 1YIT3 3MG2A 4RZMA 1T5YA 4EBGA 5AYSC 3NBRA 1FA3A 1O7WB 2IMJA 1O7MB 2W6JH 3F7XA 4MMZB 4IT7A 1IV9A 3G0KA 3FH1A 1QVF2 3BB9A 3HK4A 3IMAB 3NV0A 5D81A 3UL6A 3T8UA 4FCZA 3LXUX 1VQM3 1EA2A 2P0MA 3WOFB 3U1WA 2XGNA 3N8BA 1FGMA 1IT8A 2GXFA 3D9RA 2R4IA 3FG1A 1TUHA 3OX9A 2O9UX 4XDWA 1TIJA 4N6LA 2JDIH 1IDPA 2L4VA 4FCMA 1OCVA 4FMDA 1V74A 3NQZA 1L5GB 1SIIA 4MMYB 3EF8A 3K63A 3NBBA 3K5TA 1US1A 3FSDA 3V92A 5FW5A 3HI7A 4WHAA 1S723 1J2BA 1TFKA 1OF5B 2P0XA 2BMQB 3N9HA 2CC3A 1IVVA 1FGQA 3CCJ3 1Q42A 3HIGA 4EYCA 1N5PA 2C10A 5IG4A 3PGBA 4WYKB 4HM2B 3T8NA 1IK3A 2OWPA 4N3VA 2P09A 2I9WA 5JBSA 2CG0A 2GU1A 3CPOA 3EBYA 4WP5A 1VQ83 3PYJA 4LGQA 5EEOA 1TP6A 3MG1A 4R9KA 1UI7A 1G96A 5HGRA 1N9JA 1HU9A 4QWTA 3X42A 2OOVC 1JV2B 1OHOA 4HVNA 3SLUA 5A0OB 2RSXA 3HIIA 1OUNA 4HM0B 4O2HA 1NU3A 3F40A 3BNEA 5EQLA 4K61A 2F98A 1OHPA 2C11A 3F7SA 3EC9A 1IQXA 3BNCA 3G6E3 1JJ22 6STDA 4MEIA 1DVDA 3FKAA 2MF7A 1D6ZA 3D3LA 4OK0A 4HM1B 1W02A 3FG3A 3DMCA 1VQ73 5EVHA 1YVBI 3NX0A 1W6YA 2O3OA 4XBXA 3LMLA 3CCU3 1MOLA 1IVUA 3FF0A 3OXAA 3CD63 3GZRA 3B4PA 1Q824 5JPUA 2LYXA 1IQYA 3SOYA 3WMDA 1K734 3KE7A 3O8YA 1O7PB 2XR8B 2CWUA 1YIJ3 1QVG2 3M8CA 1AV4A 2D42A 5CXOA 3JUQA 1Y4KA 2KXGA 3ER7A 3Q1CA 4X2OA 2V1LA 2B24B 5AIHA 1VQK3 1FGRA 4R80A 1W4NA 3MYTA 3S28A 2FNQA 5G2GA 1SJWA 3S29A 1DYUA 1D6YA 2CHCA 1A67A 1ZX2A 1K9M4 3DGNA 2XGLA 2ML6A 3H51A 2OOVA 2CFDA 2PNCA 3H3HA 2OQEA 1RN7A 5IG5A 3B8LA 3NXJA 5ELJA 1FUWA 1WMPA 2XRXB 5IF6A 1WNHA 2W9QA 4NHFA 1JB5A 1AVKA 3SX1A 1LVNA 4J8TA 2W0QA 3MKIA 1VQ53 3RGRA 5BVBA 3MWZA 4R1KA 1GY6A 1RJOA 3IPTA 2XEPA 5TGNA 4EV5A 3J7Yd 3EBTA 3EE1A 3MHEA 3CPW2 3CCQ3 1NWWA 3CNXA 4HM4B 3EJVA 5KP4A 2FGTA 1E3RA 3S5CA 3G8ZA 1W00A 3V99A 4HM6B 1RRHA 4CDLA 4KZ1A 5I97A 3STDA 2W03A 1F8NA 3FF2A 3HX8A 4AKZA 4I4KA 4KFDA 3F8XA 3OV4A 2K0MA 2STDA 3LTBA 1VQ93 1Q7Y4 3GRDA 5AEWB 1N8R4 3I0YA 4KFFA 2BHMA 7STDA 2CK3H 4N6TA 3S67A 1OF5A 3A76A 2GBWB 1JKGB 2RGQA 4NREA 1ISKA 3DGLA 1M9GA 3KZTA 4BTXA 5AYRB 2P38A 1KWIA 1NDOB 5AI1A 3SOAA 4WYKA 4ZM8A 4GL6A 3NM2A 1LXEA 3DGOA 3FG4A 3JUPA 5IG3A 3DM8A 3CC23 3F8HA 4HYZA 3OWSA 1QALA 3EN1B 3CC73 4K1UA 2XFSA 3AMOA 3FCSB 5AIFA 3E99A 3LH4A 1NO3A 3EHCA 3LOYA 1YJ93 1IU7A 1A2KA 3OWYA 5CF2A 5JPPA 3DY5A 1OPYA 2OQEC 2WGQA 3CU3A 5IENA 1N5HA 3X3ZA 1JB2A 1VQ43 2K54A 4N6NB 3V98A 4MMXB 4CCVA 3L0RA 4L7KA 3K9MC 4HM5B 3QK9A 3DXOA 4J9AA 4L8PA 1OHSA 4LMIA 3RGAA 2CFLA 1CYUA 1UUWB 2XH9A 4HZ9B 3ROBA 1K28A 3LT9A 5KP1A 4R9LA 3CC43 3X40A 3EQQB 1K41A 1O7NB 2CWTA 3NM7A 4RNZA 1IQ8A 4EC6A 3B4OA 2LQVA 1STFI 1N9EA 4N6OB 1QAKA 2HMMB 3SXXA 4LEHA 1W5ZA 5DRVA 1W7CA 1CYVA 3T0UA 2BT3A 4WWUC 2SBLA 2ZDJA 3ALAA 1E97A 1AR0A 4N6V0 3I563 2KRTA 3IJEB 2IUJA 3NBJA 2ML5A 3EX9A 3KIIA 1GY7A 3BLZA 1PFPA 4XBTA 4XB5A 5CLKA 1YJN3 1U5OA 4RBNA 2FXTA 4K1VA 4LZIA 2W9PA 4BTYA 2Q07A 4O8SA 3SEDA 2Y74A 4HJLB 5IW9A 1OGXA 5D82A 5DREA 1BUQA 3JUOA 1IT7A 2BMOB 1JN5B 1S5AA 1FGTA 2B1XB 1ULJB 1Q864 3F9SA 2QA43 2CFKA 2Z77A 1HKXA 1KSIA 1WMOA 3EN8A 8CHOA 5IERA 1Z1SA 1EG9B 5LC7A 4STDA 4JF8A 