1V57A

Crystal structure of the disulfide bond isomerase dsbg
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 68
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v57A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v57A03
1T3BA 2MMZA 4ZB6A 1CQGA 2J23A 1V57A 2C0GA 1UVZA 4GQFA 5C00A 5G30A 3J7Yk 1GTAA 2E2MA 4HOJA 4I2TA 5ECOB 1S3AA 2VOCA 1WMJA 3HA9A 2L6CA 3TRPA 1A0FA 3F6DA 3DVXA 1SL1B 3WT2A 3GH9A 4JR6A 5B8AA 3VI7A 3L9SA 3I6AA 4OMVA 3J7Yb 1XPVA 22GSA 1EGRA 2JSZA 1KNGA 2JADA 1SK2A 5DCGA 3WGXA 1YF1A 4K2DA 1F3BA 2HLSA 4KH7A 3F4TA 4K0NA 3C7MA 2GSSA 4HUAA 2V6OA 4JE1A 5CYYA 1GSSA 2MYGA 4TW5A 5HQPA 1F3AA 1URMA 1PX6A 2OE3A 1K0NA 3ISOA 3M1GA 1VF3A 3JCML 2MBTA 1N8JA 1YF0A 1SL2B 2CVKA 2LRTA 14GSA 3F0IA 3F6FA 5GSTA 2XHFA 4QL9A 1EOHA 2VLTA 1X9MB 3EYTA 2LRNA 4KCAA 1ERWA 2PGTA 1WRYA 1GH2A 3L0HA 1GSUA 2IPAA 1FG4A 1ST9A 2CT6A 1PX7A 4GQCA 2GSRA 1V2AA 4TKYA 4PQHA 1NM3A 3MAKA 3F8UA 3KJYA 2B5YA 3LWAA 1A2LA 1SU9A 11GSA 1QGVA 3ZVJD 3LSZA 2LJAA 1JZDA 3QMXA 1V40A 3F4RA 4AJ8A 2EIOA 20GSA 3KXOA 3W8SA 4FYUA 5HR3A 4K7NA 2R4VA 1PMTA 4NWYA 5ABRA 3UL3A 3E3EA 1SYRA 1QUWA 2OJLA 3A2VA 3L4NA 2D2ZA 2GZPA 3KEBA 9GSSA 4GLTA 4ZBBA 1RK4A 2DJ1A 1GTBA 2H1GA 2MBSA 4FYBA 1ZGNA 4OO4A 2GDRA 1K0BA 1YDKA 3GNJA 3GURA 4N0ZA 1SKSB 5H5QA 3ZIJA 4MJEA 5CRDA 4G19A 2QC7A 2OKAA 2E7PA 1H4OA 4KUNA 4POMA 2LNTA 4XS6A 2PVQA 1BG5A 5IMCA 4HU9A 3I9V2 4MJBA 4PURA 3ZITA 3N5OA 2KLXA 3TRQA 3H1NA 1X5EA 2M80A 2JSYA 4K7IA 1PKZA 1O73A 2GSQA 5F0GA 4OFTA 1NHYA 3HYPA 4XIHA 4DSRA 4IQAA 3D22A 4KE3A 5EPFA 2LRCA 4RQRA 1FB6A 4EVMA 4PUAA 3LXTA 2K8VA 2OE1A 4J2FA 1MDJA 1A8LA 1DE2A 3WYWA 1ZYEA 3EURA 4YQUA 3NOFA 2BMXA 1G6YA 4P3YB 10GSA 3TUEA 2H0HA 2N5FA 5IIZA 1XW5A 2FY6A 5F8BA 2J9HA 2AB6A 3GX0A 3BOAA 3MNGA 3UEMA 1PKWA 5CRHA 5AIXA 2YOIA 3C1SA 3TRXA 4F0CA 2GT5A 1XIYA 5AISA 1OE8A 3LG6A 2QKEA 2IMKA 4KB3A 2ZUPA 3UJ1A 1C72A 2G2QA 5B6MA 4IKHA 2DBCA 3HJOA 4WXTA 1TXXA 2IMIA 3KH7A 2LSTA 4V1Ap 3VWXA 3ZFBA 1WJKA 2VLUA 5DDLA 3PR8A 3HY2A 2PN8A 3A2WA 1Z7RA 4KX4A 1M2BA 1THOA 7GSSA 1TU7A 1NW2A 4PX1A 1V9WA 2DC5A 1O8WA 1EEJA 4ZXGA 4Z7XA 2IY2A 5KN3A 3E0UA 4HZ2A 5HR2A 3CBUA 1FVKA 2M46A 3F9UA 1TP9A 4WBJA 3IBHA 2GQKA 3F63A 4PGTA 1MTCA 3U6VA 4OFNA 5G1KA 1XWBA 3EMXA 1OYJA 2V1MA 3QOUA 4L0WA 5F06A 3LXZA 1TU8A 1O85A 2YCDA 2H72A 4O92A 1J08A 2OBIA 3PINA 2OADA 2JZTA 3G7JA 4OO5A 2PMTA 1VRSD 1EP7A 1B48A 2OBKA 2F3MA 2CX3A 1J9BA 5ECNB 1U3AA 4ZB9A 1K0DA 2DIYA 1BJXA 4FYCA 2CZ3A 2YJ7A 1TDIA 2C3NA 1USBA 3UBKA 1B8XA 1G0TA 4EDZA 1EV9A 3VWWA 2X8CA 2C8UA 1XVWA 2FA4A 4L0UA 4FIWA 5LCZA 5J4UA 1O6JA 3ZMKA 1H75A 1ZZYA 2X64A 2N5BA 4TOPA 1ML6A 2L4QA 1R7HA 1Z6NA 2EIQA 3ED3A 1VF2A 2L6DA 3QDNA 1UA5A 5HR1A 5J9CA 4GSTA 4AJ7A 3APSA 2DJ0A 4JRRA 4F0BA 2RIIA 2LV3A 4ZIJA 1T7PB 4CDOA 1SYXA 2YNXA 1TKDB 2L5OA 4MPGA 4IBPA 1QK8A 3DMLA 2GZYA 1S3DA 1PGTA 2F8AA 2TRCP 4KNDA 2V2GA 1GLPA 3EMPA 4I5QA 5F05A 3HKRA 5ENUA 1AC1A 3RHCA 4EUYA 1N2AA 3HZ4A 4KSOA 2YN1A 2A2RA 5D9VA 3ZTLA 5D96A 3LGCA 2VCXA 4YQMA 2FLSA 1W4VA 2GSTA 4YQVA 2C0FA 3O6TA 1TTZA 2C3QA 3UVTA 1K0AA 4NAXA 4NMUA 3FEUA 2H1DA 4RI7A 3KTLA 1KEBA 4ID0A 2K8SA 5ELAA 2MZCA 1S3CA 2VL9A 2NDOA 3MWHA 1XFLA 4GRFA 1AUCA 4EO3A 4F9ZA 4LL4B 5F07A 2VCTA 4IHUA 4V1Ag 1GNWA 1VF4A 2CVBA 2AHEA 1MDIA 3FK8A 3ERFA 3FZ9A 1BYEA 4EF0A 4K1FA 1QQ2A 1TK0B 1M99A 3FHKA 1BQ7A 2HSHA 4N10A 3EE2A 1G7OA 4OCEA 1OKDA 2K9FA 3TJKA 4X1UA 3EU3A 3TKRA 5ID2A 3EWLA 1ILOA 4MLYA 2AUVA 3IHQA 4N0VA 3P90A 4ILFA 2LNSA 2VL2A 4QQ7A 4K0GA 2DJ2A 2C0EA 1HYUA 4XRDA 2WZ9A 1IYIA 2H70A 1SKWB 1X5DA 1JZOA 3GKMA 4N30A 2DJ3A 2VD1A 1DUGA 1ZMAA 2RUFA 4JEDA 2G0FA 3UIWA 3FR3A 5DALA 3VI5A 4ZILA 3RPPA 1LJRA 1Z7PA 1SK0A 4V2MA 5ECPB 3VWUA 3CMIA 3ME8A 1E2YA 3BD2A 4POKA 5KEJA 4ZL7A 2AV4A 5FHIA 5KN0A 3VPQA 2HFDA 3VPTA 3HJMA 5JCUA 2B1LA 4PXOA 3F3QA 2I3YA 3APQA 4TR3A 2CX4A 5KN2A 1U3IA 3GKXA 4LLRA 1VF1A 3FR9A 4JZQA 4RQXA 2TRXA 5DJLA 8GSSA 2CZ2A 17GSA 5B8BA 12GSA 1M9BA 2PU9C 4ML1A 3QR6A 3GTUA 2WDUA 1EGOA 1O7UA 2GVPA 2O8VB 4QL7A 2IFQA 3WGDA 1GLQA 4HS1A 6GSVA 1XBSA 2O7KA 3GHAA 3KCMA 2GT6A 3KP9A 5CRGA 1GL8A 3K8NA 1G6WA 1K3YA 1GSYA 4MJCA 4EKZA 5ID2B 3QCPA 5ECIB 5ECQB 5AIVA 1A8YA 4IVFA 1LU4A 1ACVA 4GXZA 5B6NA 5HR0A 3QAWA 2YPMA 1X9SB 1T4ZA 2HT9A 4BA7A 1GUKA 2B1KA 4TR0A 5J41A 3TJGA 4XS1A 1OE7A 2XBQA 3M9JA 5ELGA 3D21A 4PQ1A 3UMAA 2LQOA 2YANA 3TJBA 1AXDA 1TI3A 3M8NA 3ERGA 2XPDA 1MDKA 2BJXA 4MA9A 2B3SA 4I8BA 3SWLA 4LMWA 3IDVA 4Q5QA 3M9KA 4N11A 5DQSA 1AW9A 3F4SA 2PBJA 4H86A 4Q5FA 3LJRA 2HZEB 1TRSA 1PL2A 2WS2A 18GSA 3ZRDA 4EE0A 2GLRA 3UOMA 1GTUA 4TVEA 3FRCA 5FWGA 4IELA 4DVCA 1TOFA 5AN1A 1GSDA 3CSIA 4XCSA 4WR5A 4WEYA 3GIXA 2RLIA 2WFCA 4WF4A 3C71A 4YAVA 4NHWA 3C8EA 5ECHB 2H30A 5CNWA 3A5WA 3IC4A 2IL3A 3L9VA 2IFQB 4LA1A 3UARA 2VCVA 1NSWA 2X99A 3KMOA 4MJAA 1JFUA 3WD6A 3NIVA 3W6GA 5JWRB 4EXJA 1MEKA 2L4CA 2LQQA 2VCWA 4MMMA 3LFLA 5DJMA 2P5QA 19GSA 2NPBA 2ZNMA 1NHOA 3D0ZA 2VD0A 1EV4A 1DSBA 1XW9A 1WP0A 4JBBA 2B7KA 2YV7A 1O81A 1Z6MA 2F8FA 4TRXA 2VL3A 4XRAA 3ERWA 1SJ6A 2YWIA 2EC4A 2CV4A 4ZBDA 1U87A 3C1RA 4EC0A 3TKQA 2VCZA 4ULXA 5EVOA 4NV2A 3GRXA 5A4UA 4WETA 5KN1A 2YZUA 1THXA 1XOBA 6GSWA 4IW9A 2A2SA 4BL7A 2IIYA 4WKWA 1HNBA 4IN0A 3M3MA 2VUPA 2IN3A 3KGKA 5HFKA 1GRXA 1T8EB 1ON4A 3BJ5A 1XOAA 1YEPA 3GFKA 1T1VA 2CQ9A 1ABAA 2PWJA 5CREA 3OR5A 3VURA 1LBKA 3GL3A 5DCHA 5IMDA 4KAEA 2H8LA 5JCWA 3AY8A 1TK8B 1OKTA 2H0IA 3RPNA 1XWCA 1RQMA 4E8HA 3KIJA 1TRVA 4GWRA 5HFGA 1MD4A 2IMDA 5IMAA 2WRTA 3LORA 5DALB 3GV1A 6GSTA 2HYXA 3GN3A 3HVXA 4X43A 3I69A 4OD7A 1EWXA 2P31A 4DSSB 2WGRA 3IE3A 1DBYA 2NBSA 2LTKA 5D9XA 2CVDA 1TRWA 2YP6A 4F2IA 4ECJA 2WULA 5L71A 16GSA 2I9HA 1GSEA 1QFNA 3U5RE 5ECMB 3H93A 2MMNA 1XVQA 4LL1B 2V32A 2XBIA 1YZXA 2V6KA 1HNAA 3GKKA 1ZYQB 4ZBAA 5ECLB 3QFBC 3CRTA 2LEGA 1XWGA 2H6ZA 1ZL9A 3G7IA 5JCGA 2AYTA 1XWAA 3HVSA 2OA7A 6GSSA 2GQLA 3DEXA 3W8JA 4TXVA 3IRAA 3D5JA 1FO5A 3FYGA 3KD0A 2YWMA 2IYJA 1X9WB 1J0FA 4GSSA 1B9XC 2AJQB 2O85A 4IJIA 1FB0A 4I2UA 5CP1A 2GS3A 1DE1A 1TW9A 4BVYA 3FKFA 2WB9A 1Z9HA 2VLVA 2B5EA 5D93A 4IQ1A 3MDKA 3ZZXA 2L5LA 2GQMA 3HJPA 4CW9A 1JLWA 2C0DA 2B6MA 3DKSA 4BPYA 2OACA 4G9HA 1A2MA 3LQ7A 3ZIVA 1R4WA 5DBQA 5E4WA 1Q4JA 2JU5A 1A0RP 5CAXA 1T00A 2YWOA 1SKRB 4MCUA 1M9AA 3ZVJA 3Q74A 2PPTA 1QMVA 4V2NA 2H6XA 5AGYA 2GTUA 5IPGA 2HI7A 3H79A 3LYPA 1AQVA 4BWQA 1XCCA 4ACSA 3Q19A 2K6VA 2YWNA 4MH2A 5GZZB 4EL1A 1F9MA 4YAPA 3WT1A 1YEXA 5ECSA 5H5SA 5G1LA 2H74A 3A2XA 2ALBA 2BTOT 5CRWA 2DSAA 2YV9A 5D8IA 2KHPA 4FO5A 3TKSC 1AQWA 4NPBA 4HQZA 4HZ4A 3QFAC 1AQXA 1WPIA 3CSJA 4AF2A 4D73B 5A5KA 4V2LA 3Q6OA 3FY7A 3EU4A 4KDYA 4L5OA 4J56E 3KZQA 4ECCA 2H71A 5J9BA 4TR1B 4O7HA 4AJ6A 5A4WA 1G7EA 13GSA 3MSZA 3ZREA 1X5CA 1YJ6A 1A23A 1Z3EA 3HD5A 1ZOFA 2LUSA 4POBA 2YJHA 2QGVA 3UAPA 2R37A 3KTBA 3GH6A 3UVHA 1YKAA 1PN9A 3DWVA 3P2AA 3APOA 2WCIA 2F51A 1Z5YE 4G10A 1B4PA 3HZ8A 2HSYA 3I43A 4IGJA 1MD3A 4MP4A 2MMAA 4EDYA 3RHBA 4IS0A 1FVJA 2M72A 3QAGA 4OFMA 3M0FA 4JU5A 1PQNA 5EY6A 4GF0A 4ISDA 3RDWA 1GSQA 3IPZA 2VL2C 4KCEA 5ECKB 1Y6EA 4IJ3A 4HDEA 4MDCA 1SK1A 2KP2A 2IJYA 5EL8A 4ECIA 2FWGA 2JZRA 2LJRA 3BCIA 3US3A 1XWKA 4YH2A 4GSNA 1M0UA 3S9FA 2FHEA 4TR4A 2RM6A 1E6BA 4WR4A 1F37A 1UC7A 1Q98A 3GSSA 4KDUA 4JR4A 1F6MC 3VLNA 2FCHA 2PVOC 3EINA 4NXIA 2H66A 4PUFC 1B4QA 4E8EA 1SL0B 3TOTA 3VWVA 5IO0A 5E59A 6GSXA 2VAFA 1W89A 2FWFA 5IQYA 4KW6A 4TR1A 5DQYA 1JZRA 1PSQA 1SJIA 1CQHA 1T4YA 1OC9B 1WIKA 2QSIA 1OC9A 1ZCPA 1GTIA 3N9JA 3WGEA 1SJZA 3EC3A 4K7OA 1OVNA 5GAPD 4XTSA 5G5FA 3O3TA 3GSTA 2R6KA 3KP8A 1R5PA 1SD9A 5IOWA 5IMVA 4O32A 5ECRB 2X8HA 3VK9A 5J3RA 4F82A 1U88A 2A4VA 2ON7A 3QPMA 5GSSA 4KGIA 5B7CA 2I1UA 3GKNA 1KBNA 2IMEA 2LJKA 3LYKA 4MF5A 1GUHA 2LKUA 4L8EA 3CYNA 5DAKA 4X0XA 2I81A 1GNEA 2NVLA 3CXGA 4AGSA 1B9YC 1K0OA 2EIRA 2I4AA 5G2ZA 1FOVA 3FZAA 5LNKe 1I9DA 1GUMA 3TJFA 3DGQA 3IK7A 5IMZA 4CHSA 2IMFA 5D73A 3DD3A 3RAZA 2K18A 1R26A 4GTUA 1WOUA 2B5XA 1PD21 2FA8A 5GAND 1ERVA 3FR6A 2P5RA 4KA0A 1Y25A 3IV4A 1X0RA 2P0GA 2JL4A 4I6XA 1EOGA 4HEA2 4POLA 5IPHA 2LS5A 5G31A 2H76A 1F2EA 6GSUA 4XS4B 2Z9SA 4MF6A 1HD2A 4TN8A 3ZYWA 4MZCA 3GA4A 3DYRA 3HHVA 5FT3A 3ZFLA 3IR4A 1BAYA 1QXHA 2VM1A 2TIRA 3EVIA 2FGXA 4DEJA 3BBYA 1KTEA 2XPEA 3BCKA 2HRFA 2DIZA 4HU7A 3NZNA 1PL1A 4HI7A 1OC8A 5G5EA 4G2EA 4NV5A 1BEDA 1TRUA 3IK9A 3CTGA 3TKSE 3ZLPA 3GTUB 3CSHA 3G9BA 3ME7A 4FH8A 4KDXA 1OAZA 2IWTA 2ON5A 4K6XA 3DXBA 2FWHA 4K9ZA 2CA8A 2C3TA 3D4MA 1VGLA 4MZWA 5IOXA 1IYHA 1RW1A 4WBRD 3ZMLA 2FD3A 1PA3A 5JWQB 2H73A 5JWOB 2H0GA 3TJJA 4BVXA 1K3OA 3L78A 2AAWA 2DMLA 3H4KA 3TDGA 1GSFA 1XXUA 5H5RA 3PGTA 3DVWA 1M7TA 1K0CA 3IAM2 4Q5RA 2KUCA 3IOSA 3D6IA 2C1YA 3CTFA 3F3RA 1FAAA 1XZOA 3GX8A 4NHZA 4MK3A 1V58A 3R2QA 3HCZA 2HZFA 1R5AA 3TGZA 2CAIA 2HE3A 3FZ4A 3V1WA 1K0MA 2JZSA 1JHBA 1EZKA 4O5RA 4K8MA 3L9UA 1ERTA 2OE0A 2O89A 3QAVA 4MZBA 2MMOA 1JZWA 4WF5A 4TXOB 2FWEA 1AIUA 1WE0A 3KH9A 5D9TA 2ES7A 2VM2A 4D73A 3P7XA 4L5LA 2N5AA 4ZL8A 4MF7A 1XW6A 4HQSA 2V41A 3SBCA 4TXOA 1GULA 1HQOA 5DAKB 2GZZA 1HNCA 1M2AA 4BWSA 2B7JA 3ZL5A 3O76A 4RI6A 1O8XA 3G7YA 4PNFA 1BX9A 5IO2A 3QD9A 2CAQA 3GYKA 5HFIA 2VIMA 4ECBA 3UBLA 5A4VA 4PQIA 2E0QA 1TI1A 4OCFA 2H19A 2R3XA 3RBTA 1A2JA 1EP8A 1EEMA 1SD8A 1GWCA 2YZHA 2L57A 5IMFA 1JLVA 3PH9A 2HXKA 4OWYA 3HVVA 4IP1A 2JACA 5C04A 4GCIA 1TK5B 2E2GA 3IAS2 3TB2A 2WJUA 3HDCA 2DJKA 4LMVA 4I97A 4XS4A 2L59A 5INYA 2HRNA 4MPFA 2HNLA 3GL5A 4MABA 1A24A 3GMFA 4DSQA 3DRNA 1ERUA 1FW1A 4F03A 2REMA 1M2DA 2KP1A 3FW2A 1I5GA 1YQ1A 1PRXA 4XHMA 3LEFA 5DVBA 3FZ5A 2FNOA 2DMMA 2DLXA 4HJ2A 3H8QA 1AAZA 5CO3A 4PNGA 1V98A 3CRUA 1TJDA 2FUG2 4MH3A 2F9SA 1FHEA 3A3TA 4ZL9A 2H1BA 1YY7A 1K3LA 2O87A 4KSMA 3KM6A 2DJJA 2ZCTA 4HJMA 3VFIA 5COHA 4J57E 1UN2A 5D9WA 2RM5A 6GSYA 5LD0A 2R2JA 3C73A 3HXSA 4RUVA 3GUSA 2R5GA 4ZB8A 1GP1A 1OC3A 3P8WA 3E9JB 5J5NA 3TKSA 4IP6A 3TKPA 2X8GA 4DSSA 2VCQA 1SENA 2H6YA 2PUKC 3KMNA 5IM9A 2GGTA 2HZEA 2KOKA 3D4TA 3DIEA 1YKCA 2VO4A 3IXRA 3TCOA 2PERA 3Q18A 4ML6A 2H01A 2NTOA 2H75A 3IA1A 2XC2A 4Q5NA 2C4JA 3TOUA 2C80A 2H1AA 1U6TA 1WWJA 2RUEA
chains in the Genus database with same CATH superfamily
