1OGZA

Crystal structure of 5-3-ketosteroid isomerase mutants p39a complexed with equilenin from pseudomonas testosteroni
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDAVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title The Conserved Cis-Pro39 Residue Plays a Crucial Role in the Proper Positioning of the Catalytic Base Asp38 in Ketosteroid Isomerase from Comamonas Testosteroni.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 33
structure length 125
sequence length 125
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ogzA00
3KZTA 3GZRA 3SEDA 4R1KA 2F86B 3A76A 3NHXA 3F14A 2RGQA 4HVNA 5DREA 3LZAA 2K54A 2INXA 3ER7A 8CHOA 1W6YA 3VGNA 3DM8A 4XBXA 3GZBA 4XB5A 1W01A 4WYKA 4OUQA 2BMQB 3JUPA 3S5CA 1TP6A 3EHCA 5D81A 3GRDA 5D83A 3K0ZA 1JKGA 3G0KA 5KP3A 4FCJA 3B7CA 4H3UA 1AR0A 3OXAA 4R9LA 5CLKA 3CNMA 3UNLA 4XDWA 5IG3A 5IEPA 1OHPA 3NV0B 1ULJB 4I4KA 3EX9A 2GBWB 3H51A 5KP1A 1ASKA 5AEUB 3JUNA 3G8ZA 4STDA 1BUQA 3JUMA 3EN1B 4CDLA 4IIAA 3MYTA 2F98A 1QMAA 2UX0A 5IF6A 2RCDA 3EBTA 1QJGA 2B1XB 4R9KA 3IPTA 3T8NA 3ECFA 1VZZA 2HMOB 1O7MB 3MG2A 5JPUA 1OCVA 1ZX2A 3NXJA 3GWRA 4HZBB 5CF1A 4HM7B 3SOAA 3DUKA 3FH1A 1U5OA 3SOYA 1O7NB 1Q40A 5TGNA 1O7WB 3Q90A 5STDA 1HKXA 3EBYA 4WYKB 3DZLA 3EF8A 2HMNB 3D9RA 3JUQA 5IG5A 5EVHA 2W2CA 2HMLB 2OWPA 2HMMB 1JKGB 4Q53A 3FGYA 3H3HA 4WP5A 5FW5A 1OHOA 3FF2A 3F9SA 3GZXB 5KP4A 1C7HA 3FLJA 1O7GB 2STDA 4XDVA 3EN8A 3UJMA 3DMCA 2BNGA 1JN5A 4L7KA 2YFJB 4GB5A 1STDA 1E97A 5DRVA 4J9AA 5IG0A 1Z1SA 1WQLB 2F99A 3MSOA 5G2GA 3MKIA 4ORLA 1E3RA 1S5AA 3F7SA 3FZWA 1NU3A 3GZYB 4HM5B 3CU3A 3MHEA 3OWUA 2GEYA 2BMOB 2YFLB 1CQSA 1OHSA 1DMNA 3EQQB 4N3VA 2Z77A 3STDA 4RZMA 2R4IA 3T8UA 2CKFB 1W00A 4X2HA 3G16A 5JPPA 4HM4B 1EG9B 3E99A 1O7HB 4HM6B 2XSOB 1Q40B 2JQ5A 1SJWA 4HM8B 4L8PA 3LYGA 6STDA 5CXOA 5AIFA 3K7CA 1OGXA 2XRXB 4XBTA 1A2KA 5IG4A 1UUVB 4HM1B 1ULIB 2BMRB 3I0YA 2HMKB 3MG1A 3HX8A 3NM2A 1OF5A 3F40A 1JB4A 3EJVA 3DXOA 4XBYA 4U13A 3WMDA 1OUNA 5D82A 4HM0B 4FCMA 1JN5B 3F7XA 4MJDA 4LEHA 2GXFA 3B4OA 2CHCA 3NUVA 3B4PA 3NBRA 3ROBA 1EA2A 3CNXA 3KE7A 1GY7A 4XM4A 3FKAA 2XSHB 2RFRA 3RGAA 1GYBA 1GY5A 3HK4A 1K41A 5IENA 5IEOA 3F8HA 2QGUA 5CK6A 4K1VA 1NDOB 1OPYA 5BXQA 1IDPA 2GBXB 4OVMA 1W02A 2XR8B 2IMJA 2Z7AA 5AIHA 1E3VA 4K1UA 4HKVB 5AEWB 4HM3B 3BLZA 4LGQA 1NWWA 3VSYA 2PZVA 1ZO2A 1JB2A 2GEXA 2QIYA 1DMQA 4PEJA 4HJLB 4WWUC 4LMIA 1JB5A 1DMMA 4HZ9B 2A15A 3KSPA 3FF0A 2YFIB 2B24B 4KVHA 3OV4A 5CF2A 3HZPA 1OH0A 4HM2B 3JUOA 1OF5B 1OGZA 3EC9A 3FSDA 3OWSA 5AIIA 5HGRA 5AI1A 5IERA 4J8TA 3NV0A 3MG3A 1TUHA 3B8LA 1ISKA 5BVBA 3OX9A 2HMJB 7STDA 1GY6A 3M8CA 4L8OA 3BB9A 1GS3A 1Q42A 3OWYA 3F8XA 2I9WA 5AIGA 3RGRA 1UUWB 2Z76A 3KKGA 3CPOA 1O7PB 4X2OA
chains in the Genus database with same CATH superfamily
3KZTA 4R4KA 3GZRA 1IV7A 3SEDA 4R1KA 2F86B 2W6JH 2CIUA 1Q9EA 3LMLA 3CPW2 1KSIA 1Q7Y4 2P0MA 7GSPA 3D4AA 3PZWA 1BANA 1B21A 2CG0A 2P05A 3AGNA 3A76A 5EQLA 5RNTA 3NHXA 1B2SA 3F14A 1FUWA 1TTOA 1US1A 2CWUA 2KF4A 4IT7A 5G1KA 5I97A 2RGQA 3CCR3 1UUGB 4N6V0 3SX1A 2KXGA 4HVNA 3NX0A 1ZGXA 4R80A 5DREA 3LZAA 2L4VA 1RJOA 1KC84 2AADA 3PYJA 2K54A 4BTXA 2INXA 1IQ8A 3ER7A 5AYSC 2CFDA 1FGTA 2MC8A 3SLUA 1GOYA 1WMNA 1J2BA 8CHOA 1RGEA 4EV5A 3X3XA 4J5GA 1QAFA 1W6YA 1BNSA 2Y73A 3KCHA 1PY3A 2ML5A 1BGSA 1X1UA 2CW9A 3VGNA 2IY2A 3DM8A 3X40A 1C54A 4XBXA 3CCJ3 3GZBA 4XB5A 1N5PA 3X3ZA 1AVLA 1RNBA 1W01A 4WYKA 3AMOA 1PYLA 1AQZA 1SIHA 5BIRA 1V58A 1BNJA 4OUQA 1W6CA 2BMQB 3JUPA 1W2ZA 3S5CA 1TP6A 4JF8A 2GU1A 3LT8A 3EHCA 2E2VA 3GRDA 5D81A 4HAAA 5D83A 2CG1A 1JJ22 3K0ZA 3BNEA 4N6NB 1QAKA 4N6MA 1JKGA 2WGQA 1VQ43 3G0KA 5KP3A 4KT3B 4FCJA 1RSNA 3B7CA 4H3UA 3OW22 1B27A 3MWZA 1LOVA 1AR0A 1UI8A 3O8YA 3OXAA 3PGBA 4R9LA 5CLKA 3N9HA 1I2FA 4BU4A 1G96A 1T2HA 3CNMA 1RLSA 1BNEA 4XDWA 3UNLA 4GL6A 5IG3A 1OHPA 3NV0B 1ULJB 1JV2B 5IEPA 4I4KA 1ROVA 2CWVA 3LXUX 3EX9A 4EXRA 1V74A 2XEPA 4HBRA 1TJDA 2GBWB 2R41A 1IYYA 3H51A 5KP1A 1ASKA 2E2TA 5G1LA 4N6TA 4EYCA 1LXEA 3CME3 3Q1CA 5AEUB 1YIJ3 4TX4A 1JZDA 1RGHA 2Z6BA 3KSED 3JUNA 1VQ53 1IVXA 4DKIA 2L1SA 3DGLA 3G8ZA 4STDA 1EQKA 1UDII 1BUQA 2OOVA 3JUMA 3EN1B 1CYVA 4CDLA 2FNQA 2OOVC 2IYJA 4IIAA 3MYTA 3WOFB 1WTHA 1DVCA 4O2HA 4K90B 2F98A 1QMAA 4RNTA 3SXXA 2W04A 3LTAA 2UX0A 5IF6A 2RCDA 3EBTA 1B2UA 3HOHA 1QJGA 2B1XB 3BNBA 3WA3A 4R9KA 2Q07A 1A2PA 3IPTA 1LOYA 1PU4A 3LOYA 1RN7A 