1V57A

Crystal structure of the disulfide bond isomerase dsbg
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 68
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v57A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v57A03
2AAWA 5CRHA 3LGCA 2VCTA 5ECLB 4POMA 4OO4A 4PGTA 2H74A 4K6XA 4KA0A 3UEMA 4MH2A 2I9HA 2HSHA 5KN1A 1Z5YE 1K0OA 3MWHA 2WJUA 4GTUA 1QK8A 1E2YA 5F05A 1Q4JA 1R5PA 4F9ZA 2VD0A 2Z9SA 3PR8A 1M2BA 2CA8A 3EU3A 3A3TA 3ZFBA 4ML1A 2LQOA 2N5BA 1OE7A 1EV4A 4RI7A 3LG6A 3W8JA 2XC2A 3F63A 2DJ0A 4IGJA 4TOPA 1VF2A 1XIYA 4JR4A 2HNLA 4ILFA 3DD3A 2PWJA 3CYNA 3IA1A 1Z6NA 1K3OA 1GTAA 2HFDA 2E0QA 4MABA 5DDLA 2DIYA 1GWCA 4GF0A 2E2GA 4FO5A 4WETA 5J9BA 4N0VA 1GNWA 3HCZA 5KN3A 3UJ1A 2CVDA 3GV1A 2IMKA 4KCAA 1Z9HA 3IBHA 5DJMA 3FYGA 1X0RA 3MDKA 2FCHA 5LCZA 3FEUA 1A2JA 2O89A 2WB9A 5JCWA 2BMXA 4GCIA 1M99A 4V2LA 3CSIA 5A5KA 1ERTA 4NWYA 1EGOA 1AC1A 1YQ1A 4ZB8A 1NSWA 5IO2A 2GGTA 1XOAA 5H5RA 4OFNA 1TK8B 4ZL9A 2R6KA 4WBJA 4GSSA 2NTOA 4HQSA 1SL1B 3VI7A 3IC4A 3LFLA 3WD6A 6GSVA 1GNEA 4HJ2A 1G7EA 4PQ1A 4EDZA 22GSA 1XWBA 3ZL5A 2LSTA 2YANA 4TXVA 4MF7A 4ZIJA 2DMMA 4MZWA 1SJZA 2EIRA 1HNCA 3TJBA 6GSSA 4JZQA 3WT2A 3US3A 3L78A 4KH7A 2KLXA 4FYBA 1X5DA 4TRXA 1XWAA 1FHEA 4ACSA 3ZREA 1OC9B 2E2MA 2HXKA 1O7UA 2H71A 1FB0A 4KX4A 2C1YA 4E8HA 2WULA 1M2AA 2N5AA 5KN0A 3KTLA 5DALB 4N30A 4PNFA 3D6IA 5D9WA 5A4UA 3UVTA 4ECCA 3LORA 4POBA 3ZMLA 5D93A 1PQNA 3PINA 1F9MA 1V98A 3QCPA 2JU5A 4GSNA 1THOA 2H6XA 2E7PA 2H76A 1EWXA 2O8VB 4HZ4A 2OBIA 3UBKA 1SKSB 2MMNA 3ZVJD 4IJIA 4JBBA 5HR2A 1YDKA 2OE3A 2HSYA 2IL3A 5G30A 1TRUA 3FZ9A 3P7XA 2V6KA 2JADA 1Q98A 2OE0A 4BL7A 1XBSA 4ZB6A 3RDWA 4HU7A 4KE3A 2L5OA 5H5SA 2H66A 3EE2A 1K0AA 1XW6A 2LRCA 6GSXA 2H75A 5IOXA 4CHSA 2B1LA 3FY7A 1B4QA 3GSTA 4IJ3A 3CSHA 2K6VA 1XPVA 4YQVA 1XVQA 5CAXA 3N5OA 5A4WA 1K0MA 3TRPA 1G6YA 1BJXA 3TOUA 1VF3A 2MBSA 1PRXA 4O32A 2DLXA 1FO5A 4HOJA 2VL3A 3NZNA 2MMAA 3KP8A 2YWIA 5DBQA 2F8FA 3ERGA 4NHWA 2LEGA 4IS0A 4LMWA 3Q18A 3VWUA 1A2LA 2GQKA 3F4SA 1OVNA 1ERVA 5IM9A 5JCUA 5ABRA 2RUFA 4EO3A 4D73B 1SK2A 2WRTA 2CX3A 1V40A 3D5JA 3UVHA 4RUVA 2X8CA 2IY2A 4HZ2A 3N9JA 4IQAA 3J7Yb 3GNJA 4ZBBA 5G5FA 1F3AA 1U3IA 1R7HA 3GKKA 4G2EA 4L0UA 3TKPA 3GSSA 2VLVA 1X9MB 4MA9A 1K0CA 1SL2B 1OC3A 4GRFA 1K0DA 2YV7A 16GSA 3IK7A 1SJ6A 3KH9A 4YAPA 2GZPA 3CBUA 2IWTA 3KP9A 4PUFC 3KZQA 4FIWA 1YEPA 2H72A 1YF0A 4WF5A 2OACA 2M80A 5AN1A 4I2UA 3KM6A 1EOGA 2H73A 4WEYA 3Q19A 3UARA 13GSA 4QL7A 3QAGA 2GSSA 2J23A 2G2QA 4XIHA 3H79A 1U6TA 1XVWA 4IVFA 1ZL9A 4K8MA 2PU9C 4JU5A 1B9YC 5IPGA 2MYGA 2OJLA 4I8BA 1V58A 5DALA 19GSA 1FOVA 2O85A 2R4VA 4HQZA 3UIWA 1KEBA 3C1SA 1Z6MA 4TXOB 3F9UA 3HZ4A 3TJFA 2JSYA 3ME8A 4IP1A 1QUWA 4I97A 3GX0A 2QSIA 2H01A 1Z7RA 5J3RA 3BCKA 3SBCA 2GZZA 2H8LA 3FZ5A 2WGRA 2HZEB 2NBSA 3LXZA 4EKZA 5AGYA 1USBA 5KN2A 3DVXA 5HFGA 5JWRB 1PL1A 4TR1B 2K8VA 3LEFA 1XWGA 4MLYA 1ZYQB 5F07A 3A5WA 3DEXA 3L9SA 2BJXA 2WZ9A 4OO5A 5B6MA 3D4MA 4DEJA 4PX1A 5A4VA 3V1WA 1TI3A 1GP1A 2GS3A 3HDCA 2QGVA 1U88A 3L9UA 4MF5A 2LRTA 3HA9A 4NAXA 5EL8A 2YOIA 4MJEA 3BCIA 1AW9A 4IKHA 3LYPA 2PUKC 2GQMA 1M9BA 2GT6A 3VURA 3BBYA 3IPZA 3Q74A 4J56E 3TKQA 4XTSA 1BAYA 3QAVA 2B6MA 3GKXA 2VCZA 3ERWA 4X1UA 4Q5FA 1JZRA 3F3QA 2MMZA 4MH3A 8GSSA 2DBCA 2H0HA 1PL2A 5HR1A 4JR6A 5CRDA 5F8BA 3GYKA 3HVSA 3IOSA 4EC0A 2C8UA 5IPHA 4ECIA 2VD1A 3O76A 5B7CA 1GLQA 4X43A 2I1UA 1C72A 2LKUA 3LYKA 2KP1A 2B3SA 2YZHA 3TDGA 4V2NA 4HEA2 3CXGA 3J7Yk 1T8EB 2JL4A 2C3TA 2JACA 5CRWA 2C0DA 2OA7A 3DXBA 4V1Ag 2ON7A 2FWGA 1WPIA 4V2MA 2CAQA 2FD3A 3DGQA 1TP9A 2IIYA 4TN8A 2ZUPA 3F0IA 2V6OA 4BA7A 1O8WA 1SU9A 2HLSA 2C3NA 1XWCA 5ECHB 2DJ1A 2LJAA 5ECMB 4GWRA 2YJ7A 4RQXA 2MBTA 4BPYA 3DRNA 2GSQA 2HRNA 3H93A 3KH7A 1A23A 4MZBA 2H6ZA 2NPBA 3GN3A 1DUGA 3M9JA 1DE1A 4BVYA 2DJ3A 1RQMA 3GKNA 5ECNB 3FW2A 2PERA 1SKRB 3I6AA 20GSA 1WWJA 2PVOC 1I5GA 5HFIA 4AJ7A 3HXSA 1WRYA 4POLA 12GSA 4KUNA 2XPEA 3VFIA 3RHBA 2YWMA 1MDIA 3ZIVA 5HR3A 1EEMA 1B48A 1A8YA 2B5EA 2PMTA 1NHOA 4WBRD 2G0FA 2H70A 1N8JA 1NM3A 5FWGA 5G5EA 3CTGA 1PMTA 1WP0A 5ID2B 2AV4A 3WGDA 2B1KA 2YZUA 2IJYA 2RLIA 3EINA 4JRRA 3KTBA 5ELGA 5ELAA 3E3EA 5DCGA 1LJRA 3CMIA 4IBPA 2VCXA 3A2XA 1YKAA 3HJOA 2YNXA 2N5FA 2V32A 4EUYA 4HI7A 1GLPA 4ML6A 1KBNA 2WS2A 2XBQA 4GQCA 4MP4A 4ZBDA 5IOWA 2X8HA 4NMUA 4L8EA 4NHZA 1GSSA 1THXA 2KP2A 1O81A 3G9BA 3BD2A 4RI6A 1HNBA 4XS4A 1UC7A 2GSRA 1YZXA 3VWVA 1I9DA 3M1GA 3GMFA 2J9HA 14GSA 1QMVA 1ZOFA 3A2VA 1VF4A 1OE8A 4XS4B 1OKDA 2HE3A 3I9V2 2LRNA 1MD3A 2CX4A 5G2ZA 3P2AA 4KDUA 5ENUA 3GH9A 3BOAA 5ECRB 2H6YA 2IFQA 3DIEA 2DSAA 4WXTA 3EC3A 2H1GA 2PBJA 3GL3A 5ECIB 2L6DA 3MSZA 4BVXA 2FWEA 2M72A 3IV4A 1HQOA 3C71A 1PGTA 1ABAA 3Q6OA 4ZBAA 1MEKA 4FYUA 3FK8A 1QFNA 2X8GA 2GTUA 2IMDA 2TRCP 4V1Ap 3VPTA 2P0GA 1FG4A 3RPNA 2DJ2A 5D9VA 1AXDA 1LU4A 1Z7PA 1DSBA 4I2TA 3WT1A 1R5AA 5DQSA 4XRDA 11GSA 2VIMA 5L71A 1GUKA 1GSEA 2C3QA 4EVMA 1F3BA 2TRXA 2H1DA 3TKSE 1XW5A 2H30A 1TTZA 2YWNA 1ZCPA 2IPAA 4HU9A 4K2DA 2X64A 5IMZA 2JZRA 3C7MA 4N11A 5C00A 1PX6A 2WCIA 2YJHA 2DC5A 1U3AA 3WGEA 1QGVA 2F3MA 1SK1A 2K8SA 3KXOA 4K1FA 2WFCA 1EOHA 5J4UA 4QL9A 3IDVA 1BYEA 4KB3A 5AIXA 1X5CA 1S3DA 3O6TA 4CW9A 3F6DA 3HYPA 4OFMA 4OWYA 3K8NA 4ECBA 1WJKA 2VCQA 1SYXA 4G9HA 4XRAA 2KHPA 10GSA 3IAM2 5IO0A 4DSRA 1OC9A 4MMMA 3L0HA 2KOKA 3LWAA 3G7JA 4OMVA 2P31A 2VM2A 5IQYA 3ZRDA 2DJKA 5IMVA 3TKSC 1GSUA 4O92A 3VWXA 1K3YA 1OKTA 5B6NA 5EVOA 2IMEA 4IQ1A 3VK9A 2BTOT 4KCEA 1OAZA 3PGTA 3QPMA 1EP7A 3APOA 1OYJA 2C80A 4PQHA 4HS1A 4TR0A 2CQ9A 2H1BA 4KNDA 5CNWA 1O8XA 1XWKA 1Y25A 1RW1A 1K0BA 4FH8A 1GUMA 3TJGA 1YF1A 4WR4A 1IYIA 4YQUA 5F06A 1NHYA 2AYTA 1TOFA 3FR6A 1SK0A 1F6MC 3EMPA 5ECKB 5DVBA 2IFQB 1M0UA 3OR5A 2CZ2A 6GSYA 1PX7A 2L6CA 4XHMA 3FZ4A 4N10A 4PURA 2HZFA 1Z3EA 1PA3A 5HQPA 2L5LA 4MJCA 1BEDA 1ERUA 1W4VA 2H19A 4BWQA 4ECJA 1A2MA 1X9WB 3QFAC 1G6WA 4AJ6A 1AIUA 1VGLA 4FYCA 3ERFA 1GSQA 6GSUA 1FW1A 1TRSA 3P90A 2JZTA 1EZKA 4NV5A 1TW9A 2C0GA 2LS5A 4TKYA 3ZYWA 2LQQA 3ZFLA 5HFKA 1JZWA 3IRAA 1PN9A 4DSQA 4LLRA 4TW5A 3KMNA 1BQ7A 2R37A 2YV9A 3F8UA 1GTIA 5CP1A 2AJQB 5IMDA 5HR0A 5ID2A 1SL0B 4ZL7A 1GUHA 4EF0A 4XS6A 3M3MA 1YY7A 1EV9A 4GXZA 5IMAA 4F0BA 4AF2A 4H86A 4WF4A 3L9VA 1FVKA 1FAAA 1A24A 3RBTA 2DMLA 1HYUA 3KIJA 2VOCA 5LNKe 2HYXA 2F8AA 2O7KA 2LUSA 2YWOA 4WKWA 3HD5A 5FHIA 2LJRA 3C8EA 2YP6A 9GSSA 3HKRA 4IHUA 4MDCA 5IMFA 4DSSB 1A8LA 5DJLA 3GIXA 3VWWA 4CDOA 1M9AA 2C0EA 3RAZA 1GTUA 1TDIA 4TXOA 2C4JA 3EVIA 4KSOA 2F51A 5D96A 3FRCA 2L57A 1AUCA 4PXOA 3PH9A 1TRWA 4OD7A 2PN8A 3S9FA 4Q5NA 1T3BA 1M2DA 2VLUA 5JWOB 5J41A 3W6GA 1JZDA 2PPTA 4OCFA 1RK4A 3GFKA 1X9SB 3UL3A 1F37A 4XCSA 1SENA 2OE1A 1O73A 2AUVA 1TRVA 1SD8A 3TRXA 3HHVA 1SD9A 5FT3A 2L59A 1QXHA 3CRTA 4LMVA 4K9ZA 2A2RA 1WIKA 1O85A 4J2FA 4F03A 1TXXA 1B9XC 4G10A 5COHA 5G31A 2AHEA 3KD0A 3TJJA 2OBKA 2RM6A 3F4TA 4NPBA 3QMXA 5IIZA 1BG5A 2IMFA 2CVBA 3GURA 3QD9A 3H4KA 2A2SA 1T7PB 4GSTA 4IW9A 4BWSA 2TIRA 4KDYA 3LQ7A 4TR1A 2XPDA 3RHCA 4HJMA 2B5XA 4RQRA 2B7JA 1MTCA 1XZOA 5G1KA 2IMIA 1ON4A 1YEXA 2VL2C 4K7IA 4NXIA 3ZZXA 2OADA 1XXUA 2K9FA 3GH6A 1J08A 4YAVA 1VF1A 5CRGA 3ZMKA 1JZOA 2L4CA 4N0ZA 2HI7A 4OCEA 5GZZB 4PQIA 2I81A 4QQ7A 2P5QA 3ISOA 1CQHA 4X0XA 3VI5A 5ECQB 4EXJA 4ID0A 3KGKA 2OKAA 1MD4A 