3IPTA 3G713 1T3BA 2MMZA 4ZB6A 1CQGA 4O8SA 2D1WA 2J23A 1V57A 2C0GA 1UVZA 4GQFA 5C00A 5G30A 2WGOA 3J7Yk 1FUWA 1GTAA 4MJDA 2CFGA 2E2MA 4HOJA 4I2TA 5ECOB 1X1WA 2CC3A 3WOFB 2AAEA 2OTL3 1O7GB 1S3AA 2VOCA 1IT8A 1WMJA 5BMUA 1J2BA 1CH0A 3HA9A 3CPW2 2KAAA 3FMWA 1NWWA 4HJLB 2L6CA 2XF3A 3TRPA 1A0FA 3F6DA 3DVXA 3HI7A 1SL1B 3WT2A 2BMOB 3GH9A 4JR6A 5B8AA 3VI7A 3F14A 5IG4A 3L9SA 3IHGA 3I6AA 1DMMA 4OMVA 4USSA 3J7Yb 1XPVA 22GSA 1EGRA 3ECFA 2JSZA 1GY7A 1KNGA 1HZ1A 2JADA 1SK2A 1JBSA 5DCGA 1K734 3WGXA 1YF1A 4K2DA 2WGQA 1F3BA 4G0LA 4XB5A 1YJN3 2HLSA 1UCJA 4KH7A 4WYKA 3F4TA 4K0NA 2BO9B 3C7MA 2GSSA 1BSEA 3DY5A 4HUAA 2V6OA 4JE1A 5CYYA 5M1AA 1GSSA 2MYGA 4TW5A 5HQPA 4BL3A 1F3AA 2CFWA 1URMA 1CYVA 5STDA 1BU4A 1PX6A 2OE3A 1UCKA 1K0NA 3ISOA 4KZ1A 1VQ73 3M1GA 1W7CA 1VF3A 1I70A 5CK6A 3JCML 2MBTA 1N8JA 1YF0A 1SL2B 1FUTA 2CVKA 2LRTA 14GSA 2I9WA 3WMDA 1BSDA 3F0IA 2FNQA 3F6FA 3ZFZA 5GSTA 2XHFA 1GOYA 4QL9A 3BNBA 2ML6A 1EOHA 2VLTA 1X9MB 3EYTA 2LRNA 1STDA 3OW22 1ERWA 4KCAA 2PGTA 1WRYA 3F40A 1GD4A 1GH2A 4HM6B 3L0HA 1GSUA 3GAXA 2IPAA 1FG4A 1ST9A 2CT6A 1PX7A 1W2ZA 4GQCA 2GSRA 3N54B 3T8NA 1V2AA 4TKYA 3I563 4PQHA 2Y73A 1NM3A 5JPPA 3F8UA 3KJYA 3MAKA 5BVBA 2B5YA 3LWAA 1A2LA 3BIRA 1SU9A 3E99A 11GSA 1KC84 2XR8B 1QGVA 3EBYA 3ZVJD 3LSZA 2LJAA 2DKHA 2DKIA 1JZDA 1UI7A 5CF2A 3QMXA 1V40A 3F4RA 4AJ8A 3MG2A 20GSA 2EIOA 1O7MB 3EPTA 3KXOA 3W8SA 4LZIA 4FYUA 4K7NA 5HR3A 2R4VA 1QMAA 1PMTA 4NWYA 5ABRA 3UL3A 3G6E3 4R4KA 3E3EA 1SYRA 1QUWA 2FGTA 2OJLA 3A2VA 4EIPA 3L4NA 2D2ZA 1YIT3 2GZPA 2F56A 3KEBA 9GSSA 4GLTA 4ZBBA 1RK4A 2DJ1A 1GTBA 2H1GA 2MBSA 1GOUA 3WHOA 4FYBA 1ZGNA 4OO4A 2GDRA 3ZG0A 1S3RA 1K0BA 1YDKA 3GNJA 5EVHA 3GURA 4N0ZA 1SKSB 5H5QA 3ZIJA 4MJEA 1D6ZA 5CRDA 4G19A 3KFQC 1CYUA 4N6NB 2QC7A 1YJW3 2OKAA 3L0RA 1A67A 5IERA 1H4OA 2E7PA 4KUNA 4POMA 2LNTA 1PU4A 3RGRA 4XS6A 2PVQA 4CCVA 4H3UA 1BG5A 1W2B2 5IMCA 1AVLA 4HU9A 5AYSC 4STDA 3A5EA 3I9V2 4MJBA 4PURA 3ZITA 1IVXA 1WTHA 3N5OA 2KLXA 3MYDA 3I0YA 3TRQA 1EQKA 5AEUB 2A15A 1OHPA 1IQYA 1MWUA 3H1NA 4FMAA 2HRKA 1X5EA 3V99A 2M80A 2JSYA 3SX1A 3DGYA 3CD63 4K7IA 1PKZA 1O73A 4AEQA 2GSQA 2OWPA 5F0GA 1G02A 4OFTA 3S29A 1WMNA 1RMSA 1NHYA 3HYPA 3WR2A 4XIHA 3OWUA 1VQK3 4DSRA 4IQAA 4LGQA 4EV5A 4EYCA 3ZG5A 3D22A 4KE3A 5EPFA 2LRCA 4RQRA 1FB6A 4EVMA 4MMYB 4PUAA 3LXTA 3S5CA 3DGMA 2K8VA 2JDIH 1LOWA 1YGWA 3CC23 1N9EA 2OE1A 1OF5A 1X1UA 4J2FA 4YKFA 1MDJA 2PZVA 2GBWB 2F99A 1A8LA 3LT9A 1OPYA 1DE2A 3WYWA 3HZPA 1R4CA 4Z2RA 2UZ8A 4HM8B 1ZYEA 1S5AA 3EURA 4YQUA 3NOFA 2BMXA 1OUNA 1G6YA 3SOAA 4P3YB 10GSA 4N6LA 2P05A 3TUEA 1LQMB 5IENA 5HGRA 2FXTA 2H0HA 2IMJA 2N5FA 5IIZA 1XW5A 2FY6A 4H61A 3PCSA 5F8BA 3EX9A 1ZGXA 2RFRA 2AB6A 2J9HA 3GX0A 1SJWA 1Q814 3K7CA 3BOAA 3MNGA 1ULIB 3HVNA 3UEMA 1GMRA 3JUMA 1PKWA 5CRHA 1I2FA 3DUKA 5AIXA 2YOIA 1VQ83 3JUOA 3C1SA 3TRXA 4F0CA 2GT5A 4NHFA 1XIYA 5AISA 1OE8A 4FCMA 3GWRA 4HM3B 3LG6A 2QKEA 2IMKA 3X3XA 4KB3A 5TGNA 2ZUPA 1UW1A 1C72A 3UJ1A 3T8UA 2Y74A 1IQXA 2G2QA 5B6MA 4IKHA 2DBCA 3HJOA 4WXTA 1TXXA 2IMIA 3KH7A 3MG1A 2LSTA 1RRLA 4V1Ap 3VWXA 3ZFBA 4K1VA 3K5TA 3FGYA 4Q53A 1E97A 1WJKA 2VLUA 5DDLA 1T2IA 3PR8A 1JRQA 5GSPA 5LC7A 3HY2A 2PN8A 3A2WA 2QIYA 1Z7RA 2OCTA 4KX4A 1M2BA 1THOA 7GSSA 1TU7A 4WFOA 1NW2A 4PX1A 1V9WA 2DC5A 3GZRA 1O8WA 1EEJA 4ZXGA 1BRJA 1KWIA 3D79A 4Z7XA 2BT3A 2IY2A 3CNXA 5KN3A 3E0UA 4HZ2A 5HR2A 1OGZA 1I3FA 3CBUA 1FVKA 2M46A 3F9UA 1TP9A 4WBJA 3IBHA 2GQKA 3F63A 2GXFA 4PGTA 1MTCA 4RNZA 3U6VA 4OFNA 5G1KA 1XWBA 3EMXA 1OYJA 2V1MA 3QOUA 4L0WA 3LXZA 5F06A 1TU8A 1O85A 2YCDA 2H72A 4O92A 1J08A 2OBIA 4RNYA 3PINA 1FGRA 2CIUA 5AIIA 5KP4A 2OADA 3D3LA 2JZTA 3G7JA 4OO5A 1GY5A 2PMTA 4N3VA 1VRSD 1EP7A 1B48A 3SXXA 2OBKA 2F3MA 2CX3A 2E2VA 1J9BA 1MNLA 1S723 5ECNB 1U3AA 4GL6A 4ZB9A 4KFFA 1K0DA 1VQ93 1M1K4 1Q7HA 2DIYA 1BJXA 4FYCA 3MSOA 4XDVA 2CZ3A 2YJ7A 1TDIA 2C3NA 3JUQA 1M1XB 1FA3A 1USBA 3UBKA 1B8XA 3NXJA 2Z6BA 4HYZA 1G0TA 5IEPA 4EDZA 2CFLA 1EV9A 3VWWA 1JB4A 2X8CA 4GSPA 2C8UA 1XVWA 2FA4A 4L0UA 4FIWA 2OOVA 3GRDA 5LCZA 5J4UA 1O6JA 5IEOA 3ZMKA 1H75A 2R4IA 1ZZYA 1JBTA 2X64A 2N5BA 1XG8A 4TOPA 1BGSA 1NB5I 5HOHA 1ML6A 3FSDA 3AMOA 2L4QA 1R7HA 1Z6NA 2EIQA 3ED3A 4QWTA 1VF2A 2L6DA 5D82A 3QDNA 4HM4B 1UA5A 5HR1A 2JQ5A 5J9CA 4GSTA 1ZYPA 4HM1B 2QGUA 1L5GB 1HU9A 1W6YA 1YNVX 1ZX2A 4AJ7A 2HSMA 3APSA 3PCRA 2DJ0A 1RN1A 4JRRA 1IVWA 4F0BA 2CG0A 2RIIA 1W5ZA 2LV3A 4ZIJA 2KXGA 1WMPA 2BIRA 1KD14 1T7PB 5AEWB 4CDOA 6RNTA 1SYXA 4XBTA 2YNXA 1TKDB 1TP6A 2L5OA 4N6UA 4MPGA 1N8R4 4IBPA 1QK8A 3DMLA 2GZYA 4X2OA 1S3DA 5BIRA 1PGTA 2F8AA 2TRCP 4KNDA 3CXC2 2V2GA 1N5HA 3EF8A 3MWZA 1GLPA 3EMPA 3RGAA 4I5QA 1C54A 5F05A 5CF1A 3HKRA 5ENUA 1AC1A 3RHCA 4EUYA 1N2AA 3HZ4A 2K0MA 3KCHA 4KSOA 2YN1A 3NX0A 2A2RA 5D9VA 3ZTLA 5D96A 3LGCA 2VCXA 4YQMA 2FLSA 1W4VA 2GSTA 3CMA3 2GSPA 1B27A 4YQVA 1Q42A 2C0FA 3O6TA 1TTZA 4FMBA 2C3QA 3UVTA 1W00A 1K0AA 4NAXA 3DM8A 4NMUA 3FEUA 2H1DA 4K1UA 7RNTA 4RI7A 3KTLA 4FR9A 2QA2A 1KEBA 4ID0A 2K8SA 5ELAA 2MZCA 1S3CA 2VL9A 2NDOA 3MWHA 1KSIA 1EKMA 1XFLA 3MIXA 1JB5A 1AUCA 4GRFA 4EO3A 4F9ZA 3S27A 4LL4B 1GYBA 5F07A 3SOYA 8RNTA 5ELUA 2XFTA 2VCTA 4IHUA 4V1Ag 1GNWA 1VF4A 2CVBA 2AHEA 1V74A 2CK3H 3X41A 3JUPA 4KT3B 3NV0A 4PEJA 1MDIA 5RNTA 3FK8A 3ERFA 2R0CA 3FZ9A 1BYEA 4BL7B 4EF0A 3NBJA 1QQ2A 4K1FA 1TK0B 1RKYA 1M99A 3FHKA 1UGIA 4O5QA 1AV4A 1BQ7A 2HSHA 4N10A 2W56A 3EE2A 3MPHA 2W0QA 1IV7A 1G7OA 4OCEA 2CX1A 1OKDA 2K9FA 3TJKA 4X1UA 3EU3A 3TKRA 5ID2A 3GSPA 3EWLA 1AR0A 1ILOA 3HOHA 4MLYA 2AUVA 3IHQA 1K9M4 1UUWB 2CFDA 4N0VA 3P90A 4ILFA 2LNSA 1RGKA 2VL2A 4QQ7A 1SQWA 4K0GA 4BVYB 2DJ2A 3H3HA 2C0EA 1HYUA 4XRDA 1BRHA 2WZ9A 3NBRA 3WA2X 5D81A 8CHOA 1IYIA 2H70A 4KFDA 1SKWB 1X5DA 4HOHA 1JZOA 3HIGA 1A90A 4EIQA 3GKMA 4N30A 2RGQA 4N6TA 2DJ3A 2W6JH 1RJOA 1YVSA 2VD1A 1DUGA 1ZMAA 1N8QA 1U8CB 2QA43 2F5WA 2RUFA 4JEDA 2G0FA 2XFSA 1I2EA 3UIWA 3FR3A 5DALA 3VI5A 4ZILA 3RPPA 2UGIA 1LJRA 1RGFA 1Z7PA 1SK0A 4V2MA 1WMOA 1IYYA 1Q864 5ECPB 4O2HA 3VWUA 3CMIA 2XRXB 2SARA 2WO0A 3CCE3 3ME8A 1E2YA 1K41A 4FMDA 3BD2A 4POKA 5KEJA 4ZL7A 4XBYA 2AV4A 2O3OA 3J7Yd 5FHIA 1OHOA 1RTUA 5KN0A 4OVMA 3VPQA 4X4JA 2HFDA 1BUQA 3VPTA 3HJMA 5JCUA 2B1LA 4PXOA 3F3QA 2I3YA 3APQA 4TR3A 2CX4A 5KN2A 1OACA 1U3IA 3GKXA 3FZWA 4LLRA 1VF1A 3FR9A 1BRKA 4JZQA 4RQXA 2TRXA 2C11A 3QK9A 5DJLA 4ZM8A 8GSSA 3X3ZA 5KOWA 2CZ2A 1TFKA 17GSA 3D5GA 5B8BA 3BB9A 1I0XA 12GSA 1M9BA 2PU9C 3BNEA 2KRTA 1LNHA 1O7PB 1O7NB 1LQGC 3OX9A 3QR6A 4ML1A 3GTUA 2WDUA 1EGOA 1O7UA 2GVPA 2O8VB 4QL7A 2IFQA 3WGDA 2BNGA 2KF3A 1B2MA 1GLQA 4HS1A 6GSVA 2Z7AA 3I553 1XBSA 1MWSA 2O7KA 1Q40B 3GHAA 3KCMA 3GZXB 1RCKA 1DMNA 4FCZA 2GT6A 1ROVA 3KP9A 5IG3A 1E3VA 3OWYA 1YHQ3 5CRGA 1BNIA 2W56B 3CME3 1GL8A 1LRAA 3OXAA 3K8NA 1G6WA 1K3YA 1GSYA 4MJCA 4EKZA 5ID2B 1PY3A 3LMLA 5CLKA 3QCPA 5ECIB 5ECQB 5AIVA 1A8YA 4IVFA 1LVNA 1LU4A 1ACVA 4GXZA 4FMCA 5B6NA 5HR0A 3QAWA 2YPMA 1X9SB 4XM4A 4RBNA 1T4ZA 2HT9A 4BA7A 1GUKA 1B2UA 2B1KA 4TR0A 1YGEA 5J41A 3TJGA 4XS1A 1OE7A 2XBQA 3M9JA 1RGLA 5ELGA 3D21A 4PQ1A 3UMAA 3KKGA 1FGQA 2GU1A 2LQOA 2YANA 3TJBA 1AXDA 1TI3A 3M8NA 1RN7A 2IA7A 2KF6A 3ERGA 4HM5B 2XPDA 4HM2B 1MDKA 2BJXA 4MA9A 2B3SA 4I8BA 3SWLA 4LMWA 4HSCX 3IDVA 4Q5QA 4O5UA 4CDLA 3M9KA 3AMOB 1VQN3 4N11A 5DQSA 1AW9A 1JN5B 3F4SA 2PBJA 3EQQB 4H86A 2YX9A 3WDGB 3UL6A 3Q2PA 3LJRA 4Q5FA 3ROBA 1BVIA 1VQL3 2HZEB 1TRSA 1PL2A 1KQS2 2WS2A 18GSA 3ZRDA 4EE0A 2GLRA 4HZBB 1NO3A 3UOMA 1GTUA 5DRVA 4TVEA 3NBBA 3K9MC 3FRCA 4KF9A 5FWGA 4IELA 2W04A 4BTYA 4DVCA 1TOFA 5AN1A 1GSDA 3CSIA 4XCSA 4WR5A 3LH4A 2CWUA 4WEYA 3GIXA 1M3IA 2RLIA 2WFCA 1FGOA 4WF4A 3C71A 4YAVA 3FF2A 3T0UA 4NHWA 3C8EA 3UNLA 5ECHB 1BANA 1RGCA 2H30A 4GB5A 5CNWA 3A5WA 3IC4A 2IL3A 5FW5A 2IFQB 1B2ZA 3L9VA 2VCVA 4LA1A 1RN4A 1NSWA 3UARA 2X99A 3KMOA 4MJAA 1JFUA 3WD6A 1F8NA 1FYSA 3NIVA 4N6OB 3W6GA 5JWRB 1RRHA 1MEKA 2L4CA 4EXJA 2LQQA 3MG3A 1Y4KA 2VCWA 4MMMA 3LFLA 2W2CA 5DJMA 2P5QA 19GSA 2NPBA 4IIAA 2ZNMA 1NHOA 3D0ZA 2VD0A 1ZS7A 1EV4A 3CPOA 1DSBA 1BNEA 1XW9A 3CCQ3 1QAFA 1WP0A 3PXMA 2MF7A 4JBBA 2B7KA 4Z2TA 2YV7A 1O81A 1Z6MA 2F8FA 4TRXA 1C7HA 1BNFA 5IW9A 2VL3A 1BOXA 4XRAA 4R1KA 1B21A 2P38A 3ERWA 1SJ6A 2A4HA 2YWIA 4EC6A 1HKXA 2EC4A 2CV4A 4ZBDA 1U87A 1UDII 3NUVA 3C1RA 3X40A 4EC0A 3Q90A 4AKZA 3TKQA 4K5RA 3FLJA 2VCZA 3F8HA 4MMXB 3NQZA 4ULXA 4WHAA 5M18A 5EVOA 2UUGC 3UB1A 4NV2A 4L8OA 3G0KA 3GRXA 5A4UA 4WETA 2F98A 5KN1A 2YZUA 1THXA 1XOBA 5AYRB 6GSWA 4IW9A 2A2SA 4BL7A 2K3DA 1Q824 2IIYA 4WKWA 1HNBA 4IN0A 3BNCA 4HKVB 3M3MA 4K5SA 2VUPA 3S67A 2IN3A 3KGKA 4EV2A 5HFKA 1GRXA 1T8EB 1ON4A 1BSBA 3BJ5A 1XOAA 1YEPA 3GFKA 1T1VA 2CQ9A 2M7OA 2K54A 1ABAA 5AI1A 2PWJA 5CREA 4FCJA 2CHCA 3OR5A 3VURA 1LXEA 3ALAA 1JN5A 1YVBI 1LBKA 3GL3A 3FH1A 2PNCA 5DCHA 5IMDA 4KAEA 2H8LA 5JCWA 3AY8A 1TK8B 4K90B 5AIGA 2H0IA 1OKTA 1IVUA 3D5IA 2CG1A 3RPNA 1XWCA 1RQMA 4I4KA 4E8HA 1IK3A 1QALA 1FUSA 3KIJA 1UUVB 1BRNL 1TRVA 4GWRA 5HFGA 1MD4A 2IMDA 3V98A 5IMAA 1Q9EA 2WRTA 3LORA 5DALB 3B8LA 3GV1A 6GSTA 2HYXA 1FGTA 3SLUA 3GN3A 1PFOA 3HVXA 3I69A 4OD7A 3NM2A 4X43A 1EWXA 3UJMA 3PYJA 3LTBA 2P31A 4DSSB 1VQQA 2WGRA 3B7CA 3IE3A 3EHCA 1DBYA 2NBSA 3LXUX 2LTKA 5D9XA 2CVDA 1TRWA 1VQ63 2YP6A 4F2IA 1RGEA 4ECJA 2WULA 5L71A 2CWTA 16GSA 2I9HA 1GSEA 1QFNA 3U5RE 5ECMB 3H93A 2BHMA 2MMNA 4KVHA 1XVQA 1ROAA 4LL1B 2V32A 2XBIA 1YZXA 4N6MA 2V6KA 4AKYA 1W01A 1HNAA 2E2UA 3DH2A 3GKKA 1ZYQB 4ZBAA 1M904 2Z77A 2OTJ3 4CJNA 5ECLB 5KOXA 3QFBC 2AADA 2YFJB 3CRTA 2LEGA 4LYLB 1XWGA 2H6ZA 1EUIC 1JB2A 3NV0B 3IC8A 2B24B 2KCDA 1ZL9A 3G7IA 2HMMB 2UX0A 3MYTA 5JCGA 2AYTA 1XWAA 3HVSA 2OA7A 6GSSA 2GQLA 3RDEA 3DEXA 3W8JA 4TXVA 2GU3A 4A5PA 5BXQA 3IRAA 3D5JA 1FO5A 2HMJB 3FYGA 3KD0A 2YWMA 1BNRA 3AHWA 2IYJA 1X9WB 1J0FA 2QA1A 4GSSA 4O3VA 1B9XC 4XDWA 1OH0A 1MWRA 3CCM3 2O85A 2AJQB 3M8CA 2D42A 3LT8A 4IJIA 1FB0A 4I2UA 5CP1A 4G0IA 2CW9A 2GS3A 1DE1A 1TW9A 4BVYA 2R0PA 3F7XA 2F86B 3FKFA 2WB9A 4GHOA 1I8VA 1Z9HA 2XH9A 1B2SA 3ER7A 1B2XA 2VLVA 2B5EA 5D93A 4IQ1A 3MDKA 3ZZXA 2L5LA 4J9AA 2GQMA 2P09A 1FW7A 1I3IA 2GEYA 3HJPA 3OWSA 4CW9A 2IUJA 2HMKB 1JLWA 2C0DA 2B6MA 3DKSA 4K2XA 4BPYA 5EEOA 3U97A 2OACA 2XEPA 3CQFA 4G9HA 1A2MA 3H51A 3LQ7A 3ZIVA 1R4WA 5DBQA 5E4WA 1Q4JA 2JU5A 1A0RP 5CAXA 3F7SA 4NREA 1T00A 2YWOA 1US1A 1SKRB 4MCUA 1M9AA 3ZVJA 3Q74A 2PPTA 1QMVA 3CC73 4V2NA 4ICYA 2H6XA 5AGYA 2GTUA 5IPGA 3EN8A 3HK4A 2HI7A 3H79A 2XGNA 3LYPA 1AQVA 4BWQA 1JV2B 2F4YA 1XCCA 4ACSA 1CEWI 4JRFA 1RNTA 3Q19A 2C10A 4PTSA 3IMAB 2K6VA 2YWNA 4MH2A 5GZZB 4EL1A 1F9MA 1PYLA 4YAPA 1OCVA 3CCL3 3WT1A 1BSCA 7GSPA 1E3RA 1YEXA 5ECSA 5H5SA 3KN4A 4R80A 2OOVC 5G1LA 2H74A 4WWUC 2STDA 1PFPA 3A2XA 1NB3I 2ALBA 1UCIA 2BTOT 5CRWA 1BRGA 2DSAA 4HM0B 2ZDJA 2YV9A 5D8IA 2KHPA 4FO5A 3TKSC 1BNJA 1AQWA 4NPBA 1O7WB 4HQZA 4HZ4A 3QFAC 1LOYA 3F8XA 1AQXA 1N9JA 4BL2A 1WPIA 1VQ43 3LW9A 3CSJA 1EA2A 4AF2A 4D73B 1ASKA 5A5KA 2W03A 4V2LA 3Q6OA 4X2HA 2CFKA 3FY7A 3EU4A 1W4NA 3X42A 4KDYA 4L5OA 2ZA4A 3DGOA 4J56E 3KZQA 4ECCA 2H71A 5J9BA 4TR1B 4O7HA 4AJ6A 5A4WA 1G7EA 13GSA 3MSZA 3ZREA 4KFEA 6STDA 1O7HB 3LTCA 1X5CA 2HMNB 2W9PA 1YJ6A 4J5GA 1A23A 1Z3EA 3HD5A 1ZOFA 2LUSA 4CY8A 2MC8A 1OGXA 3VF1A 4POBA 3BNDA 2YJHA 2QGVA 3UAPA 1UGHI 5CXOA 1N5PA 2R37A 3KTBA 1WQLB 9RNTA 3GH6A 3UVHA 4J8TA 2WOHA 5BU4A 1YKAA 1PN9A 3DWVA 3P2AA 5AIFA 3KE7A 5ELJA 3APOA 4EBGA 1AQZA 5D83A 2WCIA 4K61A 3G4S3 3X3YA 1FOHA 2F51A 1Z5YE 4G10A 4BTWA 1B4PA 3HZ8A 2HSYA 3I43A 1RGHA 4LSOA 4IGJA 1MD3A 4MP4A 2MMAA 4EDYA 3RHBA 4IS0A 1FVJA 3KZTA 3CCS3 1FZUA 2C4BA 2M72A 3QAGA 4OFMA 3M0FA 3GZBA 4JU5A 2HOHA 1PQNA 5EY6A 4GF0A 4ISDA 3RDWA 1GOVA 1GSQA 3IPZA 2VL2C 1BAOA 3EE1A 4OK0A 3AGNA 4KCEA 5ECKB 1Y6EA 4CPKA 4IJ3A 4HDEA 4MDCA 1NDOB 1SK1A 2KP2A 2E2TA 2IJYA 3Q1CA 5EL8A 3D9RA 4ECIA 2CKFB 2FWGA 2JZRA 3EBTA 2LJRA 3S28A 3PPUA 1RGAA 3BCIA 3US3A 1XWKA 4YH2A 4GSNA 1YIJ3 4G0KA 1DE3A 1M0UA 1TIJA 3F9SA 3CCV3 3VSYA 3S9FA 3EC9A 2FHEA 2RNTA 1YJ93 3LYGA 1K28A 4TR4A 3FCSB 1IQ8A 5IF6A 3DGLA 1BRSA 2RM6A 1E6BA 4WR4A 1F37A 1UC7A 1Q98A 1EG9B 2BMQB 3GSSA 4KDUA 4JR4A 1I0VA 1F6MC 2FCHA 3EINA 2PVOC 3VLNA 4NXIA 2H66A 4PUFC 1B4QA 4E8EA 3G8ZA 1SL0B 3TOTA 3VWVA 5IO0A 1YI23 3DZLA 5E59A 6GSXA 2VAFA 1GY6A 3FF0A 1W89A 2HMOB 1DYUA 2FWFA 5IQYA 4R9LA 1MGRA 4KW6A 3SEDA 4TR1A 5DQYA 1MOLA 1JZRA 3UL5A 1PSQA 1SJIA 4WYKB 2YFLB 4IPBA 4RZMA 1CQHA 1T4YA 1WIKA 1OC9B 2QSIA 1OC9A 1ZCPA 1DETA 1GTIA 3N9JA 1SJZA 3EC3A 4K7OA 3WGEA 1MGWA 1OVNA 5GAPD 2IUKA 4XTSA 3LTAA 5G5FA 3O3TA 1IU7A 3GSTA 2R6KA 3KP8A 4HZ9B 1R5PA 1SD9A 5IOWA 5IMVA 4O32A 4R9KA 5I97A 5ECRB 1MWTA 4JF8A 5EQLA 2X8HA 4HBRA 3VK9A 5J3RA 4F82A 1U88A 3MKIA 2A4VA 3DMCA 2ON7A 3QPMA 5GSSA 4KGIA 5B7CA 5LC6A 2I1UA 1K8A4 3GKNA 1KBNA 2IMEA 2LJKA 3LYKA 4MF5A 1GUHA 1RSNA 2LKUA 4L8EA 2CX0A 3CYNA 1OF5B 5DAKA 4X0XA 2I81A 1GNEA 1LOVA 2NVLA 3CXGA 4Z2UA 4AGSA 2XGLA 4CY6A 4BIKA 1B9YC 4MMZB 1Q7Y4 1K0OA 1AY7A 2EIRA 2I4AA 1DVDA 5G2ZA 1FOVA 3FZAA 5LNKe 1I9DA 1SARA 1GUMA 3LTDA 3TJFA 3DGQA 3OV4A 1IDPA 1BUJA 5IG5A 3IK7A 