1DMQA 2WOHA 5IG0A 2HMNB 3CMA3 5AIGA 4FMAA 1LOXA 2GEXA 2XSHB 4HM3B 1CEWI 1Q40B 3VGNA 3PCRA 2HMOB 2CKFB 3VSYA 3TDGA 1RRLA 3QRDA 3I553 4FCJA 5D83A 1UI8A 5ELUA 2OTL3 3LTDA 3CME3 1LNHA 3DGMA 3KKGA 1QJGA 2Z7AA 5KP3A 1JKGA 3LTCA 1YI23 1AVLA 1YHQ3 1M1XB 3FGYA 2UX0A 3G4S3 2PZVA 4N6UA 1GD3A 2XSOB 3NUVA 3CCV3 1W6CA 4WFOA 3CCL3 1R4CA 1STDA 3PCSA 3S27A 3CCE3 1A2VA 3JVCA 1ZO2A 4EXRA 3UL5A 3K7CA 2CW9A 5BXQA 3GZXB 5AIIA 1DMMA 2E2VA 2F86B 3X3XA 2W56B 2Z76A 1KQS2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GYB A;  5IEO A;  1GS3 A;  3MSO A;  1O7H B;  5IEP A;  2JQ5 A;  3GZB A;  2QGU A;  3NV0 B;  3CNM A;  3GWR A;  3KSP A;  2HMJ B;  1JB4 A;  3UNL A;  5CF1 A;  2GEY A;  5STD A;  1W01 A;  3Q90 A;  2HML B;  4OUQ A;  4X2H A;  3DUK A;  4ORL A;  4XBY A;  4GB5 A;  1ULI B;  2F99 A;  2YFJ B;  3UJM A;  2RCD A;  3K0Z A;  3MG3 A;  4HKV B;  4U13 A;  4HZB B;  4KVH A;  1E3V A;  4OVM A;  3LZA A;  2YFI B;  3OWU A;  5AEU B;  2BNG A;  1OGZ A;  4PEJ A;  2YFL B;  4XDV A;  3GZY B;  2QIY A;  1UUV B;  2GBX B;  4Q53 A;  1JN5 A;  1GY5 A;  3B7C A;  3DZL A;  3LYG A;  1DMN A;  4XM4 A;  2BMR B;  1WQL B;  3FZW A;  4HM7 B;  3F14 A;  1Q40 A;  3NHX A;  3FLJ A;  4HM8 B;  4L8O A;  1O7G B;  3G16 A;  2HMK B;  2INX A;  3HZP A;  3JUN A;  1C7H A;  1ASK A;  1OH0 A;  3ECF A;  2W2C A;  2RFR A;  1CQS A;  2A15 A;  4IIA A;  1QMA A;  5CK6 A;  4H3U A;  4MJD A;  3JUM A;  1VZZ A;  3MG2 A;  4RZM A;  3NBR A;  1O7W B;  2IMJ A;  1O7M B;  3F7X A;  3G0K A;  3FH1 A;  3BB9 A;  3HK4 A;  3NV0 A;  5D81 A;  3T8U A;  1EA2 A;  3D9R A;  2GXF A;  3OX9 A;  2R4I A;  1TUH A;  4XDW A;  1IDP A;  4FCM A;  1OCV A;  3EF8 A;  3FSD A;  5FW5 A;  1OF5 B;  2BMQ B;  1Q42 A;  5IG4 A;  4WYK B;  4HM2 B;  3T8N A;  2OWP A;  4N3V A;  2I9W A;  3CPO A;  3EBY A;  4WP5 A;  4LGQ A;  1TP6 A;  3MG1 A;  4R9K A;  5HGR A;  1OHO A;  4HVN A;  1OUN A;  4HM0 B;  1NU3 A;  3F40 A;  2F98 A;  1OHP A;  3F7S A;  3EC9 A;  6STD A;  3FKA A;  4HM1 B;  1W02 A;  3DMC A;  5EVH A;  1W6Y A;  4XBX A;  3FF0 A;  3OXA A;  3GZR A;  3B4P A;  5JPU A;  3SOY A;  3WMD A;  3KE7 A;  1O7P B;  2XR8 B;  3M8C A;  5CXO A;  3JUQ A;  3ER7 A;  4X2O A;  2B24 B;  5AIH A;  3MYT A;  5G2G A;  1SJW A;  2CHC A;  1ZX2 A;  3H51 A;  3H3H A;  5IG5 A;  3B8L A;  3NXJ A;  2XRX B;  5IF6 A;  1JB5 A;  4J8T A;  3MKI A;  3RGR A;  5BVB A;  4R1K A;  1GY6 A;  3IPT A;  5TGN A;  3EBT A;  3MHE A;  1NWW A;  3CNX A;  4HM4 B;  3EJV A;  5KP4 A;  1E3R A;  3S5C A;  3G8Z A;  1W00 A;  4HM6 B;  4CDL A;  3STD A;  3FF2 A;  3HX8 A;  4I4K A;  3F8X A;  3OV4 A;  2STD A;  3GRD A;  5AEW B;  3I0Y A;  7STD A;  1OF5 A;  3A76 A;  2GBW B;  1JKG B;  2RGQ A;  1ISK A;  3KZT A;  1NDO B;  5AI1 A;  3SOA A;  4WYK A;  3NM2 A;  3JUP A;  5IG3 A;  3DM8 A;  3F8H A;  3OWS A;  3EN1 B;  4K1U A;  5AIF A;  3E99 A;  3EHC A;  1A2K A;  3OWY A;  5CF2 A;  5JPP A;  1OPY A;  3CU3 A;  5IEN A;  1JB2 A;  2K54 A;  4L7K A;  4HM5 B;  3DXO A;  4J9A A;  4L8P A;  1OHS A;  4LMI A;  3RGA A;  1UUW B;  