3I553 4O3VA 3T8NA 3ECFA 3LT9A 1VZZA 2HMOB 3EE1A 1BRHA 1O7MB 5ELUA 1KD14 3BIRA 2V1LA 3MG2A 4I5QA 7RNTA 1GOVA 1W4NA 5JPUA 1DE3A 1LNIA 2W03A 1N8QA 1OCVA 1ZX2A 3DY5A 2WO0A 3NXJA 3GWRA 1STFI 2W9PA 4HZBB 5CF1A 1BRGA 4HM7B 3V92A 4IPBA 3SOAA 3DUKA 3FH1A 1LRAA 1MWRA 1RHLA 1U5OA 4J5KA 3SOYA 3G6E3 2F5MA 1IVVA 1YJW3 1BRKA 2F5WA 1I2EA 2XFSA 3G713 1O7NB 1S723 1Q40A 1IQYA 1LNHA 1GOUA 3AHWA 3SYUA 2SARA 1BRIA 5TGNA 1AVKA 1O7WB 3Q90A 3ZG0A 3CXC2 2BT3A 2C11A 1TRPA 2BIRA 3IJEB 3LH4A 3MPHA 5STDA 1RN4A 3WDGB 1X1XA 1HKXA 1A90A 1BU4A 3EBYA 3AMOB 4O02B 1ROAA 4WYKB 3RNTA 1MOLA 1YJN3 3DZLA 3EF8A 1YVBI 2C4BA 4N6LA 2HMNB 3D9RA 4G1MB 3JUQA 5IG5A 5EVHA 1A67A 4WHAA 1B2ZA 2HMLB 2OWPA 2PNCA 2UGIA 2HMMB 2W2CA 2O3OA 3CCU3 1VQ63 1VQ73 1WNHA 2HOHA 3CCV3 1FW7A 1JKGB 4Q53A 1RGLA 3FGYA 2OCTA 3H3HA 1LQGC 1EUIC 4K61A 4QWTA 4RBNA 4WP5A 5FW5A 4OK0A 1UGHI 3ZFZA 1A2VA 1KQS2 2ZA4A 2XH9A 1OHOA 1IU7A 2QA43 1YNVX 3FG3A 1HZ1A 3FF2A 1EKMA 3F9SA 2IUKA 1FGRA 2XGLA 3GZXB 3GAXA 3S27A 5KP4A 1C7HA 1VQM3 4WFOA 1I2GA 3FLJA 5BU4A 3IMAB 1IV9A 4EBGA 1O7GB 2STDA 1T2IA 4XDVA 3TDGA 3WHOA 1I0XA 5ELJA 3EN8A 3PS8A 5AYRB 1NO3A 3FG4A 8RNTA 3UJMA 3DMCA 2BNGA 1JN5A 3QK9A 1NB3I 4L7KA 2P38A 5JBSA 3U97A 2QEX3 6GSPA 2SBLA 3D5GA 2YFJB 4GB5A 2H0HA 1SPUA 1STDA 1JBRA 3WA2X 3S28A 1E97A 5DRVA 4J9AA 1QALA 2CFKA 5IG0A 3PXMA 3VF1A 1Z1SA 3BNCA 2E2UA 1WQLB 3J7Yd 2F99A 3MSOA 4ZM8A 3K9MC 3MKIA 5G2GA 4ORLA 3D3LA 3SVAA 1E3RA 1I3FA 1TRQA 2C10A 1S5AA 1FGQA 3F7SA 1RGAA 3FZWA 3LTBA 4BL3A 1NU3A 2KF5A 4H61A 1YJ93 2RNTA 3GZYB 4HM5B 1UGIA 1BNGA 3CU3A 3DGNA 3MHEA 4AEQA 3OWUA 2GEYA 4HYZA 3CD63 1N9JA 1VQ93 3AHSA 2BMOB 1VQQA 4FMAA 2BO9B 2YFLB 1SIIA 3G4S3 1YIT3 2FGTA 4LYLB 1BRSA 1BSDA 1CQSA 1DETA 1G0TA 3GSPA 1L5GB 1K8A4 3NQZA 2CH9A 2CFWA 1OHSA 1MWTA 1YGEA 3HIGA 1GSPA 3CCM3 1JBTA 1DMNA 3JVCA 3EQQB 2H0GA 2ZHXB 4N3VA 2Z77A 3STDA 4RZMA 2R4IA 3T8UA 3EB8A 4N6OB 2MF7A 1VQK3 1IT7A 2CKFB 1W00A 5M19A 4FR9A 4X2HA 1RGKA 1EEJA 3K5TA 2K3DA 1RMSA 1K734 3G16A 5JPPA 4HM4B 1EG9B 3E99A 1O7HB 4HM6B 1IQXA 1TIJA 2XSOB 1RKYA 2J8XB 1KWIA 1JZOA 1Q40B 4LZIA 5HOHA 2LYXA 2JQ5A 1F8NA 3DGOA 4FMCA 2K0MA 3V98A 1SJWA 1N8R4 1R4CA 1B3SA 3CCQ3 4HM8B 3URPA 3BNDA 4L8PA 3LYGA 6STDA 3PCSA 2XF3A 4MMZB 5CXOA 1I70A 4KFDA 1FGMA 1Q7HA 1TU5A 5AIFA 3K7CA 1K9M4 1GMQA 3CCE3 1OGXA 2XRXB 1MGWA 1A2KA 4XBTA 3T0UA 5IG4A 3CCS3 1LVNA 2RBIA 1UUVB 4HM1B 4EC6A 4O8SA 5EEOA 1RCKA 1ULIB 2JDIH 3KN4A 2CFLA 2BMRB 1BNRA 1GMPA 3I0YA 3BU4A 3N8BA 1JNQA 1RGCA 2BU4A 4LSOA 3WODG 1W5ZA 1RRHA 2HMKB 1PFPA 3MG1A 3HX8A 1U8CB 3NM2A 1OF5A 3F40A 2F56A 1JB4A 3EJVA 3DXOA 3ZG5A 1YHQ3 1BSCA 4XBYA 1W6GA 3DGMA 3WR2A 3Q2PA 4FMBA 4U13A 4RNZA 1GD3A 2RSXA 3Q3FA 2O9UX 3WMDA 1RRLA 2GU3A 5IW9A 1W7CA 1OUNA 2ZL8A 2KCDA 2YX9A 2UUGC 4HM0B 3N54B 5D82A 4AKYA 1NJI4 4FCMA 1JN5B 2OQEA 2KF3A 3F7XA 2KRTA 1M1XB 4LEHA 2WOHA 4MJDA 1BVIA 2GXFA 2OQEC 5FGOA 3B4OA 3D79A 4EV2A 1FYSA 2CHCA 3NUVA 1B2MA 2W56B 3PCRA 4GHOA 4ILFA 1X1WA 1UCKA 3UB1A 1SARA 1K28A 3HI7A 1BSAA 3B4PA 2P09A 4HOHA 3UL5A 3NBRA 3ROBA 1EA2A 5LC7A 3CNXA 4CCVA 2W9QA 9RNTA 1VQL3 3KE7A 1GY7A 4KFEA 3L0RA 1QVG2 4XM4A 1M1K4 3FKAA 1CH0A 1T3BA 3FG1A 2XSHB 2RFRA 4JRFA 5M1AA 3RGAA 1BOXA 1GYBA 1BNFA 1GY5A 4FCZA 2M7OA 3HK4A 1K41A 1RNTA 4CPKA 5IENA 5IEOA 1VQO3 1NNVA 2WOFA 3F8HA 3X42A 2QGUA 1JBSA 2W0QA 5CK6A 1FA3A 4K1VA 5LC6A 1IVWA 1NDOB 1D6UA 1FGOA 2BHMA 1AY7A 1OPYA 2GSPA 1D6YA 2W56A 1IDPA 1IVUA 5BXQA 3I563 2GBXB 1CYUA 1RTUA 4OVMA 3CMA3 1IT8A 3CC43 4BIRA 3DH2A 4NREA 4BTYA 1W02A 3UL6A 2XR8B 3NBJA 2IMJA 2Z7AA 2OTL3 5AIHA 1E3VA 1UI7A 4K1UA 4MEIA 4HKVB 1NB5I 1DVDA 3LTDA 1MGRA 1UCJA 5AEWB 3KFQC 1UCIA 1HYFA 2F4YA 1TFKA 4HM3B 3BLZA 4LGQA 1WMOA 1NWWA 1RN1A 1N5HA 2CX0A 2WGOA 3VSYA 2PZVA 1B20A 1UW1A 1ZO2A 1JB2A 2GEXA 1BSEA 2QIYA 4N6UA 1RGGA 1DMQA 2ML6A 3S67A 4PEJA 4HJLB 1N9EA 4BTWA 1T5YA 4WWUC 4LMIA 1JB5A 4BL2A 1LQMB 4KFFA 1BRJA 1DMMA 1UCLA 1D6ZA 1BSBA 3S29A 1LOXA 2CK3H 1GMRA 4HZ9B 2A15A 3CCL3 1V57A 3HIIA 1CEWI 4AKZA 2CC3A 3FCSB 3RDEA 3KSPA 1BAOA 4MMYB 1BUJA 3FF0A 2YFIB 2B24B 1R4YA 3OV4A 4KVHA 4MMXB 3X3YA 5CF2A 1M904 1RCLA 1I8VA 2KAAA 2FXTA 2D1WA 2CWTA 1GD4A 2XGNA 3HZPA 1X1YA 1W2B2 1OH0A 4HM2B 6RNTA 3JUOA 5M18A 1OF5B 1OGZA 1Q814 1WMPA 2IA7A 2H0IA 1M9GA 2P0XA 1FUSA 3EC9A 3FSDA 1AV4A 1VQP3 1I3IA 4GSPA 3OWSA 5AIIA 5HGRA 3K63A 2CFGA 3NQYA 4KZ1A 5GSPA 1VQN3 4FMDA 2XFTA 5AI1A 5IERA 3NBBA 2D42A 4J8TA 4NHFA 3A5EA 4NPBA 1LOWA 2CX1A 4CJNA 3NV0A 3MG3A 3X41A 1TUHA 3B8LA 1Q824 1JRQA 1ISKA 5BVBA 1YGWA 1RDSA 1BIRA 1DYUA 3OX9A 3KIIA 2HMJB 1RGFA 1MWUA 1BRNL 1MNLA 1G02A 2LQVA 7STDA 1GY6A 3M8CA 5A0OB 4L8OA 3BB9A 3LTCA 1GS3A 3AGOA 1YI23 1Q42A 2IUJA 1ZS7A 2KF6A 3OWYA 1BNIA 3F8XA 4EW5A 1SQWA 1IK3A 2I9WA 3U1WA 4RNYA 5AIGA 2AAEA 1QVF2 3NM7A 1OACA 2OTJ3 2ZDJA 1Q864 1FUTA 1Y4KA 3RGRA 3D5IA 3ALAA 3CC23 1TFOA 1UUWB 1HU9A 2Z76A 1YVSA 3CC73 1MWSA 3KKGA 3QRDA 1I0VA 3DGYA 1B2XA 2Y74A 3CPOA 1O7PB 4X2OA 3WOEB 1VQ83 3V99A 1FZUA