5IMZA 4CHSA 4EW5A 2Q07A 3B4PA 3NM7A 2IMFA 4HM7B 5D73A 2OQEC 3Q3FA 3LZAA 1DMQA 3DD3A 3B4OA 1BIRA 1QVG2 3RAZA 2K18A 1R26A 4GTUA 1WOUA 2B5XA 1PD21 2FA8A 5GAND 1ERVA 4BU4A 3D4AA 3WODG 3FR6A 2P5RA 4KA0A 1A2KA 1Y25A 3IV4A 1X0RA 2P0GA 2JL4A 4I6XA 1EOGA 4HEA2 4POLA 5IPHA 2L4VA 2LS5A 5G31A 3STDA 2H76A 1F2EA 3AGOA 6GSUA 4XS4B 2Z9SA 4MF6A 1HD2A 4O02B 4TN8A 3EN1B 3ZYWA 4MZCA 3GA4A 1ZO2A 3DYRA 4DKIA 3HHVA 2KF5A 5FT3A 3ZFLA 1LNIA 3IR4A 1BAYA 1QXHA 1T5YA 3DXOA 2X49A 2WOFA 2VM1A 4L7KA 2TIRA 1UI8A 2INXA 3EVIA 3O8YA 2A2PA 1X1YA 2ZL8A 2B1XB 2FGXA 3PGBA 3VGNA 3BU4A 4HVNA 4DEJA 3V92A 3BBYA 1KTEA 3LOYA 1IT7A 4XBXA 2XPEA 3BCKA 3FKAA 2HRFA 1RGGA 2O9UX 2DIZA 4HU7A 3NZNA 1RNBA 1PL1A 2R41A 4HI7A 2P0MA 1OC8A 2X4AA 4HAAA 5G5EA 4G2EA 4NV5A 1TFOA 2LYXA 1BEDA 1Q40A 1TRUA 3N9HA 2R0GA 1IVVA 3IK9A 1T2HA 2QEX3 3CTGA 3TKSE 1ULJB 5IG0A 1GS3A 1VZZA 3ZLPA 1GSPA 1D6YA 4L8PA 1NNVA 4OUQA 3GTUB 1RHLA 3CSHA 3U1WA 3G9BA 1NJI4 1U5OA 1UCLA 3ME7A 4FH8A 4KDXA 4MNNA 1OAZA 1LOXA 1GMQA 3CCJ3 2IWTA 1GD3A 2ON5A 4K6XA 3DXBA 3CCR3 2FWHA 2P0XA 2CA8A 4K9ZA 2C3TA 3D4MA 2W9QA 1VGLA 3SYUA 3AHSA 4MZWA 1QVF2 2Z76A 7STDA 5IOXA 1BRIA 1IYHA 1RW1A 4WBRD 1SIHA 3CNMA 1RLSA 3ZMLA 1VQ53 2FD3A 1PA3A 2ML5A 5JWQB 2H73A 1SIIA 5JWOB 1QJGA 2H0GA 3TJJA 5DREA 1K3OA 4BVXA 3L78A 2AAWA 3TDGA 2DMLA 1CQSA 1GSFA 1XXUA 3H4KA 1B20A 5H5RA 1G96A 3PGTA 1GMPA 3DVWA 1M7TA 4N6V0 1K0CA 3IAM2 4Q5RA 2KUCA 3IOSA 3D6IA 3GZYB 2C1YA 3CCU3 3CTFA 3F3RA 1FAAA 3FG3A 1XZOA 3HX8A 3GX8A 4NHZA 4MK3A 1V58A 3R2QA 3HCZA 4MEIA 2HZFA 1R5AA 4WP5A 3WOEB 3TGZA 2CAIA 2HE3A 2L1SA 3N8BA 3FZ4A 3V1WA 1K0MA 2JZSA 1JHBA 1EZKA 1QAKA 4O5RA 4K8MA 3L9UA 1VQM3 1ERTA 2OE0A 2O89A 3QAVA 1VQP3 1BSAA 4MZBA 2CWVA 2MMOA 1JZWA 4WF5A 4TXOB 1TUHA 1JKGB 4LMIA 2FWEA 1AIUA 1WE0A 3FG4A 3A76A 1W02A 3NQYA 3KH9A 5D9TA 1OHSA 2ES7A 5G2GA 2VM2A 2LQVA 1FGMA 4D73A 3P7XA 4L5LA 2N5AA 4ZL8A 3KIIA 4EXRA 4MF7A 1XW6A 2BU4A 4HQSA 2V41A 3SBCA 4TXOA 1GULA 4ORLA 2RCDA 4IT7A 1HQOA 1R4YA 5DAKB 1I2GA 2GZZA 1HNCA 1M2AA 5M19A 4BWSA 1RDSA 2B7JA 4J5KA 3ZL5A 1HYFA 3O76A 4RI6A 1O8XA 3G7YA 4PNFA 1JBRA 1BX9A 5IO2A 5JPUA 2CAQA 3QD9A 2GBXB 2ZHXB 3GYKA 5HFIA 2VIMA 1Z1SA 4ECBA 4YKGA 3UBLA 1NU3A 1VQO3 5A4VA 4PQIA 3WA3A 2E0QA 1TI1A 5A0OB 4OCFA 2H19A 3QRDA 2R3XA 1A2JA 3RBTA 3BLZA 1EP8A 1EEMA 3FG1A 1SD8A 2V1LA 1GWCA 2YZHA 2L57A 2YFIB 5IMFA 1JLVA 2CH9A 3PH9A 3G16A 2HXKA 4OWYA 3HVVA 4IP1A 4RNTA 3PZWA 2JACA 5C04A 2SBLA 4TX4A 5KP3A 4GCIA 1TK5B 1BNSA 2E2GA 1UUGB 1D6UA 3IAS2 3TB2A 1A2VA 2WJUA 3HDCA 2DJKA 4LMVA 1JJ22 4I97A 4XS4A 2HMLB 2L59A 1X1XA 5INYA 1W6GA 1AVKA 2HRNA 4MPFA 2HNLA 1STFI 3GL5A 1TTOA 4MABA 4G1MB 1A24A 3PS8A 3GMFA 4DSQA 3URPA 2XSOB 3DRNA 1ERUA 1FW1A 4F03A 2RSXA 2REMA 1M2DA 2KP1A 3FW2A 3EJVA 3R3EA 4BTXA 1SPUA 3IJEB 1I5GA 3MHEA 3K0ZA 4LEHA 1YQ1A 3DGNA 1PRXA 4XHMA 6GSPA 3LEFA 5DVBA 1JKGA 3FZ5A 3CU3A 2FNOA 1M3JA 2DMMA 2RBIA 2DLXA 4HJ2A 3H8QA 1B3SA 1AAZA 5CO3A 4PNGA 1PN0A 4BIRA 1V98A 3CRUA 1TJDA 5JBSA 2FUG2 2F5MA 1A2PA 2F9SA 4MH3A 1FHEA 1ISKA 5BRTA 3A3TA 3A5IA 2HRAA 2H1BA 1YY7A 4ZL9A 5FGOA 3JUNA 1K3LA 2O87A 1RCLA 3NHXA 4KSMA 3KM6A 2DJJA 3KSED 2ZCTA 4HJMA 1TRQA 1IV9A 3RNTA 1JNQA 1WNHA 3SVAA 3VFIA 5COHA 4J57E 1UN2A 5D9WA 3KSPA 2RM5A 1BNGA 6GSYA 2KF4A 2R2JA 5LD0A 3C73A 2J8XB 3HXSA 4RUVA 3EB8A 3GUSA 3JVCA 2R5GA 4ZB8A 1GP1A 1OC3A 3P8WA 4U13A 1TU5A 3E9JB 5J5NA 3TKSA 3K63A 2GEXA 4IP6A 3TKPA 2X8GA 1W6CA 1TRPA 5AIHA 2OQEA 4DSSA 2VCQA 1SENA 2H6YA 2PUKC 3KMNA 5IM9A 2GGTA 1M9GA 2HZEA 2XSHB 2KOKA 3D4TA 3DIEA 1YKCA 2VO4A 5KP1A 3IXRA 3TCOA 2PERA 3Q18A 4ML6A 2H01A 2NTOA 2H75A 3IA1A 2BMRB 2XC2A 4Q5NA 2C4JA 3TOUA 4BVXB 2C80A 2H1AA 1DVCA 1ZYNA 1U6TA 3HIIA 1WWJA 4FQUA 2RUEA 3CC43
chains in the Genus database with same CATH topology
1T3BA 2MMZA 4ZB6A 1CQGA 2J23A 1V57A 2C0GA 1UVZA 4GQFA 5C00A 5G30A 3J7Yk 1GTAA 2E2MA 4HOJA 4I2TA 5ECOB 1S3AA 2VOCA 1WMJA 5BMUA 3HA9A 3FMWA 2L6CA 3TRPA 1A0FA 3F6DA 3DVXA 1SL1B 3WT2A 3GH9A 4JR6A 5B8AA 3VI7A 3L9SA 3IHGA 3I6AA 4OMVA 4USSA 3J7Yb 1XPVA 22GSA 1EGRA 2JSZA 1KNGA 2JADA 1SK2A 5DCGA 3WGXA 1YF1A 4K2DA 1F3BA 4G0LA 2HLSA 4KH7A 3F4TA 4K0NA 3C7MA 2GSSA 4HUAA 2V6OA 4JE1A 5CYYA 1GSSA 2MYGA 4TW5A 5HQPA 1F3AA 1URMA 1PX6A 2OE3A 1K0NA 3ISOA 3M1GA 1VF3A 3JCML 2MBTA 1N8JA 1YF0A 1SL2B 2CVKA 2LRTA 14GSA 3F0IA 3F6FA 5GSTA 2XHFA 4QL9A 1EOHA 2VLTA 1X9MB 3EYTA 2LRNA 4KCAA 1ERWA 2PGTA 1WRYA 1GH2A 3L0HA 1GSUA 2IPAA 1FG4A 1ST9A 2CT6A 1PX7A 4GQCA 2GSRA 1V2AA 4TKYA 4PQHA 1NM3A 3MAKA 3F8UA 3KJYA 2B5YA 3LWAA 1A2LA 1SU9A 11GSA 1QGVA 3ZVJD 3LSZA 2LJAA 2DKHA 2DKIA 1JZDA 3QMXA 1V40A 3F4RA 4AJ8A 2EIOA 20GSA 3EPTA 3KXOA 3W8SA 4FYUA 5HR3A 4K7NA 2R4VA 1PMTA 4NWYA 5ABRA 3UL3A 3E3EA 1SYRA 1QUWA 2OJLA 3A2VA 4EIPA 3L4NA 2D2ZA 2GZPA 3KEBA 9GSSA 4GLTA 4ZBBA 1RK4A 2DJ1A 1GTBA 2H1GA 2MBSA 4FYBA 1ZGNA 4OO4A 2GDRA 1K0BA 1YDKA 3GNJA 3GURA 4N0ZA 1SKSB 5H5QA 3ZIJA 4MJEA 5CRDA 4G19A 2QC7A 2OKAA 2E7PA 1H4OA 4KUNA 4POMA 2LNTA 4XS6A 2PVQA 1BG5A 5IMCA 4HU9A 3I9V2 4MJBA 4PURA 3ZITA 3N5OA 2KLXA 3MYDA 3TRQA 3H1NA 2HRKA 1X5EA 2M80A 2JSYA 4K7IA 1PKZA 1O73A 2GSQA 5F0GA 4OFTA 1NHYA 3HYPA 4XIHA 4DSRA 4IQAA 3D22A 4KE3A 5EPFA 2LRCA 4RQRA 1FB6A 4EVMA 4PUAA 3LXTA 2K8VA 2OE1A 4J2FA 4YKFA 1MDJA 1A8LA 1DE2A 3WYWA 4Z2RA 2UZ8A 1ZYEA 3EURA 4YQUA 3NOFA 2BMXA 1G6YA 4P3YB 10GSA 3TUEA 2H0HA 2N5FA 5IIZA 1XW5A 2FY6A 5F8BA 2J9HA 2AB6A 3GX0A 3BOAA 3MNGA 3UEMA 1PKWA 5CRHA 5AIXA 2YOIA 3C1SA 3TRXA 4F0CA 2GT5A 1XIYA 5AISA 1OE8A 3LG6A 2QKEA 2IMKA 4KB3A 2ZUPA 3UJ1A 1C72A 2G2QA 5B6MA 4IKHA 2DBCA 3HJOA 4WXTA 1TXXA 2IMIA 3KH7A 2LSTA 4V1Ap 3VWXA 3ZFBA 1WJKA 2VLUA 5DDLA 3PR8A 3HY2A 2PN8A 3A2WA 1Z7RA 4KX4A 1M2BA 1THOA 7GSSA 1TU7A 1NW2A 4PX1A 1V9WA 2DC5A 1O8WA 1EEJA 4ZXGA 4Z7XA 2IY2A 5KN3A 3E0UA 4HZ2A 5HR2A 3CBUA 1FVKA 2M46A 3F9UA 1TP9A 4WBJA 3IBHA 2GQKA 3F63A 4PGTA 1MTCA 3U6VA 4OFNA 5G1KA 1XWBA 3EMXA 1OYJA 2V1MA 3QOUA 4L0WA 5F06A 3LXZA 1TU8A 1O85A 2YCDA 2H72A 4O92A 1J08A 2OBIA 3PINA 2OADA 2JZTA 3G7JA 4OO5A 2PMTA 1VRSD 1EP7A 1B48A 2OBKA 2F3MA 2CX3A 1J9BA 5ECNB 1U3AA 4ZB9A 1K0DA 2DIYA 1BJXA 4FYCA 2CZ3A 2YJ7A 1TDIA 2C3NA 1USBA 3UBKA 1B8XA 1G0TA 4EDZA 1EV9A 3VWWA 2X8CA 2C8UA 1XVWA 2FA4A 4L0UA 4FIWA 5LCZA 5J4UA 1O6JA 3ZMKA 1H75A 1ZZYA 2X64A 2N5BA 4TOPA 1ML6A 2L4QA 1R7HA 1Z6NA 2EIQA 3ED3A 1VF2A 2L6DA 3QDNA 1UA5A 5HR1A 5J9CA 4GSTA 1ZYPA 4AJ7A 2HSMA 3APSA 2DJ0A 4JRRA 4F0BA 2RIIA 2LV3A 4ZIJA 1T7PB 4CDOA 1SYXA 2YNXA 1TKDB 2L5OA 4MPGA 4IBPA 1QK8A 3DMLA 2GZYA 1S3DA 1PGTA 2F8AA 2TRCP 4KNDA 2V2GA 1GLPA 3EMPA 4I5QA 5F05A 3HKRA 5ENUA 1AC1A 3RHCA 4EUYA 1N2AA 3HZ4A 4KSOA 2YN1A 2A2RA 5D9VA 3ZTLA 5D96A 3LGCA 2VCXA 4YQMA 2FLSA 1W4VA 2GSTA 4YQVA 2C0FA 3O6TA 1TTZA 2C3QA 3UVTA 1K0AA 4NAXA 4NMUA 3FEUA 2H1DA 4RI7A 3KTLA 2QA2A 1KEBA 4ID0A 2K8SA 5ELAA 2MZCA 1S3CA 2VL9A 2NDOA 3MWHA 1XFLA 3MIXA 4GRFA 1AUCA 4EO3A 4F9ZA 4LL4B 5F07A 2VCTA 4IHUA 4V1Ag 1GNWA 1VF4A 2CVBA 2AHEA 1MDIA 3FK8A 3ERFA 2R0CA 3FZ9A 1BYEA 4BL7B 4EF0A 4K1FA 1QQ2A 1TK0B 1M99A 3FHKA 4O5QA 1BQ7A 2HSHA 4N10A 3EE2A 1G7OA 4OCEA 1OKDA 2K9FA 3TJKA 4X1UA 3EU3A 3TKRA 5ID2A 3EWLA 1ILOA 4MLYA 2AUVA 3IHQA 4N0VA 3P90A 4ILFA 2LNSA 2VL2A 4QQ7A 4K0GA 4BVYB 2DJ2A 2C0EA 1HYUA 4XRDA 2WZ9A 1IYIA 2H70A 1SKWB 1X5DA 1JZOA 4EIQA 3GKMA 4N30A 2DJ3A 2VD1A 1DUGA 1ZMAA 2RUFA 4JEDA 2G0FA 3UIWA 3FR3A 5DALA 3VI5A 4ZILA 3RPPA 1LJRA 1Z7PA 1SK0A 4V2MA 5ECPB 3VWUA 3CMIA 3ME8A 1E2YA 3BD2A 4POKA 5KEJA 4ZL7A 2AV4A 5FHIA 5KN0A 3VPQA 4X4JA 2HFDA 3VPTA 3HJMA 5JCUA 2B1LA 4PXOA 3F3QA 2I3YA 3APQA 4TR3A 2CX4A 5KN2A 1U3IA 3GKXA 4LLRA 1VF1A 3FR9A 4JZQA 4RQXA 2TRXA 5DJLA 8GSSA 5KOWA 2CZ2A 17GSA 5B8BA 12GSA 1M9BA 2PU9C 4ML1A 3QR6A 3GTUA 2WDUA 1EGOA 1O7UA 2GVPA 2O8VB 4QL7A 2IFQA 3WGDA 1GLQA 4HS1A 6GSVA 1XBSA 2O7KA 3GHAA 3KCMA 2GT6A 3KP9A 5CRGA 1GL8A 3K8NA 1G6WA 1K3YA 1GSYA 4MJCA 4EKZA 5ID2B 3QCPA 5ECIB 5ECQB 5AIVA 1A8YA 4IVFA 1LU4A 1ACVA 4GXZA 5B6NA 5HR0A 3QAWA 2YPMA 1X9SB 1T4ZA 2HT9A 4BA7A 1GUKA 2B1KA 4TR0A 5J41A 3TJGA 4XS1A 1OE7A 2XBQA 3M9JA 5ELGA 3D21A 4PQ1A 3UMAA 2LQOA 2YANA 3TJBA 1AXDA 1TI3A 3M8NA 3ERGA 2XPDA 1MDKA 2BJXA 4MA9A 2B3SA 4I8BA 3SWLA 4LMWA 3IDVA 4Q5QA 4O5UA 3M9KA 4N11A 5DQSA 1AW9A 3F4SA 2PBJA 4H86A 4Q5FA 3LJRA 2HZEB 1TRSA 1PL2A 2WS2A 18GSA 3ZRDA 4EE0A 2GLRA 3UOMA 1GTUA 4TVEA 3FRCA 4KF9A 5FWGA 4IELA 4DVCA 1TOFA 5AN1A 1GSDA 3CSIA 4XCSA 4WR5A 4WEYA 3GIXA 2RLIA 2WFCA 4WF4A 3C71A 4YAVA 4NHWA 3C8EA 5ECHB 2H30A 5CNWA 3A5WA 3IC4A 2IL3A 3L9VA 2IFQB 4LA1A 3UARA 2VCVA 1NSWA 2X99A 3KMOA 4MJAA 1JFUA 3WD6A 3NIVA 3W6GA 5JWRB 4EXJA 1MEKA 2L4CA 2LQQA 2VCWA 4MMMA 3LFLA 5DJMA 2P5QA 19GSA 2NPBA 2ZNMA 1NHOA 3D0ZA 2VD0A 1EV4A 1DSBA 1XW9A 1WP0A 4JBBA 2B7KA 4Z2TA 2YV7A 1O81A 1Z6MA 2F8FA 4TRXA 2VL3A 4XRAA 3ERWA 1SJ6A 2A4HA 2YWIA 2EC4A 2CV4A 4ZBDA 1U87A 3C1RA 4EC0A 3TKQA 4K5RA 2VCZA 4ULXA 5EVOA 4NV2A 3GRXA 5A4UA 4WETA 5KN1A 2YZUA 1THXA 1XOBA 6GSWA 4IW9A 2A2SA 4BL7A 2IIYA 4WKWA 1HNBA 4IN0A 3M3MA 4K5SA 2VUPA 2IN3A 3KGKA 5HFKA 1GRXA 1T8EB 1ON4A 3BJ5A 1XOAA 1YEPA 3GFKA 1T1VA 2CQ9A 1ABAA 2PWJA 5CREA 3OR5A 3VURA 1LBKA 3GL3A 5DCHA 5IMDA 4KAEA 2H8LA 5JCWA 3AY8A 1TK8B 1OKTA 2H0IA 3RPNA 1XWCA 1RQMA 4E8HA 3KIJA 1TRVA 4GWRA 5HFGA 1MD4A 2IMDA 5IMAA 2WRTA 3LORA 5DALB 3GV1A 6GSTA 2HYXA 3GN3A 3HVXA 4X43A 3I69A 4OD7A 1EWXA 2P31A 4DSSB 2WGRA 3IE3A 1DBYA 2NBSA 2LTKA 5D9XA 2CVDA 1TRWA 2YP6A 4F2IA 4ECJA 2WULA 5L71A 16GSA 2I9HA 1GSEA 1QFNA 3U5RE 5ECMB 3H93A 2MMNA 1XVQA 4LL1B 2V32A 2XBIA 1YZXA 2V6KA 1HNAA 3GKKA 1ZYQB 4ZBAA 5ECLB 5KOXA 3QFBC 3CRTA 2LEGA 1XWGA 2H6ZA 3IC8A 1ZL9A 3G7IA 5JCGA 2AYTA 1XWAA 3HVSA 2OA7A 6GSSA 2GQLA 3DEXA 3W8JA 4TXVA 4A5PA 3IRAA 3D5JA 1FO5A 3FYGA 3KD0A 2YWMA 2IYJA 1X9WB 1J0FA 2QA1A 4GSSA 1B9XC 2AJQB 2O85A 4IJIA 1FB0A 4I2UA 5CP1A 4G0IA 2GS3A 1DE1A 1TW9A 4BVYA 2R0PA 3FKFA 2WB9A 1Z9HA 2VLVA 2B5EA 5D93A 4IQ1A 3MDKA 3ZZXA 2L5LA 2GQMA 3HJPA 4CW9A 1JLWA 2C0DA 2B6MA 3DKSA 4K2XA 4BPYA 2OACA 4G9HA 1A2MA 3LQ7A 3ZIVA 1R4WA 5DBQA 5E4WA 1Q4JA 2JU5A 1A0RP 5CAXA 1T00A 2YWOA 1SKRB 4MCUA 1M9AA 3ZVJA 3Q74A 2PPTA 1QMVA 4V2NA 4ICYA 2H6XA 5AGYA 2GTUA 5IPGA 2HI7A 3H79A 3LYPA 1AQVA 4BWQA 1XCCA 4ACSA 3Q19A 4PTSA 2K6VA 2YWNA 4MH2A 5GZZB 4EL1A 1F9MA 4YAPA 3WT1A 1YEXA 5ECSA 5H5SA 5G1LA 2H74A 3A2XA 2ALBA 2BTOT 5CRWA 2DSAA 2YV9A 5D8IA 2KHPA 4FO5A 3TKSC 1AQWA 4NPBA 4HQZA 4HZ4A 3QFAC 1AQXA 1WPIA 3LW9A 3CSJA 4AF2A 4D73B 5A5KA 4V2LA 3Q6OA 3FY7A 3EU4A 4KDYA 4L5OA 4J56E 3KZQA 4ECCA 2H71A 5J9BA 4TR1B 4O7HA 4AJ6A 5A4WA 1G7EA 13GSA 3MSZA 3ZREA 1X5CA 1YJ6A 1A23A 1Z3EA 3HD5A 1ZOFA 2LUSA 4CY8A 4POBA 2YJHA 2QGVA 3UAPA 2R37A 3KTBA 3GH6A 3UVHA 1YKAA 1PN9A 3DWVA 3P2AA 3APOA 2WCIA 1FOHA 2F51A 1Z5YE 4G10A 1B4PA 3HZ8A 2HSYA 3I43A 4IGJA 1MD3A 4MP4A 2MMAA 4EDYA 3RHBA 4IS0A 1FVJA 2M72A 3QAGA 4OFMA 3M0FA 4JU5A 1PQNA 5EY6A 4GF0A 4ISDA 3RDWA 1GSQA 3IPZA 2VL2C 4KCEA 5ECKB 1Y6EA 4IJ3A 4HDEA 4MDCA 1SK1A 2KP2A 2IJYA 5EL8A 4ECIA 2FWGA 2JZRA 2LJRA 3PPUA 3BCIA 3US3A 1XWKA 4YH2A 4GSNA 4G0KA 1M0UA 3S9FA 2FHEA 4TR4A 2RM6A 1E6BA 4WR4A 1F37A 1UC7A 1Q98A 3GSSA 4KDUA 4JR4A 1F6MC 2FCHA 3EINA 2PVOC 3VLNA 4NXIA 2H66A 4PUFC 1B4QA 4E8EA 1SL0B 3TOTA 3VWVA 5IO0A 5E59A 6GSXA 2VAFA 1W89A 2FWFA 5IQYA 4KW6A 4TR1A 5DQYA 1JZRA 1PSQA 1SJIA 1CQHA 1T4YA 1OC9B 1WIKA 2QSIA 1OC9A 1ZCPA 1GTIA 3N9JA 1SJZA 3EC3A 4K7OA 3WGEA 1OVNA 5GAPD 4XTSA 5G5FA 3O3TA 3GSTA 2R6KA 3KP8A 1R5PA 1SD9A 5IOWA 5IMVA 4O32A 5ECRB 2X8HA 3VK9A 5J3RA 4F82A 1U88A 2A4VA 2ON7A 3QPMA 5GSSA 4KGIA 5B7CA 2I1UA 3GKNA 1KBNA 2IMEA 2LJKA 3LYKA 4MF5A 1GUHA 2LKUA 4L8EA 