1E6BA 3I69A 4DSSA 2GT5A 1AQWA 2F9SA 1PKZA 3U5RE 5GSTA 5CREA 4O5RA 2EIQA 4IN0A 1JLVA 3MNGA 2M46A 4F2IA 4LL4B 3D4TA 2GQLA 1HD2A 4KW6A 2RM5A 1H75A 1YKCA 2LV3A 3TKRA 2V41A 2FNOA 4TR3A 5D8IA 3CRUA 4I6XA 4GLTA 2FGXA 2QC7A 2R2JA 1EGRA 3F4RA 3E0UA 3TUEA 1DBYA 4JE1A 1XFLA 2CV4A 3D21A 2LTKA 5DCHA 3DMLA 5D73A 1R26A 2GDRA 4LA1A 2EIOA 1EEJA 3IK9A 2REMA 2EC4A 4PNGA 1FB6A 5C04A 3QDNA 3QOUA 1XW9A 3TOTA 2GZYA 3NIVA 3W8SA 2IN3A 1ZMAA 1MDKA 3ZIJA 5DAKA 3D22A 1U87A 3QAWA 1AQVA 3GA4A 2O87A 1SKWB 2MMOA 3KCMA 1R4WA 3G7IA 1W89A 5G1LA 1DE2A 3DWVA 3GX8A 1GTBA 2RUEA 3MAKA 5D9TA 5B8AA 2RIIA 3FZAA 4POKA 1TKDB 2XHFA 1FVJA 3IXRA 3ZVJA 2ZNMA 2CVKA 1UN2A 2VAFA 1ILOA 1UA5A 2FLSA 1GSYA 2HZEA 1PSQA 1BX9A 4MJBA 5JCGA 4ULXA 17GSA 1A0FA 1QQ2A 3A2WA 3IHQA 2JSZA 1WMJA 1X5EA 5J9CA 7GSSA 1JLWA 4MK3A 3APQA 3HVVA 2X99A 1OC8A 2MZCA 2FWHA 3EURA 1ZZYA 2K18A 1SJIA 2JZSA 4IP6A 3DVWA 2FA8A 5ECOB 3E9JB 4Z7XA 3UOMA 3CSJA 1F2EA 5KEJA 1TU7A 5DAKB 4L5OA 2HT9A 4AGSA 4TVEA 2B5YA 1GSFA 5J5NA 3RPPA 4K7OA 3ME7A 5INYA 3H8QA 3GKMA 1K0NA 4TR4A 1K3LA 3GRXA 2FHEA 3TKSA 4G19A 5B8BA 3APSA 2WDUA 1PD21 1GRXA 4ZB9A 4EL1A 3U6VA 1GL8A 3CTFA 2B7KA 1N2AA 3JCML 2L4QA 4Q5QA 2QKEA 5IMCA 3AY8A 4XS1A 1TJDA 3ZITA 1CQGA 1V9WA 3UBLA 1B8XA 3M9KA 5AISA 4KAEA 5CYYA 1IYHA 2D2ZA 2GSTA 1T00A 4ISDA 3DKSA 1VRSD 3GTUA 3HJPA 3KMOA 4J57E 3VLNA 4YH2A 1KNGA 1AQXA 1UVZA 4KDXA 3IAS2 2V2GA 4ZXGA 3HJMA 3LXTA 4O7HA 4E8EA 2H0GA 1HNAA 1NW2A 5GAPD 4D73A 4WR5A 3SWLA 4L5LA 4LL1B 3ZLPA 2FY6A 5LD0A 5ECSA 2ZCTA 4JEDA 1J0FA 2YCDA 18GSA 4KGIA 3FKFA 4KSMA 1O6JA 1TI1A 3D0ZA 3QFBC 2GLRA 4L0WA 2VCVA 2FWFA 5E4WA 1ST9A 1PKWA 4MPGA 5F0GA 3F6FA 4HUAA 2FUG2 5GSSA 3EMXA 2H0IA 2C0FA 4K0GA 2R3XA 4MPFA 3TRQA 1ACVA 1YJ6A 1TU8A 1WOUA 3G7YA 6GSWA 3H1NA 6GSTA 3GTUB 1JHBA 2GVPA 3QR6A 2LNTA 2ALBA 5E59A 4ZILA 3TB2A 5H5QA 4GQFA 5CO3A 3ZTLA 5D9XA 1TK0B 2FA4A 3TJKA 1ZYEA 3EU4A 3I43A 3UAPA 2HRFA 5EPFA 2XBIA 2CT6A 5ECPB 3M8NA 2I3YA 3FHKA 3TGZA 3IR4A 3F3RA 3IE3A 4I5QA 2I4AA 2VLTA 1V57A 3O3TA 3C73A 4PUAA 4YQMA 4NV2A 3EWLA 4P3YB 1A0RP 3EYTA 4MJAA 4ZL8A 1GSDA 2NVLA 5AIVA 3DYRA 4Q5RA 2KUCA 3FR9A 1JFUA 2CZ3A 2LJKA 3NOFA 4HDEA 3C1RA 4K7NA 3ED3A 5GAND 3KJYA 4MZCA 2DJJA 2P5RA 2VL9A 2A4VA 2VUPA 3HZ8A 1G7OA 1T4YA 1GULA 1S3AA 2ON5A 3WYWA 1EP8A 4DVCA 3R2QA 2IYJA 3VPQA 1G0TA 3GHAA 3P8WA 2LNSA 4F0CA 5JWQB 1MDJA 4F82A 2H1AA 2R5GA 1B4PA 1M7TA 1ML6A 2VCWA 2DIZA 4MCUA 4IELA 1T4ZA 1URMA 1H4OA 1S3CA 2VM1A 2CAIA 1J9BA 1KTEA 4MF6A 2AB6A 1XCCA 3UMAA 1T1VA 3M0FA 5DQYA 1WE0A 5EY6A 3LSZA 3BJ5A 2V1MA 4EDYA 1ZGNA 2PVQA 4K0NA 3GUSA 1V2AA 3L4NA 4OFTA 2YN1A 1XOBA 3KEBA 2YPMA 3FR3A 1SYRA 3LJRA 1Y6EA 3HY2A 4AJ8A 3WGXA 1LBKA 3TCOA 1GH2A 2ES7A 2NDOA 3GL5A 1TK5B 1ERWA 2VO4A 1AAZA 2PGTA 3HVXA 2VL2A 4EE0A
chains in the Genus database with same CATH superfamily
2AAWA 5CRHA 3LGCA 2VCTA 5ECLB 4L8OA 3MWZA 4POMA 4OO4A 4PGTA 1O7PB 4BTYA 3D4AA 2H74A 4K6XA 4KA0A 1OUNA 4MH2A 3UEMA 2I9HA 2HSHA 5KN1A 1Z5YE 1K0OA 3MWHA 4HVNA 2WJUA 1QK8A 4KFFA 1E2YA 4GTUA 5F05A 1Q4JA 1R5PA 4F9ZA 1JV2B 2VD0A 2F98A 2Z9SA 1DVCA 3UNLA 1PU4A 3F7XA 3PR8A 1M2BA 2CA8A 3EU3A 2BMQB 2D42A 1FGTA 2CWTA 3EBYA 3FG4A 3A3TA 2PZVA 1TP6A 3ZFBA 2BU4A 4ML1A 2LQOA 2N5BA 1OE7A 1EV4A 4RI7A 1O7WB 3LG6A 3W8JA 3DM8A 2XC2A 1FUSA 3F63A 2DJ0A 4IGJA 1D6ZA 4TOPA 1VF2A 1IT7A 1A67A 1C7HA 1XIYA 4JR4A 2HNLA 4Z2RA 1X1XA 1BNSA 4BTWA 3CCV3 4ILFA 3DD3A 2PWJA 3CYNA 4G0KA 3IA1A 1Z6NA 2A4HA 1K3OA 1GTAA 3SEDA 1I3FA 2HFDA 1JBTA 2E0QA 4MABA 5DDLA 2DIYA 1GWCA 4GF0A 2E2GA 2QEX3 4FO5A 4WETA 5J9BA 4EV5A 4N0VA 1GNWA 3HCZA 1Q864 5KN3A 3UJ1A 2CVDA 3GV1A 7GSPA 2IMKA 4KCAA 1Z9HA 3IBHA 5DJMA 3FYGA 4R4KA 1X0RA 1NJI4 2ML6A 3MDKA 1FGMA 3FF0A 2LYXA 1UDII 2FCHA 5LCZA 2Z7AA 3HIIA 3FEUA 1A2JA 1QAKA 2W04A 2O89A 2WB9A 4MEIA 3CMA3 5AEWB 5JCWA 1NNVA 2BMXA 4GCIA 1M99A 4V2LA 3CSIA 1YNVX 5A5KA 1ERTA 4NWYA 1EGOA 1IVUA 1AC1A 1YQ1A 4ZB8A 1NSWA 5IO2A 1RGKA 2GGTA 1XOAA 1Z1SA 5H5RA 4WYKB 4OFNA 1TK8B 4ZL9A 2R6KA 4G0IA 4WBJA 4GSSA 3VGNA 2NTOA 1FUWA 4HQSA 1SL1B 3BU4A 3VI7A 3IC4A 3LFLA 3WD6A 6GSVA 4EC6A 1GNEA 4HJ2A 1G7EA 1LQMB 4PQ1A 4EDZA 2OTL3 22GSA 4OUQA 1JB2A 1LOYA 1XWBA 3ZL5A 2LSTA 2F99A 3I0YA 2K0MA 2P38A 2YANA 1TIJA 4TXVA 4MF7A 4ZIJA 3CNXA 1QMAA 2CWUA 3F14A 2DMMA 4MZWA 1SJZA 2EIRA 1HNCA 3TJBA 1BSBA 6GSSA 4MMXB 4JZQA 3WT2A 3CC43 1W01A 3US3A 3L78A 4KH7A 1VQL3 2KLXA 5BMUA 4FYBA 2JQ5A 3I563 1X5DA 4TRXA 1XWAA 1GSPA 1FHEA 4ACSA 3ZREA 1OC9B 1RLSA 2E2MA 2HXKA 1O7UA 2H71A 3X3YA 1FB0A 4KX4A 2C1YA 3A5EA 2WGOA 4E8HA 2WULA 4N6UA 1M2AA 2N5AA 5KN0A 5HGRA 3KTLA 5DALB 4N30A 4PNFA 3D6IA 5D9WA 5A4UA 3UVTA 1BRKA 4ECCA 3LORA 4POBA 3ZMLA 4J8TA 5D93A 1RGAA 1PQNA 1VQ43 3PINA 1RSNA 1F9MA 1V98A 4G1MB 3QCPA 2JU5A 4GSNA 1THOA 3FGYA 1BOXA 1GD4A 2H6XA 2C11A 3CCU3 2E7PA 2H76A 3JVCA 4Q53A 1EWXA 2O8VB 4HZ4A 2OBIA 3IPTA 3OXAA 5I97A 1I2EA 3UBKA 1IVWA 3AMOB 3NM7A 1SKSB 2MMNA 3ZVJD 1LRAA 4IJIA 4JBBA 5HR2A 1YDKA 2P05A 2OE3A 2HSYA 6RNTA 2IL3A 1Y4KA 2D1WA 5G30A 3B7CA 4ZM8A 4RNZA 1R4YA 1TRUA 3FZ9A 3P7XA 2V6KA 2JADA 1Q98A 2OE0A 4BL7A 1OGXA 3EE1A 2WO0A 2UGIA 2Y74A 3WODG 1X1UA 1XBSA 4ZB6A 5BU4A 3RDWA 1MNLA 5IW9A 4HU7A 4KE3A 4BTXA 2L5OA 5H5SA 2H66A 2UZ8A 3EE2A 1K0AA 3L0RA 1XW6A 2LRCA 6GSXA 2H75A 3LTCA 2CX0A 5IOXA 4CHSA 2B1LA 3FY7A 1B4QA 5M19A 3GSTA 4IJ3A 1MOLA 3ECFA 2OQEC 3MG2A 3NX0A 3CSHA 2K6VA 3BNCA 1XPVA 5FGOA 4EW5A 4YQVA 1XVQA 5CAXA 3N5OA 1W2ZA 1LXEA 5A4WA 4EIQA 3G8ZA 5IG3A 3D5GA 1K0MA 3TRPA 1G6YA 1BJXA 1GOUA 3TOUA 1VF3A 2MBSA 2JDIH 1PRXA 4O32A 3A5IA 3X41A 2DLXA 1FO5A 4HOJA 1D6YA 1RTUA 2VL3A 3NZNA 2MMAA 3KP8A 2OWPA 2YWIA 5DBQA 2F8FA 3ERGA 4NHWA 2LEGA 4IS0A 2W9QA 1VQO3 1U5OA 2HMKB 4QWTA 3Q18A 4LMWA 2BNGA 1YHQ3 4AKYA 3VWUA 1A2LA 2GQKA 3F4SA 2YX9A 2Y73A 1OVNA 1ERVA 1T5YA 5IM9A 5JCUA 5ABRA 2RUFA 4EO3A 5CF2A 4D73B 3F40A 2BHMA 4J5GA 1DE3A 1SK2A 2WRTA 2CX3A 1VQQA 1V40A 3D5JA 3UVHA 4RUVA 2X8CA 2IY2A 3MIXA 4HZ2A 3N9JA 4IQAA 3J7Yb 3GNJA 4LYLB 4ZBBA 5G5FA 3FSDA 5KP1A 1F3AA 1CH0A 2Z6BA 2W2CA 2K54A 1R7HA 1U3IA 3GKKA 4IPBA 4G2EA 4L0UA 3TKPA 3GSSA 3HVNA 3LOYA 2VLVA 1X9MB 2O3OA 1L5GB 4MA9A 1K0CA 1SL2B 1T2IA 1OC3A 4GRFA 3GZRA 1K0DA 2YV7A 16GSA 3IK7A 2GXFA 1SJ6A 3KH9A 4YAPA 2GZPA 3EN8A 1MGRA 1KD14 3CBUA 2OOVA 1NB3I 2IWTA 3KP9A 1CYVA 4PUFC 3KZQA 4FIWA 1YEPA 2H72A 1YF0A 4WF5A 2OACA 2M80A 5AN1A 1RCKA 4I2UA 1RGFA 1QALA 1K9M4 3KM6A 1BRJA 1EOGA 2H73A 4HKVB 3AGOA 4WEYA 1AY7A 3Q19A 7RNTA 3UARA 13GSA 4QL7A 3S27A 3QAGA 2GSSA 1BSDA 2J23A 1Q7HA 5JPUA 4CJNA 2G2QA 4XIHA 1W00A 3H79A 3LH4A 1U6TA 4EIPA 1XVWA 4IVFA 3KCHA 1ZL9A 4K8MA 2PU9C 4JU5A 1B9YC 4Z2UA 3IJEB 4FCJA 1W4NA 2KF6A 1ROVA 1LOVA 5IPGA 2MYGA 2OJLA 4I8BA 2RNTA 1V58A 5DALA 3G4S3 3OW22 19GSA 1FOVA 2O85A 2R4VA 4HQZA 2CKFB 1HU9A 3UIWA 1KEBA 1TU5A 3C1SA 1Z6MA 4TXOB 3F9UA 3HZ4A 1K734 3TJFA 2JSYA 3ME8A 4FQUA 1IQ8A 3AGNA 2XFTA 1JBSA 4IP1A 1B20A 1W6YA 1QUWA 4I97A 3GX0A 2QSIA 2H01A 1Z7RA 3MHEA 5J3RA 3WMDA 3BCKA 3SBCA 3NV0B 2GZZA 3X40A 2H8LA 3KSED 1BGSA 3FZ5A 2STDA 2F56A 2R4IA 2WGRA 1EA2A 2HZEB 2NBSA 3LXZA 4WHAA 3FKAA 1US1A 4EKZA 5AGYA 5IEOA 1USBA 5KN2A 3DVXA 1SIHA 5HFGA 5JWRB 1PL1A 2KRTA 4TR1B 2K8VA 3MYTA 3HIGA 3CME3 3LEFA 1XWGA 4MLYA 3D3LA 1JJ22 1ZYQB 5F07A 2WOHA 3A5WA 3DEXA 3L9SA 