4HZ9 B;  3ROB A;  5KP1 A;  4R9L A;  3EQQ B;  1K41 A;  1O7N B;  3B4O A;  2HMM B;  4LEH A;  5DRV A;  4WWU C;  1E97 A;  1AR0 A;  3EX9 A;  1GY7 A;  3BLZ A;  4XBT A;  4XB5 A;  5CLK A;  1U5O A;  4K1V A;  3SED A;  4HJL B;  1OGX A;  5D82 A;  5DRE A;  1BUQ A;  3JUO A;  2BMO B;  1JN5 B;  1S5A A;  2B1X B;  1ULJ B;  3F9S A;  1HKX A;  2Z77 A;  3EN8 A;  8CHO A;  5IER A;  1Z1S A;  1EG9 B;  4STD A;  1DMQ A;  5IG0 A;  2HMN B;  5AIG A;  2GEX A;  2XSH B;  4HM3 B;  1Q40 B;  3VGN A;  2HMO B;  2CKF B;  3VSY A;  4FCJ A;  5D83 A;  3KKG A;  1QJG A;  2Z7A A;  5KP3 A;  1JKG A;  3FGY A;  2UX0 A;  2PZV A;  2XSO B;  3NUV A;  1STD A;  1ZO2 A;  3K7C A;  5BXQ A;  3GZX B;  5AII A;  1DMM A;  2F86 B;  2Z76 A; 
#chains in the Genus database with same CATH topology
 1U8C B;  1GYB A;  5IEO A;  3X41 A;  1GOY A;  1K8A 4;  1GS3 A;  1NB3 I;  1O7H B;  2CWV A;  2ZL8 A;  3MSO A;  5IEP A;  2OCT A;  2JQ5 A;  1V57 A;  4HAA A;  4KFE A;  4FMC A;  1YGE A;  1NNV A;  2KF5 A;  3GZB A;  2QGU A;  3DH2 A;  3CNM A;  3NV0 B;  3GWR A;  4BTW A;  3KSP A;  1YJW 3;  2HMJ B;  1NB5 I;  2KF4 A;  1MGR A;  1JB4 A;  3WA2 X;  3WOD G;  4G1M B;  1NJI 4;  4H61 A;  3UNL A;  5CF1 A;  1BU4 A;  3CCS 3;  1RGA A;  2E2T A;  1FYS A;  2CIU A;  2GEY A;  4DKI A;  1TTO A;  1VQO 3;  1A90 A;  1RLS A;  4JRF A;  2BU4 A;  2AAE A;  4R4K A;  1B2X A;  5STD A;  3GSP A;  1VQL 3;  1M90 4;  1BRS A;  1IVW A;  2CFW A;  4BL2 A;  2OTJ 3;  4BU4 A;  1FZU A;  2D1W A;  1W01 A;  3CCV 3;  3G71 3;  3UJM A;  2CH9 A;  2CFG A;  2HML B;  3Q90 A;  4OUQ A;  3U97 A;  2E2U A;  4X2H A;  3BNB A;  3MPH A;  3DUK A;  4LSO A;  2IA7 A;  4ORL A;  4XBY A;  3LT8 A;  1ULI B;  2F99 A;  2YFJ B;  4GB5 A;  3GAX A;  3KFQ C;  2KCD A;  3RDE A;  3SVA A;  2RCD A;  3K0Z A;  3N54 B;  1RKY A;  1B2M A;  4HBR A;  1WMN A;  3MG3 A;  3AMO B;  2H0H A;  1EQK A;  4HKV B;  2Y73 A;  1YVS A;  3OW2 2;  4RNY A;  4FR9 A;  4U13 A;  4O3V A;  4GHO A;  4HZB B;  4BIR A;  2MC8 A;  1ROV A;  3WHO A;  1W6G A;  1E3V A;  3LTA A;  4KVH A;  5LC6 A;  1JBR A;  4OVM A;  1GD4 A;  3LZA A;  2M7O A;  1I0V A;  1LOY A;  2YFI B;  2WGO A;  3OWU A;  5AEU B;  1GOV A;  1OAC A;  1IV7 A;  1OGZ A;  1QAF A;  2BNG A;  1N8Q A;  2YFL B;  4PEJ A;  5G1K A;  3X3Y A;  2F4Y A;  1WTH A;  1IVX A;  4XDV A;  1SQW A;  1GSP A;  2BO9 B;  4TX4 A;  1KC8 4;  3Q2P A;  1D6U A;  3GZY B;  6GSP A;  2QEX 3;  1VQP 3;  2QIY A;  4O02 B;  1KD1 4;  3UB1 A;  3VF1 A;  1UUV B;  1JZD A;  2GBX B;  4Q53 A;  1JN5 A;  2GU3 A;  2P05 A;  1RCL A;  1GY5 A;  1ROA A;  2KF3 A;  2WOF A;  4BL3 A;  1I70 A;  3B7C A;  1FW7 A;  1GMP A;  3KSE D;  4KT3 B;  3EB8 A;  1DE3 A;  3DZL A;  1TU5 A;  3LYG A;  1DMN A;  1UCJ A;  4XM4 A;  1UW1 A;  1DVC A;  1EKM A;  2BMR B;  1WQL B;  4AEQ A;  3FZW A;  1VQN 3;  1Q81 4;  4HM7 B;  3PXM A;  3F14 A;  1PU4 A;  2XFT A;  3WOE B;  1JNQ A;  3RNT A;  2UUG C;  1LRA A;  1MNL A;  1Q40 A;  2J8X B;  3WA3 A;  3NHX A;  4EV2 A;  2XF3 A;  3AHS A;  4IPB A;  3FLJ A;  5M18 A;  4HM8 B;  4L8O