3CYNA 5DAKA 4X0XA 2I81A 1GNEA 2NVLA 3CXGA 4Z2UA 4AGSA 4CY6A 1B9YC 1K0OA 2EIRA 2I4AA 5G2ZA 1FOVA 3FZAA 5LNKe 1I9DA 1GUMA 3TJFA 3DGQA 3IK7A 5IMZA 4CHSA 2IMFA 5D73A 3DD3A 3RAZA 2K18A 1R26A 4GTUA 1WOUA 2B5XA 1PD21 2FA8A 5GAND 1ERVA 3FR6A 2P5RA 4KA0A 1Y25A 3IV4A 1X0RA 2P0GA 2JL4A 4I6XA 1EOGA 4HEA2 4POLA 5IPHA 2LS5A 5G31A 2H76A 1F2EA 6GSUA 4XS4B 2Z9SA 4MF6A 1HD2A 4TN8A 3ZYWA 4MZCA 3GA4A 3DYRA 3HHVA 5FT3A 3ZFLA 3IR4A 1BAYA 1QXHA 2X49A 2VM1A 2TIRA 3EVIA 2A2PA 2FGXA 4DEJA 3BBYA 1KTEA 2XPEA 3BCKA 2HRFA 2DIZA 4HU7A 3NZNA 1PL1A 4HI7A 1OC8A 2X4AA 5G5EA 4G2EA 4NV5A 1BEDA 1TRUA 2R0GA 3IK9A 3CTGA 3TKSE 3ZLPA 3GTUB 3CSHA 3G9BA 3ME7A 4FH8A 4KDXA 4MNNA 1OAZA 2IWTA 2ON5A 4K6XA 3DXBA 2FWHA 4K9ZA 2CA8A 2C3TA 3D4MA 1VGLA 4MZWA 5IOXA 1IYHA 1RW1A 4WBRD 3ZMLA 2FD3A 1PA3A 5JWQB 2H73A 5JWOB 2H0GA 3TJJA 4BVXA 1K3OA 3L78A 2AAWA 2DMLA 3H4KA 3TDGA 1GSFA 1XXUA 5H5RA 3PGTA 3DVWA 1M7TA 1K0CA 3IAM2 4Q5RA 2KUCA 3IOSA 3D6IA 2C1YA 3CTFA 3F3RA 1FAAA 1XZOA 3GX8A 4NHZA 4MK3A 1V58A 3R2QA 3HCZA 2HZFA 1R5AA 3TGZA 2CAIA 2HE3A 3FZ4A 3V1WA 1K0MA 2JZSA 1JHBA 1EZKA 4O5RA 4K8MA 3L9UA 1ERTA 2OE0A 2O89A 3QAVA 4MZBA 2MMOA 1JZWA 4WF5A 4TXOB 2FWEA 1AIUA 1WE0A 3KH9A 5D9TA 2ES7A 2VM2A 4D73A 3P7XA 4L5LA 2N5AA 4ZL8A 4MF7A 1XW6A 4HQSA 2V41A 3SBCA 4TXOA 1GULA 1HQOA 5DAKB 2GZZA 1HNCA 1M2AA 4BWSA 2B7JA 3ZL5A 3O76A 4RI6A 1O8XA 3G7YA 4PNFA 1BX9A 5IO2A 3QD9A 2CAQA 3GYKA 5HFIA 2VIMA 4ECBA 4YKGA 3UBLA 5A4VA 4PQIA 2E0QA 1TI1A 4OCFA 2H19A 2R3XA 3RBTA 1A2JA 1EP8A 1EEMA 1SD8A 1GWCA 2YZHA 2L57A 5IMFA 1JLVA 3PH9A 2HXKA 4OWYA 3HVVA 4IP1A 2JACA 5C04A 4GCIA 1TK5B 2E2GA 3IAS2 3TB2A 2WJUA 3HDCA 2DJKA 4LMVA 4I97A 4XS4A 2L59A 5INYA 2HRNA 4MPFA 2HNLA 3GL5A 4MABA 1A24A 3GMFA 4DSQA 3DRNA 1ERUA 1FW1A 4F03A 2REMA 1M2DA 2KP1A 3FW2A 3R3EA 1I5GA 1YQ1A 1PRXA 4XHMA 3LEFA 5DVBA 3FZ5A 2FNOA 2DMMA 2DLXA 4HJ2A 3H8QA 1AAZA 5CO3A 4PNGA 1PN0A 1V98A 3CRUA 1TJDA 2FUG2 4MH3A 2F9SA 1FHEA 5BRTA 3A3TA 3A5IA 2HRAA 2H1BA 1YY7A 4ZL9A 1K3LA 2O87A 4KSMA 3KM6A 2DJJA 2ZCTA 4HJMA 3VFIA 5COHA 4J57E 1UN2A 5D9WA 2RM5A 6GSYA 5LD0A 2R2JA 3C73A 3HXSA 4RUVA 3GUSA 2R5GA 4ZB8A 1GP1A 1OC3A 3P8WA 3E9JB 5J5NA 3TKSA 4IP6A 3TKPA 2X8GA 4DSSA 2VCQA 1SENA 2H6YA 2PUKC 3KMNA 5IM9A 2GGTA 2HZEA 2KOKA 3D4TA 3DIEA 1YKCA 2VO4A 3IXRA 3TCOA 2PERA 3Q18A 4ML6A 2H01A 2NTOA 2H75A 3IA1A 2XC2A 4Q5NA 2C4JA 3TOUA 4BVXB 2C80A 2H1AA 1ZYNA 1U6TA 1WWJA 4FQUA 2RUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3B A;  2MMZ A;  4ZB6 A;  1CQG A;  2J23 A;  1V57 A;  2C0G A;  1UVZ A;  4GQF A;  5C00 A;  5G30 A;  3J7Y k;  1GTA A;  2E2M A;  4HOJ A;  4I2T A;  5ECO B;  1S3A A;  2VOC A;  1WMJ A;  3HA9 A;  2L6C A;  3TRP A;  1A0F A;  3F6D A;  3DVX A;  1SL1 B;  3WT2 A;  3GH9 A;  4JR6 A;  5B8A A;  3VI7 A;  3L9S A;  3I6A A;  4OMV A;  3J7Y b;  1XPV A;  22GS A;  1EGR A;  2JSZ A;  1KNG A;  2JAD A;  1SK2 A;  5DCG A;  3WGX A;  1YF1 A;  4K2D A;  1F3B A;  2HLS A;  4KH7 A;  3F4T A;  4K0N A;  3C7M A;  2GSS A;  4HUA A;  2V6O A;  4JE1 A;  5CYY A;  1GSS A;  2MYG A;  4TW5 A;  5HQP A;  1F3A A;  1URM A;  1PX6 A;  2OE3 A;  1K0N A;  3ISO A;  3M1G A;  1VF3 A;  3JCM L;  2MBT A;  1N8J A;  1YF0 A;  1SL2 B;  2CVK A;  2LRT A;  14GS A;  3F0I A;  3F6F A;  5GST A;  2XHF A;  4QL9 A;  1EOH A;  2VLT A;  1X9M B;  3EYT A;  2LRN A;  4KCA A;  1ERW A;  2PGT A;  1WRY A;  1GH2 A;  3L0H A;  1GSU A;  2IPA A;  1FG4 A;  1ST9 A;  2CT6 A;  1PX7 A;  4GQC A;  2GSR A;  1V2A A;  4TKY A;  4PQH A;  1NM3 A;  3MAK A;  3F8U A;  3KJY A;  2B5Y A;  3LWA A;  1A2L A;  1SU9 A;  11GS A;  1QGV A;  3ZVJ D;  3LSZ A;  2LJA A;  1JZD A;  3QMX A;  1V40 A;  3F4R A;  4AJ8 A;  2EIO A;  20GS A;  3KXO A;  3W8S A;  4FYU A;  5HR3 A;  4K7N A;  2R4V A;  1PMT A;  4NWY A;  5ABR A;  3UL3 A;  3E3E A;  1SYR A;  1QUW A;  2OJL A;  3A2V A;  3L4N A;  2D2Z A;  2GZP A;  3KEB A;  9GSS A;  4GLT A;  4ZBB A;  1RK4 A;  2DJ1 A;  1GTB A;  2H1G A;  2MBS A;  4FYB A;  1ZGN A;  4OO4 A;  2GDR A;  1K0B A;  1YDK A;  3GNJ A;  3GUR A;  4N0Z A;  1SKS B;  5H5Q A;  3ZIJ A;  4MJE A;  5CRD A;  4G19 A;  2QC7 A;  2OKA A;  2E7P A;  1H4O A;  4KUN A;  4POM A;  2LNT A;  4XS6 A;  2PVQ A;  1BG5 A;  5IMC A;  4HU9 A;  3I9V 2;  4MJB A;  4PUR A;  3ZIT A;  3N5O A;  2KLX A;  3TRQ A;  3H1N A;  1X5E A;  2M80 A;  2JSY A;  4K7I A;  1PKZ A;  1O73 A;  2GSQ A;  5F0G A;  4OFT A;  1NHY A;  3HYP A;  4XIH A;  4DSR A;  4IQA A;  3D22 A;  4KE3 A;  5EPF A;  2LRC A;  4RQR A;  1FB6 A;  4EVM A;  4PUA A;  3LXT A;  2K8V A;  2OE1 A;  4J2F A;  1MDJ A;  1A8L A;  1DE2 A;  3WYW A;  1ZYE A;  3EUR A;  4YQU A;  3NOF A;  2BMX A;  1G6Y A;  4P3Y B;  10GS A;  3TUE A;  2H0H A;  2N5F A;  5IIZ A;  1XW5 A;  2FY6 A;  5F8B A;  2J9H A;  2AB6 A;  3GX0 A;  3BOA A;  3MNG A;  3UEM A;  1PKW A;  5CRH A;  5AIX A;  2YOI A;  3C1S A;  3TRX A;  4F0C A;  2GT5 A;  1XIY A;  5AIS A;  1OE8 A;  3LG6 A;  2QKE A;  2IMK A;  4KB3 A;  2ZUP A;  3UJ1 A;  1C72 A;  2G2Q A;  5B6M A;  4IKH A;  2DBC A;  3HJO A;  4WXT A;  1TXX A;  2IMI A;  3KH7 A;  2LST A;  4V1A p;  3VWX A;  3ZFB A;  1WJK A;  2VLU A;  5DDL A;  3PR8 A;  3HY2 A;  2PN8 A;  3A2W A;  1Z7R A;  4KX4 A;  1M2B A;  1THO A;  7GSS A;  1TU7 A;  1NW2 A;  4PX1 A;  1V9W A;  2DC5 A;  1O8W A;  1EEJ A;  4ZXG A;  4Z7X A;  2IY2 A;  5KN3 A;  3E0U A;  4HZ2 A;  5HR2 A;  3CBU A;  1FVK A;  2M46 A;  3F9U A;  1TP9 A;  4WBJ A;  3IBH A;  2GQK A;  3F63 A;  4PGT A;  1MTC A;  3U6V A;  4OFN A;  5G1K A;  1XWB A;  3EMX A;  1OYJ A;  2V1M A;  3QOU A;  4L0W A;  5F06 A;  3LXZ A;  1TU8 A;  1O85 A;  2YCD A;  2H72 A;  4O92 A;  1J08 A;  2OBI A;  3PIN A;  2OAD A;  2JZT A;  3G7J A;  4OO5 A;  2PMT A;  1VRS D;  1EP7 A;  1B48 A;  2OBK A;  2F3M A;  2CX3 A;  1J9B A;  5ECN B;  1U3A A;  4ZB9 A;  1K0D A;  2DIY A;  1BJX A;  4FYC A;  2CZ3 A;  2YJ7 A;  1TDI A;  2C3N A;  1USB A;  3UBK A;  1B8X A;  1G0T A;  4EDZ A;  1EV9 A;  3VWW A;  2X8C A;  2C8U A;  1XVW A;  2FA4 A;  4L0U A;  4FIW A;  5LCZ A;  5J4U A;  1O6J A;  3ZMK A;  1H75 A;  1ZZY A;  2X64 A;  2N5B A;  4TOP A;  1ML6 A;  2L4Q A;  1R7H A;  1Z6N A;  2EIQ A;  3ED3 A;  1VF2 A;  2L6D A;  3QDN A;  1UA5 A;  5HR1 A;  5J9C A;  4GST A;  4AJ7 A;  3APS A;  2DJ0 A;  4JRR A;  4F0B A;  2RII A;  2LV3 A;  4ZIJ A;  1T7P B;  4CDO A;  1SYX A;  2YNX A;  1TKD B;  2L5O A;  4MPG A;  4IBP A;  1QK8 A;  3DML A;  2GZY A;  1S3D A;  1PGT A;  2F8A A;  2TRC P;  4KND A;  2V2G A;  1GLP A;  3EMP A;  4I5Q A;  5F05 A;  3HKR A;  5ENU A;  1AC1 A;  3RHC A;  4EUY A;  1N2A A;  3HZ4 A;  4KSO A;  2YN1 A;  2A2R A;  5D9V A;  3ZTL A;  5D96 A;  3LGC A;  2VCX A;  4YQM A;  2FLS A;  1W4V A;  2GST A;  4YQV A;  2C0F A;  3O6T A;  1TTZ A;  2C3Q A;  3UVT A;  1K0A A;  4NAX A;  4NMU A;  3FEU A;  2H1D A;  4RI7 A;  3KTL A;  1KEB A;  4ID0 A;  2K8S A;  5ELA A;  2MZC A;  1S3C A;  2VL9 A;  2NDO A;  3MWH A;  1XFL A;  4GRF A;  1AUC A;  4EO3 A;  4F9Z A;  4LL4 B;  5F07 A;  2VCT A;  4IHU A;  4V1A g;  1GNW A;  1VF4 A;  2CVB A;  2AHE A;  1MDI A;  3FK8 A;  3ERF A;  3FZ9 A;  1BYE A;  4EF0 A;  4K1F A;  1QQ2 A;  1TK0 B;  1M99 A;  3FHK A;  1BQ7 A;  2HSH A;  4N10 A;  3EE2 A;  1G7O A;  4OCE A;  1OKD A;  2K9F A;  3TJK A;  4X1U A;  3EU3 A;  3TKR A;  5ID2 A;  3EWL A;  1ILO A;  4MLY A;  2AUV A;  3IHQ A;  4N0V A;  3P90 A;  4ILF A;  2LNS A;  2VL2 A;  4QQ7 A;  4K0G A;  2DJ2 A;  2C0E A;  1HYU A;  4XRD A;  2WZ9 A;  1IYI A;  2H70 A;  1SKW B;  1X5D A;  1JZO A;  3GKM A;  4N30 A;  2DJ3 A;  2VD1 A;  1DUG A;  1ZMA A;  2RUF A;  4JED A;  2G0F A;  3UIW A;  3FR3 A;  5DAL A;  3VI5 A;  4ZIL A;  3RPP A;  1LJR A;  1Z7P A;  1SK0 A;  4V2M A;  5ECP B;  3VWU A;  3CMI A;  3ME8 A;  1E2Y A;  3BD2 A;  4POK A;  5KEJ A;  4ZL7 A;  2AV4 A;  5FHI A;  5KN0 A;  3VPQ A;  2HFD A;  3VPT A;  3HJM A;  5JCU A;  2B1L A;  4PXO A;  3F3Q A;  2I3Y A;  3APQ A;  4TR3 A;  2CX4 A;  5KN2 A;  1U3I A;  3GKX A;  4LLR A;  1VF1 A;  3FR9 A;  4JZQ A;  4RQX A;  2TRX A;  5DJL A;  8GSS A;  2CZ2 A;  17GS A;  5B8B A;  12GS A;  1M9B A;  2PU9 C;  4ML1 A;  3QR6 A;  3GTU A;  2WDU A;  1EGO A;  1O7U A;  2GVP A;  2O8V B;  4QL7 A;  2IFQ A;  3WGD A;  1GLQ A;  4HS1 A;  6GSV A;  1XBS A;  2O7K A;  3GHA A;  3KCM A;  2GT6 A;  3KP9 A;  5CRG A;  1GL8 A;  3K8N A;  1G6W A;  1K3Y A;  1GSY A;  4MJC A;  4EKZ A;  5ID2 B;  3QCP A;  5ECI B;  5ECQ B;  5AIV A;  1A8Y A;  4IVF A;  1LU4 A;  1ACV A;  4GXZ A;  5B6N A;  5HR0 A;  3QAW A;  2YPM A;  1X9S B;  1T4Z A;  2HT9 A;  4BA7 A;  1GUK A;  2B1K A;  4TR0 A;  5J41 A;  3TJG A;  4XS1 A;  1OE7 A;  2XBQ A;  3M9J A;  5ELG A;  3D21 A;  4PQ1 A;  3UMA A;  2LQO A;  2YAN A;  3TJB A;  1AXD A;  1TI3 A;  3M8N A;  3ERG A;  2XPD A;  1MDK A;  2BJX A;  4MA9 A;  2B3S A;  4I8B A;  3SWL A;  4LMW A;  3IDV A;  4Q5Q A;  3M9K A;  4N11 A;  5DQS A;  1AW9 A;  3F4S A;  2PBJ A;  4H86 A;  4Q5F A;  3LJR A;  2HZE B;  1TRS A;  1PL2 A;  2WS2 A;  18GS A;  3ZRD A;  4EE0 A;  2GLR A;  3UOM A;  1GTU A;  4TVE A;  3FRC A;  5FWG A;  4IEL A;  4DVC A;  1TOF A;  5AN1 A;  1GSD A;  3CSI A;  4XCS A;  4WR5 A;  4WEY A;  3GIX A;  2RLI A;  2WFC A;  4WF4 A;  3C71 A;  4YAV A;  4NHW A;  3C8E A;  5ECH B;  2H30 A;  5CNW A;  3A5W A;  3IC4 A;  2IL3 A;  3L9V A;  2IFQ B;  4LA1 A;  3UAR A;  2VCV A;  1NSW A;  2X99 A;  3KMO A;  4MJA A;  1JFU A;  3WD6 A;  3NIV A;  3W6G A;  5JWR B;  4EXJ A;  1MEK A;  2L4C A;  2LQQ A;  2VCW A;  4MMM A;  3LFL A;  5DJM A;  2P5Q A;  19GS A;  2NPB A;  2ZNM A;  1NHO A;  3D0Z A;  2VD0 A;  1EV4 A;  1DSB A;  1XW9 A;  1WP0 A;  4JBB A;  2B7K A;  2YV7 A;  1O81 A;  1Z6M A;  2F8F A;  4TRX A;  2VL3 A;  4XRA A;  3ERW A;  1SJ6 A;  2YWI A;  2EC4 A;  2CV4 A;  4ZBD A;  1U87 A;  3C1R A;  4EC0 A;  3TKQ A;  2VCZ A;  4ULX A;  5EVO A;  4NV2 A;  3GRX A;  5A4U A;  4WET A;  5KN1 A;  2YZU A;  1THX A;  1XOB A;  6GSW A;  4IW9 A;  2A2S A;  4BL7 A;  2IIY A;  4WKW A;  1HNB A;  4IN0 A;  3M3M A;  2VUP A;  2IN3 A;  3KGK A;  5HFK A;  1GRX A;  1T8E B;  1ON4 A;  3BJ5 A;  1XOA A;  1YEP A;  3GFK A;  1T1V A;  2CQ9 A;  1ABA A;  2PWJ A;  5CRE A;  3OR5 A;  3VUR A;  1LBK A;  3GL3 A;  5DCH A;  5IMD A;  4KAE A;  2H8L A;  5JCW A;  3AY8 A;  1TK8 B;  1OKT A;  2H0I A;  3RPN A;  1XWC A;  1RQM A;  4E8H A;  3KIJ A;  1TRV A;  4GWR A;  5HFG A;  1MD4 A;  2IMD A;  5IMA A;  2WRT A;  3LOR A;  5DAL B;  3GV1 A;  6GST A;  2HYX A;  3GN3 A;  3HVX A;  4X43 A;  3I69 A;  4OD7 A;  1EWX A;  2P31 A;  4DSS B;  2WGR A;  3IE3 A;  1DBY A;  2NBS A;  2LTK A;  5D9X A;  2CVD A;  1TRW A;  2YP6 A;  4F2I A;  4ECJ A;  2WUL A;  5L71 A;  16GS A;  2I9H A;  1GSE A;  1QFN A;  3U5R E;  5ECM B;  3H93 A;  2MMN A;  1XVQ A;  4LL1 B;  2V32 A;  2XBI A;  1YZX A;  2V6K A;  1HNA A;  3GKK A;  1ZYQ B;  4ZBA A;  5ECL B;  3QFB C;  3CRT A;  2LEG A;  1XWG A;  2H6Z A;  1ZL9 A;  3G7I A;  5JCG A;  2AYT A;  1XWA A;  3HVS A;  2OA7 A;  6GSS A;  2GQL A;  3DEX A;  3W8J A;  4TXV A;  3IRA A;  3D5J A;  1FO5 A;  3FYG A;  3KD0 A;  2YWM A;  2IYJ A;  1X9W B;  1J0F A;  4GSS A;  1B9X C;  2AJQ B;  2O85 A;  4IJI A;  1FB0 A;  4I2U A;  5CP1 A;  2GS3 A;  1DE1 A;  1TW9 A;  4BVY A;  3FKF A;  2WB9 A;  1Z9H A;  2VLV A;  2B5E A;  5D93 A;  4IQ1 A;  3MDK A;  3ZZX A;  2L5L A;  2GQM A;  3HJP A;  4CW9 A;  1JLW A;  2C0D A;  2B6M A;  3DKS A;  4BPY A;  2OAC A;  4G9H A;  1A2M A;  3LQ7 A;  3ZIV A;  1R4W A;  5DBQ A;  5E4W A;  1Q4J A;  2JU5 A;  1A0R P;  5CAX A;  1T00 A;  2YWO A;  1SKR B;  4MCU A;  1M9A A;  3ZVJ A;  3Q74 A;  2PPT A;  1QMV A;  4V2N