2BJXA 2WZ9A 4OO5A 1KWIA 3WOEB 5B6MA 3D4MA 4DEJA 4PX1A 3HK4A 3U1WA 5A4VA 3V1WA 1TI3A 1GP1A 2GS3A 3HDCA 3FZWA 2QGVA 1U88A 3L9UA 1I0XA 4MF5A 5IERA 2LRTA 3HA9A 4NAXA 5EL8A 2YOIA 1OCVA 4MJEA 3BCIA 3Q2PA 1JKGA 1AW9A 4IKHA 3LYPA 2PUKC 2GQMA 3E99A 1SJWA 2ZHXB 1M9BA 1NWWA 1UCKA 4H61A 2GT6A 3VURA 4PEJA 4KFEA 3BBYA 3IPZA 3Q74A 3R3EA 4J56E 4XTSA 3TKQA 1BAYA 4K61A 2GBXB 1UCIA 4HZBB 5DREA 3QAVA 2CIUA 2B6MA 3GKXA 2VCZA 4X2OA 1ZYNA 2XR8B 3ERWA 4X1UA 4Q5FA 1JZRA 1CQSA 2YFLB 5AIFA 3F3QA 2HMJB 3SXXA 4TX4A 4O5QA 1RDSA 1LOWA 2MMZA 1LVNA 4MH3A 8GSSA 3F9SA 1A2PA 2DBCA 2H0HA 4HM5B 4BU4A 1E97A 1PL2A 5HR1A 1UUVB 4JR6A 5CRDA 1UCJA 5F8BA 3B4PA 1BNRA 3GYKA 3HVSA 3IOSA 4EC0A 3CCQ3 2C8UA 1BSEA 5IPHA 4ECIA 1Q40B 2VD1A 3O76A 1BNGA 5B7CA 1GLQA 4X43A 2I1UA 1C72A 2LKUA 3LYKA 2KP1A 2B3SA 2YZHA 3MG3A 3TDGA 1GY5A 4XBYA 4V2NA 5IF6A 1TTOA 2R0CA 4HEA2 2XH9A 4IT7A 1EG9B 3CXGA 3J7Yk 1T8EB 4HJLB 2JL4A 2ZL8A 2C3TA 1BRGA 2JACA 4R80A 5CRWA 2C0DA 2OA7A 1C54A 3DXBA 4BL7B 4V1Ag 2IA7A 2FWGA 2ON7A 1EQKA 4LZIA 2W56B 4MNNA 3NXJA 3CNMA 1WPIA 4V2MA 2CW9A 2CAQA 1IV9A 2FD3A 1UGHI 1IQXA 2MC8A 2Z76A 2W0QA 3DGQA 2BMRB 1GOYA 1TP9A 1I2FA 2HMLB 3JUNA 2SBLA 3MKIA 2IIYA 4TN8A 2ZUPA 3F0IA 2GEYA 2V6OA 4BA7A 4FMBA 1O8WA 1SU9A 2HLSA 2W03A 2C3NA 1XWCA 4BL2A 5ECHB 2DJ1A 2LJAA 1RN7A 5ECMB 4GWRA 1B2ZA 2YJ7A 4RQXA 2MBTA 4BPYA 3DRNA 2GSQA 2HRNA 3H93A 3KH7A 1A23A 1BVIA 3U97A 4J5KA 3DGMA 3NM2A 4MZBA 3JUQA 2H6ZA 4R9KA 2NPBA 3KE7A 3GN3A 1DUGA 1SARA 3M9JA 1DE1A 4GSPA 3NHXA 4BVYA 2DJ3A 2CX1A 1RQMA 3GKNA 5ECNB 1M1K4 3KFQC 3FW2A 2PERA 1WTHA 1SKRB 3GZYB 3I6AA 3RDEA 20GSA 1LOXA 1WWJA 2PVOC 1I5GA 3F8HA 1OACA 5HFIA 4AJ7A 4JRFA 1WRYA 3HXSA 4POLA 2PNCA 12GSA 4KUNA 1SQWA 1QAFA 2XPEA 1LNIA 3VFIA 3RHBA 1W02A 2YWMA 1MDIA 3ZIVA 4A5PA 1JN5B 5HR3A 1EEMA 1B48A 1O7GB 2RGQA 1A8YA 2B5EA 2PMTA 1NHOA 4WBRD 3SVAA 1I8VA 2G0FA 2H70A 3H51A 1NM3A 3OWSA 1X1WA 1N8JA 3K9MC 5FWGA 5G5EA 3CTGA 1PMTA 2OTJ3 3VSYA 1LQGC 1WP0A 5ID2B 3WR2A 2AV4A 3WGDA 4BVXB 2B1KA 2YZUA 4AEQA 2IJYA 2RLIA 3EINA 3WDGB 1K28A 4JRRA 3KTBA 5ELGA 5ELAA 3LTAA 1B2UA 3CCS3 3E3EA 4HYZA 1I0VA 2BO9B 3Q3FA 5DCGA 1LJRA 3CMIA 3JUOA 3NBRA 8RNTA 1YIJ3 1BUQA 1VZZA 1QVF2 1BRIA 4IBPA 5RNTA 3MSOA 2VCXA 4HM6B 3A2XA 1YKAA 3HJOA 2YNXA 1IVXA 4RNTA 3DMCA 2N5FA 2V32A 3PYJA 4EUYA 4HI7A 1GLPA 1FUTA 4ML6A 1KBNA 2WS2A 2XBQA 5AYRB 4EV2A 4GQCA 4MP4A 2X4AA 4ZBDA 5IOWA 2X8HA 4NMUA 4L8EA 5D81A 4NHZA 1GSSA 1THXA 2KP2A 3Q1CA 3V92A 1KSIA 1O81A 4K1UA 4RZMA 3G9BA 2ZA4A 3BD2A 4RI6A 1N9EA 1DMQA 1HNBA 4XS4A 4YKFA 1UC7A 4K5RA 2GSRA 2AAEA 1YZXA 1IYYA 3VWVA 1JB5A 1I9DA 3M1GA 3GMFA 2J9HA 2DKHA 14GSA 1QMVA 1ZOFA 4LSOA 3A2VA 3JUMA 1VF4A 1OE8A 4XS4B 1ZO2A 1OKDA 2ML5A 2HE3A 3WA3A 3I9V2 2LRNA 1MD3A 1Q42A 2CX4A 4G0LA 5G2ZA 3P2AA 4KDUA 3RNTA 2XEPA 4CY8A 5ENUA 3GH9A 3BOAA 5ECRB 2H6YA 2IFQA 3DIEA 2DSAA 3CC23 4WXTA 1G02A 4N6NB 6STDA 3EC3A 3LZAA 4N3VA 2H1GA 2PBJA 1W6GA 3GL3A 2IUJA 3LMLA 5ECIB 1VQ63 1FOHA 2L6DA 3MSZA 3IHGA 4BVXA 2FWEA 2M72A 3IV4A 1HQOA 3C71A 1PGTA 1ABAA 3Q6OA 4ZBAA 1VQ73 1TUHA 1MEKA 4FYUA 3FK8A 3QK9A 1QFNA 2X8GA 2GTUA 1DVDA 2IMDA 3DH2A 2TRCP 3NBJA 3NQZA 4V1Ap 4WFOA 3VPTA 2DKIA 2P0GA 1BNJA 1FG4A 1JNQA 4FCMA 3RPNA 2DJ2A 4U13A 5D9VA 5DRVA 1AXDA 1LU4A 3EF8A 2BMOB 1Z7PA 1DSBA 1LNHA 4I2TA 3WT1A 3NBBA 3S29A 4K90B 1R5AA 3F7SA 1PYLA 4FCZA 3MG1A 2KXGA 2BT3A 1WMNA 4HM8B 4BVYB 5DQSA 1S5AA 1RGCA 4XRDA 11GSA 2VIMA 5L71A 1GUKA 1GSEA 2C3QA 4EVMA 1F3BA 2FGTA 2TRXA 1ROAA 2H1DA 3TKSE 1XW5A 4Z2TA 2H30A 3M8CA 1VQP3 1TTZA 2YWNA 1IDPA 1ZCPA 2IPAA 4X2HA 4HU9A 4K2DA 4K5SA 2X64A 5IMZA 5EVHA 3G16A 3BNDA 2JZRA 4IIAA 3B4OA 3C7MA 1I2GA 4HM0B 1MWRA 4N11A 5C00A 1PX6A 4EYCA 1B3SA 2WCIA 2YJHA 2DC5A 1U3AA 3WGEA 1QGVA 2F3MA 1B27A 1SK1A 2K8SA 2CFLA 3KXOA 1ISKA 4ICYA 4K1FA 1JKGB 2WFCA 3FMWA 5KP3A 1S3RA 1GMRA 1EOHA 1TFKA 5J4UA 4QL9A 3IDVA 1BYEA 3QRDA 1NO3A 4KB3A 5AIXA 3SX1A 1X5CA 1S3DA 3O6TA 4CW9A 3F6DA 3HYPA 4OFMA 4OWYA 3K8NA 3UL5A 3DUKA 1PFOA 3CU3A 3UJMA 4ECBA 1WJKA 2VCQA 1SYXA 4G9HA 4XRAA 3S67A 1OPYA 2R0GA 1E3VA 2KHPA 3ROBA 10GSA 1UGIA 3IAM2 5IO0A 3CPW2 4DSRA 1OC9A 4MMMA 3L0HA 2KOKA 3LWAA 3G7JA 4OMVA 3G0KA 1MWUA 2P31A 2VM2A 5IQYA 3ALAA 3ZRDA 4USSA 2DJKA 5IMVA 3TKSC 1GSUA 4O92A 3CXC2 3VWXA 1K3YA 1OKTA 4CCVA 5B6NA 5EVOA 3WHOA 2HRKA 2IMEA 4IQ1A 3VK9A 4XB5A 2BTOT 4KCEA 1OAZA 3S28A 3PGTA 5BXQA 3QPMA 1Q7Y4 1YJN3 1EP7A 3KIIA 3APOA 2CC3A 3GSPA 1OYJA 2C80A 1FA3A 4PQHA 4HS1A 4TR0A 1BUJA 2CQ9A 1OH0A 3S5CA 2H1BA 1GS3A 4KNDA 1FYSA 1JBRA 2RFRA 3BLZA 5CNWA 1O8XA 1XWKA 1Y25A 3N9HA 1RW1A 1K0BA 4FH8A 1GUMA 2RCDA 3TJGA 1YF1A 3PS8A 4WR4A 1IYIA 4YQUA 5F06A 1DMNA 3JUPA 1NHYA 1VQ53 1TOFA 2AYTA 3FR6A 1RGEA 1SK0A 5CF1A 5ELJA 1F6MC 1XG8A 3EMPA 5DVBA 2IFQB 5ECKB 3WOFB 7STDA 1M0UA 3FCSB 3OR5A 2CZ2A 6GSYA 1PX7A 1M904 1N9JA 2L6CA 1ZX2A 1JB4A 4XHMA 3SYUA 1YVSA 2E2VA 5JBSA 3FZ4A 4N10A 4PURA 3G713 2HZFA 1Z3EA 1PA3A 3URPA 5HQPA 1BU4A 2M7OA 2L5LA 2MF7A 4MJCA 4MJDA 3GZBA 1BEDA 1ERUA 1W4VA 2H19A 3DY5A 4BWQA 2CFWA 4ECJA 1A2MA 1X9WB 4KVHA 3QFAC 1G6WA 4GHOA 4AJ6A 1AIUA 2CWVA 3CCL3 3STDA 1VGLA 4FYCA 3ERFA 1GSQA 6GSUA 5GSPA 1FW1A 1RGLA 3GWRA 1JN5A 2QA2A 1WQLB 1TRSA 3P90A 2JZTA 9RNTA 1EZKA 4NV5A 1TW9A 2C0GA 2LS5A 3CD63 3ZG0A 4TKYA 3ZYWA 2E2UA 2LQQA 1N5HA 1OHSA 3ZFLA 5HFKA 1JZWA 3A76A 2ZDJA 3IRAA 4HM7B 3BNEA 1PN9A 4DSQA 5IG4A 1Q824 4LLRA 4TW5A 3KMNA 1BQ7A 1BSCA 4FMDA 2R37A 1FGQA 1ULJB 3RGAA 2YV9A 2GEXA 3F8UA 1GTIA 5CP1A 2AJQB 5IMDA 1KC84 5HR0A 1AVKA 5ID2A 1SL0B 4ZL7A 4KFDA 1GUHA 4EF0A 4XS6A 3M3MA 1YY7A 1EV9A 4GXZA 1U8CB 5IMAA 3CC73 4F0BA 4AF2A 5ELUA 4H86A 3T8NA 4WF4A 3L9VA 2C10A 1FVKA 2XF3A 1FAAA 1A24A 3RBTA 2K3DA 5AI1A 2DMLA 2XFSA 1HYUA 3LT9A 2HMOB 3KIJA 2VOCA 5LNKe 2HYXA 2F8AA 2O7KA 2LUSA 4MMZB 2HMNB 2YWOA 1K8A4 1ASKA 3HD5A 3OV4A 4WKWA 2CFDA 3UB1A 1UW1A 3AHWA 4HZ9B 5FHIA 2LJRA 3C8EA 4WP5A 4JF8A 1HKXA 1STDA 2A2PA 2YP6A 2CG0A 9GSSA 3HKRA 2I9WA 4IHUA 4MDCA 4HM2B 5IMFA 4DSSB 1A8LA 5DJLA 3GIXA 3VWWA 1J2BA 4CDOA 1FZUA 1M9AA 2C0EA 5AEUB 3RAZA 4HOHA 1GTUA 1TDIA 5A0OB 4TXOA 2C4JA 2P0MA 3EVIA 4KSOA 1FGRA 2F51A 5D96A 3FRCA 2L57A 1UUGB 1MWTA 1AUCA 1IV7A 3PH9A 4PXOA 1BNFA 1GMPA 1TRWA 4OD7A 1DMMA 3CPOA 2PN8A 3S9FA 4Q5NA 1FW7A 2XGLA 1T3BA 2W9PA 3DXOA 1M2DA 2VLUA 5M18A 5JWOB 5J41A 1N8R4 3W6GA 1JZDA 3DGOA 2PPTA 4OCFA 3X3XA 4OK0A 1RK4A 3GFKA 1X9SB 1YVBI 3UL3A 3IMAB 1F37A 4XCSA 1SENA 2OE1A 2W6JH 2CFGA 1BRHA 1O73A 3CCR3 2AUVA 1TRVA 1TFOA 1SD8A 1UI7A 3TRXA 3CCM3 3HHVA 1SD9A 5FT3A 3FLJA 2L59A 1QXHA 3CRTA 4LMVA 4K9ZA 5EEOA 1WIKA 1A90A 2A2RA 3FH1A 3GAXA 1O85A 4J2FA 4F03A 1TXXA 1W5ZA 1HYFA 4R9LA 1B9XC 1K41A 1RGGA 4MMYB 2XSHB 4G10A 5M1AA 5COHA 5G31A 2AHEA 3KD0A 3TJJA 2OBKA 2UX0A 3BNBA 4I4KA 2RM6A 3F4TA 4NPBA 5IENA 3QMXA 5IIZA 4BIRA 2CH9A 1BAOA 1BG5A 4LGQA 2WOFA 3Q90A 3EPTA 2IMFA 2CVBA 3GURA 2RSXA 4XBTA 4KT3B 1YGWA 3QD9A 3H4KA 1RNBA 2A2SA 1T7PB 1YJ93 4GSTA 4IW9A 4BWSA 2TIRA 4KDYA 3LQ7A 4K2XA 4TR1A 2XPDA 3RHCA 3J7Yd 4HJMA 2B5XA 4RQRA 3EX9A 2B7JA 1MTCA 1XZOA 3K63A 5G1KA 2IMIA 1ON4A 1YEXA 2VL2C 4K7IA 1D6UA 1BIRA 4N6TA 3DGLA 3B8LA 1NU3A 4NREA 4NXIA 3ZZXA 2OADA 1XXUA 5KOXA 2K9FA 2OQEA 3GH6A 1J08A 2IMJA 4YAVA 1VF1A 5CRGA 3ZMKA 1RRHA 4L8PA 8CHOA 1QJGA 2L1SA 1JZOA 1OHPA 5IG5A 