A;  3CCM 3;  1JRQ A;  1O7G B;  3KN4 A;  1RGC A;  1SIH A;  2IUK A;  3G16 A;  3WDG B;  4FMB A;  2HMK B;  2INX A;  3HZP A;  5FGO A;  1X1X A;  1C7H A;  3JUN A;  1FGO A;  1ASK A;  1UUG B;  1M1K 4;  4HOH A;  1OH0 A;  3NQY A;  3ECF A;  3CXC 2;  2W2C A;  2RFR A;  4K90 B;  2CG1 A;  3BND A;  1CQS A;  1SPU A;  2A15 A;  3CCR 3;  2WO0 A;  1BNG A;  4IIA A;  1QMA A;  2Z6B A;  2W04 A;  2YX9 A;  1GOU A;  4H3U A;  1DET A;  5CK6 A;  1TFO A;  5BU4 A;  4MJD A;  1W2Z A;  2W56 A;  3PS8 A;  3PZW A;  3JUM A;  4N6M A;  4AKY A;  1UCI A;  1VZZ A;  1W2B 2;  1YIT 3;  1MWT A;  3MG2 A;  1JZO A;  4J5K A;  1T5Y A;  4RZM A;  4EBG A;  1RGK A;  5AYS C;  3NBR A;  1FA3 A;  1O7W B;  2IMJ A;  1O7M B;  2W6J H;  1RCK A;  3F7X A;  4MMZ B;  1UDI I;  4IT7 A;  1IV9 A;  5HOH A;  3G0K A;  3FH1 A;  1QVF 2;  3BB9 A;  1YGW A;  3HK4 A;  1X1Y A;  3IMA B;  3NV0 A;  5D81 A;  4RNT A;  1RGF A;  3UL6 A;  3T8U A;  4FCZ A;  3LXU X;  1VQM 3;  1EA2 A;  2P0M A;  3WOF B;  3U1W A;  1TJD A;  1B2U A;  2XGN A;  3N8B A;  1FGM A;  1IT8 A;  2GXF A;  3D9R A;  2R4I A;  3FG1 A;  1TUH A;  3D4A A;  2O9U X;  3HOH A;  3OX9 A;  4XDW A;  3URP A;  1TIJ A;  1BRJ A;  1B27 A;  2JDI H;  4N6L A;  1IDP A;  2L4V A;  4LYL B;  4FCM A;  1OCV A;  1RN1 A;  4FMD A;  1V74 A;  3NQZ A;  1L5G B;  1SII A;  4MMY B;  3EF8 A;  3K63 A;  3NBB A;  3K5T A;  1US1 A;  3FSD A;  3V92 A;  5FW5 A;  3HI7 A;  4WHA A;  1S72 3;  1J2B A;  1TFK A;  1Q9E A;  1OF5 B;  2GSP A;  2P0X A;  1EUI C;  2BMQ B;  1R4Y A;  1IVV A;  1EEJ A;  1FGQ A;  1FUT A;  2CC3 A;  3D5I A;  3N9H A;  1BSB A;  3CCJ 3;  1CH0 A;  1Q42 A;  1TRP A;  3HIG A;  3A5E A;  4EYC A;  1N5P A;  2C10 A;  5IG4 A;  3PGB A;  4WYK B;  4HM2 B;  3T8N A;  9RNT A;  2OWP A;  4N3V A;  2P09 A;  2I9W A;  1IK3 A;  5JBS A;  2CG0 A;  1BNI A;  2GU1 A;  3CPO A;  3EBY A;  4WP5 A;  1VQ8 3;  3PYJ A;  4LGQ A;  4NPB A;  5EEO A;  1TP6 A;  3MG1 A;  4R9K A;  1UI7 A;  1G96 A;  5HGR A;  7RNT A;  1BVI A;  2SAR A;  1N9J A;  1HU9 A;  4QWT A;  3X42 A;  2OOV C;  1JV2 B;  1RNB A;  1BRI A;  1OHO A;  1UCL A;  4HVN A;  5G1L A;  3SLU A;  5A0O B;  1I0X A;  2RSX A;  3BIR A;  3HII A;  1OUN A;  4HM0 B;  4O2H A;  2KAA A;  1NU3 A;  1BNS A;  3F40 A;  1X1U A;  3BNE A;  5EQL A;  4K61 A;  2F98 A;  1OHP A;  2C11 A;  1TRQ A;  3F7S A;  3EC9 A;  1IQX A;  3BNC A;  3G6E 3;  1BSA A;  1JJ2 2;  6STD A;  4MEI A;  1DVD A;  3FKA A;  2MF7 A;  1D6Z A;  3D3L A;  4OK0 A;  3ZG5 A;  3D79 A;  4HM1 B;  1W02 A;  1BUJ A;  3FG3 A;  3DMC A;  1VQ7 3;  5EVH A;  1BNJ A;  1YVB I;  3NX0 A;  5M1A A;  1W6Y A;  2O3O A;  4XBX A;  3LML A;  1BAO A;  3CCU 3;  1MOL A;  1IVU A;  1B2Z A;  3FF0 A;  3OXA A;  3CD6 3;  3GZR A;  2F5W A;  3B4P A;  1Q82 4;  5JPU A;  2LYX A;  1IQY A;  1I2G A;  1FUS A;  3SOY A;  3WMD A;  1K73 4;  1B3S A;  1B2S A;  1ZGX A;  1O7P B;  2XR8 B;  2CWU A;  2ZA4 A;  3KE7 A;  3O8Y A;  1RHL A;  1YIJ 3;  1QVG 2;  3M8C A;  1AV4 A;  2D42 A;  5CXO A;  1I8V A;  3JUQ A;  1Y4K A;  2KXG A;  3ER7 A;  1BAN A;  2L1S