A;  2H6X A;  5AGY A;  2GTU A;  5IPG A;  2HI7 A;  3H79 A;  3LYP A;  1AQV A;  4BWQ A;  1XCC A;  4ACS A;  3Q19 A;  2K6V A;  2YWN A;  4MH2 A;  5GZZ B;  4EL1 A;  1F9M A;  4YAP A;  3WT1 A;  1YEX A;  5ECS A;  5H5S A;  5G1L A;  2H74 A;  3A2X A;  2ALB A;  2BTO T;  5CRW A;  2DSA A;  2YV9 A;  5D8I A;  2KHP A;  4FO5 A;  3TKS C;  1AQW A;  4NPB A;  4HQZ A;  4HZ4 A;  3QFA C;  1AQX A;  1WPI A;  3CSJ A;  4AF2 A;  4D73 B;  5A5K A;  4V2L A;  3Q6O A;  3FY7 A;  3EU4 A;  4KDY A;  4L5O A;  4J56 E;  3KZQ A;  4ECC A;  2H71 A;  5J9B A;  4TR1 B;  4O7H A;  4AJ6 A;  5A4W A;  1G7E A;  13GS A;  3MSZ A;  3ZRE A;  1X5C A;  1YJ6 A;  1A23 A;  1Z3E A;  3HD5 A;  1ZOF A;  2LUS A;  4POB A;  2YJH A;  2QGV A;  3UAP A;  2R37 A;  3KTB A;  3GH6 A;  3UVH A;  1YKA A;  1PN9 A;  3DWV A;  3P2A A;  3APO A;  2WCI A;  2F51 A;  1Z5Y E;  4G10 A;  1B4P A;  3HZ8 A;  2HSY A;  3I43 A;  4IGJ A;  1MD3 A;  4MP4 A;  2MMA A;  4EDY A;  3RHB A;  4IS0 A;  1FVJ A;  2M72 A;  3QAG A;  4OFM A;  3M0F A;  4JU5 A;  1PQN A;  5EY6 A;  4GF0 A;  4ISD A;  3RDW A;  1GSQ A;  3IPZ A;  2VL2 C;  4KCE A;  5ECK B;  1Y6E A;  4IJ3 A;  4HDE A;  4MDC A;  1SK1 A;  2KP2 A;  2IJY A;  5EL8 A;  4ECI A;  2FWG A;  2JZR A;  2LJR A;  3BCI A;  3US3 A;  1XWK A;  4YH2 A;  4GSN A;  1M0U A;  3S9F A;  2FHE A;  4TR4 A;  2RM6 A;  1E6B A;  4WR4 A;  1F37 A;  1UC7 A;  1Q98 A;  3GSS A;  4KDU A;  4JR4 A;  1F6M C;  3VLN A;  2FCH A;  2PVO C;  3EIN A;  4NXI A;  2H66 A;  4PUF C;  1B4Q A;  4E8E A;  1SL0 B;  3TOT A;  3VWV A;  5IO0 A;  5E59 A;  6GSX A;  2VAF A;  1W89 A;  2FWF A;  5IQY A;  4KW6 A;  4TR1 A;  5DQY A;  1JZR A;  1PSQ A;  1SJI A;  1CQH A;  1T4Y A;  1OC9 B;  1WIK A;  2QSI A;  1OC9 A;  1ZCP A;  1GTI A;  3N9J A;  3WGE A;  1SJZ A;  3EC3 A;  4K7O A;  1OVN A;  5GAP D;  4XTS A;  5G5F A;  3O3T A;  3GST A;  2R6K A;  3KP8 A;  1R5P A;  1SD9 A;  5IOW A;  5IMV A;  4O32 A;  5ECR B;  2X8H A;  3VK9 A;  5J3R A;  4F82 A;  1U88 A;  2A4V A;  2ON7 A;  3QPM A;  5GSS A;  4KGI A;  5B7C A;  2I1U A;  3GKN A;  1KBN A;  2IME A;  2LJK A;  3LYK A;  4MF5 A;  1GUH A;  2LKU A;  4L8E A;  3CYN A;  5DAK A;  4X0X A;  2I81 A;  1GNE A;  2NVL A;  3CXG A;  4AGS A;  1B9Y C;  1K0O A;  2EIR A;  2I4A A;  5G2Z A;  1FOV A;  3FZA A;  5LNK e;  1I9D A;  1GUM A;  3TJF A;  3DGQ A;  3IK7 A;  5IMZ A;  4CHS A;  2IMF A;  5D73 A;  3DD3 A;  3RAZ A;  2K18 A;  1R26 A;  4GTU A;  1WOU A;  2B5X A;  1PD2 1;  2FA8 A;  5GAN D;  1ERV A;  3FR6 A;  2P5R A;  4KA0 A;  1Y25 A;  3IV4 A;  1X0R A;  2P0G A;  2JL4 A;  4I6X A;  1EOG A;  4HEA 2;  4POL A;  5IPH A;  2LS5 A;  5G31 A;  2H76 A;  1F2E A;  6GSU A;  4XS4 B;  2Z9S A;  4MF6 A;  1HD2 A;  4TN8 A;  3ZYW A;  4MZC A;  3GA4 A;  3DYR A;  3HHV A;  5FT3 A;  3ZFL A;  3IR4 A;  1BAY A;  1QXH A;  2VM1 A;  2TIR A;  3EVI A;  2FGX A;  4DEJ A;  3BBY A;  1KTE A;  2XPE A;  3BCK A;  2HRF A;  2DIZ A;  4HU7 A;  3NZN A;  1PL1 A;  4HI7 A;  1OC8 A;  5G5E A;  4G2E A;  4NV5 A;  1BED A;  1TRU A;  3IK9 A;  3CTG A;  3TKS E;  3ZLP A;  3GTU B;  3CSH A;  3G9B A;  3ME7 A;  4FH8 A;  4KDX A;  1OAZ A;  2IWT A;  2ON5 A;  4K6X A;  3DXB A;  2FWH A;  4K9Z A;  2CA8 A;  2C3T A;  3D4M A;  1VGL A;  4MZW A;  5IOX A;  1IYH A;  1RW1 A;  4WBR D;  3ZML A;  2FD3 A;  1PA3 A;  5JWQ B;  2H73 A;  5JWO B;  2H0G A;  3TJJ A;  4BVX A;  1K3O A;  3L78 A;  2AAW A;  2DML A;  3H4K A;  3TDG A;  1GSF A;  1XXU A;  5H5R A;  3PGT A;  3DVW A;  1M7T A;  1K0C A;  3IAM 2;  4Q5R A;  2KUC A;  3IOS A;  3D6I A;  2C1Y A;  3CTF A;  3F3R A;  1FAA A;  1XZO A;  3GX8 A;  4NHZ A;  4MK3 A;  1V58 A;  3R2Q A;  3HCZ A;  2HZF A;  1R5A A;  3TGZ A;  2CAI A;  2HE3 A;  3FZ4 A;  3V1W A;  1K0M A;  2JZS A;  1JHB A;  1EZK A;  4O5R A;  4K8M A;  3L9U A;  1ERT A;  2OE0 A;  2O89 A;  3QAV A;  4MZB A;  2MMO A;  1JZW A;  4WF5 A;  4TXO B;  2FWE A;  1AIU A;  1WE0 A;  3KH9 A;  5D9T A;  2ES7 A;  2VM2 A;  4D73 A;  3P7X A;  4L5L A;  2N5A A;  4ZL8 A;  4MF7 A;  1XW6 A;  4HQS A;  2V41 A;  3SBC A;  4TXO A;  1GUL A;  1HQO A;  5DAK B;  2GZZ A;  1HNC A;  1M2A A;  4BWS A;  2B7J A;  3ZL5 A;  3O76 A;  4RI6 A;  1O8X A;  3G7Y A;  4PNF A;  1BX9 A;  5IO2 A;  3QD9 A;  2CAQ A;  3GYK A;  5HFI A;  2VIM A;  4ECB A;  3UBL A;  5A4V A;  4PQI A;  2E0Q A;  1TI1 A;  4OCF A;  2H19 A;  2R3X A;  3RBT A;  1A2J A;  1EP8 A;  1EEM A;  1SD8 A;  1GWC A;  2YZH A;  2L57 A;  5IMF A;  1JLV A;  3PH9 A;  2HXK A;  4OWY A;  3HVV A;  4IP1 A;  2JAC A;  5C04 A;  4GCI A;  1TK5 B;  2E2G A;  3IAS 2;  3TB2 A;  2WJU A;  3HDC A;  2DJK A;  4LMV A;  4I97 A;  4XS4 A;  2L59 A;  5INY A;  2HRN A;  4MPF A;  2HNL A;  3GL5 A;  4MAB A;  1A24 A;  3GMF A;  4DSQ A;  3DRN A;  1ERU A;  1FW1 A;  4F03 A;  2REM A;  1M2D A;  2KP1 A;  3FW2 A;  1I5G A;  1YQ1 A;  1PRX A;  4XHM A;  3LEF A;  5DVB A;  3FZ5 A;  2FNO A;  2DMM A;  2DLX A;  4HJ2 A;  3H8Q A;  1AAZ A;  5CO3 A;  4PNG A;  1V98 A;  3CRU A;  1TJD A;  2FUG 2;  4MH3 A;  2F9S A;  1FHE A;  3A3T A;  4ZL9 A;  2H1B A;  1YY7 A;  1K3L A;  2O87 A;  4KSM A;  3KM6 A;  2DJJ A;  2ZCT A;  4HJM A;  3VFI A;  5COH A;  4J57 E;  1UN2 A;  5D9W A;  2RM5 A;  6GSY A;  5LD0 A;  2R2J A;  3C73 A;  3HXS A;  4RUV A;  3GUS A;  2R5G A;  4ZB8 A;  1GP1 A;  1OC3 A;  3P8W A;  3E9J B;  5J5N A;  3TKS A;  4IP6 A;  3TKP A;  2X8G A;  4DSS A;  2VCQ A;  1SEN A;  2H6Y A;  2PUK C;  3KMN A;  5IM9 A;  2GGT A;  2HZE A;  2KOK A;  3D4T A;  3DIE A;  1YKC A;  2VO4 A;  3IXR A;  3TCO A;  2PER A;  3Q18 A;  4ML6 A;  2H01 A;  2NTO A;  2H75 A;  3IA1 A;  2XC2 A;  4Q5N A;  2C4J A;  3TOU A;  2C80 A;  2H1A A;  1U6T A;  1WWJ A;  2RUE A; 
#chains in the Genus database with same CATH topology
 3IPT A;  3G71 3;  1T3B A;  2MMZ A;  4ZB6 A;  1CQG A;  4O8S A;  2D1W A;  2J23 A;  1V57 A;  2C0G A;  1UVZ A;  4GQF A;  5C00 A;  5G30 A;  2WGO A;  3J7Y k;  1FUW A;  1GTA A;  4MJD A;  2CFG A;  2E2M A;  4HOJ A;  4I2T A;  5ECO B;  1X1W A;  2CC3 A;  3WOF B;  2AAE A;  2OTL 3;  1O7G B;  1S3A A;  2VOC A;  1IT8 A;  1WMJ A;  5BMU A;  1J2B A;  1CH0 A;  3HA9 A;  3CPW 2;  2KAA A;  3FMW A;  1NWW A;  4HJL B;  2L6C A;  2XF3 A;  3TRP A;  1A0F A;  3F6D A;  3DVX A;  3HI7 A;  1SL1 B;  3WT2 A;  2BMO B;  3GH9 A;  4JR6 A;  5B8A A;  3VI7 A;  3F14 A;  5IG4 A;  3L9S A;  3IHG A;  3I6A A;  1DMM A;  4OMV A;  4USS A;  3J7Y b;  1XPV A;  22GS A;  1EGR A;  3ECF A;  2JSZ A;  1GY7 A;  1KNG A;  1HZ1 A;  2JAD A;  1SK2 A;  1JBS A;  5DCG A;  1K73 4;  3WGX A;  1YF1 A;  4K2D A;  2WGQ A;  1F3B A;  4G0L A;  4XB5 A;  1YJN 3;  2HLS A;  1UCJ A;  4KH7 A;  4WYK A;  3F4T A;  4K0N A;  2BO9 B;  3C7M A;  2GSS A;  1BSE A;  3DY5 A;  4HUA A;  2V6O A;  4JE1 A;  5CYY A;  5M1A A;  1GSS A;  2MYG A;  4TW5 A;  5HQP A;  4BL3 A;  1F3A A;  2CFW A;  1URM A;  1CYV A;  5STD A;  1BU4 A;  1PX6 A;  2OE3 A;  1UCK A;  1K0N A;  3ISO A;  4KZ1 A;  1VQ7 3;  3M1G A;  1W7C A;  1VF3 A;  1I70 A;  5CK6 A;  3JCM L;  2MBT A;  1N8J A;  1YF0 A;  1SL2 B;  1FUT A;  2CVK A;  2LRT A;  14GS A;  2I9W A;  3WMD A;  1BSD A;  3F0I A;  2FNQ A;  3F6F A;  3ZFZ A;  5GST A;  2XHF A;  1GOY A;  4QL9 A;  3BNB A;  2ML6 A;  1EOH A;  2VLT A;  1X9M B;  3EYT A;  2LRN A;  1STD A;  3OW2 2;  1ERW A;  4KCA A;  2PGT A;  1WRY A;  3F40 A;  1GD4 A;  1GH2 A;  4HM6 B;  3L0H A;  1GSU A;  3GAX A;  2IPA A;  1FG4 A;  1ST9 A;  2CT6 A;  1PX7 A;  1W2Z A;  4GQC A;  2GSR A;  3N54 B;  3T8N A;  1V2A A;  4TKY A;  3I56 3;  4PQH A;  2Y73 A;  1NM3 A;  5JPP A;  3F8U A;  3KJY A;  3MAK A;  5BVB A;  2B5Y A;  3LWA A;  1A2L A;  3BIR A;  1SU9 A;  3E99 A;  11GS A;  1KC8 4;  2XR8 B;  1QGV A;  3EBY A;  3ZVJ D;  3LSZ A;  2LJA A;  2DKH A;  2DKI A;  1JZD A;  1UI7 A;  5CF2 A;  3QMX A;  1V40 A;  3F4R A;  4AJ8 A;  3MG2 A;  20GS A;  2EIO A;  1O7M B;  3EPT A;  3KXO A;  3W8S A;  4LZI A;  4FYU A;  4K7N A;  5HR3 A;  2R4V A;  1QMA A;  1PMT A;  4NWY A;  5ABR A;  3UL3 A;  3G6E 3;  4R4K A;  3E3E A;  1SYR A;  1QUW A;  2FGT A;  2OJL A;  3A2V A;  4EIP A;  3L4N A;  2D2Z A;  1YIT 3;  2GZP A;  2F56 A;  3KEB A;  9GSS A;  4GLT A;  4ZBB A;  1RK4 A;  2DJ1 A;  1GTB A;  2H1G A;  2MBS A;  1GOU A;  3WHO A;  4FYB A;  1ZGN A;  4OO4 A;  2GDR A;  3ZG0 A;  1S3R A;  1K0B A;  1YDK A;  3GNJ A;  5EVH A;  3GUR A;  4N0Z A;  1SKS B;  5H5Q A;  3ZIJ A;  4MJE A;  1D6Z A;  5CRD A;  4G19 A;  3KFQ C;  1CYU A;  4N6N B;  2QC7 A;  1YJW 3;  2OKA A;  3L0R A;  1A67 A;  5IER A;  1H4O A;  2E7P A;  4KUN A;  4POM A;  2LNT A;  1PU4 A;  3RGR A;  4XS6 A;  2PVQ A;  4CCV A;  4H3U A;  1BG5 A;  1W2B 2;  5IMC A;  1AVL A;  4HU9 A;  5AYS C;  4STD A;  3A5E A;  3I9V 2;  4MJB A;  4PUR A;  3ZIT A;  1IVX A;  1WTH A;  3N5O A;  2KLX A;  3MYD A;  3I0Y A;  3TRQ A;  1EQK A;  5AEU B;  2A15 A;  1OHP A;  1IQY A;  1MWU A;  3H1N A;  4FMA A;  2HRK A;  1X5E A;  3V99 A;  2M80 A;  2JSY A;  3SX1 A;  3DGY A;  3CD6 3;  4K7I A;  1PKZ A;  1O73 A;  4AEQ A;  2GSQ A;  2OWP A;  5F0G A;  1G02 A;  4OFT A;  3S29 A;  1WMN A;  1RMS A;  1NHY A;  3HYP A;  3WR2 A;  4XIH A;  3OWU A;  1VQK 3;  4DSR A;  4IQA A;  4LGQ A;  4EV5 A;  4EYC A;  3ZG5 A;  3D22 A;  4KE3 A;  5EPF A;  2LRC A;  4RQR A;  1FB6 A;  4EVM A;  4MMY B;  4PUA A;  3LXT A;  3S5C A;  3DGM A;  2K8V A;  2JDI H;  1LOW A;  1YGW A;  3CC2 3;  1N9E A;  2OE1 A;  1OF5 A;  1X1U A;  4J2F A;  4YKF A;  1MDJ A;  2PZV A;  2GBW B;  2F99 A;  1A8L A;  3LT9 A;  1OPY A;  1DE2 A;  3WYW A;  3HZP A;  1R4C A;  4Z2R A;  2UZ8 A;  4HM8 B;  1ZYE A;  1S5A A;  3EUR A;  4YQU A;  3NOF A;  2BMX A;  1OUN A;  1G6Y A;  3SOA A;  4P3Y B;  10GS A;  4N6L A;  2P05 A;  3TUE A;  1LQM B;  5IEN A;  5HGR A;  2FXT A;  2H0H A;  2IMJ A;  2N5F A;  5IIZ A;  1XW5 A;  2FY6 A;  4H61 A;  3PCS A;  5F8B A;  3EX9 A;  1ZGX A;  2RFR A;  2AB6 A;  2J9H A;  3GX0 A;  1SJW A;  1Q81 4;  3K7C A;  3BOA A;  3MNG A;  1ULI B;  3HVN A;  3UEM A;  1GMR A;  3JUM A;  1PKW A;  5CRH A;  1I2F A;  3DUK A;  5AIX A;  2YOI A;  1VQ8 3;  3JUO A;  3C1S A;  3TRX A;  4F0C A;  2GT5 A;  4NHF A;  1XIY A;  5AIS A;  1OE8 A;  4FCM A;  3GWR A;  4HM3 B;  3LG6 A;  2QKE A;  2IMK A;  3X3X A;  4KB3 A;  5TGN A;  2ZUP A;  1UW1 A;  1C72 A;  3UJ1 A;  3T8U A;  2Y74 A;  1IQX A;  2G2Q A;  5B6M A;  4IKH A;  2DBC A;  3HJO A;  4WXT A;  1TXX A;  2IMI A;  3KH7 A;  3MG1 A;  2LST A;  1RRL A;  4V1A p;  3VWX A;  3ZFB A;  4K1V A;  3K5T A;  3FGY A;  4Q53 A;  1E97 A;  1WJK A;  2VLU A;  5DDL A;  1T2I A;  3PR8 A;  1JRQ A;  5GSP A;  5LC7 A;  3HY2 A;  2PN8 A;  3A2W A;  2QIY A;  1Z7R A;  2OCT A;  4KX4 A;  1M2B A;  1THO A;  7GSS A;  1TU7 A;  4WFO A;  1NW2 A;  4PX1 A;  1V9W A;  2DC5 A;  3GZR A;  1O8W A;  1EEJ A;  4ZXG A;  1BRJ A;  1KWI A;  3D79 A;  4Z7X A;  2BT3 A;  2IY2 A;  3CNX A;  5KN3 A;  3E0U A;  4HZ2 A;  5HR2 A;  1OGZ A;  1I3F A;  3CBU A;  1FVK A;  2M46 A;  3F9U A;  1TP9 A;  4WBJ A;  3IBH A;  2GQK A;  3F63 A;  2GXF A;  4PGT A;  1MTC A;  4RNZ A;  3U6V A;  4OFN A;  5G1K A;  1XWB A;  3EMX A;  1OYJ A;  2V1M A;  3QOU A;  4L0W A;  3LXZ A;  5F06 A;  1TU8 A;  1O85 A;  2YCD A;  2H72 A;  4O92 A;  1J08 A;  2OBI A;  4RNY A;  3PIN A;  1FGR A;  2CIU A;  5AII A;  5KP4 A;  2OAD A;  3D3L A;  2JZT A;  3G7J A;  4OO5 A;  1GY5 A;  2PMT A;  4N3V A;  1VRS D;  1EP7 A;  1B48 A;  3SXX A;  2OBK A;  2F3M A;  2CX3 A;  2E2V A;  1J9B A;  1MNL A;  1S72 3;  5ECN B;  1U3A A;  4GL6 A;  4ZB9 A;  4KFF A;  1K0D A;  1VQ9 3;  1M1K 4;  1Q7H A;  2DIY A;  1BJX A;  4FYC A;  3MSO A;  4XDV A;  2CZ3 A;  2YJ7 A;  1TDI A;  2C3N A;  3JUQ A;  