4HM3B 2L4CA 4N0ZA 1KQS2 2HI7A 1N5PA 4OCEA 5GZZB 4PQIA 4R1KA 2I81A 4QQ7A 5BIRA 5STDA 2P5QA 3ISOA 1CQHA 3NQYA 5IG0A 4O8SA 4X0XA 2HRAA 4J9AA 3VI5A 5ECQB 4EXJA 3NV0A 3KGKA 4KZ1A 4ID0A 2OKAA 3KN4A 1MD4A 1E6BA 3I69A 5D82A 4DSSA 4XDVA 2GT5A 1AQWA 2F9SA 5CK6A 1PKZA 1MWSA 3U5RE 3PCRA 5GSTA 1IQYA 5CREA 1RMSA 2SARA 4O5RA 3I553 2EIQA 4IN0A 1JLVA 2YFIB 4CDLA 3MNGA 2M46A 1GMQA 1OF5A 4F2IA 4LL4B 3D4TA 1RCLA 2GQLA 2X49A 1HD2A 4KW6A 1RRLA 4CY6A 2RM5A 1G96A 1I3IA 1H75A 1YKCA 2LV3A 5AIIA 3TKRA 2V41A 2FNOA 4TR3A 3D9RA 5D8IA 1W2B2 3CRUA 4I6XA 4GLTA 1ULIB 2FGXA 2QC7A 2R2JA 1EGRA 4HM4B 3F4RA 3E0UA 3TUEA 1WNHA 1DBYA 4JE1A 1VQ93 1VQ83 1XFLA 2CV4A 1OHOA 3D21A 2LTKA 1BNEA 5DCHA 3DMLA 5D73A 4ORLA 1R26A 1DETA 2GDRA 4LA1A 4WWUC 2QIYA 2Z77A 2EIOA 1EEJA 4KF9A 3IK9A 2REMA 2EC4A 3KKGA 4PNGA 2XSOB 1FB6A 3EBTA 5C04A 3QDNA 3QOUA 1XW9A 1BNIA 3TOTA 1RJOA 1NDOB 2GZYA 3NIVA 3W8SA 1PY3A 1GOVA 2IN3A 1ZMAA 1MDKA 3ZIJA 1Q9EA 3LTBA 4O5UA 4BL3A 5DAKA 3D22A 2LQVA 1O7NB 1U87A 3QAWA 1W6CA 1AQVA 3EC9A 3V99A 3G6E3 3GA4A 2O87A 1SKWB 2MMOA 1M1XB 4XBXA 1ZYPA 3KCMA 1AQZA 3ZFZA 1R4WA 3G7IA 1W89A 1CEWI 3WA2X 5G1LA 1JRQA 1DE2A 3D79A 3DWVA 3GX8A 2AADA 1GTBA 2RUEA 3MAKA 4CPKA 5D9TA 5B8AA 1GY7A 5TGNA 2BIRA 1N8QA 2YFJB 2RIIA 3FZAA 5AIHA 4POKA 1TKDB 2XHFA 1FVJA 5CXOA 3IXRA 3K7CA 3IC8A 3ZVJA 2ZNMA 2CVKA 1UN2A 3BIRA 1IK3A 5G2GA 1UA5A 2VAFA 2FLSA 1ILOA 1GSYA 5BVBA 1OGZA 2HZEA 1SPUA 1BX9A 1PSQA 2CFKA 2XRXB 4MJBA 5JCGA 4ULXA 3LXUX 2FNQA 17GSA 1A0FA 1QQ2A 3A2WA 2HSMA 3IHQA 1O7HB 2JSZA 1WMJA 1RGHA 1X5EA 1EKMA 1YI23 4X4JA 7GSSA 5J9CA 1MGWA 1JLWA 4MK3A 3APQA 2QGUA 3EJVA 4HM1B 4GB5A 3HVVA 3EQQB 2X99A 1OC8A 2MZCA 2FWHA 3EURA 1O7MB 1ZZYA 2K18A 3CCJ3 1SJIA 2JZSA 2R0PA 4IP6A 2F86B 3DVWA 2FA8A 5ECOB 3E9JB 3V98A 4Z7XA 3UOMA 1ZS7A 1X1YA 3CSJA 5AYSC 1F2EA 3EN1B 5KEJA 1TU7A 1M9GA 1YJW3 5DAKB 4AKZA 4L5OA 5KP4A 2HT9A 3HX8A 4AGSA 4TVEA 2B1XB 3OX9A 1A2KA 2B5YA 4BIKA 1GSFA 2HOHA 3BB9A 5J5NA 3RPPA 4K7OA 3ME7A 5INYA 3H8QA 3FG3A 1BRNL 1Q814 3GKMA 4N6MA 2QA43 1K0NA 3H3HA 4TR4A 1K3LA 3MYDA 3GRXA 2FHEA 3TKSA 3K0ZA 3F8XA 4G19A 5B8BA 2FXTA 3APSA 3AHSA 1AV4A 3LTDA 2WDUA 3LYGA 1QVG2 3PZWA 3EHCA 4HBRA 1PD21 1GRXA 5HOHA 4ZB9A 3X42A 4EL1A 3DZLA 3PCSA 3U6VA 1GL8A 3CTFA 1WMOA 2B7KA 2KF4A 1N2AA 3JCML 2L4QA 4Q5QA 4LEHA 1PFPA 2QKEA 1BRSA 2CG1A 5IMCA 3AY8A 4XS1A 1TJDA 3ZITA 3CQFA 1CQGA 1V9WA 3UBLA 1B8XA 3M9KA 5IEPA 5AISA 4KAEA 3K5TA 4O2HA 5CYYA 1RN1A 1IYHA 2D2ZA 2GSTA 2CHCA 4N6OB 1PN0A 1T00A 4ISDA 3DKSA 2KF5A 1F8NA 1VRSD 3GTUA 3HJPA 3KMOA 5JPPA 4J57E 3VF1A 4YH2A 1KNGA 1AQXA 1GY6A 3VLNA 1UVZA 4KDXA 1B2SA 1IVVA 3IAS2 4O02B 2V2GA 4ZXGA 3MPHA 3HJMA 3O8YA 3LXTA 4O7HA 2L4VA 2H0GA 4E8EA 1HNAA 1NW2A 5GAPD 4D73A 4WR5A 2F5MA 3SWLA 2WGQA 4L5LA 2CK3H 4LL1B 2RBIA 3ZLPA 2FY6A 3UL6A 2IUKA 3OWUA 5LD0A 5ECSA 2ZCTA 3DGNA 4JEDA 2QA1A 1J0FA 2YCDA 3HOHA 2KCDA 4FMAA 18GSA 1UI8A 2OOVC 5LC7A 4KGIA 6GSPA 4K1VA 2KAAA 4STDA 3FKFA 1B21A 4KSMA 2OCTA 2GU1A 1RN4A 2GU3A 1O6JA 1TI1A 1A2VA 3ZG5A 3D0ZA 4HSCX 3QFBC 2GLRA 4L0WA 2VCVA 2FWFA 5E4WA 1ST9A 1DYUA 1PKWA 4H3UA 3N8BA 4MPGA 1OF5B 5F0GA 3F6FA 3SLUA 4GL6A 4HUAA 2FUG2 1WMPA 3EMXA 5GSSA 2H0IA 2C0FA 4K0GA 1B2MA 1RKYA 2R3XA 3X3ZA 4MPFA 3TRQA 1SIIA 1ACVA 1CYUA 1YJ6A 1TU8A 1WOUA 3T0UA 4RBNA 1STFI 3G7YA 6GSWA 1BSAA 3KZTA 3CCE3 3H1NA 6GSTA 3GTUB 1JHBA 2GVPA 1IU7A 2P09A 3QR6A 1M3IA 1NB5I 2LNTA 4LMIA 2ALBA 5E59A 4ZILA 3TB2A 5H5QA 4GQFA 1Q40A 5CO3A 4N6LA 3ZTLA 5D9XA 1TK0B 2O9UX 3D5IA 1W7CA 4EXRA 2FA4A 3TJKA 1ZYEA 1VQM3 3EU4A 3I43A 3UAPA 2HRFA 5EPFA 1RHLA 4EBGA 2UUGC 1TRQA 2A15A 3FF2A 2CT6A 2XBIA 5ECPB 5CLKA 1S723 1YIT3 1IT8A 3M8NA 4DKIA 2I3YA 2R41A 3FHKA 4WYKA 1T2HA 5LC6A 3TGZA 3IR4A 3F3RA 2GSPA 4XM4A 3IE3A 4I5QA 2I4AA 2HMMB 4RNYA 2J8XB 1YGEA 2Q07A 2VLTA 1M3JA 2B24B 1V57A 3FG1A 2KF3A 3O3TA 5FW5A 3C73A 1AVLA 1VQK3 4PUAA 1EUIC 2C4BA 4OVMA 3GZXB 4YQMA 3HZPA 1I70A 1V74A 3EWLA 4NV2A 4P3YB 3KSPA 1A0RP 3LW9A 3EYTA 1HZ1A 1ZGXA 4MJAA 4ZL8A 4XDWA 1GSDA 3EB8A 2INXA 2NVLA 5AIVA 3DYRA 4Q5RA 2KUCA 1JFUA 2CZ3A 3FR9A 2LJKA 5D83A 3NOFA 4HDEA 3C1RA 3HI7A 4K7NA 3ED3A 5GAND 3KJYA 3RGRA 4MZCA 2DJJA 1RNTA 4HAAA 2P5RA 2VL9A 2A4VA 2VUPA 3HZ8A 1G7OA 3SOAA 1T4YA 1GULA 1S3AA 5EQLA 2ON5A 1TRPA 3WYWA 1GYBA 3OWYA 1EP8A 3SOYA 4DVCA 3R2QA 2IYJA 3VPQA 1G0TA 3PPUA 3GHAA 3P8WA 2LNSA 4F0CA 5JWQB 1MDJA 4F82A 2H1AA 2R5GA 3PGBA 5AIGA 1B4PA 1M7TA 1ML6A 2VCWA 2DIZA 4MCUA 4IELA 1T4ZA 2XGNA 1URMA 4PTSA 1H4OA 1S3CA 3GRDA 1FGOA 2VM1A 2CAIA 3ER7A 1J9BA 1KTEA 3LT8A 4MF6A 2AB6A 1XCCA 4YKGA 3UMAA 2W56A 3NUVA 4L7KA 1T1VA 3M0FA 5DQYA 3PXMA 3DGYA 1WE0A 3N54B 5EY6A 3LSZA 3BJ5A 1AR0A 2V1MA 4EDYA 1ZGNA 4N6V0 4FMCA 2PVQA 3GUSA 4K0NA 2F4YA 1V2AA 1UCLA 3L4NA 4OFTA 2YN1A 1XOBA 3KEBA 4O3VA 2YPMA 3T8UA 3FR3A 1SYRA 1VQN3 3LJRA 1B2XA 1Y6EA 3HY2A 1E3RA 2GBWB 2V1LA 4AJ8A 4FR9A 1BANA 3WGXA 1LBKA 3TCOA 1GH2A 2ES7A 2NDOA 3GL5A 1TK5B 1ERWA 2F5WA 2P0XA 1GD3A 4NHFA 2VO4A 1AAZA 2PGTA 5BRTA 3HVXA 1R4CA 5KOWA 3AMOA 2VL2A 1UUWB 2E2TA 4EE0A
chains in the Genus database with same CATH topology
2AAWA 5CRHA 3LGCA 2VCTA 5ECLB 4POMA 4OO4A 4PGTA 2H74A 4K6XA 4KA0A 3UEMA 4MH2A 2I9HA 2HSHA 5KN1A 1Z5YE 1K0OA 3MWHA 2WJUA 4GTUA 1QK8A 1E2YA 5F05A 1Q4JA 1R5PA 4F9ZA 2VD0A 2Z9SA 3PR8A 1M2BA 2CA8A 3EU3A 3A3TA 3ZFBA 4ML1A 2LQOA 2N5BA 1OE7A 1EV4A 4RI7A 3LG6A 3W8JA 2XC2A 3F63A 2DJ0A 4IGJA 4TOPA 1VF2A 1XIYA 4JR4A 2HNLA 4Z2RA 4ILFA 3DD3A 2PWJA 3CYNA 4G0KA 3IA1A 1Z6NA 2A4HA 1K3OA 1GTAA 2HFDA 2E0QA 4MABA 5DDLA 2DIYA 1GWCA 4GF0A 2E2GA 4FO5A 4WETA 5J9BA 4N0VA 1GNWA 3HCZA 5KN3A 3UJ1A 2CVDA 3GV1A 2IMKA 4KCAA 1Z9HA 3IBHA 5DJMA 3FYGA 1X0RA 3MDKA 2FCHA 5LCZA 3FEUA 1A2JA 2O89A 2WB9A 5JCWA 2BMXA 4GCIA 1M99A 4V2LA 3CSIA 5A5KA 1ERTA 4NWYA 1EGOA 1AC1A 1YQ1A 4ZB8A 1NSWA 5IO2A 2GGTA 1XOAA 5H5RA 4OFNA 1TK8B 4ZL9A 2R6KA 4G0IA 4WBJA 4GSSA 2NTOA 4HQSA 1SL1B 3VI7A 3IC4A 3LFLA 3WD6A 6GSVA 1GNEA 4HJ2A 1G7EA 4PQ1A 4EDZA 22GSA 1XWBA 3ZL5A 2LSTA 2YANA 4TXVA 4MF7A 4ZIJA 2DMMA 4MZWA 1SJZA 2EIRA 1HNCA 3TJBA 6GSSA 4JZQA 3WT2A 3US3A 3L78A 4KH7A 2KLXA 5BMUA 4FYBA 1X5DA 4TRXA 1XWAA 1FHEA 4ACSA 3ZREA 1OC9B 2E2MA 2HXKA 1O7UA 2H71A 1FB0A 4KX4A 2C1YA 4E8HA 2WULA 1M2AA 2N5AA 5KN0A 3KTLA 5DALB 4N30A 4PNFA 3D6IA 5D9WA 5A4UA 3UVTA 4ECCA 3LORA 4POBA 3ZMLA 5D93A 1PQNA 3PINA 1F9MA 1V98A 3QCPA 2JU5A 4GSNA 1THOA 2H6XA 2E7PA 2H76A 1EWXA 2O8VB 4HZ4A 2OBIA 3UBKA 1SKSB 2MMNA 3ZVJD 4IJIA 4JBBA 5HR2A 1YDKA 2OE3A 2HSYA 2IL3A 5G30A 1TRUA 3FZ9A 3P7XA 2V6KA 2JADA 1Q98A 2OE0A 4BL7A 1XBSA 4ZB6A 3RDWA 4HU7A 4KE3A 2L5OA 5H5SA 2H66A 2UZ8A 3EE2A 1K0AA 1XW6A 2LRCA 6GSXA 2H75A 5IOXA 4CHSA 2B1LA 3FY7A 1B4QA 3GSTA 4IJ3A 3CSHA 2K6VA 1XPVA 4YQVA 1XVQA 5CAXA 3N5OA 5A4WA 4EIQA 1K0MA 3TRPA 1G6YA 1BJXA 3TOUA 1VF3A 2MBSA 1PRXA 4O32A 3A5IA 2DLXA 1FO5A 4HOJA 2VL3A 3NZNA 2MMAA 3KP8A 2YWIA 5DBQA 2F8FA 3ERGA 4NHWA 2LEGA 4IS0A 4LMWA 3Q18A 3VWUA 1A2LA 2GQKA 3F4SA 1OVNA 1ERVA 5IM9A 5JCUA 5ABRA 2RUFA 4EO3A 4D73B 1SK2A 2WRTA 2CX3A 1V40A 3D5JA 3UVHA 4RUVA 2X8CA 2IY2A 3MIXA 4HZ2A 3N9JA 4IQAA 3J7Yb 3GNJA 4ZBBA 5G5FA 1F3AA 1U3IA 1R7HA 3GKKA 4G2EA 4L0UA 3TKPA 3GSSA 2VLVA 1X9MB 4MA9A 1K0CA 1SL2B 1OC3A 4GRFA 1K0DA 2YV7A 16GSA 3IK7A 1SJ6A 3KH9A 4YAPA 2GZPA 3CBUA 2IWTA 