chains in the Genus database with same CATH topology
3KZTA 4R4KA 3GZRA 1IV7A 3SEDA 4R1KA 2F86B 2W6JH 2CIUA 3LMLA 3CPW2 1KSIA 1Q7Y4 2P0MA 3PZWA 2CG0A 2P05A 3A76A 5EQLA 3NHXA 3F14A 1FUWA 1US1A 2CWUA 4IT7A 5I97A 2RGQA 3CCR3 4N6V0 3SX1A 2KXGA 4HVNA 3NX0A 4R80A 5DREA 3LZAA 2L4VA 1RJOA 1KC84 3PYJA 2K54A 4BTXA 2INXA 1IQ8A 3ER7A 5AYSC 2CFDA 1FGTA 2MC8A 3SLUA 1WMNA 1J2BA 8CHOA 4EV5A 3X3XA 1QAFA 1W6YA 2Y73A 2ML5A 2CW9A 3VGNA 3DM8A 3X40A 4XBXA 3CCJ3 3GZBA 4XB5A 1N5PA 3X3ZA 1AVLA 1W01A 4WYKA 3AMOA 1SIHA 4OUQA 1W6CA 2BMQB 3JUPA 1W2ZA 3S5CA 1TP6A 4JF8A 2GU1A 3LT8A 3EHCA 2E2VA 3GRDA 5D81A 1JJ22 5D83A 2CG1A 3K0ZA 3BNEA 4N6NB 1QAKA 4N6MA 1JKGA 2WGQA 1VQ43 3G0KA 5KP3A 4FCJA 3B7CA 4H3UA 3OW22 3MWZA 1AR0A 1UI8A 3O8YA 3OXAA 3PGBA 4R9LA 5CLKA 3N9HA 1G96A 3CNMA 3UNLA 4XDWA 4GL6A 5IG3A 1OHPA 3NV0B 1ULJB 1JV2B 5IEPA 4I4KA 1ROVA 2CWVA 3LXUX 3EX9A 4EXRA 1V74A 2XEPA 4HBRA 2GBWB 3H51A 5KP1A 1ASKA 2E2TA 4N6TA 4EYCA 1LXEA 3CME3 3Q1CA 5AEUB 1YIJ3 4TX4A 2Z6BA 3KSED 3JUNA 1VQ53 1IVXA 1EQKA 3DGLA 3G8ZA 4STDA 1BUQA 2OOVA 3JUMA 3EN1B 1CYVA 4CDLA 2FNQA 2OOVC 4IIAA 3MYTA 3WOFB 1WTHA 1DVCA 4O2HA 4K90B 2F98A 1QMAA 3SXXA 2W04A 3LTAA 2UX0A 5IF6A 2RCDA 3EBTA 1QJGA 2B1XB 3BNBA 3WA3A 4R9KA 2Q07A 3IPTA 1PU4A 3LOYA 1RN7A 3I553 4O3VA 3T8NA 3ECFA 3LT9A 1VZZA 2HMOB 3EE1A 1KD14 1O7MB 5ELUA 2V1LA 3MG2A 5JPUA 1W4NA 2W03A 1N8QA 1OCVA 1ZX2A 3DY5A 2WO0A 3NXJA 3GWRA 1STFI 2W9PA 4HZBB 5CF1A 4HM7B 3V92A 4IPBA 3SOAA 3DUKA 3FH1A 1U5OA 3G6E3 3SOYA 1IVVA 1YJW3 2XFSA 3G713 1O7NB 1Q40A 1IQYA 1LNHA 5TGNA 1AVKA 1O7WB 3Q90A 3CXC2 2BT3A 2C11A 3IJEB 3LH4A 3MPHA 5STDA 3WDGB 1HKXA 1A90A 3EBYA 3AMOB 4O02B 1ROAA 4WYKB 1YJN3 1MOLA 3DZLA 3EF8A 1YVBI 4N6LA 2HMNB 3D9RA 4G1MB 3JUQA 5IG5A 5EVHA 1A67A 4WHAA 2W2CA 2OWPA 2HMLB 2PNCA 2HMMB 2O3OA 3CCU3 1VQ63 1VQ73 1WNHA 3CCV3 1JKGB 4Q53A 3FGYA 3H3HA 2OCTA 4K61A 4QWTA 4RBNA 4WP5A 5FW5A 1S723 4OK0A 1A2VA 1KQS2 2XH9A 1OHOA 1IU7A 2QA43 3FG3A 3FF2A 1EKMA 3F9SA 2IUKA 1FGRA 2XGLA 3GZXB 3GAXA 3S27A 5KP4A 1C7HA 1VQM3 4WFOA 3FLJA 3IMAB 1IV9A 4EBGA 1O7GB 2STDA 4XDVA 3TDGA 5ELJA 3EN8A 3PS8A 5AYRB 1NO3A 3FG4A 3UJMA 3DMCA 2BNGA 1JN5A 3QK9A 1NB3I 4L7KA 2P38A 2QEX3 3U97A 2SBLA 2YFJB 4GB5A 1SPUA 1STDA 3WA2X 3S28A 1E97A 5DRVA 4J9AA 1QALA 2CFKA 5IG0A 3PXMA 3VF1A 1Z1SA 3BNCA 2E2UA 1WQLB 3J7Yd 2F99A 3MSOA 4ZM8A 3K9MC 3MKIA 5G2GA 4ORLA 3D3LA 3SVAA 1E3RA 2C10A 1S5AA 1FGQA 3F7SA 3FZWA 3LTBA 1NU3A 4H61A 1YJ93 3GZYB 5JBSA 4HM5B 3CU3A 3DGNA 3MHEA 4AEQA 3OWUA 2GEYA 4HYZA 3CD63 1N9JA 1VQ93 2BMOB 4FMAA 2YFLB 2BO9B 1SIIA 3G4S3 1YIT3 2FGTA 1CQSA 1L5GB 1K8A4 3NQZA 2CH9A 2CFWA 1OHSA 1YGEA 3HIGA 3CCM3 1DMNA 3JVCA 3EQQB 4N3VA 2Z77A 3STDA 4RZMA 2R4IA 3T8UA 3EB8A 4N6OB 2MF7A 1VQK3 2CKFB 1W00A 4FR9A 4X2HA 3K5TA 1K734 3G16A 5JPPA 4HM4B 1EG9B 3E99A 1O7HB 4HM6B 1IQXA 1TIJA 2XSOB 1RKYA 1KWIA 1Q40B 4LZIA 2LYXA 2JQ5A 1F8NA 3DGOA 4FMCA 2K0MA 3V98A 1SJWA 1N8R4 1R4CA 3CCQ3 4HM8B 3BNDA 4L8PA 3LYGA 6STDA 3PCSA 2XF3A 4MMZB 5CXOA 4KFDA 1FGMA 1TU5A 5AIFA 3K7CA 1K9M4 3CCE3 1OGXA 2XRXB 4XBTA 1A2KA 3T0UA 5IG4A 3CCS3 1LVNA 1UUVB 4HM1B 4EC6A 4O8SA 5EEOA 1ULIB 2JDIH 3KN4A 2CFLA 2BMRB 3I0YA 3N8BA 1JNQA 4LSOA 3WODG 1W5ZA 1RRHA 2HMKB 1PFPA 3MG1A 3HX8A 1U8CB 3NM2A 1OF5A 3F40A 1JB4A 3EJVA 3DXOA 1YHQ3 4XBYA 1W6GA 3DGMA 3Q2PA 4FMBA 4U13A 4RNZA 1GD3A 2RSXA 3WMDA 2O9UX 1RRLA 2GU3A 5IW9A 1W7CA 1OUNA 2ZL8A 2KCDA 2YX9A 5D82A 4HM0B 3N54B 4AKYA 1NJI4 4FCMA 1JN5B 2OQEA 3F7XA 2KRTA 1M1XB 4LEHA 2WOHA 4MJDA 2GXFA 2OQEC 5FGOA 3B4OA 4EV2A 2CHCA 3NUVA 2W56B 3PCRA 3UB1A 1K28A 3HI7A 3B4PA 3UL5A 2P09A 3NBRA 3ROBA 1EA2A 5LC7A 3CNXA 4CCVA 2W9QA 1VQL3 3KE7A 1GY7A 4KFEA 3L0RA 1QVG2 4XM4A 1M1K4 3FKAA 4JRFA 3FG1A 2XSHB 2RFRA 3RGAA 1GYBA 1GY5A 4FCZA 2M7OA 3HK4A 1K41A 5IENA 1VQO3 5IEOA 2WOFA 3F8HA 3X42A 2QGUA 2W0QA 5CK6A 1FA3A 