1M1X B;  1FA3 A;  1USB A;  3UBK A;  1B8X A;  3NXJ A;  2Z6B A;  4HYZ A;  1G0T A;  5IEP A;  4EDZ A;  2CFL A;  1EV9 A;  3VWW A;  1JB4 A;  2X8C A;  4GSP A;  2C8U A;  1XVW A;  2FA4 A;  4L0U A;  4FIW A;  2OOV A;  3GRD A;  5LCZ A;  5J4U A;  1O6J A;  5IEO A;  3ZMK A;  1H75 A;  2R4I A;  1ZZY A;  1JBT A;  2X64 A;  2N5B A;  1XG8 A;  4TOP A;  1BGS A;  1NB5 I;  5HOH A;  1ML6 A;  3FSD A;  3AMO A;  2L4Q A;  1R7H A;  1Z6N A;  2EIQ A;  3ED3 A;  4QWT A;  1VF2 A;  2L6D A;  5D82 A;  3QDN A;  4HM4 B;  1UA5 A;  5HR1 A;  2JQ5 A;  5J9C A;  4GST A;  1ZYP A;  4HM1 B;  2QGU A;  1L5G B;  1HU9 A;  1W6Y A;  1YNV X;  1ZX2 A;  4AJ7 A;  2HSM A;  3APS A;  3PCR A;  2DJ0 A;  1RN1 A;  4JRR A;  1IVW A;  4F0B A;  2CG0 A;  2RII A;  1W5Z A;  2LV3 A;  4ZIJ A;  2KXG A;  1WMP A;  2BIR A;  1KD1 4;  1T7P B;  5AEW B;  4CDO A;  6RNT A;  1SYX A;  4XBT A;  2YNX A;  1TKD B;  1TP6 A;  2L5O A;  4N6U A;  4MPG A;  1N8R 4;  4IBP A;  1QK8 A;  3DML A;  2GZY A;  4X2O A;  1S3D A;  5BIR A;  1PGT A;  2F8A A;  2TRC P;  4KND A;  3CXC 2;  2V2G A;  1N5H A;  3EF8 A;  3MWZ A;  1GLP A;  3EMP A;  3RGA A;  4I5Q A;  1C54 A;  5F05 A;  5CF1 A;  3HKR A;  5ENU A;  1AC1 A;  3RHC A;  4EUY A;  1N2A A;  3HZ4 A;  2K0M A;  3KCH A;  4KSO A;  2YN1 A;  3NX0 A;  2A2R A;  5D9V A;  3ZTL A;  5D96 A;  3LGC A;  2VCX A;  4YQM A;  2FLS A;  1W4V A;  2GST A;  3CMA 3;  2GSP A;  1B27 A;  4YQV A;  1Q42 A;  2C0F A;  3O6T A;  1TTZ A;  4FMB A;  2C3Q A;  3UVT A;  1W00 A;  1K0A A;  4NAX A;  3DM8 A;  4NMU A;  3FEU A;  2H1D A;  4K1U A;  7RNT A;  4RI7 A;  3KTL A;  4FR9 A;  2QA2 A;  1KEB A;  4ID0 A;  2K8S A;  5ELA A;  2MZC A;  1S3C A;  2VL9 A;  2NDO A;  3MWH A;  1KSI A;  1EKM A;  1XFL A;  3MIX A;  1JB5 A;  1AUC A;  4GRF A;  4EO3 A;  4F9Z A;  3S27 A;  4LL4 B;  1GYB A;  5F07 A;  3SOY A;  8RNT A;  5ELU A;  2XFT A;  2VCT A;  4IHU A;  4V1A g;  1GNW A;  1VF4 A;  2CVB A;  2AHE A;  1V74 A;  2CK3 H;  3X41 A;  3JUP A;  4KT3 B;  3NV0 A;  4PEJ A;  1MDI A;  5RNT A;  3FK8 A;  3ERF A;  2R0C A;  3FZ9 A;  1BYE A;  4BL7 B;  4EF0 A;  3NBJ A;  1QQ2 A;  4K1F A;  1TK0 B;  1RKY A;  1M99 A;  3FHK A;  1UGI A;  4O5Q A;  1AV4 A;  1BQ7 A;  2HSH A;  4N10 A;  2W56 A;  3EE2 A;  3MPH A;  2W0Q A;  1IV7 A;  1G7O A;  4OCE A;  2CX1 A;  1OKD A;  2K9F A;  3TJK A;  4X1U A;  3EU3 A;  3TKR A;  5ID2 A;  3GSP A;  3EWL A;  1AR0 A;  1ILO A;  3HOH A;  4MLY A;  2AUV A;  3IHQ A;  1K9M 4;  1UUW B;  2CFD A;  4N0V A;  3P90 A;  4ILF A;  2LNS A;  1RGK A;  2VL2 A;  4QQ7 A;  1SQW A;  4K0G A;  4BVY B;  2DJ2 A;  3H3H A;  2C0E A;  1HYU A;  4XRD A;  1BRH A;  2WZ9 A;  3NBR A;  3WA2 X;  5D81 A;  8CHO A;  1IYI A;  2H70 A;  4KFD A;  1SKW B;  1X5D A;  4HOH A;  1JZO A;  3HIG A;  1A90 A;  4EIQ A;  3GKM A;  4N30 A;  2RGQ A;  4N6T A;  2DJ3 A;  2W6J H;  1RJO A;  1YVS A;  2VD1 A;  1DUG A;  1ZMA A;  1N8Q A;  1U8C B;  2QA4 3;  2F5W A;  2RUF A;  4JED A;  2G0F A;  2XFS A;  1I2E A;  3UIW A;  3FR3 A;  5DAL A;  3VI5 A;  4ZIL A;  3RPP A;  2UGI A;  1LJR A;  1RGF A;  1Z7P A;  1SK0 A;  4V2M A;  1WMO A;  1IYY A;  1Q86 4;  5ECP B;  4O2H A;  3VWU A;  3CMI A;  2XRX B;  2SAR A;  2WO0 A;  3CCE 3;  3ME8 A;  1E2Y A;  1K41 A;  4FMD A;  3BD2 A;  4POK A;  5KEJ A;  4ZL7 A;  4XBY A;  2AV4 A;  2O3O A;  3J7Y d;  5FHI A;  1OHO A;  1RTU A;  5KN0 A;  4OVM A;  3VPQ A;  4X4J A;  2HFD A;  1BUQ A;  3VPT A;  3HJM A;  5JCU A;  2B1L A;  4PXO A;  3F3Q A;  2I3Y A;  3APQ A;  4TR3 A;  2CX4 A;  5KN2 A;  1OAC A;  1U3I A;  3GKX A;  3FZW A;  4LLR A;  1VF1 A;  3FR9 A;  1BRK A;  4JZQ A;  4RQX A;  2TRX A;  2C11 A;  3QK9 A;  5DJL A;  4ZM8 A;  8GSS A;  3X3Z A;  5KOW A;  2CZ2 A;  1TFK A;  17GS A;  3D5G A;  5B8B A;  3BB9 A;  1I0X A;  12GS A;  1M9B A;  2PU9 C;  3BNE A;  2KRT A;  1LNH A;  1O7P B;  1O7N B;  1LQG C;  3OX9 A;  3QR6 A;  4ML1 A;  3GTU A;  2WDU A;  1EGO A;  1O7U A;  2GVP A;  2O8V B;  4QL7 A;  2IFQ A;  3WGD A;  2BNG A;  2KF3 A;  1B2M A;  1GLQ A;  4HS1 A;  6GSV A;  2Z7A A;  3I55 3;  1XBS A;  1MWS A;  2O7K A;  1Q40 B;  3GHA A;  3KCM A;  3GZX B;  1RCK A;  1DMN A;  4FCZ A;  2GT6 A;  1ROV A;  3KP9 A;  5IG3 A;  1E3V A;  3OWY A;  1YHQ 3;  5CRG A;  1BNI A;  2W56 B;  3CME 3;  1GL8 A;  1LRA A;  3OXA A;  3K8N A;  1G6W A;  1K3Y A;  1GSY A;  4MJC A;  4EKZ A;  5ID2 B;  1PY3 A;  3LML A;  5CLK A;  3QCP A;  5ECI B;  5ECQ B;  5AIV A;  1A8Y A;  4IVF A;  1LVN A;  1LU4 A;  1ACV A;  4GXZ A;  4FMC A;  5B6N A;  5HR0 A;  3QAW A;  2YPM A;  1X9S B;  4XM4 A;  4RBN A;  1T4Z A;  2HT9 A;  4BA7 A;  1GUK A;  1B2U A;  2B1K A;  4TR0 A;  1YGE A;  5J41 A;  3TJG A;  4XS1 A;  1OE7 A;  2XBQ A;  3M9J A;  1RGL A;  5ELG A;  3D21 A;  4PQ1 A;  3UMA A;  3KKG A;  1FGQ A;  2GU1 A;  2LQO A;  2YAN A;  3TJB A;  1AXD A;  1TI3 A;  3M8N A;  1RN7 A;  2IA7 A;  2KF6 A;  3ERG A;  4HM5 B;  2XPD A;  4HM2 B;  1MDK A;  2BJX A;  4MA9 A;  2B3S A;  4I8B A;  3SWL A;  4LMW A;  4HSC X;  3IDV A;  4Q5Q A;  4O5U A;  4CDL A;  3M9K A;  3AMO B;  1VQN 3;  4N11 A;  5DQS A;  1AW9 A;  1JN5 B;  3F4S A;  2PBJ A;  3EQQ B;  4H86 A;  2YX9 A;  3WDG B;  3UL6 A;  3Q2P A;  3LJR A;  4Q5F A;  3ROB A;  1BVI A;  1VQL 3;  2HZE B;  1TRS A;  1PL2 A;  1KQS 2;  2WS2 A;  18GS A;  3ZRD A;  4EE0 A;  2GLR A;  4HZB B;  1NO3 A;  3UOM A;  1GTU A;  5DRV A;  4TVE A;  3NBB A;  3K9M C;  3FRC A;  4KF9 A;  5FWG A;  4IEL A;  2W04 A;  4BTY A;  4DVC A;  1TOF A;  5AN1 A;  1GSD A;  3CSI A;  4XCS A;  4WR5 A;  3LH4 A;  2CWU A;  4WEY A;  3GIX A;  1M3I A;  2RLI A;  2WFC A;  1FGO A;  4WF4 A;  3C71 A;  4YAV A;  3FF2 A;  3T0U A;  4NHW A;  3C8E A;  3UNL A;  5ECH B;  1BAN A;  1RGC A;  2H30 A;  4GB5 A;  5CNW A;  3A5W A;  3IC4 A;  2IL3 A;  5FW5 A;  2IFQ B;  1B2Z A;  3L9V A;  2VCV A;  4LA1 A;  1RN4 A;  1NSW A;  3UAR A;  2X99 A;  3KMO A;  4MJA A;  1JFU A;  3WD6 A;  1F8N A;  1FYS A;  3NIV A;  4N6O B;  3W6G A;  5JWR B;  1RRH A;  1MEK A;  2L4C A;  4EXJ A;  2LQQ A;  3MG3 A;  1Y4K A;  2VCW A;  4MMM A;  3LFL A;  2W2C A;  5DJM A;  2P5Q A;  19GS A;  2NPB A;  4IIA A;  2ZNM A;  1NHO A;  3D0Z A;  2VD0 A;  1ZS7 A;  1EV4 A;  3CPO A;  1DSB A;  1BNE A;  1XW9 A;  3CCQ 3;  1QAF A;  1WP0 A;  3PXM A;  2MF7 A;  4JBB A;  2B7K A;  4Z2T A;  2YV7 A;  1O81 A;  1Z6M A;  2F8F A;  4TRX A;  1C7H A;  1BNF A;  5IW9 A;  2VL3 A;  1BOX A;  4XRA A;  4R1K A;  1B21 A;  2P38 A;  3ERW A;  1SJ6 A;  2A4H A;  2YWI A;  4EC6 A;  1HKX A;  2EC4 A;  2CV4 A;  4ZBD A;  1U87 A;  1UDI I;  3NUV A;  3C1R A;  3X40 A;  4EC0 A;  3Q90 A;  4AKZ A;  3TKQ A;  4K5R A;  3FLJ A;  2VCZ A;  3F8H A;  4MMX B;  3NQZ A;  4ULX A;  4WHA A;  5M18 A;  5EVO A;  2UUG C;  3UB1 A;  4NV2 A;  4L8O A;  3G0K A;  3GRX A;  5A4U A;  4WET A;  2F98 A;  5KN1 A;  2YZU A;  1THX A;  1XOB A;  5AYR B;  6GSW A;  4IW9 A;  2A2S A;  4BL7 A;  2K3D A;  1Q82 4;  2IIY A;  4WKW A;  1HNB A;  4IN0 A;  3BNC A;  4HKV B;  3M3M A;  4K5S A;  2VUP A;  3S67 A;  2IN3 A;  3KGK A;  4EV2 A;  5HFK A;  1GRX A;  1T8E B;  1ON4 A;  1BSB A;  3BJ5 A;  1XOA A;  1YEP A;  3GFK A;  1T1V A;  2CQ9 A;  2M7O A;  2K54 A;  1ABA A;  5AI1 A;  2PWJ A;  5CRE A;  4FCJ A;  2CHC A;  3OR5 A;  3VUR A;  1LXE A;  3ALA A;  1JN5 A;  1YVB I;  1LBK A;  3GL3 A;  3FH1 A;  2PNC A;  5DCH A;  5IMD A;  4KAE A;  2H8L A;  5JCW A;  3AY8 A;  1TK8 B;  4K90 B;  5AIG A;  2H0I A;  1OKT A;  1IVU A;  3D5I A;  2CG1 A;  3RPN A;  1XWC A;  1RQM A;  4I4K A;  4E8H A;  1IK3 A;  1QAL A;  1FUS A;  3KIJ A;  1UUV B;  1BRN L;  1TRV A;  4GWR A;  5HFG A;  1MD4 A;  2IMD A;  3V98 A;  5IMA A;  1Q9E A;  2WRT A;  3LOR A;  5DAL B;  3B8L A;  3GV1 A;  6GST A;  2HYX A;  1FGT A;  3SLU A;  3GN3 A;  1PFO A;  3HVX A;  3I69 A;  4OD7 A;  3NM2 A;  4X43 A;  1EWX A;  3UJM A;  3PYJ A;  3LTB A;  2P31 A;  4DSS B;  1VQQ A;  2WGR A;  3B7C A;  3IE3 A;  3EHC A;  1DBY A;  2NBS A;  3LXU X;  2LTK A;  5D9X A;  2CVD A;  1TRW A;  1VQ6 3;  2YP6 A;  4F2I A;  1RGE A;  4ECJ A;  2WUL A;  5L71 A;  2CWT A;  16GS A;  2I9H A;  1GSE A;  1QFN A;  3U5R E;  5ECM B;  3H93 A;  2BHM A;  2MMN A;  4KVH A;  1XVQ A;  1ROA A;  4LL1 B;  2V32 A;  2XBI A;  1YZX A;  4N6M A;  2V6K A;  4AKY A;  1W01 A;  1HNA A;  2E2U A;  3DH2 A;  3GKK A;  1ZYQ B;  4ZBA A;  1M90 4;  2Z77 A;  2OTJ 3;  4CJN A;  5ECL B;  5KOX A;  3QFB C;  2AAD A;  2YFJ B;  3CRT A;  2LEG A;  4LYL B;  1XWG A;  2H6Z A;  1EUI C;  1JB2 A;  3NV0 B;  3IC8 A;  2B24 B;  2KCD A;  1ZL9 A;  3G7I A;  2HMM B;  2UX0 A;  3MYT A;  5JCG A;  2AYT A;  1XWA A;  3HVS A;  2OA7 A;  6GSS A;  2GQL A;  3RDE A;  3DEX A;  3W8J A;  4TXV A;  2GU3 A;  4A5P A;  5BXQ A;  3IRA A;  3D5J A;  1FO5 A;  2HMJ B;  3FYG A;  3KD0 A;  2YWM A;  1BNR A;  3AHW A;  2IYJ A;  1X9W B;  1J0F A;  2QA1 A;  4GSS A;  4O3V A;  1B9X C;  4XDW A;  1OH0 A;  1MWR A;  3CCM 3;  2O85 A;  2AJQ B;  3M8C A;  2D42 A;  3LT8 A;  4IJI A;  1FB0 A;  4I2U A;  5CP1 A;  4G0I A;  2CW9 A;  2GS3 A;  1DE1 A;  1TW9 A;  4BVY A;  2R0P A;  3F7X A;  2F86 B;  3FKF A;  2WB9 A;  4GHO A;  1I8V A;  1Z9H A;  2XH9 A;  1B2S A;  3ER7 A;  1B2X A;  2VLV A;  2B5E A;  5D93 A;  4IQ1 A;  3MDK A;  3ZZX A;  2L5L A;  4J9A A;  2GQM A;  2P09 A;  1FW7 A;  1I3I A;  2GEY A;  3HJP A;  3OWS A;  4CW9 A;  2IUJ A;  2HMK B;  1JLW A;  2C0D A;  2B6M A;  3DKS A;  4K2X A;  4BPY A;  5EEO A;  3U97 A;  2OAC A;  2XEP A;  3CQF A;  4G9H A;  1A2M A;  3H51 A;  3LQ7 A;  3ZIV A;  1R4W A;  5DBQ A;  5E4W A;  1Q4J A;  2JU5 A;  1A0R P;  5CAX A;  3F7S A;  4NRE A;  1T00 A;  2YWO A;  1US1 A;  1SKR B;  4MCU A;  1M9A A;  3ZVJ A;  3Q74 A;  2PPT A;  1QMV A;  3CC7 3;  4V2N A;  4ICY A;  2H6X A;  5AGY A;  2GTU A;  5IPG A;  3EN8 A;  3HK4 A;  2HI7 A;  3H79 A;  2XGN A;  3LYP A;  1AQV A;  4BWQ A;  1JV2 B;  2F4Y A;  1XCC A;  4ACS A;  1CEW I;  4JRF A;  1RNT A;  3Q19 A;  2C10 A;  4PTS A;  3IMA B;  2K6V A;  2YWN A;  4MH2 A;  5GZZ B;  4EL1 A;  1F9M A;  1PYL A;  4YAP A;  1OCV A;  3CCL 3;  3WT1 A;  1BSC A;  7GSP A;  1E3R A;  1YEX A;  5ECS A;  5H5S A;  3KN4 A;  4R80 A;  2OOV C;  5G1L A;  2H74 A;  4WWU C;  2STD A;  1PFP A;  3A2X A;  1NB3 I;  2ALB A;  1UCI A;  2BTO T;  5CRW A;  1BRG A;  2DSA A;  4HM0 B;  2ZDJ A;  2YV9 A;  5D8I A;  2KHP A;  4FO5 A;  3TKS C;  1BNJ A;  1AQW A;  4NPB A;  1O7W B;  4HQZ A;  4HZ4 A;  3QFA C;  1LOY A;  3F8X A;  1AQX A;  1N9J A;  4BL2 A;  1WPI A;  1VQ4 3;  3LW9 A;  3CSJ A;  1EA2 A;  4AF2 A;  4D73 B;  1ASK A;  5A5K A;  2W03 A;  4V2L A;  3Q6O A;  4X2H A;  2CFK A;  3FY7 A;  3EU4 A;  1W4N A;  3X42 A;  4KDY A;  4L5O A;  2ZA4 A;  3DGO A;  4J56 E;  3KZQ A;  4ECC A;  2H71 A;  5J9B A;  4TR1 B;  4O7H A;  4AJ6 A;  5A4W A;  1G7E A;  13GS A;  3MSZ A;  3ZRE A;  4KFE A;  6STD A;  1O7H B;  3LTC A;  1X5C A;  2HMN B;  2W9P A;  1YJ6 A;  4J5G A;  1A23 A;  1Z3E A;  3HD5 A;  1ZOF A;  2LUS A;  4CY8 A;  2MC8 A;  1OGX A;  3VF1 A;  4POB A;  3BND A;  2YJH A;  2QGV A;  3UAP A;  1UGH I;  5CXO A;  1N5P A;  2R37 A;  3KTB A;  1WQL B;  9RNT A;  3GH6 A;  3UVH A;  4J8T A;  2WOH A;  5BU4 A;  1YKA A;  1PN9 A;  3DWV A;  3P2A A;  5AIF A;  3KE7 A;  5ELJ A;  3APO A;  4EBG A;  1AQZ A;  5D83 A;  2WCI A;  4K61 A;  3G4S 3;  3X3Y A;  1FOH A;  2F51 A;  1Z5Y E;  4G10 A;  4BTW A;  1B4P A;  3HZ8 A;  2HSY A;  3I43 A;  1RGH A;  4LSO A;  4IGJ A;  1MD3 A;  4MP4 A;  2MMA A;  4EDY A;  3RHB A;  4IS0 A;  1FVJ A;  3KZT A;  3CCS 3;  1FZU A;  2C4B A;  2M72 A;  3QAG A;  4OFM A;  3M0F A;  3GZB A;  4JU5 A;  2HOH A;  1PQN A;  5EY6 A;  4GF0 A;  4ISD A;  3RDW A;  1GOV A;  