3KP9A 4PUFC 3KZQA 4FIWA 1YEPA 2H72A 1YF0A 4WF5A 2OACA 2M80A 5AN1A 4I2UA 3KM6A 1EOGA 2H73A 4WEYA 3Q19A 3UARA 13GSA 4QL7A 3QAGA 2GSSA 2J23A 2G2QA 4XIHA 3H79A 1U6TA 4EIPA 1XVWA 4IVFA 1ZL9A 4K8MA 2PU9C 4JU5A 1B9YC 4Z2UA 5IPGA 2MYGA 2OJLA 4I8BA 1V58A 5DALA 19GSA 1FOVA 2O85A 2R4VA 4HQZA 3UIWA 1KEBA 3C1SA 1Z6MA 4TXOB 3F9UA 3HZ4A 3TJFA 2JSYA 3ME8A 4FQUA 4IP1A 1QUWA 4I97A 3GX0A 2QSIA 2H01A 1Z7RA 5J3RA 3BCKA 3SBCA 2GZZA 2H8LA 3FZ5A 2WGRA 2HZEB 2NBSA 3LXZA 4EKZA 5AGYA 1USBA 5KN2A 3DVXA 5HFGA 5JWRB 1PL1A 4TR1B 2K8VA 3LEFA 1XWGA 4MLYA 1ZYQB 5F07A 3A5WA 3DEXA 3L9SA 2BJXA 2WZ9A 4OO5A 5B6MA 3D4MA 4DEJA 4PX1A 5A4VA 3V1WA 1TI3A 1GP1A 2GS3A 3HDCA 2QGVA 1U88A 3L9UA 4MF5A 2LRTA 3HA9A 4NAXA 5EL8A 2YOIA 4MJEA 3BCIA 1AW9A 4IKHA 3LYPA 2PUKC 2GQMA 1M9BA 2GT6A 3VURA 3BBYA 3IPZA 3Q74A 3R3EA 4J56E 3TKQA 4XTSA 1BAYA 3QAVA 2B6MA 3GKXA 2VCZA 1ZYNA 3ERWA 4X1UA 4Q5FA 1JZRA 3F3QA 4O5QA 2MMZA 4MH3A 8GSSA 2DBCA 2H0HA 1PL2A 5HR1A 4JR6A 5CRDA 5F8BA 3GYKA 3HVSA 3IOSA 4EC0A 2C8UA 5IPHA 4ECIA 2VD1A 3O76A 5B7CA 1GLQA 4X43A 2I1UA 1C72A 2LKUA 3LYKA 2KP1A 2B3SA 2YZHA 3TDGA 4V2NA 2R0CA 4HEA2 3CXGA 3J7Yk 1T8EB 2JL4A 2C3TA 2JACA 5CRWA 2C0DA 2OA7A 3DXBA 4BL7B 4V1Ag 2ON7A 2FWGA 4MNNA 1WPIA 4V2MA 2CAQA 2FD3A 3DGQA 1TP9A 2IIYA 4TN8A 2ZUPA 3F0IA 2V6OA 4BA7A 1O8WA 1SU9A 2HLSA 2C3NA 1XWCA 5ECHB 2DJ1A 2LJAA 5ECMB 4GWRA 2YJ7A 4RQXA 2MBTA 4BPYA 3DRNA 2GSQA 2HRNA 3H93A 3KH7A 1A23A 4MZBA 2H6ZA 2NPBA 3GN3A 1DUGA 3M9JA 1DE1A 4BVYA 2DJ3A 1RQMA 3GKNA 5ECNB 3FW2A 2PERA 1SKRB 3I6AA 20GSA 1WWJA 2PVOC 1I5GA 5HFIA 4AJ7A 3HXSA 1WRYA 4POLA 12GSA 4KUNA 2XPEA 3VFIA 3RHBA 2YWMA 1MDIA 3ZIVA 4A5PA 5HR3A 1EEMA 1B48A 1A8YA 2B5EA 2PMTA 1NHOA 4WBRD 2G0FA 2H70A 1N8JA 1NM3A 5FWGA 5G5EA 3CTGA 1PMTA 1WP0A 5ID2B 2AV4A 3WGDA 4BVXB 2B1KA 2YZUA 2IJYA 2RLIA 3EINA 4JRRA 3KTBA 5ELGA 5ELAA 3E3EA 5DCGA 1LJRA 3CMIA 4IBPA 2VCXA 3A2XA 1YKAA 3HJOA 2YNXA 2N5FA 2V32A 4EUYA 4HI7A 1GLPA 4ML6A 1KBNA 2WS2A 2XBQA 4GQCA 4MP4A 2X4AA 4ZBDA 5IOWA 2X8HA 4NMUA 4L8EA 4NHZA 1GSSA 1THXA 2KP2A 1O81A 3G9BA 3BD2A 4RI6A 1HNBA 4XS4A 4YKFA 1UC7A 4K5RA 2GSRA 1YZXA 3VWVA 1I9DA 3M1GA 3GMFA 2J9HA 2DKHA 14GSA 1QMVA 1ZOFA 3A2VA 1VF4A 1OE8A 4XS4B 1OKDA 2HE3A 3I9V2 2LRNA 1MD3A 2CX4A 4G0LA 5G2ZA 3P2AA 4KDUA 4CY8A 5ENUA 3GH9A 3BOAA 5ECRB 2H6YA 2IFQA 3DIEA 2DSAA 4WXTA 3EC3A 2H1GA 2PBJA 3GL3A 5ECIB 1FOHA 2L6DA 3MSZA 3IHGA 4BVXA 2FWEA 2M72A 3IV4A 1HQOA 3C71A 1PGTA 1ABAA 3Q6OA 4ZBAA 1MEKA 4FYUA 3FK8A 1QFNA 2X8GA 2GTUA 2IMDA 2TRCP 4V1Ap 3VPTA 2DKIA 2P0GA 1FG4A 3RPNA 2DJ2A 5D9VA 1AXDA 1LU4A 1Z7PA 1DSBA 4I2TA 3WT1A 1R5AA 4BVYB 5DQSA 4XRDA 11GSA 2VIMA 5L71A 1GUKA 1GSEA 2C3QA 4EVMA 1F3BA 2TRXA 2H1DA 3TKSE 1XW5A 4Z2TA 2H30A 1TTZA 2YWNA 1ZCPA 2IPAA 4HU9A 4K2DA 4K5SA 2X64A 5IMZA 2JZRA 3C7MA 4N11A 5C00A 1PX6A 2WCIA 2YJHA 2DC5A 1U3AA 3WGEA 1QGVA 2F3MA 1SK1A 2K8SA 3KXOA 4ICYA 4K1FA 2WFCA 3FMWA 1EOHA 5J4UA 4QL9A 3IDVA 1BYEA 4KB3A 5AIXA 1X5CA 1S3DA 3O6TA 4CW9A 3F6DA 3HYPA 4OFMA 4OWYA 3K8NA 4ECBA 1WJKA 2VCQA 1SYXA 4G9HA 4XRAA 2R0GA 2KHPA 10GSA 3IAM2 5IO0A 4DSRA 1OC9A 4MMMA 3L0HA 2KOKA 3LWAA 3G7JA 4OMVA 2P31A 2VM2A 5IQYA 3ZRDA 4USSA 2DJKA 5IMVA 3TKSC 1GSUA 4O92A 3VWXA 1K3YA 1OKTA 5B6NA 5EVOA 2HRKA 2IMEA 4IQ1A 3VK9A 2BTOT 4KCEA 1OAZA 3PGTA 3QPMA 1EP7A 3APOA 1OYJA 2C80A 4PQHA 4HS1A 4TR0A 2CQ9A 2H1BA 4KNDA 5CNWA 1O8XA 1XWKA 1Y25A 1RW1A 1K0BA 4FH8A 1GUMA 3TJGA 1YF1A 4WR4A 1IYIA 4YQUA 5F06A 1NHYA 2AYTA 1TOFA 3FR6A 1SK0A 1F6MC 3EMPA 5ECKB 5DVBA 2IFQB 1M0UA 3OR5A 2CZ2A 6GSYA 1PX7A 2L6CA 4XHMA 3FZ4A 4N10A 4PURA 2HZFA 1Z3EA 1PA3A 5HQPA 2L5LA 4MJCA 1BEDA 1ERUA 1W4VA 2H19A 4BWQA 4ECJA 1A2MA 1X9WB 3QFAC 1G6WA 4AJ6A 1AIUA 1VGLA 4FYCA 3ERFA 1GSQA 6GSUA 1FW1A 2QA2A 1TRSA 3P90A 2JZTA 1EZKA 4NV5A 1TW9A 2C0GA 2LS5A 4TKYA 3ZYWA 2LQQA 3ZFLA 5HFKA 1JZWA 3IRAA 1PN9A 4DSQA 4LLRA 4TW5A 3KMNA 1BQ7A 2R37A 2YV9A 3F8UA 1GTIA 5CP1A 2AJQB 5IMDA 5HR0A 5ID2A 1SL0B 4ZL7A 1GUHA 4EF0A 4XS6A 3M3MA 1YY7A 1EV9A 4GXZA 5IMAA 4F0BA 4AF2A 4H86A 4WF4A 3L9VA 1FVKA 1FAAA 1A24A 3RBTA 2DMLA 1HYUA 3KIJA 2VOCA 5LNKe 2HYXA 2F8AA 2O7KA 2LUSA 2YWOA 4WKWA 3HD5A 5FHIA 2LJRA 3C8EA 2YP6A 2A2PA 9GSSA 3HKRA 4IHUA 4MDCA 5IMFA 4DSSB 1A8LA 5DJLA 3GIXA 3VWWA 4CDOA 1M9AA 2C0EA 3RAZA 1GTUA 1TDIA 4TXOA 2C4JA 3EVIA 4KSOA 2F51A 5D96A 3FRCA 2L57A 1AUCA 4PXOA 3PH9A 1TRWA 4OD7A 2PN8A 3S9FA 4Q5NA 1T3BA 1M2DA 2VLUA 5JWOB 5J41A 3W6GA 1JZDA 2PPTA 4OCFA 1RK4A 3GFKA 1X9SB 3UL3A 1F37A 4XCSA 1SENA 2OE1A 1O73A 2AUVA 1TRVA 1SD8A 3TRXA 3HHVA 1SD9A 5FT3A 2L59A 1QXHA 3CRTA 4LMVA 4K9ZA 2A2RA 1WIKA 1O85A 4J2FA 4F03A 1TXXA 1B9XC 4G10A 5COHA 5G31A 2AHEA 3TJJA 3KD0A 2OBKA 2RM6A 3F4TA 4NPBA 3QMXA 5IIZA 1BG5A 3EPTA 2IMFA 2CVBA 3GURA 3QD9A 3H4KA 2A2SA 1T7PB 4GSTA 4IW9A 4BWSA 2TIRA 4KDYA 3LQ7A 4K2XA 4TR1A 2XPDA 3RHCA 4HJMA 2B5XA 4RQRA 2B7JA 1MTCA 1XZOA 5G1KA 2IMIA 1ON4A 1YEXA 2VL2C 4K7IA 4NXIA 3ZZXA 2OADA 1XXUA 5KOXA 2K9FA 3GH6A 1J08A 4YAVA 1VF1A 5CRGA 3ZMKA 1JZOA 2L4CA 4N0ZA 2HI7A 4OCEA 5GZZB 4PQIA 2I81A 4QQ7A 2P5QA 3ISOA 1CQHA 4X0XA 2HRAA 3VI5A 5ECQB 4EXJA 4ID0A 3KGKA 2OKAA 1MD4A 1E6BA 3I69A 4DSSA 2GT5A 1AQWA 2F9SA 1PKZA 3U5RE 5GSTA 5CREA 4O5RA 2EIQA 4IN0A 1JLVA 3MNGA 2M46A 4F2IA 4LL4B 3D4TA 2GQLA 2X49A 1HD2A 4KW6A 4CY6A 2RM5A 1H75A 1YKCA 2LV3A 3TKRA 2V41A 2FNOA 4TR3A 5D8IA 3CRUA 4I6XA 4GLTA 2FGXA 2QC7A 2R2JA 1EGRA 3F4RA 3E0UA 3TUEA 1DBYA 4JE1A 1XFLA 2CV4A 3D21A 2LTKA 5DCHA 3DMLA 5D73A 1R26A 2GDRA 4LA1A 2EIOA 1EEJA 4KF9A 3IK9A 2REMA 2EC4A 4PNGA 1FB6A 5C04A 3QDNA 3QOUA 1XW9A 3TOTA 2GZYA 3NIVA 3W8SA 2IN3A 1ZMAA 1MDKA 3ZIJA 4O5UA 5DAKA 3D22A 1U87A 3QAWA 1AQVA 3GA4A 2O87A 1SKWB 2MMOA 1ZYPA 3KCMA 1R4WA 3G7IA 1W89A 5G1LA 1DE2A 3DWVA 3GX8A 1GTBA 2RUEA 3MAKA 5D9TA 5B8AA 2RIIA 3FZAA 4POKA 1TKDB 2XHFA 1FVJA 3IXRA 3IC8A 3ZVJA 2ZNMA 2CVKA 1UN2A 2VAFA 1ILOA 1UA5A 2FLSA 1GSYA 2HZEA 1PSQA 1BX9A 4MJBA 5JCGA 4ULXA 17GSA 1A0FA 1QQ2A 3A2WA 2HSMA 3IHQA 2JSZA 1WMJA 1X5EA 5J9CA 4X4JA 7GSSA 1JLWA 4MK3A 3APQA 3HVVA 2X99A 1OC8A 2MZCA 2FWHA 3EURA 1ZZYA 2K18A 1SJIA 2JZSA 2R0PA 4IP6A 3DVWA 2FA8A 5ECOB 3E9JB 4Z7XA 3UOMA 3CSJA 1F2EA 5KEJA 1TU7A 5DAKB 4L5OA 2HT9A 4AGSA 4TVEA 2B5YA 1GSFA 5J5NA 3RPPA 4K7OA 3ME7A 5INYA 3H8QA 3GKMA 1K0NA 4TR4A 1K3LA 3MYDA 3GRXA 2FHEA 3TKSA 4G19A 5B8BA 3APSA 2WDUA 1PD21 1GRXA 4ZB9A 4EL1A 3U6VA 1GL8A 3CTFA 2B7KA 1N2AA 3JCML 2L4QA 4Q5QA 2QKEA 5IMCA 3AY8A 4XS1A 1TJDA 3ZITA 1CQGA 1V9WA 3UBLA 1B8XA 3M9KA 5AISA 4KAEA 5CYYA 1IYHA 2D2ZA 2GSTA 1PN0A 1T00A 4ISDA 3DKSA 1VRSD 3GTUA 3HJPA 3KMOA 4J57E 3VLNA 4YH2A 1KNGA 1AQXA 1UVZA 4KDXA 3IAS2 2V2GA 4ZXGA 3HJMA 3LXTA 4O7HA 4E8EA 2H0GA 1HNAA 1NW2A 5GAPD 4D73A 4WR5A 3SWLA 4L5LA 4LL1B 3ZLPA 2FY6A 5LD0A 5ECSA 2ZCTA 4JEDA 2QA1A 1J0FA 2YCDA 18GSA 4KGIA 3FKFA 4KSMA 1O6JA 1TI1A 3D0ZA 3QFBC 2GLRA 4L0WA 2VCVA 2FWFA 5E4WA 1ST9A 1PKWA 4MPGA 5F0GA 3F6FA 4HUAA 2FUG2 5GSSA 3EMXA 2H0IA 2C0FA 4K0GA 2R3XA 4MPFA 3TRQA 1ACVA 1YJ6A 1TU8A 1WOUA 3G7YA 6GSWA 3H1NA 6GSTA 3GTUB 1JHBA 2GVPA 3QR6A 2LNTA 2ALBA 5E59A 4ZILA 3TB2A 5H5QA 4GQFA 5CO3A 3ZTLA 5D9XA 1TK0B 2FA4A 3TJKA 1ZYEA 3EU4A 3I43A 3UAPA 2HRFA 5EPFA 2XBIA 2CT6A 5ECPB 3M8NA 2I3YA 3FHKA 3TGZA 3IR4A 3F3RA 3IE3A 4I5QA 2I4AA 2VLTA 1V57A 3O3TA 3C73A 4PUAA 4YQMA 