4K1VA 5LC6A 1IVWA 1NDOB 1D6UA 1FGOA 2BHMA 1OPYA 1D6YA 2W56A 1IDPA 1IVUA 5BXQA 3I563 2GBXB 1CYUA 4OVMA 3CMA3 1IT8A 3CC43 4NREA 4BTYA 1W02A 3UL6A 2XR8B 3NBJA 2IMJA 2Z7AA 2OTL3 5AIHA 1E3VA 1UI7A 4K1UA 4MEIA 4HKVB 1NB5I 1DVDA 3LTDA 5AEWB 3KFQC 1TFKA 4HM3B 3BLZA 4LGQA 1WMOA 1NWWA 3VSYA 1N5HA 2WGOA 2PZVA 1UW1A 1ZO2A 1JB2A 2GEXA 2QIYA 4N6UA 3S67A 1DMQA 2ML6A 4PEJA 4HJLB 1N9EA 4BTWA 1T5YA 4WWUC 4LMIA 1JB5A 4KFFA 1DMMA 1D6ZA 3S29A 1LOXA 2CK3H 4HZ9B 2A15A 3CCL3 3HIIA 4AKZA 1CEWI 2CC3A 3FCSB 3RDEA 3KSPA 4MMYB 3FF0A 2YFIB 2B24B 4KVHA 3OV4A 4MMXB 3X3YA 5CF2A 1M904 2FXTA 2D1WA 2CWTA 1GD4A 2XGNA 3HZPA 1W2B2 1OH0A 4HM2B 3JUOA 1OF5B 1OGZA 1Q814 1WMPA 2IA7A 1M9GA 2P0XA 3EC9A 3FSDA 1AV4A 1VQP3 3OWSA 5AIIA 5HGRA 3K63A 2CFGA 3NQYA 4KZ1A 1VQN3 4FMDA 2XFTA 5AI1A 5IERA 3NBBA 2D42A 4J8TA 4NHFA 3NV0A 3MG3A 3X41A 1TUHA 3B8LA 1Q824 1JRQA 1ISKA 5BVBA 1DYUA 3OX9A 3KIIA 2HMJB 1MNLA 2LQVA 7STDA 1GY6A 3M8CA 5A0OB 4L8OA 3BB9A 3LTCA 1GS3A 1YI23 1Q42A 2IUJA 3OWYA 3F8XA 1SQWA 1IK3A 2I9WA 3U1WA 4RNYA 5AIGA 1QVF2 3NM7A 1OACA 2OTJ3 2ZDJA 1Q864 1Y4KA 3RGRA 3ALAA 3CC23 1TFOA 1UUWB 1HU9A 2Z76A 3CC73 3KKGA 3QRDA 2Y74A 3CPOA 1O7PB 4X2OA 3WOEB 1VQ83 3V99A 1IT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZT A;  3GZR A;  3SED A;  4R1K A;  2F86 B;  3A76 A;  3NHX A;  3F14 A;  2RGQ A;  4HVN A;  5DRE A;  3LZA A;  2K54 A;  2INX A;  3ER7 A;  8CHO A;  1W6Y A;  3VGN A;  3DM8 A;  4XBX A;  3GZB A;  4XB5 A;  1W01 A;  4WYK A;  4OUQ A;  2BMQ B;  3JUP A;  3S5C A;  1TP6 A;  3EHC A;  5D81 A;  3GRD A;  5D83 A;  3K0Z A;  1JKG A;  3G0K A;  5KP3 A;  4FCJ A;  3B7C A;  4H3U A;  1AR0 A;  3OXA A;  4R9L A;  5CLK A;  3CNM A;  3UNL A;  4XDW A;  5IG3 A;  5IEP A;  1OHP A;  3NV0 B;  1ULJ B;  4I4K A;  3EX9 A;  2GBW B;  3H51 A;  5KP1 A;  1ASK A;  5AEU B;  3JUN A;  3G8Z A;  4STD A;  1BUQ A;  3JUM A;  3EN1 B;  4CDL A;  4IIA A;  3MYT A;  2F98 A;  1QMA A;  2UX0 A;  5IF6 A;  2RCD A;  3EBT A;  1QJG A;  2B1X B;  4R9K A;  3IPT A;  3T8N A;  3ECF A;  1VZZ A;  2HMO B;  1O7M B;  3MG2 A;  5JPU A;  1OCV A;  1ZX2 A;  3NXJ A;  3GWR A;  4HZB B;  5CF1 A;  4HM7 B;  3SOA A;  3DUK A;  3FH1 A;  1U5O A;  3SOY A;  1O7N B;  1Q40 A;  5TGN A;  1O7W B;  3Q90 A;  5STD A;  1HKX A;  3EBY A;  4WYK B;  3DZL A;  3EF8 A;  2HMN B;  3D9R A;  3JUQ A;  5IG5 A;  5EVH A;  2W2C A;  2HML B;  2OWP A;  2HMM B;  1JKG B;  4Q53 A;  3FGY A;  3H3H A;  4WP5 A;  5FW5 A;  1OHO A;  3FF2 A;  3F9S A;  3GZX B;  5KP4 A;  1C7H A;  3FLJ A;  1O7G B;  2STD A;  4XDV A;  3EN8 A;  3UJM A;  3DMC A;  2BNG A;  1JN5 A;  4L7K A;  2YFJ B;  4GB5 A;  1STD A;  1E97 A;  5DRV A;  4J9A A;  5IG0 A;  1Z1S A;  1WQL B;  2F99 A;  3MSO A;  5G2G A;  3MKI A;  4ORL A;  1E3R A;  1S5A A;  3F7S A;  3FZW A;  1NU3 A;  3GZY B;  4HM5 B;  3CU3 A;  3MHE A;  3OWU A;  2GEY A;  2BMO B;  2YFL B;  1CQS A;  1OHS A;  1DMN A;  3EQQ B;  4N3V A;  2Z77 A;  3STD A;  4RZM A;  2R4I A;  3T8U A;  2CKF B;  1W00 A;  4X2H A;  3G16 A;  5JPP A;  4HM4 B;  1EG9 B;  3E99 A;  1O7H B;  4HM6 B;  2XSO B;  1Q40 B;  2JQ5 A;  1SJW A;  4HM8 B;  4L8P A;  3LYG A;  6STD A;  5CXO A;  5AIF A;  3K7C A;  1OGX A;  2XRX B;  4XBT A;  1A2K A;  5IG4 A;  1UUV B;  4HM1 B;  1ULI B;  2BMR B;  3I0Y A;  2HMK B;  3MG1 A;  3HX8 A;  3NM2 A;  1OF5 A;  3F40 A;  1JB4 A;  3EJV A;  3DXO A;  4XBY A;  4U13 A;  3WMD A;  1OUN A;  5D82 A;  4HM0 B;  4FCM A;  1JN5 B;  3F7X A;  4MJD A;  4LEH A;  2GXF A;  3B4O A;  2CHC A;  3NUV A;  3B4P A;  3NBR A;  3ROB A;  1EA2 A;  3CNX A;  3KE7 A;  1GY7 A;  4XM4 A;  3FKA A;  2XSH B;  2RFR A;  3RGA A;  1GYB A;  1GY5 A;  3HK4 A;  1K41 A;  5IEN A;  5IEO A;  3F8H A;  2QGU A;  5CK6 A;  4K1V A;  1NDO B;  1OPY A;  5BXQ A;  1IDP A;  2GBX B;  4OVM A;  1W02 A;  2XR8 B;  2IMJ A;  2Z7A A;  5AIH A;  1E3V A;  4K1U A;  4HKV B;  5AEW B;  4HM3 B;  3BLZ A;  4LGQ A;  1NWW A;  3VSY A;  2PZV A;  1ZO2 A;  1JB2 A;  2GEX A;  2QIY A;  1DMQ A;  4PEJ A;  4HJL B;  4WWU C;  4LMI A;  1JB5 A;  1DMM A;  4HZ9 B;  2A15 A;  3KSP A;  3FF0 A;  2YFI B;  2B24 B;  4KVH A;  3OV4 A;  5CF2 A;  3HZP A;  1OH0 A;  4HM2 B;  3JUO A;  1OF5 B;  1OGZ A;  3EC9 A;  3FSD A;  3OWS A;  5AII A;  5HGR A;  5AI1 A;  5IER A;  4J8T A;  3NV0 A;  3MG3 A;  1TUH A;  3B8L A;  1ISK A;  5BVB A;  3OX9 A;  2HMJ B;  7STD A;  1GY6 A;  3M8C A;  4L8O A;  3BB9 A;  1GS3 A;  1Q42 A;  3OWY A;  3F8X A;  2I9W A;  5AIG A;  3RGR A;  1UUW B;  2Z76 A;  3KKG A;  3CPO A;  1O7P B;  4X2O A; 