1GSQ A;  3IPZ A;  2VL2 C;  1BAO A;  3EE1 A;  4OK0 A;  3AGN A;  4KCE A;  5ECK B;  1Y6E A;  4CPK A;  4IJ3 A;  4HDE A;  4MDC A;  1NDO B;  1SK1 A;  2KP2 A;  2E2T A;  2IJY A;  3Q1C A;  5EL8 A;  3D9R A;  4ECI A;  2CKF B;  2FWG A;  2JZR A;  3EBT A;  2LJR A;  3S28 A;  3PPU A;  1RGA A;  3BCI A;  3US3 A;  1XWK A;  4YH2 A;  4GSN A;  1YIJ 3;  4G0K A;  1DE3 A;  1M0U A;  1TIJ A;  3F9S A;  3CCV 3;  3VSY A;  3S9F A;  3EC9 A;  2FHE A;  2RNT A;  1YJ9 3;  3LYG A;  1K28 A;  4TR4 A;  3FCS B;  1IQ8 A;  5IF6 A;  3DGL A;  1BRS A;  2RM6 A;  1E6B A;  4WR4 A;  1F37 A;  1UC7 A;  1Q98 A;  1EG9 B;  2BMQ B;  3GSS A;  4KDU A;  4JR4 A;  1I0V A;  1F6M C;  2FCH A;  3EIN A;  2PVO C;  3VLN A;  4NXI A;  2H66 A;  4PUF C;  1B4Q A;  4E8E A;  3G8Z A;  1SL0 B;  3TOT A;  3VWV A;  5IO0 A;  1YI2 3;  3DZL A;  5E59 A;  6GSX A;  2VAF A;  1GY6 A;  3FF0 A;  1W89 A;  2HMO B;  1DYU A;  2FWF A;  5IQY A;  4R9L A;  1MGR A;  4KW6 A;  3SED A;  4TR1 A;  5DQY A;  1MOL A;  1JZR A;  3UL5 A;  1PSQ A;  1SJI A;  4WYK B;  2YFL B;  4IPB A;  4RZM A;  1CQH A;  1T4Y A;  1WIK A;  1OC9 B;  2QSI A;  1OC9 A;  1ZCP A;  1DET A;  1GTI A;  3N9J A;  1SJZ A;  3EC3 A;  4K7O A;  3WGE A;  1MGW A;  1OVN A;  5GAP D;  2IUK A;  4XTS A;  3LTA A;  5G5F A;  3O3T A;  1IU7 A;  3GST A;  2R6K A;  3KP8 A;  4HZ9 B;  1R5P A;  1SD9 A;  5IOW A;  5IMV A;  4O32 A;  4R9K A;  5I97 A;  5ECR B;  1MWT A;  4JF8 A;  5EQL A;  2X8H A;  4HBR A;  3VK9 A;  5J3R A;  4F82 A;  1U88 A;  3MKI A;  2A4V A;  3DMC A;  2ON7 A;  3QPM A;  5GSS A;  4KGI A;  5B7C A;  5LC6 A;  2I1U A;  1K8A 4;  3GKN A;  1KBN A;  2IME A;  2LJK A;  3LYK A;  4MF5 A;  1GUH A;  1RSN A;  2LKU A;  4L8E A;  2CX0 A;  3CYN A;  1OF5 B;  5DAK A;  4X0X A;  2I81 A;  1GNE A;  1LOV A;  2NVL A;  3CXG A;  4Z2U A;  4AGS A;  2XGL A;  4CY6 A;  4BIK A;  1B9Y C;  4MMZ B;  1Q7Y 4;  1K0O A;  1AY7 A;  2EIR A;  2I4A A;  1DVD A;  5G2Z A;  1FOV A;  3FZA A;  5LNK e;  1I9D A;  1SAR A;  1GUM A;  3LTD A;  3TJF A;  3DGQ A;  3OV4 A;  1IDP A;  1BUJ A;  5IG5 A;  3IK7 A;  5IMZ A;  4CHS A;  4EW5 A;  2Q07 A;  3B4P A;  3NM7 A;  2IMF A;  4HM7 B;  5D73 A;  2OQE C;  3Q3F A;  3LZA A;  1DMQ A;  3DD3 A;  3B4O A;  1BIR A;  1QVG 2;  3RAZ A;  2K18 A;  1R26 A;  4GTU A;  1WOU A;  2B5X A;  1PD2 1;  2FA8 A;  5GAN D;  1ERV A;  4BU4 A;  3D4A A;  3WOD G;  3FR6 A;  2P5R A;  4KA0 A;  1A2K A;  1Y25 A;  3IV4 A;  1X0R A;  2P0G A;  2JL4 A;  4I6X A;  1EOG A;  4HEA 2;  4POL A;  5IPH A;  2L4V A;  2LS5 A;  5G31 A;  3STD A;  2H76 A;  1F2E A;  3AGO A;  6GSU A;  4XS4 B;  2Z9S A;  4MF6 A;  1HD2 A;  4O02 B;  4TN8 A;  3EN1 B;  3ZYW A;  4MZC A;  3GA4 A;  1ZO2 A;  3DYR A;  4DKI A;  3HHV A;  2KF5 A;  5FT3 A;  3ZFL A;  1LNI A;  3IR4 A;  1BAY A;  1QXH A;  1T5Y A;  3DXO A;  2X49 A;  2WOF A;  2VM1 A;  4L7K A;  2TIR A;  1UI8 A;  2INX A;  3EVI A;  3O8Y A;  2A2P A;  1X1Y A;  2ZL8 A;  2B1X B;  2FGX A;  3PGB A;  3VGN A;  3BU4 A;  4HVN A;  4DEJ A;  3V92 A;  3BBY A;  1KTE A;  3LOY A;  1IT7 A;  4XBX A;  2XPE A;  3BCK A;  3FKA A;  2HRF A;  1RGG A;  2O9U X;  2DIZ A;  4HU7 A;  3NZN A;  1RNB A;  1PL1 A;  2R41 A;  4HI7 A;  2P0M A;  1OC8 A;  2X4A A;  4HAA A;  5G5E A;  4G2E A;  4NV5 A;  1TFO A;  2LYX A;  1BED A;  1Q40 A;  1TRU A;  3N9H A;  2R0G A;  1IVV A;  3IK9 A;  1T2H A;  2QEX 3;  3CTG A;  3TKS E;  1ULJ B;  5IG0 A;  1GS3 A;  1VZZ A;  3ZLP A;  1GSP A;  1D6Y A;  4L8P A;  1NNV A;  4OUQ A;  3GTU B;  1RHL A;  3CSH A;  3U1W A;  3G9B A;  1NJI 4;  1U5O A;  1UCL A;  3ME7 A;  4FH8 A;  4KDX A;  4MNN A;  1OAZ A;  1LOX A;  1GMQ A;  3CCJ 3;  2IWT A;  1GD3 A;  2ON5 A;  4K6X A;  3DXB A;  3CCR 3;  2FWH A;  2P0X A;  2CA8 A;  4K9Z A;  2C3T A;  3D4M A;  2W9Q A;  1VGL A;  3SYU A;  3AHS A;  4MZW A;  1QVF 2;  2Z76 A;  7STD A;  5IOX A;  1BRI A;  1IYH A;  1RW1 A;  4WBR D;  1SIH A;  3CNM A;  1RLS A;  3ZML A;  1VQ5 3;  2FD3 A;  1PA3 A;  2ML5 A;  5JWQ B;  2H73 A;  1SII A;  5JWO B;  1QJG A;  2H0G A;  3TJJ A;  5DRE A;  1K3O A;  4BVX A;  3L78 A;  2AAW A;  3TDG A;  2DML A;  1CQS A;  1GSF A;  1XXU A;  3H4K A;  1B20 A;  5H5R A;  1G96 A;  3PGT A;  1GMP A;  3DVW A;  1M7T A;  4N6V 0;  1K0C A;  3IAM 2;  4Q5R A;  2KUC A;  3IOS A;  3D6I A;  3GZY B;  2C1Y A;  3CCU 3;  3CTF A;  3F3R A;  1FAA A;  3FG3 A;  1XZO A;  3HX8 A;  3GX8 A;  4NHZ A;  4MK3 A;  1V58 A;  3R2Q A;  3HCZ A;  4MEI A;  2HZF A;  1R5A A;  4WP5 A;  3WOE B;  3TGZ A;  2CAI A;  2HE3 A;  2L1S A;  3N8B A;  3FZ4 A;  3V1W A;  1K0M A;  2JZS A;  1JHB A;  1EZK A;  1QAK A;  4O5R A;  4K8M A;  3L9U A;  1VQM 3;  1ERT A;  2OE0 A;  2O89 A;  3QAV A;  1VQP 3;  1BSA A;  4MZB A;  2CWV A;  2MMO A;  1JZW A;  4WF5 A;  4TXO B;  1TUH A;  1JKG B;  4LMI A;  2FWE A;  1AIU A;  1WE0 A;  3FG4 A;  3A76 A;  1W02 A;  3NQY A;  3KH9 A;  5D9T A;  1OHS A;  2ES7 A;  5G2G A;  2VM2 A;  2LQV A;  1FGM A;  4D73 A;  3P7X A;  4L5L A;  2N5A A;  4ZL8 A;  3KII A;  4EXR A;  4MF7 A;  1XW6 A;  2BU4 A;  4HQS A;  2V41 A;  3SBC A;  4TXO A;  1GUL A;  4ORL A;  2RCD A;  4IT7 A;  1HQO A;  1R4Y A;  5DAK B;  1I2G A;  2GZZ A;  1HNC A;  1M2A A;  5M19 A;  4BWS A;  1RDS A;  2B7J A;  4J5K A;  3ZL5 A;  1HYF A;  3O76 A;  4RI6 A;  1O8X A;  3G7Y A;  4PNF A;  1JBR A;  1BX9 A;  5IO2 A;  5JPU A;  2CAQ A;  3QD9 A;  2GBX B;  2ZHX B;  3GYK A;  5HFI A;  2VIM A;  1Z1S A;  4ECB A;  4YKG A;  3UBL A;  1NU3 A;  1VQO 3;  5A4V A;  4PQI A;  3WA3 A;  2E0Q A;  1TI1 A;  5A0O B;  4OCF A;  2H19 A;  3QRD A;  2R3X A;  1A2J A;  3RBT A;  3BLZ A;  1EP8 A;  1EEM A;  3FG1 A;  1SD8 A;  2V1L A;  1GWC A;  2YZH A;  2L57 A;  2YFI B;  5IMF A;  1JLV A;  2CH9 A;  3PH9 A;  3G16 A;  2HXK A;  4OWY A;  3HVV A;  4IP1 A;  4RNT A;  3PZW A;  2JAC A;  5C04 A;  2SBL A;  4TX4 A;  5KP3 A;  4GCI A;  1TK5 B;  1BNS A;  2E2G A;  1UUG B;  1D6U A;  3IAS 2;  3TB2 A;  1A2V A;  2WJU A;  3HDC A;  2DJK A;  4LMV A;  1JJ2 2;  4I97 A;  4XS4 A;  2HML B;  2L59 A;  1X1X A;  5INY A;  1W6G A;  1AVK A;  2HRN A;  4MPF A;  2HNL A;  1STF I;  3GL5 A;  1TTO A;  4MAB A;  4G1M B;  1A24 A;  3PS8 A;  3GMF A;  4DSQ A;  3URP A;  2XSO B;  3DRN A;  1ERU A;  1FW1 A;  4F03 A;  2RSX A;  2REM A;  1M2D A;  2KP1 A;  3FW2 A;  3EJV A;  3R3E A;  4BTX A;  1SPU A;  3IJE B;  1I5G A;  3MHE A;  3K0Z A;  4LEH A;  1YQ1 A;  3DGN A;  1PRX A;  4XHM A;  6GSP A;  3LEF A;  5DVB A;  1JKG A;  3FZ5 A;  3CU3 A;  2FNO A;  1M3J A;  2DMM A;  2RBI A;  2DLX A;  4HJ2 A;  3H8Q A;  1B3S A;  1AAZ A;  5CO3 A;  4PNG A;  1PN0 A;  4BIR A;  1V98 A;  3CRU A;  1TJD A;  5JBS A;  2FUG 2;  2F5M A;  1A2P A;  2F9S A;  4MH3 A;  1FHE A;  1ISK A;  5BRT A;  3A3T A;  3A5I A;  2HRA A;  2H1B A;  1YY7 A;  4ZL9 A;  5FGO A;  3JUN A;  1K3L A;  2O87 A;  1RCL A;  3NHX A;  4KSM A;  3KM6 A;  2DJJ A;  3KSE D;  2ZCT A;  4HJM A;  1TRQ A;  1IV9 A;  3RNT A;  1JNQ A;  1WNH A;  3SVA A;  3VFI A;  5COH A;  4J57 E;  1UN2 A;  5D9W A;  3KSP A;  2RM5 A;  1BNG A;  6GSY A;  2KF4 A;  2R2J A;  5LD0 A;  3C73 A;  2J8X B;  3HXS A;  4RUV A;  3EB8 A;  3GUS A;  3JVC A;  2R5G A;  4ZB8 A;  1GP1 A;  1OC3 A;  3P8W A;  4U13 A;  1TU5 A;  3E9J B;  5J5N A;  3TKS A;  3K63 A;  2GEX A;  4IP6 A;  3TKP A;  2X8G A;  1W6C A;  1TRP A;  5AIH A;  2OQE A;  4DSS A;  2VCQ A;  1SEN A;  2H6Y A;  2PUK C;  3KMN A;  5IM9 A;  2GGT A;  1M9G A;  2HZE A;  2XSH B;  2KOK A;  3D4T A;  3DIE A;  1YKC A;  2VO4 A;  5KP1 A;  3IXR A;  3TCO A;  2PER A;  3Q18 A;  4ML6 A;  2H01 A;  2NTO A;  2H75 A;  3IA1 A;  2BMR B;  2XC2 A;  4Q5N A;  2C4J A;  3TOU A;  4BVX B;  2C80 A;  2H1A A;  1DVC A;  1ZYN A;  1U6T A;  3HII A;  1WWJ A;  4FQU A;  2RUE A;  3CC4 3; 
#chains in the Genus database with same CATH homology
 1T3B A;  2MMZ A;  4ZB6 A;  1CQG A;  2J23 A;  1V57 A;  2C0G A;  1UVZ A;  4GQF A;  5C00 A;  5G30 A;  3J7Y k;  1GTA A;  2E2M A;  4HOJ A;  4I2T A;  5ECO B;  1S3A A;  2VOC A;  1WMJ A;  5BMU A;  3HA9 A;  3FMW A;  2L6C A;  3TRP A;  1A0F A;  3F6D A;  3DVX A;  1SL1 B;  3WT2 A;  3GH9 A;  4JR6 A;  5B8A A;  3VI7 A;  3L9S A;  3IHG A;  3I6A A;  4OMV A;  4USS A;  3J7Y b;  1XPV A;  22GS A;  1EGR A;  2JSZ A;  1KNG A;  2JAD A;  1SK2 A;  5DCG A;  3WGX A;  1YF1 A;  4K2D A;  1F3B A;  4G0L A;  2HLS A;  4KH7 A;  3F4T A;  4K0N A;  3C7M A;  2GSS A;  4HUA A;  2V6O A;  4JE1 A;  5CYY A;  1GSS A;  2MYG A;  4TW5 A;  5HQP A;  1F3A A;  1URM A;  1PX6 A;  2OE3 A;  1K0N A;  3ISO A;  3M1G A;  1VF3 A;  3JCM L;  2MBT A;  1N8J A;  1YF0 A;  1SL2 B;  2CVK A;  2LRT A;  14GS A;  3F0I A;  3F6F A;  5GST A;  2XHF A;  4QL9 A;  1EOH A;  2VLT A;  1X9M B;  3EYT A;  2LRN A;  4KCA A;  1ERW A;  2PGT A;  1WRY A;  1GH2 A;  3L0H A;  1GSU A;  2IPA A;  1FG4 A;  1ST9 A;  2CT6 A;  1PX7 A;  4GQC A;  2GSR A;  1V2A A;  4TKY A;  4PQH A;  1NM3 A;  3MAK A;  3F8U A;  3KJY A;  2B5Y A;  3LWA A;  1A2L A;  1SU9 A;  11GS A;  1QGV A;  3ZVJ D;  3LSZ A;  2LJA A;  2DKH A;  2DKI A;  1JZD A;  3QMX A;  1V40 A;  3F4R A;  4AJ8 A;  2EIO A;  20GS A;  3EPT A;  3KXO A;  3W8S A;  4FYU A;  5HR3 A;  4K7N A;  2R4V A;  1PMT A;  4NWY A;  5ABR A;  3UL3 A;  3E3E A;  1SYR A;  1QUW A;  2OJL A;  3A2V A;  4EIP A;  3L4N A;  2D2Z A;  2GZP A;  3KEB A;  9GSS A;  4GLT A;  4ZBB A;  1RK4 A;  2DJ1 A;  1GTB A;  2H1G A;  2MBS A;  4FYB A;  1ZGN A;  4OO4 A;  2GDR A;  1K0B A;  1YDK A;  3GNJ A;  3GUR A;  4N0Z A;  1SKS B;  5H5Q A;  3ZIJ A;  4MJE A;  5CRD A;  4G19 A;  2QC7 A;  2OKA A;  2E7P A;  1H4O A;  4KUN A;  4POM A;  2LNT A;  4XS6 A;  2PVQ A;  1BG5 A;  5IMC A;  4HU9 A;  3I9V 2;  4MJB A;  4PUR A;  3ZIT A;  3N5O A;  2KLX A;  3MYD A;  3TRQ A;  3H1N A;  2HRK A;  1X5E A;  2M80 A;  2JSY A;  4K7I A;  1PKZ A;  1O73 A;  2GSQ A;  5F0G A;  4OFT A;  1NHY A;  3HYP A;  4XIH A;  4DSR A;  4IQA A;  3D22 A;  4KE3 A;  5EPF A;  2LRC A;  4RQR A;  1FB6 A;  4EVM A;  4PUA A;  3LXT A;  2K8V A;  2OE1 A;  4J2F A;  4YKF A;  1MDJ A;  1A8L A;  1DE2 A;  3WYW A;  4Z2R A;  2UZ8 A;  1ZYE A;  3EUR A;  4YQU A;  3NOF A;  2BMX A;  1G6Y A;  4P3Y B;  10GS A;  3TUE A;  2H0H A;  2N5F A;  5IIZ A;  1XW5 A;  2FY6 A;  5F8B A;  2J9H A;  2AB6 A;  3GX0 A;  3BOA A;  3MNG A;  3UEM A;  1PKW A;  5CRH A;  5AIX A;  2YOI A;  3C1S A;  3TRX A;  4F0C A;  2GT5 A;  1XIY A;  5AIS A;  1OE8 A;  3LG6 A;  2QKE A;  2IMK A;  4KB3 A;  2ZUP A;  3UJ1 A;  1C72 A;  2G2Q A;  5B6M A;  4IKH A;  2DBC A;  3HJO A;  4WXT A;  1TXX A;  2IMI A;  3KH7 A;  2LST A;  4V1A p;  3VWX A;  3ZFB A;  1WJK A;  2VLU A;  5DDL A;  3PR8 A;  3HY2 A;  2PN8 A;  3A2W A;  1Z7R A;  4KX4 A;  1M2B A;  1THO A;  7GSS A;  1TU7 A;  1NW2 A;  4PX1 A;  1V9W A;  2DC5 A;  1O8W A;  1EEJ A;  4ZXG A;  4Z7X A;  2IY2 A;  5KN3 A;  3E0U A;  4HZ2 A;  5HR2 A;  3CBU A;  1FVK A;  2M46 A;  3F9U A;  1TP9 A;  4WBJ A;  3IBH A;  2GQK A;  3F63 A;  4PGT A;  1MTC A;  3U6V A;  4OFN A;  5G1K A;  1XWB A;  3EMX A;  1OYJ A;  2V1M A;  3QOU A;  4L0W A;  5F06 A;  3LXZ A;  1TU8 A;  1O85 A;  2YCD A;  2H72 A;  4O92 A;  1J08 A;  2OBI A;  3PIN A;  2OAD A;  2JZT A;  3G7J A;  4OO5 A;  2PMT A;  1VRS D;  1EP7 A;  1B48 A;  2OBK A;  2F3M A;  2CX3 A;  1J9B A;  5ECN B;  1U3A A;  4ZB9 A;  1K0D A;  2DIY A;  1BJX A;  4FYC A;  2CZ3 A;  2YJ7 A;  1TDI A;  2C3N A;  1USB A;  3UBK A;  1B8X A;  1G0T A;  4EDZ A;  1EV9 A;  3VWW A;  2X8C A;  2C8U A;  1XVW A;  2FA4 A;  4L0U A;  4FIW A;  5LCZ A;  5J4U A;  1O6J A;  3ZMK A;  1H75 A;  1ZZY A;  2X64 A;  2N5B A;  4TOP A;  1ML6 A;  2L4Q A;  1R7H A;  1Z6N A;  2EIQ A;  3ED3 A;  1VF2 