4NV2A 3EWLA 4P3YB 1A0RP 3LW9A 3EYTA 4MJAA 4ZL8A 1GSDA 2NVLA 5AIVA 3DYRA 4Q5RA 2KUCA 3FR9A 1JFUA 2CZ3A 2LJKA 3NOFA 4HDEA 3C1RA 4K7NA 3ED3A 5GAND 3KJYA 4MZCA 2DJJA 2P5RA 2VL9A 2A4VA 2VUPA 3HZ8A 1G7OA 1T4YA 1GULA 1S3AA 2ON5A 3WYWA 1EP8A 4DVCA 3R2QA 2IYJA 3VPQA 1G0TA 3PPUA 3GHAA 3P8WA 2LNSA 4F0CA 5JWQB 1MDJA 4F82A 2H1AA 2R5GA 1B4PA 1M7TA 1ML6A 2VCWA 2DIZA 4MCUA 4IELA 1T4ZA 1URMA 4PTSA 1H4OA 1S3CA 2VM1A 2CAIA 1J9BA 1KTEA 4MF6A 2AB6A 1XCCA 4YKGA 3UMAA 1T1VA 3M0FA 5DQYA 1WE0A 5EY6A 3LSZA 3BJ5A 2V1MA 4EDYA 1ZGNA 2PVQA 4K0NA 3GUSA 1V2AA 3L4NA 4OFTA 2YN1A 1XOBA 3KEBA 2YPMA 3FR3A 1SYRA 3LJRA 1Y6EA 3HY2A 4AJ8A 3WGXA 1LBKA 3TCOA 1GH2A 2ES7A 2NDOA 3GL5A 1TK5B 1ERWA 2VO4A 1AAZA 2PGTA 5BRTA 3HVXA 5KOWA 2VL2A 4EE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAW A;  5CRH A;  3LGC A;  2VCT A;  5ECL B;  4POM A;  4OO4 A;  4PGT A;  2H74 A;  4K6X A;  4KA0 A;  3UEM A;  4MH2 A;  2I9H A;  2HSH A;  5KN1 A;  1Z5Y E;  1K0O A;  3MWH A;  2WJU A;  4GTU A;  1QK8 A;  1E2Y A;  5F05 A;  1Q4J A;  1R5P A;  4F9Z A;  2VD0 A;  2Z9S A;  3PR8 A;  1M2B A;  2CA8 A;  3EU3 A;  3A3T A;  3ZFB A;  4ML1 A;  2LQO A;  2N5B A;  1OE7 A;  1EV4 A;  4RI7 A;  3LG6 A;  3W8J A;  2XC2 A;  3F63 A;  2DJ0 A;  4IGJ A;  4TOP A;  1VF2 A;  1XIY A;  4JR4 A;  2HNL A;  4ILF A;  3DD3 A;  2PWJ A;  3CYN A;  3IA1 A;  1Z6N A;  1K3O A;  1GTA A;  2HFD A;  2E0Q A;  4MAB A;  5DDL A;  2DIY A;  1GWC A;  4GF0 A;  2E2G A;  4FO5 A;  4WET A;  5J9B A;  4N0V A;  1GNW A;  3HCZ A;  5KN3 A;  3UJ1 A;  2CVD A;  3GV1 A;  2IMK A;  4KCA A;  1Z9H A;  3IBH A;  5DJM A;  3FYG A;  1X0R A;  3MDK A;  2FCH A;  5LCZ A;  3FEU A;  1A2J A;  2O89 A;  2WB9 A;  5JCW A;  2BMX A;  4GCI A;  1M99 A;  4V2L A;  3CSI A;  5A5K A;  1ERT A;  4NWY A;  1EGO A;  1AC1 A;  1YQ1 A;  4ZB8 A;  1NSW A;  5IO2 A;  2GGT A;  1XOA A;  5H5R A;  4OFN A;  1TK8 B;  4ZL9 A;  2R6K A;  4WBJ A;  4GSS A;  2NTO A;  4HQS A;  1SL1 B;  3VI7 A;  3IC4 A;  3LFL A;  3WD6 A;  6GSV A;  1GNE A;  4HJ2 A;  1G7E A;  4PQ1 A;  4EDZ A;  22GS A;  1XWB A;  3ZL5 A;  2LST A;  2YAN A;  4TXV A;  4MF7 A;  4ZIJ A;  2DMM A;  4MZW A;  1SJZ A;  2EIR A;  1HNC A;  3TJB A;  6GSS A;  4JZQ A;  3WT2 A;  3US3 A;  3L78 A;  4KH7 A;  2KLX A;  4FYB A;  1X5D A;  4TRX A;  1XWA A;  1FHE A;  4ACS A;  3ZRE A;  1OC9 B;  2E2M A;  2HXK A;  1O7U A;  2H71 A;  1FB0 A;  4KX4 A;  2C1Y A;  4E8H A;  2WUL A;  1M2A A;  2N5A A;  5KN0 A;  3KTL A;  5DAL B;  4N30 A;  4PNF A;  3D6I A;  5D9W A;  5A4U A;  3UVT A;  4ECC A;  3LOR A;  4POB A;  3ZML A;  5D93 A;  1PQN A;  3PIN A;  1F9M A;  1V98 A;  3QCP A;  2JU5 A;  4GSN A;  1THO A;  2H6X A;  2E7P A;  2H76 A;  1EWX A;  2O8V B;  4HZ4 A;  2OBI A;  3UBK A;  1SKS B;  2MMN A;  3ZVJ D;  4IJI A;  4JBB A;  5HR2 A;  1YDK A;  2OE3 A;  2HSY A;  2IL3 A;  5G30 A;  1TRU A;  3FZ9 A;  3P7X A;  2V6K A;  2JAD A;  1Q98 A;  2OE0 A;  4BL7 A;  1XBS A;  4ZB6 A;  3RDW A;  4HU7 A;  4KE3 A;  2L5O A;  5H5S A;  2H66 A;  3EE2 A;  1K0A A;  1XW6 A;  2LRC A;  6GSX A;  2H75 A;  5IOX A;  4CHS A;  2B1L A;  3FY7 A;  1B4Q A;  3GST A;  4IJ3 A;  3CSH A;  2K6V A;  1XPV A;  4YQV A;  1XVQ A;  5CAX A;  3N5O A;  5A4W A;  1K0M A;  3TRP A;  1G6Y A;  1BJX A;  3TOU A;  1VF3 A;  2MBS A;  1PRX A;  4O32 A;  2DLX A;  1FO5 A;  4HOJ A;  2VL3 A;  3NZN A;  2MMA A;  3KP8 A;  2YWI A;  5DBQ A;  2F8F A;  3ERG A;  4NHW A;  2LEG A;  4IS0 A;  4LMW A;  3Q18 A;  3VWU A;  1A2L A;  2GQK A;  3F4S A;  1OVN A;  1ERV A;  5IM9 A;  5JCU A;  5ABR A;  2RUF A;  4EO3 A;  4D73 B;  1SK2 A;  2WRT A;  2CX3 A;  1V40 A;  3D5J A;  3UVH A;  4RUV A;  2X8C A;  2IY2 A;  4HZ2 A;  3N9J A;  4IQA A;  3J7Y b;  3GNJ A;  4ZBB A;  5G5F A;  1F3A A;  1U3I A;  1R7H A;  3GKK A;  4G2E A;  4L0U A;  3TKP A;  3GSS A;  2VLV A;  1X9M B;  4MA9 A;  1K0C A;  1SL2 B;  1OC3 A;  4GRF A;  1K0D A;  2YV7 A;  16GS A;  3IK7 A;  1SJ6 A;  3KH9 A;  4YAP A;  2GZP A;  3CBU A;  2IWT A;  3KP9 A;  4PUF C;  3KZQ A;  4FIW A;  1YEP A;  2H72 A;  1YF0 A;  4WF5 A;  2OAC A;  2M80 A;  5AN1 A;  4I2U A;  3KM6 A;  1EOG A;  2H73 A;  4WEY A;  3Q19 A;  3UAR A;  13GS A;  4QL7 A;  3QAG A;  2GSS A;  2J23 A;  2G2Q A;  4XIH A;  3H79 A;  1U6T A;  1XVW A;  4IVF A;  1ZL9 A;  4K8M A;  2PU9 C;  4JU5 A;  1B9Y C;  5IPG A;  2MYG A;  2OJL A;  4I8B A;  1V58 A;  5DAL A;  19GS A;  1FOV A;  2O85 A;  2R4V A;  4HQZ A;  3UIW A;  1KEB A;  3C1S A;  1Z6M A;  4TXO B;  3F9U A;  3HZ4 A;  3TJF A;  2JSY A;  3ME8 A;  4IP1 A;  1QUW A;  4I97 A;  3GX0 A;  2QSI A;  2H01 A;  1Z7R A;  5J3R A;  3BCK A;  3SBC A;  2GZZ A;  2H8L A;  3FZ5 A;  2WGR A;  2HZE B;  2NBS A;  3LXZ A;  4EKZ A;  5AGY A;  1USB A;  5KN2 A;  3DVX A;  5HFG A;  5JWR B;  1PL1 A;  4TR1 B;  2K8V A;  3LEF A;  1XWG A;  4MLY A;  1ZYQ B;  5F07 A;  3A5W A;  3DEX A;  3L9S A;  2BJX A;  2WZ9 A;  4OO5 A;  5B6M A;  3D4M A;  4DEJ A;  4PX1 A;  5A4V A;  3V1W A;  1TI3 A;  1GP1 A;  2GS3 A;  3HDC A;  2QGV A;  1U88 A;  3L9U A;  4MF5 A;  2LRT A;  3HA9 A;  4NAX A;  5EL8 A;  2YOI A;  4MJE A;  3BCI A;  1AW9 A;  4IKH A;  3LYP A;  2PUK C;  2GQM A;  1M9B A;  2GT6 A;  3VUR A;  3BBY A;  3IPZ A;  3Q74 A;  4J56 E;  3TKQ A;  4XTS A;  1BAY A;  3QAV A;  2B6M A;  3GKX A;  2VCZ A;  3ERW A;  4X1U A;  4Q5F A;  1JZR A;  3F3Q A;  2MMZ A;  4MH3 A;  8GSS A;  2DBC A;  2H0H A;  1PL2 A;  5HR1 A;  4JR6 A;  5CRD A;  5F8B A;  3GYK A;  3HVS A;  3IOS A;  4EC0 A;  2C8U A;  5IPH A;  4ECI A;  2VD1 A;  3O76 A;  5B7C A;  1GLQ A;  4X43 A;  2I1U A;  1C72 A;  2LKU A;  3LYK A;  2KP1 A;  2B3S A;  2YZH A;  3TDG A;  4V2N A;  4HEA 2;  3CXG A;  3J7Y k;  1T8E B;  2JL4 A;  2C3T A;  2JAC A;  5CRW A;  2C0D A;  2OA7 A;  3DXB A;  4V1A g;  2ON7 A;  2FWG A;  1WPI A;  4V2M A;  2CAQ A;  2FD3 A;  3DGQ A;  1TP9 A;  2IIY A;  4TN8 A;  2ZUP A;  3F0I A;  2V6O A;  4BA7 A;  1O8W A;  1SU9 A;  2HLS A;  2C3N A;  1XWC A;  5ECH B;  2DJ1 A;  2LJA A;  5ECM B;  4GWR A;  2YJ7 A;  4RQX A;  2MBT A;  4BPY A;  3DRN A;  2GSQ A;  2HRN A;  3H93 A;  3KH7 A;  1A23 A;  4MZB A;  2H6Z A;  2NPB A;  3GN3 A;  1DUG A;  3M9J A;  1DE1 A;  4BVY A;  2DJ3 A;  1RQM A;  3GKN A;  5ECN B;  3FW2 A;  2PER A;  1SKR B;  3I6A A;  20GS A;  1WWJ A;  2PVO C;  1I5G A;  5HFI A;  4AJ7 A;  3HXS A;  1WRY A;  4POL A;  12GS A;  4KUN A;  2XPE A;  3VFI A;  3RHB A;  2YWM A;  1MDI A;  3ZIV A;  5HR3 A;  1EEM A;  1B48 A;  1A8Y A;  2B5E A;  2PMT A;  1NHO A;  4WBR D;  2G0F A;  2H70 A;  1N8J A;  1NM3 A;  5FWG A;  5G5E A;  3CTG A;  1PMT A;  1WP0 A;  5ID2 B;  2AV4 A;  3WGD A;  2B1K A;  2YZU A;  2IJY A;  2RLI A;  3EIN A;  4JRR A;  3KTB A;  5ELG A;  5ELA A;  3E3E A;  5DCG A;  1LJR A;  3CMI A;  4IBP A;  2VCX A;  3A2X A;  1YKA A;  3HJO A;  2YNX A;  2N5F A;  2V32 A;  4EUY A;  4HI7 A;  1GLP A;  4ML6 A;  1KBN A;  2WS2 A;  2XBQ A;  4GQC A;  4MP4 A;  4ZBD A;  5IOW A;  2X8H A;  4NMU A;  4L8E A;  4NHZ A;  1GSS A;  1THX A;  2KP2 A;  1O81 A;  3G9B A;  3BD2 A;  4RI6 A;  1HNB A;  4XS4 A;  1UC7 A;  2GSR A;  1YZX A;  3VWV A;  1I9D A;  3M1G A;  3GMF A;  2J9H A;  14GS A;  1QMV A;  1ZOF A;  3A2V A;  1VF4 A;  1OE8 A;  4XS4 B;  1OKD A;  2HE3 A;  3I9V 2;  2LRN A;  1MD3 A;  2CX4 A;  5G2Z A;  3P2A A;  4KDU A;  