#chains in the Genus database with same CATH topology
 3KZT A;  4R4K A;  3GZR A;  1IV7 A;  3SED A;  4R1K A;  2F86 B;  2W6J H;  2CIU A;  1Q9E A;  3LML A;  3CPW 2;  1KSI A;  1Q7Y 4;  2P0M A;  7GSP A;  3D4A A;  3PZW A;  1BAN A;  1B21 A;  2CG0 A;  2P05 A;  3AGN A;  3A76 A;  5EQL A;  5RNT A;  3NHX A;  1B2S A;  3F14 A;  1FUW A;  1TTO A;  1US1 A;  2CWU A;  2KF4 A;  4IT7 A;  5G1K A;  5I97 A;  2RGQ A;  3CCR 3;  1UUG B;  4N6V 0;  3SX1 A;  2KXG A;  4HVN A;  3NX0 A;  1ZGX A;  4R80 A;  5DRE A;  3LZA A;  2L4V A;  1RJO A;  1KC8 4;  2AAD A;  3PYJ A;  2K54 A;  4BTX A;  2INX A;  1IQ8 A;  3ER7 A;  5AYS C;  2CFD A;  1FGT A;  2MC8 A;  3SLU A;  1GOY A;  1WMN A;  1J2B A;  8CHO A;  1RGE A;  4EV5 A;  3X3X A;  4J5G A;  1QAF A;  1W6Y A;  1BNS A;  2Y73 A;  3KCH A;  1PY3 A;  2ML5 A;  1BGS A;  1X1U A;  2CW9 A;  3VGN A;  2IY2 A;  3DM8 A;  3X40 A;  1C54 A;  4XBX A;  3CCJ 3;  3GZB A;  4XB5 A;  1N5P A;  3X3Z A;  1AVL A;  1RNB A;  1W01 A;  4WYK A;  3AMO A;  1PYL A;  1AQZ A;  1SIH A;  5BIR A;  1V58 A;  1BNJ A;  4OUQ A;  1W6C A;  2BMQ B;  3JUP A;  1W2Z A;  3S5C A;  1TP6 A;  4JF8 A;  2GU1 A;  3LT8 A;  3EHC A;  2E2V A;  3GRD A;  5D81 A;  4HAA A;  5D83 A;  2CG1 A;  1JJ2 2;  3K0Z A;  3BNE A;  4N6N B;  1QAK A;  4N6M A;  1JKG A;  2WGQ A;  1VQ4 3;  3G0K A;  5KP3 A;  4KT3 B;  4FCJ A;  1RSN A;  3B7C A;  4H3U A;  3OW2 2;  1B27 A;  3MWZ A;  1LOV A;  1AR0 A;  1UI8 A;  3O8Y A;  3OXA A;  3PGB A;  4R9L A;  5CLK A;  3N9H A;  1I2F A;  4BU4 A;  1G96 A;  1T2H A;  3CNM A;  1RLS A;  1BNE A;  4XDW A;  3UNL A;  4GL6 A;  5IG3 A;  1OHP A;  3NV0 B;  1ULJ B;  1JV2 B;  5IEP A;  4I4K A;  1ROV A;  2CWV A;  3LXU X;  3EX9 A;  4EXR A;  1V74 A;  2XEP A;  4HBR A;  1TJD A;  2GBW B;  2R41 A;  1IYY A;  3H51 A;  5KP1 A;  1ASK A;  2E2T A;  5G1L A;  4N6T A;  4EYC A;  1LXE A;  3CME 3;  3Q1C A;  5AEU B;  1YIJ 3;  4TX4 A;  1JZD A;  1RGH A;  2Z6B A;  3KSE D;  3JUN A;  1VQ5 3;  1IVX A;  4DKI A;  2L1S A;  3DGL A;  3G8Z A;  4STD A;  1EQK A;  1UDI I;  1BUQ A;  2OOV A;  3JUM A;  3EN1 B;  1CYV A;  4CDL A;  2FNQ A;  2OOV C;  2IYJ A;  4IIA A;  3MYT A;  3WOF B;  1WTH A;  1DVC A;  4O2H A;  4K90 B;  2F98 A;  1QMA A;  4RNT A;  3SXX A;  2W04 A;  3LTA A;  2UX0 A;  5IF6 A;  2RCD A;  3EBT A;  1B2U A;  3HOH A;  1QJG A;  2B1X B;  3BNB A;  3WA3 A;  4R9K A;  2Q07 A;  1A2P A;  3IPT A;  1LOY A;  1PU4 A;  3LOY A;  1RN7 A;  3I55 3;  4O3V A;  3T8N A;  3ECF A;  3LT9 A;  1VZZ A;  2HMO B;  3EE1 A;  1BRH A;  1O7M B;  5ELU A;  1KD1 4;  3BIR A;  2V1L A;  3MG2 A;  4I5Q A;  7RNT A;  1GOV A;  1W4N A;  5JPU A;  1DE3 A;  1LNI A;  2W03 A;  1N8Q A;  1OCV A;  1ZX2 A;  3DY5 A;  2WO0 A;  3NXJ A;  3GWR A;  1STF I;  2W9P A;  4HZB B;  5CF1 A;  1BRG A;  4HM7 B;  3V92 A;  4IPB A;  3SOA A;  3DUK A;  3FH1 A;  1LRA A;  1MWR A;  1RHL A;  1U5O A;  4J5K A;  3SOY A;  3G6E 3;  2F5M A;  1IVV A;  1YJW 3;  1BRK A;  2F5W A;  1I2E A;  2XFS A;  3G71 3;  1O7N B;  1S72 3;  1Q40 A;  1IQY A;  1LNH A;  1GOU A;  3AHW A;  3SYU A;  2SAR A;  1BRI A;  5TGN A;  1AVK A;  1O7W B;  3Q90 A;  3ZG0 A;  3CXC 2;  2BT3 A;  2C11 A;  1TRP A;  2BIR A;  3IJE B;  3LH4 A;  3MPH A;  5STD A;  1RN4 A;  3WDG B;  1X1X A;  1HKX A;  1A90 A;  1BU4 A;  3EBY A;  3AMO B;  4O02 B;  1ROA A;  4WYK B;  3RNT A;  1MOL A;  1YJN 3;  3DZL A;  3EF8 A;  1YVB I;  2C4B A;  4N6L A;  2HMN B;  3D9R A;  4G1M B;  3JUQ A;  5IG5 A;  5EVH A;  1A67 A;  4WHA A;  1B2Z A;  2HML B;  2OWP A;  2PNC A;  2UGI A;  2HMM B;  2W2C A;  2O3O A;  3CCU 3;  1VQ6 3;  1VQ7 3;  1WNH A;  2HOH A;  3CCV 3;  1FW7 A;  1JKG B;  4Q53 A;  1RGL A;  3FGY A;  2OCT A;  3H3H A;  1LQG C;  1EUI C;  4K61 A;  4QWT A;  4RBN A;  4WP5 A;  5FW5 A;  4OK0 A;  1UGH I;  3ZFZ A;  1A2V A;  1KQS 2;  2ZA4 A;  2XH9 A;  1OHO A;  1IU7 A;  2QA4 3;  1YNV X;  3FG3 A;  1HZ1 A;  3FF2 A;  1EKM A;  3F9S A;  2IUK A;  1FGR A;  2XGL A;  3GZX B;  3GAX A;  3S27 A;  5KP4 A;  1C7H A;  1VQM 3;  4WFO A;  1I2G A;  3FLJ A;  5BU4 A;  3IMA B;  1IV9 A;  4EBG A;  1O7G B;  2STD A;  1T2I A;  4XDV A;  3TDG A;  3WHO A;  1I0X A;  5ELJ A;  3EN8 A;  3PS8 A;  5AYR B;  1NO3 A;  3FG4 A;  8RNT A;  3UJM A;  3DMC A;  2BNG A;  1JN5 A;  3QK9 A;  1NB3 I;  4L7K A;  2P38 A;  5JBS A;  3U97 A;  2QEX 3;  