A;  2L6D A;  3QDN A;  1UA5 A;  5HR1 A;  5J9C A;  4GST A;  1ZYP A;  4AJ7 A;  2HSM A;  3APS A;  2DJ0 A;  4JRR A;  4F0B A;  2RII A;  2LV3 A;  4ZIJ A;  1T7P B;  4CDO A;  1SYX A;  2YNX A;  1TKD B;  2L5O A;  4MPG A;  4IBP A;  1QK8 A;  3DML A;  2GZY A;  1S3D A;  1PGT A;  2F8A A;  2TRC P;  4KND A;  2V2G A;  1GLP A;  3EMP A;  4I5Q A;  5F05 A;  3HKR A;  5ENU A;  1AC1 A;  3RHC A;  4EUY A;  1N2A A;  3HZ4 A;  4KSO A;  2YN1 A;  2A2R A;  5D9V A;  3ZTL A;  5D96 A;  3LGC A;  2VCX A;  4YQM A;  2FLS A;  1W4V A;  2GST A;  4YQV A;  2C0F A;  3O6T A;  1TTZ A;  2C3Q A;  3UVT A;  1K0A A;  4NAX A;  4NMU A;  3FEU A;  2H1D A;  4RI7 A;  3KTL A;  2QA2 A;  1KEB A;  4ID0 A;  2K8S A;  5ELA A;  2MZC A;  1S3C A;  2VL9 A;  2NDO A;  3MWH A;  1XFL A;  3MIX A;  4GRF A;  1AUC A;  4EO3 A;  4F9Z A;  4LL4 B;  5F07 A;  2VCT A;  4IHU A;  4V1A g;  1GNW A;  1VF4 A;  2CVB A;  2AHE A;  1MDI A;  3FK8 A;  3ERF A;  2R0C A;  3FZ9 A;  1BYE A;  4BL7 B;  4EF0 A;  4K1F A;  1QQ2 A;  1TK0 B;  1M99 A;  3FHK A;  4O5Q A;  1BQ7 A;  2HSH A;  4N10 A;  3EE2 A;  1G7O A;  4OCE A;  1OKD A;  2K9F A;  3TJK A;  4X1U A;  3EU3 A;  3TKR A;  5ID2 A;  3EWL A;  1ILO A;  4MLY A;  2AUV A;  3IHQ A;  4N0V A;  3P90 A;  4ILF A;  2LNS A;  2VL2 A;  4QQ7 A;  4K0G A;  4BVY B;  2DJ2 A;  2C0E A;  1HYU A;  4XRD A;  2WZ9 A;  1IYI A;  2H70 A;  1SKW B;  1X5D A;  1JZO A;  4EIQ A;  3GKM A;  4N30 A;  2DJ3 A;  2VD1 A;  1DUG A;  1ZMA A;  2RUF A;  4JED A;  2G0F A;  3UIW A;  3FR3 A;  5DAL A;  3VI5 A;  4ZIL A;  3RPP A;  1LJR A;  1Z7P A;  1SK0 A;  4V2M A;  5ECP B;  3VWU A;  3CMI A;  3ME8 A;  1E2Y A;  3BD2 A;  4POK A;  5KEJ A;  4ZL7 A;  2AV4 A;  5FHI A;  5KN0 A;  3VPQ A;  4X4J A;  2HFD A;  3VPT A;  3HJM A;  5JCU A;  2B1L A;  4PXO A;  3F3Q A;  2I3Y A;  3APQ A;  4TR3 A;  2CX4 A;  5KN2 A;  1U3I A;  3GKX A;  4LLR A;  1VF1 A;  3FR9 A;  4JZQ A;  4RQX A;  2TRX A;  5DJL A;  8GSS A;  5KOW A;  2CZ2 A;  17GS A;  5B8B A;  12GS A;  1M9B A;  2PU9 C;  4ML1 A;  3QR6 A;  3GTU A;  2WDU A;  1EGO A;  1O7U A;  2GVP A;  2O8V B;  4QL7 A;  2IFQ A;  3WGD A;  1GLQ A;  4HS1 A;  6GSV A;  1XBS A;  2O7K A;  3GHA A;  3KCM A;  2GT6 A;  3KP9 A;  5CRG A;  1GL8 A;  3K8N A;  1G6W A;  1K3Y A;  1GSY A;  4MJC A;  4EKZ A;  5ID2 B;  3QCP A;  5ECI B;  5ECQ B;  5AIV A;  1A8Y A;  4IVF A;  1LU4 A;  1ACV A;  4GXZ A;  5B6N A;  5HR0 A;  3QAW A;  2YPM A;  1X9S B;  1T4Z A;  2HT9 A;  4BA7 A;  1GUK A;  2B1K A;  4TR0 A;  5J41 A;  3TJG A;  4XS1 A;  1OE7 A;  2XBQ A;  3M9J A;  5ELG A;  3D21 A;  4PQ1 A;  3UMA A;  2LQO A;  2YAN A;  3TJB A;  1AXD A;  1TI3 A;  3M8N A;  3ERG A;  2XPD A;  1MDK A;  2BJX A;  4MA9 A;  2B3S A;  4I8B A;  3SWL A;  4LMW A;  3IDV A;  4Q5Q A;  4O5U A;  3M9K A;  4N11 A;  5DQS A;  1AW9 A;  3F4S A;  2PBJ A;  4H86 A;  4Q5F A;  3LJR A;  2HZE B;  1TRS A;  1PL2 A;  2WS2 A;  18GS A;  3ZRD A;  4EE0 A;  2GLR A;  3UOM A;  1GTU A;  4TVE A;  3FRC A;  4KF9 A;  5FWG A;  4IEL A;  4DVC A;  1TOF A;  5AN1 A;  1GSD A;  3CSI A;  4XCS A;  4WR5 A;  4WEY A;  3GIX A;  2RLI A;  2WFC A;  4WF4 A;  3C71 A;  4YAV A;  4NHW A;  3C8E A;  5ECH B;  2H30 A;  5CNW A;  3A5W A;  3IC4 A;  2IL3 A;  3L9V A;  2IFQ B;  4LA1 A;  3UAR A;  2VCV A;  1NSW A;  2X99 A;  3KMO A;  4MJA A;  1JFU A;  3WD6 A;  3NIV A;  3W6G A;  5JWR B;  4EXJ A;  1MEK A;  2L4C A;  2LQQ A;  2VCW A;  4MMM A;  3LFL A;  5DJM A;  2P5Q A;  19GS A;  2NPB A;  2ZNM A;  1NHO A;  3D0Z A;  2VD0 A;  1EV4 A;  1DSB A;  1XW9 A;  1WP0 A;  4JBB A;  2B7K A;  4Z2T A;  2YV7 A;  1O81 A;  1Z6M A;  2F8F A;  4TRX A;  2VL3 A;  4XRA A;  3ERW A;  1SJ6 A;  2A4H A;  2YWI A;  2EC4 A;  2CV4 A;  4ZBD A;  1U87 A;  3C1R A;  4EC0 A;  3TKQ A;  4K5R A;  2VCZ A;  4ULX A;  5EVO A;  4NV2 A;  3GRX A;  5A4U A;  4WET A;  5KN1 A;  2YZU A;  1THX A;  1XOB A;  6GSW A;  4IW9 A;  2A2S A;  4BL7 A;  2IIY A;  4WKW A;  1HNB A;  4IN0 A;  3M3M A;  4K5S A;  2VUP A;  2IN3 A;  3KGK A;  5HFK A;  1GRX A;  1T8E B;  1ON4 A;  3BJ5 A;  1XOA A;  1YEP A;  3GFK A;  1T1V A;  2CQ9 A;  1ABA A;  2PWJ A;  5CRE A;  3OR5 A;  3VUR A;  1LBK A;  3GL3 A;  5DCH A;  5IMD A;  4KAE A;  2H8L A;  5JCW A;  3AY8 A;  1TK8 B;  1OKT A;  2H0I A;  3RPN A;  1XWC A;  1RQM A;  4E8H A;  3KIJ A;  1TRV A;  4GWR A;  5HFG A;  1MD4 A;  2IMD A;  5IMA A;  2WRT A;  3LOR A;  5DAL B;  3GV1 A;  6GST A;  2HYX A;  3GN3 A;  3HVX A;  4X43 A;  3I69 A;  4OD7 A;  1EWX A;  2P31 A;  4DSS B;  2WGR A;  3IE3 A;  1DBY A;  2NBS A;  2LTK A;  5D9X A;  2CVD A;  1TRW A;  2YP6 A;  4F2I A;  4ECJ A;  2WUL A;  5L71 A;  16GS A;  2I9H A;  1GSE A;  1QFN A;  3U5R E;  5ECM B;  3H93 A;  2MMN A;  1XVQ A;  4LL1 B;  2V32 A;  2XBI A;  1YZX A;  2V6K A;  1HNA A;  3GKK A;  1ZYQ B;  4ZBA A;  5ECL B;  5KOX A;  3QFB C;  3CRT A;  2LEG A;  1XWG A;  2H6Z A;  3IC8 A;  1ZL9 A;  3G7I A;  5JCG A;  2AYT A;  1XWA A;  3HVS A;  2OA7 A;  6GSS A;  2GQL A;  3DEX A;  3W8J A;  4TXV A;  4A5P A;  3IRA A;  3D5J A;  1FO5 A;  3FYG A;  3KD0 A;  2YWM A;  2IYJ A;  1X9W B;  1J0F A;  2QA1 A;  4GSS A;  1B9X C;  2AJQ B;  2O85 A;  4IJI A;  1FB0 A;  4I2U A;  5CP1 A;  4G0I A;  2GS3 A;  1DE1 A;  1TW9 A;  4BVY A;  2R0P A;  3FKF A;  2WB9 A;  1Z9H A;  2VLV A;  2B5E A;  5D93 A;  4IQ1 A;  3MDK A;  3ZZX A;  2L5L A;  2GQM A;  3HJP A;  4CW9 A;  1JLW A;  2C0D A;  2B6M A;  3DKS A;  4K2X A;  4BPY A;  2OAC A;  4G9H A;  1A2M A;  3LQ7 A;  3ZIV A;  1R4W A;  5DBQ A;  5E4W A;  1Q4J A;  2JU5 A;  1A0R P;  5CAX A;  1T00 A;  2YWO A;  1SKR B;  4MCU A;  1M9A A;  3ZVJ A;  3Q74 A;  2PPT A;  1QMV A;  4V2N A;  4ICY A;  2H6X A;  5AGY A;  2GTU A;  5IPG A;  2HI7 A;  3H79 A;  3LYP A;  1AQV A;  4BWQ A;  1XCC A;  4ACS A;  3Q19 A;  4PTS A;  2K6V A;  2YWN A;  4MH2 A;  5GZZ B;  4EL1 A;  1F9M A;  4YAP A;  3WT1 A;  1YEX A;  5ECS A;  5H5S A;  5G1L A;  2H74 A;  3A2X A;  2ALB A;  2BTO T;  5CRW A;  2DSA A;  2YV9 A;  5D8I A;  2KHP A;  4FO5 A;  3TKS C;  1AQW A;  4NPB A;  4HQZ A;  4HZ4 A;  3QFA C;  1AQX A;  1WPI A;  3LW9 A;  3CSJ A;  4AF2 A;  4D73 B;  5A5K A;  4V2L A;  3Q6O A;  3FY7 A;  3EU4 A;  4KDY A;  4L5O A;  4J56 E;  3KZQ A;  4ECC A;  2H71 A;  5J9B A;  4TR1 B;  4O7H A;  4AJ6 A;  5A4W A;  1G7E A;  13GS A;  3MSZ A;  3ZRE A;  1X5C A;  1YJ6 A;  1A23 A;  1Z3E A;  3HD5 A;  1ZOF A;  2LUS A;  4CY8 A;  4POB A;  2YJH A;  2QGV A;  3UAP A;  2R37 A;  3KTB A;  3GH6 A;  3UVH A;  1YKA A;  1PN9 A;  3DWV A;  3P2A A;  3APO A;  2WCI A;  1FOH A;  2F51 A;  1Z5Y E;  4G10 A;  1B4P A;  3HZ8 A;  2HSY A;  3I43 A;  4IGJ A;  1MD3 A;  4MP4 A;  2MMA A;  4EDY A;  3RHB A;  4IS0 A;  1FVJ A;  2M72 A;  3QAG A;  4OFM A;  3M0F A;  4JU5 A;  1PQN A;  5EY6 A;  4GF0 A;  4ISD A;  3RDW A;  1GSQ A;  3IPZ A;  2VL2 C;  4KCE A;  5ECK B;  1Y6E A;  4IJ3 A;  4HDE A;  4MDC A;  1SK1 A;  2KP2 A;  2IJY A;  5EL8 A;  4ECI A;  2FWG A;  2JZR A;  2LJR A;  3PPU A;  3BCI A;  3US3 A;  1XWK A;  4YH2 A;  4GSN A;  4G0K A;  1M0U A;  3S9F A;  2FHE A;  4TR4 A;  2RM6 A;  1E6B A;  4WR4 A;  1F37 A;  1UC7 A;  1Q98 A;  3GSS A;  4KDU A;  4JR4 A;  1F6M C;  2FCH A;  3EIN A;  2PVO C;  3VLN A;  4NXI A;  2H66 A;  4PUF C;  1B4Q A;  4E8E A;  1SL0 B;  3TOT A;  3VWV A;  5IO0 A;  5E59 A;  6GSX A;  2VAF A;  1W89 A;  2FWF A;  5IQY A;  4KW6 A;  4TR1 A;  5DQY A;  1JZR A;  1PSQ A;  1SJI A;  1CQH A;  1T4Y A;  1OC9 B;  1WIK A;  2QSI A;  1OC9 A;  1ZCP A;  1GTI A;  3N9J A;  1SJZ A;  3EC3 A;  4K7O A;  3WGE A;  1OVN A;  5GAP D;  4XTS A;  5G5F A;  3O3T A;  3GST A;  2R6K A;  3KP8 A;  1R5P A;  1SD9 A;  5IOW A;  5IMV A;  4O32 A;  5ECR B;  2X8H A;  3VK9 A;  5J3R A;  4F82 A;  1U88 A;  2A4V A;  2ON7 A;  3QPM A;  5GSS A;  4KGI A;  5B7C A;  2I1U A;  3GKN A;  1KBN A;  2IME A;  2LJK A;  3LYK A;  4MF5 A;  1GUH A;  2LKU A;  4L8E A;  3CYN A;  5DAK A;  4X0X A;  2I81 A;  1GNE A;  2NVL A;  3CXG A;  4Z2U A;  4AGS A;  4CY6 A;  1B9Y C;  1K0O A;  2EIR A;  2I4A A;  5G2Z A;  1FOV A;  3FZA A;  5LNK e;  1I9D A;  1GUM A;  3TJF A;  3DGQ A;  3IK7 A;  5IMZ A;  4CHS A;  2IMF A;  5D73 A;  3DD3 A;  3RAZ A;  2K18 A;  1R26 A;  4GTU A;  1WOU A;  2B5X A;  1PD2 1;  2FA8 A;  5GAN D;  1ERV A;  3FR6 A;  2P5R A;  4KA0 A;  1Y25 A;  3IV4 A;  1X0R A;  2P0G A;  2JL4 A;  4I6X A;  1EOG A;  4HEA 2;  4POL A;  5IPH A;  2LS5 A;  5G31 A;  2H76 A;  1F2E A;  6GSU A;  4XS4 B;  2Z9S A;  4MF6 A;  1HD2 A;  4TN8 A;  3ZYW A;  4MZC A;  3GA4 A;  3DYR A;  3HHV A;  5FT3 A;  3ZFL A;  3IR4 A;  1BAY A;  1QXH A;  2X49 A;  2VM1 A;  2TIR A;  3EVI A;  2A2P A;  2FGX A;  4DEJ A;  3BBY A;  1KTE A;  2XPE A;  3BCK A;  2HRF A;  2DIZ A;  4HU7 A;  3NZN A;  1PL1 A;  4HI7 A;  1OC8 A;  2X4A A;  5G5E A;  4G2E A;  4NV5 A;  1BED A;  1TRU A;  2R0G A;  3IK9 A;  3CTG A;  3TKS E;  3ZLP A;  3GTU B;  3CSH A;  3G9B A;  3ME7 A;  4FH8 A;  4KDX A;  4MNN A;  1OAZ A;  2IWT A;  2ON5 A;  4K6X A;  3DXB A;  2FWH A;  4K9Z A;  2CA8 A;  2C3T A;  3D4M A;  1VGL A;  4MZW A;  5IOX A;  1IYH A;  1RW1 A;  4WBR D;  3ZML A;  2FD3 A;  1PA3 A;  5JWQ B;  2H73 A;  5JWO B;  2H0G A;  3TJJ A;  4BVX A;  1K3O A;  3L78 A;  2AAW A;  2DML A;  3H4K A;  3TDG A;  1GSF A;  1XXU A;  5H5R A;  3PGT A;  3DVW A;  1M7T A;  1K0C A;  3IAM 2;  4Q5R A;  2KUC A;  3IOS A;  3D6I A;  2C1Y A;  3CTF A;  3F3R A;  1FAA A;  1XZO A;  3GX8 A;  4NHZ A;  4MK3 A;  1V58 A;  3R2Q A;  3HCZ A;  2HZF A;  1R5A A;  3TGZ A;  2CAI A;  2HE3 A;  3FZ4 A;  3V1W A;  1K0M A;  2JZS A;  1JHB A;  1EZK A;  4O5R A;  4K8M A;  3L9U A;  1ERT A;  2OE0 A;  2O89 A;  3QAV A;  4MZB A;  2MMO A;  1JZW A;  4WF5 A;  4TXO B;  2FWE A;  1AIU A;  1WE0 A;  3KH9 A;  5D9T A;  2ES7 A;  2VM2 A;  4D73 A;  3P7X A;  4L5L A;  2N5A A;  4ZL8 A;  4MF7 A;  1XW6 A;  4HQS A;  2V41 A;  3SBC A;  4TXO A;  1GUL A;  1HQO A;  5DAK B;  2GZZ A;  1HNC A;  1M2A A;  4BWS A;  2B7J A;  3ZL5 A;  3O76 A;  4RI6 A;  1O8X A;  3G7Y A;  4PNF A;  1BX9 A;  5IO2 A;  3QD9 A;  2CAQ A;  3GYK A;  5HFI A;  2VIM A;  4ECB A;  4YKG A;  3UBL A;  5A4V A;  4PQI A;  2E0Q A;  1TI1 A;  4OCF A;  2H19 A;  2R3X A;  3RBT A;  1A2J A;  1EP8 A;  1EEM A;  1SD8 A;  1GWC A;  2YZH A;  2L57 A;  5IMF A;  1JLV A;  3PH9 A;  2HXK A;  4OWY A;  3HVV A;  4IP1 A;  2JAC A;  5C04 A;  4GCI A;  1TK5 B;  2E2G A;  3IAS 2;  3TB2 A;  2WJU A;  3HDC A;  2DJK A;  4LMV A;  4I97 A;  4XS4 A;  2L59 A;  5INY A;  2HRN A;  4MPF A;  2HNL A;  3GL5 A;  4MAB A;  1A24 A;  3GMF A;  4DSQ A;  3DRN A;  1ERU A;  1FW1 A;  4F03 A;  2REM A;  1M2D A;  2KP1 A;  3FW2 A;  3R3E A;  1I5G A;  1YQ1 A;  1PRX A;  4XHM A;  3LEF A;  5DVB A;  3FZ5 A;  2FNO A;  2DMM A;  2DLX A;  4HJ2 A;  3H8Q A;  1AAZ A;  5CO3 A;  4PNG A;  1PN0 A;  1V98 A;  3CRU A;  1TJD A;  2FUG 2;  4MH3 A;  2F9S A;  1FHE A;  5BRT A;  3A3T A;  3A5I A;  2HRA A;  2H1B A;  1YY7 A;  4ZL9 A;  1K3L A;  2O87 A;  4KSM A;  3KM6 A;  2DJJ A;  2ZCT A;  4HJM A;  3VFI A;  5COH A;  4J57 E;  1UN2 A;  5D9W A;  2RM5 A;  6GSY A;  5LD0 A;  2R2J A;  3C73 A;  3HXS A;  4RUV A;  3GUS A;  2R5G A;  4ZB8 A;  1GP1 A;  1OC3 A;  3P8W A;  3E9J B;  5J5N A;  3TKS A;  4IP6 A;  3TKP A;  2X8G A;  4DSS A;  2VCQ A;  1SEN A;  2H6Y A;  2PUK C;  3KMN A;  5IM9 A;  2GGT A;  2HZE A;  2KOK A;  3D4T A;  3DIE A;  1YKC A;  2VO4 A;  3IXR A;  3TCO A;  2PER A;  3Q18 A;  4ML6 A;  2H01 A;  2NTO A;  2H75 A;  3IA1 A;  2XC2 A;  4Q5N A;  2C4J A;  3TOU A;  4BVX B;  2C80 A;  2H1A A;  1ZYN A;  1U6T A;  1WWJ A;  4FQU A;  2RUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...