A;  1RTU A;  1BNF A;  1LOV A;  3Q1C A;  4X2O A;  2V1L A;  2B24 B;  5AIH A;  1VQK 3;  1FGR A;  4R80 A;  1T2H A;  1W4N A;  3MYT A;  3S28 A;  1GMQ A;  1I3F A;  1RSN A;  2FNQ A;  7GSP A;  3SYU A;  5G2G A;  1SJW A;  3S29 A;  2CX0 A;  3BU4 A;  1DYU A;  1MWR A;  1D6Y A;  2CHC A;  1A67 A;  1ZX2 A;  1K9M 4;  3DGN A;  5GSP A;  2XGL A;  2ML6 A;  3H51 A;  2OOV A;  2CFD A;  2PNC A;  3H3H A;  2OQE A;  1RN7 A;  5IG5 A;  3B8L A;  3NXJ A;  5ELJ A;  1FUW A;  1WMP A;  2XRX B;  5IF6 A;  1B20 A;  1WNH A;  2W9Q A;  4NHF A;  1JB5 A;  1YNV X;  1T2I A;  1AVK A;  1BRG A;  1LVN A;  1RGG A;  3SX1 A;  4J8T A;  2W0Q A;  3MKI A;  1VQ5 3;  2H0G A;  3RGR A;  5BVB A;  3MWZ A;  4R1K A;  1GY6 A;  1RJO A;  3IPT A;  2XEP A;  5TGN A;  2QA4 3;  4EV5 A;  1A2P A;  3J7Y d;  2IY2 A;  2CX1 A;  3EBT A;  3EE1 A;  3MHE A;  3CPW 2;  3CCQ 3;  1BGS A;  1NWW A;  3CNX A;  4HM4 B;  3EJV A;  5KP4 A;  1PYL A;  1E3R A;  2FGT A;  3S5C A;  3G8Z A;  1W00 A;  1BRK A;  3V99 A;  4HM6 B;  1RRH A;  4CDL A;  4KZ1 A;  5I97 A;  3STD A;  2W03 A;  1F8N A;  3FF2 A;  3HX8 A;  4AKZ A;  4I4K A;  4KFD A;  3F8X A;  3OV4 A;  1BNR A;  2K0M A;  2STD A;  3LTB A;  1VQ9 3;  2IYJ A;  1X1W A;  1Q7Y 4;  1LNI A;  3GRD A;  5AEW B;  1N8R 4;  3I0Y A;  1T3B A;  2AAD A;  2BHM A;  4KFF A;  7STD A;  1AQZ A;  2CK3 H;  4N6T A;  3S67 A;  1OF5 A;  3A76 A;  8RNT A;  2UGI A;  2GBW B;  1JKG B;  1GMR A;  2RGQ A;  4NRE A;  1Q7H A;  1ISK A;  3DGL A;  1M9G A;  3KZT A;  4BTX A;  5AYR B;  2BIR A;  2P38 A;  1KWI A;  1NDO B;  5AI1 A;  3SOA A;  4WYK A;  4ZM8 A;  4GL6 A;  3NM2 A;  1LXE A;  3DGO A;  3FG4 A;  1RN4 A;  3JUP A;  3ZFZ A;  2R41 A;  3DM8 A;  5IG3 A;  3CC2 3;  1KQS 2;  3F8H A;  4HYZ A;  3OWS A;  1RGE A;  1QAL A;  1RNT A;  3EN1 B;  3CC7 3;  4K1U A;  2XFS A;  1JBS A;  3AGN A;  3AMO A;  3FCS B;  5AIF A;  3E99 A;  3LH4 A;  1NO3 A;  3EHC A;  3LOY A;  1RGH A;  1YJ9 3;  1IU7 A;  2ZHX B;  1A2K A;  3OWY A;  5CF2 A;  1IYY A;  1C54 A;  1RGL A;  5JPP A;  3DY5 A;  1MGW A;  1OPY A;  2OQE C;  2WGQ A;  4J5G A;  3CU3 A;  5IEN A;  1N5H A;  3X3Z A;  3AHW A;  1JB2 A;  1VQ4 3;  1BIR A;  2K54 A;  4N6N B;  3V98 A;  4MMX B;  4CCV A;  3L0R A;  2KF6 A;  4L7K A;  3K9M C;  4HM5 B;  3QK9 A;  3DXO A;  4J9A A;  1V58 A;  4L8P A;  1OHS A;  4LMI A;  3RGA A;  2CFL A;  1UGI A;  3WR2 A;  1CYU A;  1UUW B;  2XH9 A;  4HZ9 B;  3ROB A;  1K28 A;  3LT9 A;  1BSE A;  5KP1 A;  4R9L A;  3CC4 3;  3X40 A;  3EQQ B;  1K41 A;  1O7N B;  2CWT A;  3NM7 A;  4RNZ A;  1IQ8 A;  5RNT A;  4EC6 A;  3B4O A;  2LQV A;  1STF I;  1N9E A;  4N6O B;  1QAK A;  2HMM B;  3SXX A;  6RNT A;  2F56 A;  1HYF A;  3G4S 3;  1BOX A;  4LEH A;  1W5Z A;  5DRV A;  1W7C A;  1CYV A;  3T0U A;  2BT3 A;  3AGO A;  4WWU C;  2SBL A;  3DGY A;  3ZG0 A;  1I2E A;  2ZDJ A;  4ILF A;  3ALA A;  1E97 A;  1AR0 A;  4N6V 0;  3I56 3;  2KRT A;  1LQM B;  1JBT A;  3IJE B;  1UGH I;  2IUJ A;  3NBJ A;  2ML5 A;  3EX9 A;  3KII A;  3D5G A;  1AY7 A;  1GY7 A;  1PFP A;  3BLZ A;  4XBT A;  