6GSP A;  2SBL A;  3D5G A;  2YFJ B;  4GB5 A;  2H0H A;  1SPU A;  1STD A;  1JBR A;  3WA2 X;  3S28 A;  1E97 A;  5DRV A;  4J9A A;  1QAL A;  2CFK A;  5IG0 A;  3PXM A;  3VF1 A;  1Z1S A;  3BNC A;  2E2U A;  1WQL B;  3J7Y d;  2F99 A;  3MSO A;  4ZM8 A;  3K9M C;  3MKI A;  5G2G A;  4ORL A;  3D3L A;  3SVA A;  1E3R A;  1I3F A;  1TRQ A;  2C10 A;  1S5A A;  1FGQ A;  3F7S A;  1RGA A;  3FZW A;  3LTB A;  4BL3 A;  1NU3 A;  2KF5 A;  4H61 A;  1YJ9 3;  2RNT A;  3GZY B;  4HM5 B;  1UGI A;  1BNG A;  3CU3 A;  3DGN A;  3MHE A;  4AEQ A;  3OWU A;  2GEY A;  4HYZ A;  3CD6 3;  1N9J A;  1VQ9 3;  3AHS A;  2BMO B;  1VQQ A;  4FMA A;  2BO9 B;  2YFL B;  1SII A;  3G4S 3;  1YIT 3;  2FGT A;  4LYL B;  1BRS A;  1BSD A;  1CQS A;  1DET A;  1G0T A;  3GSP A;  1L5G B;  1K8A 4;  3NQZ A;  2CH9 A;  2CFW A;  1OHS A;  1MWT A;  1YGE A;  3HIG A;  1GSP A;  3CCM 3;  1JBT A;  1DMN A;  3JVC A;  3EQQ B;  2H0G A;  2ZHX B;  4N3V A;  2Z77 A;  3STD A;  4RZM A;  2R4I A;  3T8U A;  3EB8 A;  4N6O B;  2MF7 A;  1VQK 3;  1IT7 A;  2CKF B;  1W00 A;  5M19 A;  4FR9 A;  4X2H A;  1RGK A;  1EEJ A;  3K5T A;  2K3D A;  1RMS A;  1K73 4;  3G16 A;  5JPP A;  4HM4 B;  1EG9 B;  3E99 A;  1O7H B;  4HM6 B;  1IQX A;  1TIJ A;  2XSO B;  1RKY A;  2J8X B;  1KWI A;  1JZO A;  1Q40 B;  4LZI A;  5HOH A;  2LYX A;  2JQ5 A;  1F8N A;  3DGO A;  4FMC A;  2K0M A;  3V98 A;  1SJW A;  1N8R 4;  1R4C A;  1B3S A;  3CCQ 3;  4HM8 B;  3URP A;  3BND A;  4L8P A;  3LYG A;  6STD A;  3PCS A;  2XF3 A;  4MMZ B;  5CXO A;  1I70 A;  4KFD A;  1FGM A;  1Q7H A;  1TU5 A;  5AIF A;  3K7C A;  1K9M 4;  1GMQ A;  3CCE 3;  1OGX A;  2XRX B;  1MGW A;  1A2K A;  4XBT A;  3T0U A;  5IG4 A;  3CCS 3;  1LVN A;  2RBI A;  1UUV B;  4HM1 B;  4EC6 A;  4O8S A;  5EEO A;  1RCK A;  1ULI B;  2JDI H;  3KN4 A;  2CFL A;  2BMR B;  1BNR A;  1GMP A;  3I0Y A;  3BU4 A;  3N8B A;  1JNQ A;  1RGC A;  2BU4 A;  4LSO A;  3WOD G;  1W5Z A;  1RRH A;  2HMK B;  1PFP A;  3MG1 A;  3HX8 A;  1U8C B;  3NM2 A;  1OF5 A;  3F40 A;  2F56 A;  1JB4 A;  3EJV A;  3DXO A;  3ZG5 A;  1YHQ 3;  1BSC A;  4XBY A;  1W6G A;  3DGM A;  3WR2 A;  3Q2P A;  4FMB A;  4U13 A;  4RNZ A;  1GD3 A;  2RSX A;  3Q3F A;  2O9U X;  3WMD A;  1RRL A;  2GU3 A;  5IW9 A;  1W7C A;  1OUN A;  2ZL8 A;  2KCD A;  2YX9 A;  2UUG C;  4HM0 B;  3N54 B;  5D82 A;  4AKY A;  1NJI 4;  4FCM A;  1JN5 B;  2OQE A;  2KF3 A;  3F7X A;  2KRT A;  1M1X B;  4LEH A;  2WOH A;  4MJD A;  1BVI A;  2GXF A;  2OQE C;  5FGO A;  3B4O A;  3D79 A;  4EV2 A;  1FYS A;  2CHC A;  3NUV A;  1B2M A;  2W56 B;  3PCR A;  4GHO A;  4ILF A;  1X1W A;  1UCK A;  3UB1 A;  1SAR A;  1K28 A;  3HI7 A;  1BSA A;  3B4P A;  2P09 A;  4HOH A;  3UL5 A;  3NBR A;  3ROB A;  1EA2 A;  5LC7 A;  3CNX A;  4CCV A;  2W9Q A;  9RNT A;  1VQL 3;  3KE7 A;  1GY7 A;  4KFE A;  3L0R A;  1QVG 2;  4XM4 A;  1M1K 4;  3FKA A;  1CH0 A;  1T3B A;  3FG1 A;  2XSH B;  2RFR A;  4JRF A;  5M1A A;  3RGA A;  1BOX A;  1GYB A;  1BNF A;  1GY5 A;  4FCZ A;  2M7O A;  3HK4 A;  1K41 A;  1RNT A;  4CPK A;  5IEN A;  5IEO A;  1VQO 3;  1NNV A;  2WOF A;  3F8H A;  3X42 A;  2QGU A;  1JBS A;  2W0Q A;  5CK6 A;  1FA3 A;  4K1V A;  5LC6 A;  1IVW A;  1NDO B;  1D6U A;  1FGO A;  2BHM A;  1AY7 A;  1OPY A;  2GSP A;  1D6Y A;  2W56 A;  1IDP A;  1IVU A;  5BXQ A;  3I56 3;  2GBX B;  1CYU A;  1RTU A;  4OVM A;  3CMA 3;  1IT8 A;  3CC4 3;  4BIR A;  3DH2 A;  4NRE A;  4BTY A;  1W02 A;  3UL6 A;  2XR8 B;  3NBJ A;  2IMJ A;  2Z7A A;  2OTL 3;  5AIH A;  1E3V A;  1UI7 A;  4K1U A;  4MEI A;  4HKV B;  1NB5 I;  1DVD A;  3LTD A;  1MGR A;  1UCJ A;  5AEW B;  3KFQ C;  1UCI A;  1HYF A;  2F4Y A;  1TFK A;  4HM3 B;  3BLZ A;  4LGQ A;  1WMO A;  1NWW A;  1RN1 A;  1N5H A;  2CX0 A;  2WGO A;  3VSY A;  2PZV A;  1B20 A;  1UW1 A;  1ZO2 A;  1JB2 A;  2GEX A;  1BSE A;  2QIY A;  4N6U A;  1RGG A;  1DMQ A;  2ML6 A;  3S67 A;  4PEJ A;  4HJL B;  1N9E A;  4BTW A;  1T5Y A;  4WWU C;  4LMI A;  1JB5 A;  4BL2 A;  1LQM B;  4KFF A;  1BRJ A;  1DMM A;  1UCL A;  1D6Z A;  1BSB A;  3S29 A;  1LOX A;  2CK3 H;  1GMR A;  4HZ9 B;  2A15 A;  3CCL 3;  1V57 A;  3HII A;  1CEW I;  4AKZ A;  2CC3 A;  3FCS B;  3RDE A;  3KSP A;  1BAO A;  4MMY B;  1BUJ A;  3FF0 A;  2YFI B;  2B24 B;  1R4Y A;  3OV4 A;  4KVH A;  4MMX B;  3X3Y A;  5CF2 A;  1M90 4;  1RCL A;  1I8V A;  2KAA A;  2FXT A;  2D1W A;  2CWT A;  1GD4 A;  2XGN A;  3HZP A;  1X1Y A;  