5ENU A;  3GH9 A;  3BOA A;  5ECR B;  2H6Y A;  2IFQ A;  3DIE A;  2DSA A;  4WXT A;  3EC3 A;  2H1G A;  2PBJ A;  3GL3 A;  5ECI B;  2L6D A;  3MSZ A;  4BVX A;  2FWE A;  2M72 A;  3IV4 A;  1HQO A;  3C71 A;  1PGT A;  1ABA A;  3Q6O A;  4ZBA A;  1MEK A;  4FYU A;  3FK8 A;  1QFN A;  2X8G A;  2GTU A;  2IMD A;  2TRC P;  4V1A p;  3VPT A;  2P0G A;  1FG4 A;  3RPN A;  2DJ2 A;  5D9V A;  1AXD A;  1LU4 A;  1Z7P A;  1DSB A;  4I2T A;  3WT1 A;  1R5A A;  5DQS A;  4XRD A;  11GS A;  2VIM A;  5L71 A;  1GUK A;  1GSE A;  2C3Q A;  4EVM A;  1F3B A;  2TRX A;  2H1D A;  3TKS E;  1XW5 A;  2H30 A;  1TTZ A;  2YWN A;  1ZCP A;  2IPA A;  4HU9 A;  4K2D A;  2X64 A;  5IMZ A;  2JZR A;  3C7M A;  4N11 A;  5C00 A;  1PX6 A;  2WCI A;  2YJH A;  2DC5 A;  1U3A A;  3WGE A;  1QGV A;  2F3M A;  1SK1 A;  2K8S A;  3KXO A;  4K1F A;  2WFC A;  1EOH A;  5J4U A;  4QL9 A;  3IDV A;  1BYE A;  4KB3 A;  5AIX A;  1X5C A;  1S3D A;  3O6T A;  4CW9 A;  3F6D A;  3HYP A;  4OFM A;  4OWY A;  3K8N A;  4ECB A;  1WJK A;  2VCQ A;  1SYX A;  4G9H A;  4XRA A;  2KHP A;  10GS A;  3IAM 2;  5IO0 A;  4DSR A;  1OC9 A;  4MMM A;  3L0H A;  2KOK A;  3LWA A;  3G7J A;  4OMV A;  2P31 A;  2VM2 A;  5IQY A;  3ZRD A;  2DJK A;  5IMV A;  3TKS C;  1GSU A;  4O92 A;  3VWX A;  1K3Y A;  1OKT A;  5B6N A;  5EVO A;  2IME A;  4IQ1 A;  3VK9 A;  2BTO T;  4KCE A;  1OAZ A;  3PGT A;  3QPM A;  1EP7 A;  3APO A;  1OYJ A;  2C80 A;  4PQH A;  4HS1 A;  4TR0 A;  2CQ9 A;  2H1B A;  4KND A;  5CNW A;  1O8X A;  1XWK A;  1Y25 A;  1RW1 A;  1K0B A;  4FH8 A;  1GUM A;  3TJG A;  1YF1 A;  4WR4 A;  1IYI A;  4YQU A;  5F06 A;  1NHY A;  2AYT A;  1TOF A;  3FR6 A;  1SK0 A;  1F6M C;  3EMP A;  5ECK B;  5DVB A;  2IFQ B;  1M0U A;  3OR5 A;  2CZ2 A;  6GSY A;  1PX7 A;  2L6C A;  4XHM A;  3FZ4 A;  4N10 A;  4PUR A;  2HZF A;  1Z3E A;  1PA3 A;  5HQP A;  2L5L A;  4MJC A;  1BED A;  1ERU A;  1W4V A;  2H19 A;  4BWQ A;  4ECJ A;  1A2M A;  1X9W B;  3QFA C;  1G6W A;  4AJ6 A;  1AIU A;  1VGL A;  4FYC A;  3ERF A;  1GSQ A;  6GSU A;  1FW1 A;  1TRS A;  3P90 A;  2JZT A;  1EZK A;  4NV5 A;  1TW9 A;  2C0G A;  2LS5 A;  4TKY A;  3ZYW A;  2LQQ A;  3ZFL A;  5HFK A;  1JZW A;  3IRA A;  1PN9 A;  4DSQ A;  4LLR A;  4TW5 A;  3KMN A;  1BQ7 A;  2R37 A;  2YV9 A;  3F8U A;  1GTI A;  5CP1 A;  2AJQ B;  5IMD A;  5HR0 A;  5ID2 A;  1SL0 B;  4ZL7 A;  1GUH A;  4EF0 A;  4XS6 A;  3M3M A;  1YY7 A;  1EV9 A;  4GXZ A;  5IMA A;  4F0B A;  4AF2 A;  4H86 A;  4WF4 A;  3L9V A;  1FVK A;  1FAA A;  1A24 A;  3RBT A;  2DML A;  1HYU A;  3KIJ A;  2VOC A;  5LNK e;  2HYX A;  2F8A A;  2O7K A;  2LUS A;  2YWO A;  4WKW A;  3HD5 A;  5FHI A;  2LJR A;  3C8E A;  2YP6 A;  9GSS A;  3HKR A;  4IHU A;  4MDC A;  5IMF A;  4DSS B;  1A8L A;  5DJL A;  3GIX A;  3VWW A;  4CDO A;  1M9A A;  2C0E A;  3RAZ A;  1GTU A;  1TDI A;  4TXO A;  2C4J A;  3EVI A;  4KSO A;  2F51 A;  5D96 A;  3FRC A;  2L57 A;  1AUC A;  4PXO A;  3PH9 A;  1TRW A;  4OD7 A;  2PN8 A;  3S9F A;  4Q5N A;  1T3B A;  1M2D A;  2VLU A;  5JWO B;  5J41 A;  3W6G A;  1JZD A;  2PPT A;  4OCF A;  1RK4 A;  3GFK A;  1X9S B;  3UL3 A;  1F37 A;  4XCS A;  1SEN A;  2OE1 A;  1O73 A;  2AUV A;  1TRV A;  1SD8 A;  3TRX A;  3HHV A;  1SD9 A;  5FT3 A;  2L59 A;  1QXH A;  3CRT A;  4LMV A;  4K9Z A;  2A2R A;  1WIK A;  1O85 A;  4J2F A;  4F03 A;  1TXX A;  1B9X C;  4G10 A;  5COH A;  5G31 A;  2AHE A;  3KD0 A;  3TJJ A;  2OBK A;  2RM6 A;  3F4T A;  4NPB A;  3QMX A;  5IIZ A;  1BG5 A;  2IMF A;  2CVB A;  3GUR A;  3QD9 A;  3H4K A;  2A2S A;  1T7P B;  4GST A;  4IW9 A;  4BWS A;  2TIR A;  4KDY A;  3LQ7 A;  4TR1 A;  2XPD A;  3RHC A;  4HJM A;  2B5X A;  4RQR A;  2B7J A;  1MTC A;  1XZO A;  5G1K A;  2IMI A;  1ON4 A;  1YEX A;  2VL2 C;  4K7I A;  4NXI A;  3ZZX A;  2OAD A;  1XXU A;  2K9F A;  3GH6 A;  1J08 A;  4YAV A;  1VF1 A;  5CRG A;  3ZMK A;  1JZO A;  2L4C A;  4N0Z A;  2HI7 A;  4OCE A;  5GZZ B;  4PQI A;  2I81 A;  4QQ7 A;  2P5Q A;  3ISO A;  1CQH A;  4X0X A;  3VI5 A;  5ECQ B;  4EXJ A;  4ID0 A;  3KGK A;  2OKA A;  1MD4 A;  1E6B A;  3I69 A;  4DSS A;  2GT5 A;  1AQW A;  2F9S A;  1PKZ A;  3U5R E;  5GST A;  5CRE A;  4O5R A;  2EIQ A;  4IN0 A;  1JLV A;  3MNG A;  2M46 A;  4F2I A;  4LL4 B;  3D4T A;  2GQL A;  1HD2 A;  4KW6 A;  2RM5 A;  1H75 A;  1YKC A;  2LV3 A;  3TKR A;  2V41 A;  2FNO A;  4TR3 A;  5D8I A;  3CRU A;  4I6X A;  4GLT A;  2FGX A;  2QC7 A;  2R2J A;  1EGR A;  3F4R A;  3E0U A;  3TUE A;  1DBY A;  4JE1 A;  1XFL A;  2CV4 A;  3D21 A;  2LTK A;  5DCH A;  3DML A;  5D73 A;  1R26 A;  2GDR A;  4LA1 A;  2EIO A;  1EEJ A;  3IK9 A;  2REM A;  2EC4 A;  4PNG A;  1FB6 A;  5C04 A;  3QDN A;  3QOU A;  1XW9 A;  3TOT A;  2GZY A;  3NIV A;  3W8S A;  2IN3 A;  1ZMA A;  1MDK A;  3ZIJ A;  5DAK A;  3D22 A;  1U87 A;  3QAW A;  1AQV A;  3GA4 A;  2O87 A;  1SKW B;  2MMO A;  3KCM A;  1R4W A;  3G7I A;  1W89 A;  5G1L A;  1DE2 A;  3DWV A;  3GX8 A;  1GTB A;  2RUE A;  3MAK A;  5D9T A;  5B8A A;  2RII A;  3FZA A;  4POK A;  1TKD B;  2XHF A;  1FVJ A;  3IXR A;  3ZVJ A;  2ZNM A;  2CVK A;  1UN2 A;  2VAF A;  1ILO A;  1UA5 A;  2FLS A;  1GSY A;  2HZE A;  1PSQ A;  1BX9 A;  4MJB A;  5JCG A;  4ULX A;  17GS A;  1A0F A;  1QQ2 A;  3A2W A;  3IHQ A;  2JSZ A;  1WMJ A;  1X5E A;  5J9C A;  7GSS A;  1JLW A;  4MK3 A;  3APQ A;  3HVV A;  2X99 A;  1OC8 A;  2MZC A;  2FWH A;  3EUR A;  1ZZY A;  2K18 A;  1SJI A;  2JZS A;  4IP6 A;  3DVW A;  2FA8 A;  5ECO B;  3E9J B;  4Z7X A;  3UOM A;  3CSJ A;  1F2E A;  5KEJ A;  1TU7 A;  5DAK B;  4L5O A;  2HT9 A;  4AGS A;  4TVE A;  2B5Y A;  1GSF A;  5J5N A;  3RPP A;  4K7O A;  3ME7 A;  5INY A;  3H8Q A;  3GKM A;  1K0N A;  4TR4 A;  1K3L A;  3GRX A;  2FHE A;  3TKS A;  4G19 A;  5B8B A;  3APS A;  2WDU A;  1PD2 1;  1GRX A;  4ZB9 A;  4EL1 A;  3U6V A;  1GL8 A;  3CTF A;  2B7K A;  1N2A A;  3JCM L;  2L4Q A;  4Q5Q A;  2QKE A;  5IMC A;  3AY8 A;  4XS1 A;  1TJD A;  3ZIT A;  1CQG A;  1V9W A;  3UBL A;  1B8X A;  3M9K A;  5AIS A;  4KAE A;  5CYY A;  1IYH A;  2D2Z A;  2GST A;  1T00 A;  4ISD A;  3DKS A;  1VRS D;  3GTU A;  3HJP A;  3KMO A;  4J57 E;  3VLN A;  4YH2 A;  1KNG A;  1AQX A;  1UVZ A;  4KDX A;  3IAS 2;  2V2G A;  4ZXG A;  3HJM A;  3LXT A;  4O7H A;  4E8E A;  2H0G A;  1HNA A;  1NW2 A;  5GAP D;  4D73 A;  4WR5 A;  3SWL A;  4L5L A;  4LL1 B;  3ZLP A;  2FY6 A;  5LD0 A;  5ECS A;  2ZCT A;  4JED A;  1J0F A;  2YCD A;  18GS A;  4KGI A;  3FKF A;  4KSM A;  1O6J A;  1TI1 A;  3D0Z A;  3QFB C;  2GLR A;  4L0W A;  2VCV A;  2FWF A;  5E4W A;  1ST9 A;  1PKW A;  4MPG A;  5F0G A;  3F6F A;  4HUA A;  2FUG 2;  5GSS A;  3EMX A;  2H0I A;  2C0F A;  4K0G A;  2R3X A;  4MPF A;  3TRQ A;  1ACV A;  1YJ6 A;  1TU8 A;  1WOU A;  3G7Y A;  6GSW A;  3H1N A;  6GST A;  3GTU B;  1JHB A;  2GVP A;  3QR6 A;  2LNT A;  2ALB A;  5E59 A;  4ZIL A;  3TB2 A;  5H5Q A;  4GQF A;  5CO3 A;  3ZTL A;  5D9X A;  1TK0 B;  2FA4 A;  3TJK A;  1ZYE A;  3EU4 A;  3I43 A;  3UAP A;  2HRF A;  5EPF A;  2XBI A;  2CT6 A;  5ECP B;  3M8N A;  2I3Y A;  3FHK A;  3TGZ A;  3IR4 A;  3F3R A;  3IE3 A;  4I5Q A;  2I4A A;  2VLT A;  1V57 A;  3O3T A;  3C73 A;  4PUA A;  4YQM A;  4NV2 A;  3EWL A;  4P3Y B;  1A0R P;  3EYT A;  4MJA A;  4ZL8 A;  1GSD A;  2NVL A;  5AIV A;  3DYR A;  4Q5R A;  2KUC A;  3FR9 A;  1JFU A;  2CZ3 A;  2LJK A;  3NOF A;  4HDE A;  3C1R A;  4K7N A;  3ED3 A;  5GAN D;  3KJY A;  4MZC A;  2DJJ A;  2P5R A;  2VL9 A;  2A4V A;  2VUP A;  3HZ8 A;  1G7O A;  1T4Y A;  1GUL A;  1S3A A;  2ON5 A;  3WYW A;  1EP8 A;  4DVC A;  3R2Q A;  2IYJ A;  3VPQ A;  1G0T A;  3GHA A;  3P8W A;  2LNS A;  4F0C A;  5JWQ B;  1MDJ A;  4F82 A;  2H1A A;  2R5G A;  1B4P A;  1M7T A;  1ML6 A;  2VCW A;  2DIZ A;  4MCU A;  4IEL A;  1T4Z A;  1URM A;  1H4O A;  1S3C A;  2VM1 A;  2CAI A;  1J9B A;  1KTE A;  4MF6 A;  2AB6 A;  1XCC A;  3UMA A;  1T1V A;  3M0F A;  5DQY A;  1WE0 A;  5EY6 A;  3LSZ A;  3BJ5 A;  2V1M A;  4EDY A;  1ZGN A;  2PVQ A;  4K0N A;  3GUS A;  1V2A A;  3L4N A;  4OFT A;  2YN1 A;  1XOB A;  3KEB A;  2YPM A;  3FR3 A;  1SYR A;  3LJR A;  1Y6E A;  3HY2 A;  4AJ8 A;  3WGX A;  1LBK A;  3TCO A;  1GH2 A;  2ES7 A;  2NDO A;  3GL5 A;  1TK5 B;  1ERW A;  2VO4 A;  1AAZ A;  2PGT A;  3HVX A;  2VL2 A;  4EE0 A; 