4XB5 A;  1BSD A;  5CLK A;  5BIR A;  1YJN 3;  1PY3 A;  1U5O A;  2FXT A;  4K1V A;  4RBN A;  4LZI A;  4EW5 A;  2W9P A;  4BTY A;  2Q07 A;  4O8S A;  3SED A;  2Y74 A;  4HJL B;  5IW9 A;  1OGX A;  2F5M A;  5D82 A;  5DRE A;  1BUQ A;  3JUO A;  1IT7 A;  2BMO B;  4CPK A;  1JN5 B;  1S5A A;  1FGT A;  2B1X B;  1ULJ B;  1Q86 4;  1LQG C;  1BRN L;  3F9S A;  1RMS A;  1RDS A;  2CFK A;  1HKX A;  1KSI A;  1WMO A;  2RBI A;  2Z77 A;  3EN8 A;  8CHO A;  5IER A;  1Z1S A;  1EG9 B;  1HZ1 A;  1B21 A;  4STD A;  5LC7 A;  5M19 A;  4JF8 A;  1DMQ A;  2WOH A;  4GSP A;  1LOW A;  1VQQ A;  5IG0 A;  1MWS A;  2HMN B;  3CMA 3;  5AIG A;  4FMA A;  3KCH A;  1BRH A;  1LOX A;  2GEX A;  2XSH B;  1ZS7 A;  4HM3 B;  1CEW I;  1Q40 B;  2K3D A;  3VGN A;  3PCR A;  2HMO B;  1BNE A;  1VQ6 3;  2CKF B;  3VSY A;  3TDG A;  1RRL A;  3QRD A;  4I5Q A;  3I55 3;  4FCJ A;  5D83 A;  1UI8 A;  5ELU A;  1MWU A;  2OTL 3;  1SAR A;  1I2F A;  3LTD A;  3CME 3;  1LNH A;  3DGM A;  3KKG A;  1BSC A;  1QJG A;  2Z7A A;  5KP3 A;  1JKG A;  3LTC A;  1YI2 3;  1AVL A;  1YHQ 3;  1M1X B;  1G02 A;  1G0T A;  2H0I A;  2PZV A;  2UX0 A;  1GD3 A;  2XSO B;  3FGY A;  3NUV A;  1W6C A;  2HOH A;  3Q3F A;  4N6U A;  4WFO A;  3CCL 3;  1R4C A;  1STD A;  3PCS A;  3S27 A;  3CCE 3;  1A2V A;  2C4B A;  1ZO2 A;  3JVC A;  4EXR A;  3UL5 A;  3K7C A;  2CW9 A;  5BXQ A;  4CJN A;  3GZX B;  5AII A;  1DMM A;  2E2V A;  2RNT A;  2F86 B;  3X3X A;  2W56 B;  2Z76 A;  1UCK A;  1I3I A; 
#chains in the Genus database with same CATH homology
 1U8C B;  1GYB A;  5IEO A;  3X41 A;  1K8A 4;  1GS3 A;  1NB3 I;  1O7H B;  2CWV A;  2ZL8 A;  3MSO A;  5IEP A;  2OCT A;  2JQ5 A;  4KFE A;  4FMC A;  1YGE A;  3GZB A;  2QGU A;  3NV0 B;  3CNM A;  1YJW 3;  3GWR A;  4BTW A;  3KSP A;  2HMJ B;  1NB5 I;  3WOD G;  1JB4 A;  3WA2 X;  4G1M B;  1NJI 4;  4H61 A;  3UNL A;  5CF1 A;  2E2T A;  2GEY A;  2CIU A;  1VQO 3;  1A90 A;  4JRF A;  4R4K A;  5STD A;  1VQL 3;  1M90 4;  1IVW A;  2CFW A;  2OTJ 3;  2D1W A;  1W01 A;  3G71 3;  3UJM A;  2CH9 A;  2CFG A;  2HML B;  3Q90 A;  4OUQ A;  3U97 A;  2E2U A;  4X2H A;  3BNB A;  3MPH A;  3DUK A;  4LSO A;  2IA7 A;  4ORL A;  4XBY A;  3LT8 A;  1ULI B;  2F99 A;  2YFJ B;  4GB5 A;  3GAX A;  3KFQ C;  2KCD A;  3RDE A;  3SVA A;  2RCD A;  3K0Z A;  3N54 B;  1RKY A;  4HBR A;  1WMN A;  3MG3 A;  3AMO B;  1EQK A;  4HKV B;  2Y73 A;  3OW2 2;  4RNY A;  4FR9 A;  4U13 A;  4O3V A;  4HZB B;  2MC8 A;  1ROV A;  1W6G A;  1E3V A;  3LTA A;  4KVH A;  5LC6 A;  4OVM A;  1GD4 A;  3LZA A;  2M7O A;  1VQ6 3;  2YFI B;  3OWU A;  2WGO A;  5AEU B;  2BNG A;  1OAC A;  1IV7 A;  1OGZ A;  1QAF A;  2YFL B;  1N8Q A;  4PEJ A;  3CCS 3;  3X3Y A;  1WTH A;  1IVX A;  4XDV A;  1SQW A;  4TX4 A;  2BO9 B;  1KC8 4;  3Q2P A;  1D6U A;  3GZY B;  2QEX 3;  1VQP 3;  2QIY A;  4O02 B;  1KD1 4;  3UB1 A;  3VF1 A;  1UUV B;  2GBX B;  4Q53 A;  1JN5 A;  2GU3 A;  2P05 A;  2WOF A;  1GY5 A;  1ROA A;  3B7C A;  3KSE D;  3EB8 A;  3DZL A;  1TU5 A;  3LYG A;  1DMN A;  4XM4 