1W2B 2;  1OH0 A;  4HM2 B;  6RNT A;  3JUO A;  5M18 A;  1OF5 B;  1OGZ A;  1Q81 4;  1WMP A;  2IA7 A;  2H0I A;  1M9G A;  2P0X A;  1FUS A;  3EC9 A;  3FSD A;  1AV4 A;  1VQP 3;  1I3I A;  4GSP A;  3OWS A;  5AII A;  5HGR A;  3K63 A;  2CFG A;  3NQY A;  4KZ1 A;  5GSP A;  1VQN 3;  4FMD A;  2XFT A;  5AI1 A;  5IER A;  3NBB A;  2D42 A;  4J8T A;  4NHF A;  3A5E A;  4NPB A;  1LOW A;  2CX1 A;  4CJN A;  3NV0 A;  3MG3 A;  3X41 A;  1TUH A;  3B8L A;  1Q82 4;  1JRQ A;  1ISK A;  5BVB A;  1YGW A;  1RDS A;  1BIR A;  1DYU A;  3OX9 A;  3KII A;  2HMJ B;  1RGF A;  1MWU A;  1BRN L;  1MNL A;  1G02 A;  2LQV A;  7STD A;  1GY6 A;  3M8C A;  5A0O B;  4L8O A;  3BB9 A;  3LTC A;  1GS3 A;  3AGO A;  1YI2 3;  1Q42 A;  2IUJ A;  1ZS7 A;  2KF6 A;  3OWY A;  1BNI A;  3F8X A;  4EW5 A;  1SQW A;  1IK3 A;  2I9W A;  3U1W A;  4RNY A;  5AIG A;  2AAE A;  1QVF 2;  3NM7 A;  1OAC A;  2OTJ 3;  2ZDJ A;  1Q86 4;  1FUT A;  1Y4K A;  3RGR A;  3D5I A;  3ALA A;  3CC2 3;  1TFO A;  1UUW B;  1HU9 A;  2Z76 A;  1YVS A;  3CC7 3;  1MWS A;  3KKG A;  3QRD A;  1I0V A;  3DGY A;  1B2X A;  2Y74 A;  3CPO A;  1O7P B;  4X2O A;  3WOE B;  1VQ8 3;  3V99 A;  1FZU A; 
#chains in the Genus database with same CATH homology
 3KZT A;  4R4K A;  3GZR A;  1IV7 A;  3SED A;  4R1K A;  2F86 B;  2W6J H;  2CIU A;  3LML A;  3CPW 2;  1KSI A;  1Q7Y 4;  2P0M A;  3PZW A;  2CG0 A;  2P05 A;  3A76 A;  5EQL A;  3NHX A;  3F14 A;  1FUW A;  1US1 A;  2CWU A;  4IT7 A;  5I97 A;  2RGQ A;  3CCR 3;  4N6V 0;  3SX1 A;  2KXG A;  4HVN A;  3NX0 A;  4R80 A;  5DRE A;  3LZA A;  2L4V A;  1RJO A;  1KC8 4;  3PYJ A;  2K54 A;  4BTX A;  2INX A;  1IQ8 A;  3ER7 A;  5AYS C;  2CFD A;  1FGT A;  2MC8 A;  3SLU A;  1WMN A;  1J2B A;  8CHO A;  4EV5 A;  3X3X A;  1QAF A;  1W6Y A;  2Y73 A;  2ML5 A;  2CW9 A;  3VGN A;  3DM8 A;  3X40 A;  4XBX A;  3CCJ 3;  3GZB A;  4XB5 A;  1N5P A;  3X3Z A;  1AVL A;  1W01 A;  4WYK A;  3AMO A;  1SIH A;  4OUQ A;  1W6C A;  2BMQ B;  3JUP A;  1W2Z A;  3S5C A;  1TP6 A;  4JF8 A;  2GU1 A;  3LT8 A;  3EHC A;  2E2V A;  3GRD A;  5D81 A;  1JJ2 2;  5D83 A;  2CG1 A;  3K0Z A;  3BNE A;  4N6N B;  1QAK A;  4N6M A;  1JKG A;  2WGQ A;  1VQ4 3;  3G0K A;  5KP3 A;  4FCJ A;  3B7C A;  4H3U A;  3OW2 2;  3MWZ A;  1AR0 A;  1UI8 A;  3O8Y A;  3OXA A;  3PGB A;  4R9L A;  5CLK A;  3N9H A;  1G96 A;  3CNM A;  3UNL A;  4XDW A;  4GL6 A;  5IG3 A;  1OHP A;  3NV0 B;  1ULJ B;  1JV2 B;  5IEP A;  4I4K A;  1ROV A;  2CWV A;  3LXU X;  3EX9 A;  4EXR A;  1V74 A;  2XEP A;  4HBR A;  2GBW B;  3H51 A;  5KP1 A;  1ASK A;  2E2T A;  4N6T A;  4EYC A;  1LXE A;  3CME 3;  3Q1C A;  5AEU B;  1YIJ 3;  4TX4 A;  2Z6B A;  3KSE D;  3JUN A;  1VQ5 3;  1IVX A;  1EQK A;  3DGL A;  3G8Z A;  4STD A;  1BUQ A;  2OOV A;  3JUM A;  3EN1 B;  1CYV A;  4CDL A;  2FNQ A;  2OOV C;  4IIA A;  3MYT A;  3WOF B;  1WTH A;  1DVC A;  4O2H A;  4K90 B;  2F98 A;  1QMA A;  3SXX A;  2W04 A;  3LTA A;  2UX0 A;  5IF6 A;  2RCD A;  3EBT A;  1QJG A;  2B1X B;  3BNB A;  3WA3 A;  4R9K A;  2Q07 A;  3IPT A;  1PU4 A;  3LOY A;  1RN7 A;  3I55 3;  4O3V A;  3T8N A;  3ECF A;  3LT9 A;  1VZZ A;  2HMO B;  3EE1 A;  1KD1 4;  1O7M B;  5ELU A;  2V1L A;  3MG2 A;  5JPU A;  1W4N A;  2W03 A;  1N8Q A;  1OCV A;  1ZX2 A;  3DY5 A;  2WO0 A;  3NXJ A;  3GWR A;  1STF I;  2W9P A;  4HZB B;  5CF1 A;  4HM7 B;  3V92 A;  4IPB A;  3SOA A;  3DUK A;  3FH1 A;  1U5O A;  3G6E 3;  3SOY A;  1IVV A;  1YJW 3;  2XFS A;  3G71 3;  1O7N B;  1Q40 A;  1IQY A;  1LNH A;  5TGN A;  1AVK A;  1O7W B;  3Q90 A;  3CXC 2;  2BT3 A;  2C11 A;  3IJE B;  3LH4 A;  3MPH A;  5STD A;  3WDG B;  1HKX A;  1A90 A;  3EBY A;  3AMO B;  4O02 B;  1ROA A;  4WYK B;  1YJN 3;  1MOL A;  3DZL A;  3EF8 A;  1YVB I;  4N6L A;  2HMN B;  3D9R A;  4G1M B;  3JUQ A;  5IG5 A;  5EVH A;  1A67 A;  4WHA A;  2W2C A;  2OWP A;  2HML B;  2PNC A;  2HMM B;  2O3O A;  3CCU 3;  1VQ6 3;  1VQ7 3;  1WNH A;  3CCV 3;  1JKG B;  4Q53 A;  3FGY A;  3H3H A;  2OCT A;  4K61 A;  4QWT A;  4RBN A;  4WP5 A;  5FW5 A;  1S72 3;  4OK0 A;  1A2V A;  1KQS 2;  2XH9 A;  1OHO A;  1IU7 A;  2QA4 3;  3FG3 A;  3FF2 A;  1EKM A;  3F9S A;  2IUK A;  1FGR A;  2XGL A;  3GZX B;  3GAX A;  3S27 A;  5KP4 A;  1C7H A;  1VQM 3;  4WFO A;  3FLJ A;  3IMA B;  1IV9 A;  4EBG A;  1O7G B;  2STD A;  4XDV A;  3TDG A;  5ELJ A;  3EN8 A;  3PS8 A;  5AYR B;  1NO3 A;  3FG4 A;  3UJM A;  3DMC A;  2BNG A;  1JN5 A;  3QK9 A;  1NB3 I;  4L7K A;  2P38 A;  2QEX 3;  3U97 A;  2SBL A;  2YFJ B;  4GB5 A;  1SPU A;  1STD A;  3WA2 X;  3S28 A;  1E97 A;  5DRV A;  4J9A A;  1QAL A;  2CFK A;  5IG0 A;  3PXM A;  3VF1 A;  1Z1S A;  3BNC A;  2E2U A;  1WQL B;  3J7Y d;  2F99 A;  3MSO A;  4ZM8 A;  3K9M C;  3MKI A;  5G2G A;  4ORL A;  3D3L A;  3SVA A;  1E3R A;  2C10 A;  1S5A A;  1FGQ A;  3F7S A;  3FZW A;  3LTB A;  1NU3 A;  4H61 A;  1YJ9 3;  3GZY B;  5JBS A;  4HM5 B;  3CU3 A;  3DGN A;  3MHE A;  4AEQ A;  3OWU A;  2GEY A;  4HYZ A;  3CD6 3;  1N9J A;  1VQ9 3;  2BMO B;  4FMA A;  2YFL B;  2BO9 B;  1SII A;  3G4S 3;  1YIT 3;  2FGT A;  1CQS A;  1L5G B;  1K8A 4;  3NQZ A;  2CH9 A;  2CFW A;  1OHS A;  1YGE A;  3HIG A;  3CCM 3;  1DMN A;  3JVC A;  3EQQ B;  4N3V A;  2Z77 A;  3STD A;  4RZM A;  2R4I A;  3T8U A;  3EB8 A;  4N6O B;  2MF7 A;  1VQK 3;  2CKF B;  1W00 A;  4FR9 A;  4X2H A;  3K5T A;  1K73 4;  3G16 A;  5JPP A;  4HM4 B;  1EG9 B;  3E99 A;  1O7H B;  4HM6 B;  1IQX A;  1TIJ A;  2XSO B;  1RKY A;  1KWI A;  1Q40 B;  4LZI A;  2LYX A;  2JQ5 A;  1F8N A;  3DGO A;  4FMC A;  2K0M A;  3V98 A;  1SJW A;  1N8R 4;  1R4C A;  3CCQ 3;  4HM8 B;  3BND A;  4L8P A;  3LYG A;  6STD A;  3PCS A;  2XF3 A;  4MMZ B;  5CXO A;  4KFD A;  1FGM A;  1TU5 A;  5AIF A;  3K7C A;  1K9M 4;  3CCE 3;  1OGX A;  2XRX B;  4XBT A;  1A2K A;  3T0U A;  5IG4 A;  3CCS 3;  1LVN A;  1UUV B;  4HM1 B;  4EC6 A;  4O8S A;  5EEO A;  1ULI B;  2JDI H;  3KN4 A;  2CFL A;  2BMR B;  3I0Y A;  3N8B A;  1JNQ A;  4LSO A;  3WOD G;  1W5Z A;  1RRH A;  2HMK B;  1PFP A;  3MG1 A;  3HX8 A;  1U8C B;  3NM2 A;  1OF5 A;  3F40 A;  1JB4 A;  3EJV A;  3DXO A;  1YHQ 3;  4XBY A;  1W6G A;  3DGM A;  3Q2P A;  4FMB A;  4U13 A;  4RNZ A;  1GD3 A;  2RSX A;  3WMD A;  2O9U X;  1RRL A;  2GU3 A;  5IW9 A;  1W7C A;  1OUN A;  2ZL8 A;  2KCD A;  2YX9 A;  5D82 A;  4HM0 B;  3N54 B;  4AKY A;  1NJI 4;  4FCM A;  1JN5 B;  2OQE A;  3F7X A;  2KRT A;  1M1X B;  4LEH A;  2WOH A;  4MJD A;  2GXF A;  2OQE C;  5FGO A;  3B4O A;  4EV2 A;  2CHC A;  3NUV A;  2W56 B;  3PCR A;  3UB1 A;  1K28 A;  3HI7 A;  3B4P A;  3UL5 A;  2P09 A;  3NBR A;  3ROB A;  1EA2 A;  5LC7 A;  3CNX A;  4CCV A;  2W9Q A;  1VQL 3;  3KE7 A;  1GY7 A;  4KFE A;  3L0R A;  1QVG 2;  4XM4 A;  1M1K 4;  3FKA A;  4JRF A;  3FG1 A;  2XSH B;  2RFR A;  3RGA A;  1GYB A;  1GY5 A;  4FCZ A;  2M7O A;  3HK4 A;  1K41 A;  5IEN A;  1VQO 3;  5IEO A;  2WOF A;  3F8H A;  3X42 A;  2QGU A;  2W0Q A;  5CK6 A;  1FA3 A;  4K1V A;  5LC6 A;  1IVW A;  1NDO B;  1D6U A;  1FGO A;  2BHM A;  1OPY A;  1D6Y A;  2W56 A;  1IDP A;  1IVU A;  5BXQ A;  3I56 3;  2GBX B;  1CYU A;  4OVM A;  3CMA 3;  1IT8 A;  3CC4 3;  4NRE A;  4BTY A;  1W02 A;  3UL6 A;  2XR8 B;  3NBJ A;  2IMJ A;  2Z7A A;  2OTL 3;  5AIH A;  1E3V A;  1UI7 A;  4K1U A;  4MEI A;  4HKV B;  1NB5 I;  1DVD A;  3LTD A;  5AEW B;  3KFQ C;  1TFK A;  4HM3 B;  3BLZ A;  4LGQ A;  1WMO A;  1NWW A;  3VSY A;  1N5H A;  2WGO A;  2PZV A;  1UW1 A;  1ZO2 A;  1JB2 A;  2GEX A;  2QIY A;  4N6U A;  3S67 A;  1DMQ A;  2ML6 A;  4PEJ A;  4HJL B;  1N9E A;  4BTW A;  1T5Y A;  4WWU C;  4LMI A;  1JB5 A;  4KFF A;  1DMM A;  1D6Z A;  3S29 A;  1LOX A;  2CK3 H;  4HZ9 B;  2A15 A;  3CCL 3;  3HII A;  4AKZ A;  1CEW I;  2CC3 A;  3FCS B;  3RDE A;  3KSP A;  4MMY B;  3FF0 A;  2YFI B;  2B24 B;  4KVH A;  3OV4 A;  4MMX B;  3X3Y A;  5CF2 A;  1M90 4;  2FXT A;  2D1W A;  2CWT A;  1GD4 A;  2XGN A;  3HZP A;  1W2B 2;  1OH0 A;  4HM2 B;  3JUO A;  1OF5 B;  1OGZ A;  1Q81 4;  1WMP A;  2IA7 A;  1M9G A;  2P0X A;  3EC9 A;  3FSD A;  1AV4 A;  1VQP 3;  3OWS A;  5AII A;  5HGR A;  3K63 A;  2CFG A;  3NQY A;  4KZ1 A;  1VQN 3;  4FMD A;  2XFT A;  5AI1 A;  5IER A;  3NBB A;  2D42 A;  4J8T A;  4NHF A;  3NV0 A;  3MG3 A;  3X41 A;  1TUH A;  3B8L A;  1Q82 4;  1JRQ A;  1ISK A;  5BVB A;  1DYU A;  3OX9 A;  3KII A;  2HMJ B;  1MNL A;  2LQV A;  7STD A;  1GY6 A;  3M8C A;  5A0O B;  4L8O A;  3BB9 A;  3LTC A;  1GS3 A;  1YI2 3;  1Q42 A;  2IUJ A;  3OWY A;  3F8X A;  1SQW A;  1IK3 A;  2I9W A;  3U1W A;  4RNY A;  5AIG A;  1QVF 2;  3NM7 A;  1OAC A;  2OTJ 3;  2ZDJ A;  1Q86 4;  1Y4K A;  3RGR A;  3ALA A;  3CC2 3;  1TFO A;  1UUW B;  1HU9 A;  2Z76 A;  3CC7 3;  3KKG A;  3QRD A;  2Y74 A;  3CPO A;  1O7P B;  4X2O A;  3WOE B;  1VQ8 3;  3V99 A;  1IT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...