A;  1UW1 A;  1DVC A;  1EKM A;  2BMR B;  1WQL B;  4AEQ A;  3FZW A;  1VQN 3;  1Q81 4;  4HM7 B;  3PXM A;  3F14 A;  1PU4 A;  2XFT A;  3WOE B;  1JNQ A;  1MNL A;  1Q40 A;  3WA3 A;  3NHX A;  4EV2 A;  2XF3 A;  4IPB A;  3FLJ A;  4HM8 B;  4L8O A;  3CCM 3;  1JRQ A;  1O7G B;  3KN4 A;  2IUK A;  1SIH A;  3G16 A;  3WDG B;  4FMB A;  2HMK B;  2INX A;  3HZP A;  5FGO A;  1C7H A;  3JUN A;  1FGO A;  1ASK A;  1M1K 4;  1OH0 A;  3NQY A;  3ECF A;  3CXC 2;  2W2C A;  2RFR A;  4K90 B;  2CG1 A;  3BND A;  1CQS A;  1SPU A;  2A15 A;  3CCR 3;  2WO0 A;  4IIA A;  1QMA A;  2Z6B A;  2W04 A;  2YX9 A;  5CK6 A;  4H3U A;  1TFO A;  4MJD A;  1W2Z A;  2W56 A;  3PS8 A;  3PZW A;  3JUM A;  4N6M A;  4AKY A;  1VZZ A;  1W2B 2;  1YIT 3;  3MG2 A;  4RZM A;  1T5Y A;  4EBG A;  5AYS C;  3NBR A;  1FA3 A;  1O7W B;  2IMJ A;  1O7M B;  2W6J H;  3F7X A;  4MMZ B;  4IT7 A;  1IV9 A;  3G0K A;  3FH1 A;  1QVF 2;  3BB9 A;  3HK4 A;  3IMA B;  3NV0 A;  5D81 A;  3UL6 A;  3T8U A;  4FCZ A;  3LXU X;  1VQM 3;  1EA2 A;  2P0M A;  3WOF B;  3U1W A;  2XGN A;  3N8B A;  1FGM A;  1IT8 A;  2GXF A;  3D9R A;  2R4I A;  3FG1 A;  1TUH A;  3OX9 A;  2O9U X;  4XDW A;  1TIJ A;  4N6L A;  2JDI H;  1IDP A;  2L4V A;  4FCM A;  1OCV A;  4FMD A;  1V74 A;  3NQZ A;  1L5G B;  1SII A;  4MMY B;  3EF8 A;  3K63 A;  3NBB A;  3K5T A;  1US1 A;  3FSD A;  3V92 A;  5FW5 A;  3HI7 A;  4WHA A;  1S72 3;  1J2B A;  1TFK A;  1OF5 B;  2P0X A;  2BMQ B;  3N9H A;  2CC3 A;  1IVV A;  1FGQ A;  3CCJ 3;  1Q42 A;  3HIG A;  4EYC A;  1N5P A;  2C10 A;  5IG4 A;  3PGB A;  4WYK B;  4HM2 B;  3T8N A;  1IK3 A;  2OWP A;  4N3V A;  2P09 A;  2I9W A;  5JBS A;  2CG0 A;  2GU1 A;  3CPO A;  3EBY A;  4WP5 A;  1VQ8 3;  3PYJ A;  4LGQ A;  5EEO A;  1TP6 A;  3MG1 A;  4R9K A;  1UI7 A;  1G96 A;  5HGR A;  1N9J A;  1HU9 A;  4QWT A;  3X42 A;  2OOV C;  1JV2 B;  1OHO A;  4HVN A;  3SLU A;  5A0O B;  2RSX A;  3HII A;  1OUN A;  4HM0 B;  4O2H A;  1NU3 A;  3F40 A;  3BNE A;  5EQL A;  4K61 A;  2F98 A;  1OHP A;  2C11 A;  3F7S A;  3EC9 A;  1IQX A;  3BNC A;  3G6E 3;  1JJ2 2;  6STD A;  4MEI A;  1DVD A;  3FKA A;  2MF7 A;  1D6Z A;  3D3L A;  4OK0 A;  4HM1 B;  1W02 A;  3FG3 A;  3DMC A;  1VQ7 3;  5EVH A;  1YVB I;  3NX0 A;  1W6Y A;  2O3O A;  4XBX A;  3LML A;  3CCU 3;  1MOL A;  1IVU A;  3FF0 A;  3OXA A;  3CD6 3;  3GZR A;  3B4P A;  1Q82 4;  5JPU A;  2LYX A;  1IQY A;  3SOY A;  3WMD A;  1K73 4;  3KE7 A;  3O8Y A;  1O7P B;  2XR8 B;  2CWU A;  1YIJ 3;  1QVG 2;  3M8C A;  1AV4 A;  2D42 A;  5CXO A;  3JUQ A;  1Y4K A;  2KXG A;  3ER7 A;  3Q1C A;  4X2O A;  2V1L A;  2B24 B;  5AIH A;  1VQK 3;  1FGR A;  4R80 A;  1W4N A;  3MYT A;  3S28 A;  2FNQ A;  5G2G A;  1SJW A;  3S29 A;  1DYU A;  1D6Y A;  2CHC A;  1A67 A;  1ZX2 A;  1K9M 4;  3DGN A;  2XGL A;  2ML6 A;  3H51 A;  2OOV A;  2CFD A;  2PNC A;  3H3H A;  2OQE A;  1RN7 A;  5IG5 A;  3B8L A;  3NXJ A;  5ELJ A;  1FUW A;  1WMP A;  2XRX B;  5IF6 A;  1WNH A;  2W9Q A;  4NHF A;  1JB5 A;  1AVK A;  3SX1 A;  1LVN A;  4J8T A;  2W0Q A;  3MKI A;  1VQ5 3;  3RGR A;  5BVB A;  3MWZ A;  4R1K A;  1GY6 A;  1RJO A;  3IPT A;  2XEP A;  5TGN A;  4EV5 A;  3J7Y d;  3EBT A;  3EE1 A;  3MHE A;  3CPW 2;  3CCQ 3;  1NWW A;  3CNX A;  4HM4 B;  3EJV A;  5KP4 A;  2FGT A;  1E3R A;  3S5C A;  3G8Z A;  1W00 A;  3V99 A;  4HM6 B;  1RRH A;  4CDL A;  4KZ1 A;  5I97 A;  3STD A;  2W03 A;  1F8N A;  3FF2 A;  3HX8 A;  4AKZ A;  4I4K A;  4KFD A;  3F8X A;  3OV4 A;  2K0M A;  2STD A;  3LTB A;  1VQ9 3;  1Q7Y 4;  3GRD A;  5AEW B;  1N8R 4;  3I0Y A;  4KFF A;  2BHM A;  7STD A;  2CK3 H;  4N6T A;  3S67 A;  1OF5 A;  3A76 A;  2GBW B;  1JKG B;  2RGQ A;  4NRE A;  1ISK A;  3DGL A;  1M9G A;  3KZT A;  4BTX A;  5AYR B;  2P38 A;  1KWI A;  1NDO B;  5AI1 A;  3SOA A;  4WYK A;  4ZM8 A;  4GL6 A;  3NM2 A;  1LXE A;  3DGO A;  3FG4 A;  3JUP A;  5IG3 A;  3DM8 A;  3CC2 3;  3F8H A;  4HYZ A;  3OWS A;  1QAL A;  3EN1 B;  3CC7 3;  4K1U A;  2XFS A;  3AMO A;  3FCS B;  5AIF A;  3E99 A;  3LH4 A;  1NO3 A;  3EHC A;  3LOY A;  1YJ9 3;  1IU7 A;  1A2K A;  3OWY A;  5CF2 A;  5JPP A;  3DY5 A;  1OPY A;  2OQE C;  2WGQ A;  3CU3 A;  5IEN A;  1N5H A;  3X3Z A;  1JB2 A;  1VQ4 3;  2K54 A;  4N6N B;  3V98 A;  4MMX B;  4CCV A;  3L0R A;  4L7K A;  3K9M C;  4HM5 B;  3QK9 A;  3DXO A;  4J9A A;  4L8P A;  1OHS A;  4LMI A;  3RGA A;  2CFL A;  1CYU A;  1UUW B;  2XH9 A;  4HZ9 B;  3ROB A;  1K28 A;  3LT9 A;  5KP1 A;  4R9L A;  3CC4 3;  3X40 A;  3EQQ B;  1K41 A;  1O7N B;  2CWT A;  3NM7 A;  4RNZ A;  1IQ8 A;  4EC6 A;  3B4O A;  2LQV A;  1STF I;  1N9E A;  4N6O B;  1QAK A;  2HMM B;  3SXX A;  4LEH A;  1W5Z A;  5DRV A;  1W7C A;  1CYV A;  3T0U A;  2BT3 A;  4WWU C;  2SBL A;  2ZDJ A;  3ALA A;  1E97 A;  1AR0 A;  4N6V 0;  3I56 3;  2KRT A;  3IJE B;  2IUJ A;  3NBJ A;  2ML5 A;  3EX9 A;  3KII A;  1GY7 A;  3BLZ A;  1PFP A;  4XBT A;  4XB5 A;  5CLK A;  1YJN 3;  1U5O A;  4RBN A;  2FXT A;  4K1V A;  4LZI A;  2W9P A;  4BTY A;  2Q07 A;  4O8S A;  3SED A;  2Y74 A;  4HJL B;  5IW9 A;  1OGX A;  5D82 A;  5DRE A;  1BUQ A;  3JUO A;  1IT7 A;  2BMO B;  1JN5 B;  1S5A A;  1FGT A;  2B1X B;  1ULJ B;  1Q86 4;  3F9S A;  2QA4 3;  2CFK A;  2Z77 A;  1HKX A;  1KSI A;  1WMO A;  3EN8 A;  8CHO A;  5IER A;  1Z1S A;  1EG9 B;  5LC7 A;  4STD A;  4JF8 A;  1DMQ A;  2WOH A;  5IG0 A;  2HMN B;  3CMA 3;  5AIG A;  4FMA A;  1LOX A;  2GEX A;  2XSH B;  4HM3 B;  1CEW I;  1Q40 B;  3VGN A;  3PCR A;  2HMO B;  2CKF B;  3VSY A;  3TDG A;  1RRL A;  3QRD A;  3I55 3;  4FCJ A;  5D83 A;  1UI8 A;  5ELU A;  2OTL 3;  3LTD A;  3CME 3;  1LNH A;  3DGM A;  3KKG A;  1QJG A;  2Z7A A;  5KP3 A;  1JKG A;  3LTC A;  1YI2 3;  1AVL A;  1YHQ 3;  1M1X B;  3FGY A;  2UX0 A;  3G4S 3;  2PZV A;  4N6U A;  1GD3 A;  2XSO B;  3NUV A;  3CCV 3;  1W6C A;  4WFO A;  3CCL 3;  1R4C A;  1STD A;  3PCS A;  3S27 A;  3CCE 3;  1A2V A;  3JVC A;  1ZO2 A;  4EXR A;  3UL5 A;  3K7C A;  2CW9 A;  5BXQ A;  3GZX B;  5AII A;  1DMM A;  2E2V A;  2F86 B;  3X3X A;  2W56 B;  2Z76 A;  1KQS 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...