#chains in the Genus database with same CATH topology
 2AAW A;  5CRH A;  3LGC A;  2VCT A;  5ECL B;  4L8O A;  3MWZ A;  4POM A;  4OO4 A;  4PGT A;  1O7P B;  4BTY A;  3D4A A;  2H74 A;  4K6X A;  4KA0 A;  1OUN A;  4MH2 A;  3UEM A;  2I9H A;  2HSH A;  5KN1 A;  1Z5Y E;  1K0O A;  3MWH A;  4HVN A;  2WJU A;  1QK8 A;  4KFF A;  1E2Y A;  4GTU A;  5F05 A;  1Q4J A;  1R5P A;  4F9Z A;  1JV2 B;  2VD0 A;  2F98 A;  2Z9S A;  1DVC A;  3UNL A;  1PU4 A;  3F7X A;  3PR8 A;  1M2B A;  2CA8 A;  3EU3 A;  2BMQ B;  2D42 A;  1FGT A;  2CWT A;  3EBY A;  3FG4 A;  3A3T A;  2PZV A;  1TP6 A;  3ZFB A;  2BU4 A;  4ML1 A;  2LQO A;  2N5B A;  1OE7 A;  1EV4 A;  4RI7 A;  1O7W B;  3LG6 A;  3W8J A;  3DM8 A;  2XC2 A;  1FUS A;  3F63 A;  2DJ0 A;  4IGJ A;  1D6Z A;  4TOP A;  1VF2 A;  1IT7 A;  1A67 A;  1C7H A;  1XIY A;  4JR4 A;  2HNL A;  4Z2R A;  1X1X A;  1BNS A;  4BTW A;  3CCV 3;  4ILF A;  3DD3 A;  2PWJ A;  3CYN A;  4G0K A;  3IA1 A;  1Z6N A;  2A4H A;  1K3O A;  1GTA A;  3SED A;  1I3F A;  2HFD A;  1JBT A;  2E0Q A;  4MAB A;  5DDL A;  2DIY A;  1GWC A;  4GF0 A;  2E2G A;  2QEX 3;  4FO5 A;  4WET A;  5J9B A;  4EV5 A;  4N0V A;  1GNW A;  3HCZ A;  1Q86 4;  5KN3 A;  3UJ1 A;  2CVD A;  3GV1 A;  7GSP A;  2IMK A;  4KCA A;  1Z9H A;  3IBH A;  5DJM A;  3FYG A;  4R4K A;  1X0R A;  1NJI 4;  2ML6 A;  3MDK A;  1FGM A;  3FF0 A;  2LYX A;  1UDI I;  2FCH A;  5LCZ A;  2Z7A A;  3HII A;  3FEU A;  1A2J A;  1QAK A;  2W04 A;  2O89 A;  2WB9 A;  4MEI A;  3CMA 3;  5AEW B;  5JCW A;  1NNV A;  2BMX A;  4GCI A;  1M99 A;  4V2L A;  3CSI A;  1YNV X;  5A5K A;  1ERT A;  4NWY A;  1EGO A;  1IVU A;  1AC1 A;  1YQ1 A;  4ZB8 A;  1NSW A;  5IO2 A;  1RGK A;  2GGT A;  1XOA A;  1Z1S A;  5H5R A;  4WYK B;  4OFN A;  1TK8 B;  4ZL9 A;  2R6K A;  4G0I A;  4WBJ A;  4GSS A;  3VGN A;  2NTO A;  1FUW A;  4HQS A;  1SL1 B;  3BU4 A;  3VI7 A;  3IC4 A;  3LFL A;  3WD6 A;  6GSV A;  4EC6 A;  1GNE A;  4HJ2 A;  1G7E A;  1LQM B;  4PQ1 A;  4EDZ A;  2OTL 3;  22GS A;  4OUQ A;  1JB2 A;  1LOY A;  1XWB A;  3ZL5 A;  2LST A;  2F99 A;  3I0Y A;  2K0M A;  2P38 A;  2YAN A;  1TIJ A;  4TXV A;  4MF7 A;  4ZIJ A;  3CNX A;  1QMA A;  2CWU A;  3F14 A;  2DMM A;  4MZW A;  1SJZ A;  2EIR A;  1HNC A;  3TJB A;  1BSB A;  6GSS A;  4MMX B;  4JZQ A;  3WT2 A;  3CC4 3;  1W01 A;  3US3 A;  3L78 A;  4KH7 A;  1VQL 3;  2KLX A;  5BMU A;  4FYB A;  2JQ5 A;  3I56 3;  1X5D A;  4TRX A;  1XWA A;  1GSP A;  1FHE A;  4ACS A;  3ZRE A;  1OC9 B;  1RLS A;  2E2M A;  2HXK A;  1O7U A;  2H71 A;  3X3Y A;  1FB0 A;  4KX4 A;  2C1Y A;  3A5E A;  2WGO A;  4E8H A;  2WUL A;  4N6U A;  1M2A A;  2N5A A;  5KN0 A;  5HGR A;  3KTL A;  5DAL B;  4N30 A;  4PNF A;  3D6I A;  5D9W A;  5A4U A;  3UVT A;  1BRK A;  4ECC A;  3LOR A;  4POB A;  3ZML A;  4J8T A;  5D93 A;  1RGA A;  1PQN A;  1VQ4 3;  3PIN A;  1RSN A;  1F9M A;  1V98 A;  4G1M B;  3QCP A;  2JU5 A;  4GSN A;  1THO A;  3FGY A;  1BOX A;  1GD4 A;  2H6X A;  2C11 A;  3CCU 3;  2E7P A;  2H76 A;  3JVC A;  4Q53 A;  1EWX A;  2O8V B;  4HZ4 A;  2OBI A;  3IPT A;  3OXA A;  5I97 A;  1I2E A;  3UBK A;  1IVW A;  3AMO B;  3NM7 A;  1SKS B;  2MMN A;  3ZVJ D;  1LRA A;  4IJI A;  4JBB A;  5HR2 A;  1YDK A;  2P05 A;  2OE3 A;  2HSY A;  6RNT A;  2IL3 A;  1Y4K A;  2D1W A;  5G30 A;  3B7C A;  4ZM8 A;  4RNZ A;  1R4Y A;  1TRU A;  3FZ9 A;  3P7X A;  2V6K A;  2JAD A;  1Q98 A;  2OE0 A;  4BL7 A;  1OGX A;  3EE1 A;  2WO0 A;  2UGI A;  2Y74 A;  3WOD G;  1X1U A;  1XBS A;  4ZB6 A;  5BU4 A;  3RDW A;  1MNL A;  5IW9 A;  4HU7 A;  4KE3 A;  4BTX A;  2L5O A;  5H5S A;  2H66 A;  2UZ8 A;  3EE2 A;  1K0A A;  3L0R A;  1XW6 A;  2LRC A;  6GSX A;  2H75 A;  3LTC A;  2CX0 A;  5IOX A;  4CHS A;  2B1L A;  3FY7 A;  1B4Q A;  5M19 A;  3GST A;  4IJ3 A;  1MOL A;  3ECF A;  2OQE C;  3MG2 A;  3NX0 A;  3CSH A;  2K6V A;  3BNC A;  1XPV A;  5FGO A;  4EW5 A;  4YQV A;  1XVQ A;  5CAX A;  3N5O A;  1W2Z A;  1LXE A;  5A4W A;  4EIQ A;  3G8Z A;  5IG3 A;  3D5G A;  1K0M A;  3TRP A;  1G6Y A;  1BJX A;  1GOU A;  3TOU A;  1VF3 A;  2MBS A;  2JDI H;  1PRX A;  4O32 A;  3A5I A;  3X41 A;  2DLX A;  1FO5 A;  4HOJ A;  1D6Y A;  1RTU A;  2VL3 A;  3NZN A;  2MMA A;  3KP8 A;  2OWP A;  2YWI A;  5DBQ A;  2F8F A;  3ERG A;  4NHW A;  2LEG A;  4IS0 A;  2W9Q A;  1VQO 3;  1U5O A;  2HMK B;  4QWT A;  3Q18 A;  4LMW A;  2BNG A;  1YHQ 3;  4AKY A;  3VWU A;  1A2L A;  2GQK A;  3F4S A;  2YX9 A;  2Y73 A;  1OVN A;  1ERV A;  1T5Y A;  5IM9 A;  5JCU A;  5ABR A;  2RUF A;  4EO3 A;  5CF2 A;  4D73 B;  3F40 A;  2BHM A;  4J5G A;  1DE3 A;  1SK2 A;  2WRT A;  2CX3 A;  1VQQ A;  1V40 A;  3D5J A;  3UVH A;  4RUV A;  2X8C A;  2IY2 A;  3MIX A;  4HZ2 A;  3N9J A;  4IQA A;  3J7Y b;  3GNJ A;  4LYL B;  4ZBB A;  5G5F A;  3FSD A;  5KP1 A;  1F3A A;  1CH0 A;  2Z6B A;  2W2C A;  2K54 A;  1R7H A;  1U3I A;  3GKK A;  4IPB A;  4G2E A;  4L0U A;  3TKP A;  3GSS A;  3HVN A;  3LOY A;  2VLV A;  1X9M B;  2O3O A;  1L5G B;  4MA9 A;  1K0C A;  1SL2 B;  1T2I A;  1OC3 A;  4GRF A;  3GZR A;  1K0D A;  2YV7 A;  16GS A;  3IK7 A;  2GXF A;  1SJ6 A;  3KH9 A;  4YAP A;  2GZP A;  3EN8 A;  1MGR A;  1KD1 4;  3CBU A;  2OOV A;  1NB3 I;  2IWT A;  3KP9 A;  1CYV A;  4PUF C;  3KZQ A;  4FIW A;  1YEP A;  2H72 A;  1YF0 A;  4WF5 A;  2OAC A;  2M80 A;  5AN1 A;  1RCK A;  4I2U A;  1RGF A;  1QAL A;  1K9M 4;  3KM6 A;  1BRJ A;  1EOG A;  2H73 A;  4HKV B;  3AGO A;  4WEY A;  1AY7 A;  3Q19 A;  7RNT A;  3UAR A;  13GS A;  4QL7 A;  3S27 A;  3QAG A;  2GSS A;  1BSD A;  2J23 A;  1Q7H A;  5JPU A;  4CJN A;  2G2Q A;  4XIH A;  1W00 A;  3H79 A;  3LH4 A;  1U6T A;  4EIP A;  1XVW A;  4IVF A;  3KCH A;  1ZL9 A;  4K8M A;  2PU9 C;  4JU5 A;  1B9Y C;  4Z2U A;  3IJE B;  4FCJ A;  1W4N A;  2KF6 A;  1ROV A;  1LOV A;  5IPG A;  2MYG A;  2OJL A;  4I8B A;  2RNT A;  1V58 A;  5DAL A;  3G4S 3;  3OW2 2;  19GS A;  1FOV A;  2O85 A;  2R4V A;  4HQZ A;  2CKF B;  1HU9 A;  3UIW A;  1KEB A;  1TU5 A;  3C1S A;  1Z6M A;  4TXO B;  3F9U A;  3HZ4 A;  1K73 4;  3TJF A;  2JSY A;  3ME8 A;  4FQU A;  1IQ8 A;  3AGN A;  2XFT A;  1JBS A;  4IP1 A;  1B20 A;  1W6Y A;  1QUW A;  4I97 A;  3GX0 A;  2QSI A;  2H01 A;  1Z7R A;  3MHE A;  5J3R A;  3WMD A;  3BCK A;  3SBC A;  3NV0 B;  2GZZ A;  3X40 A;  2H8L A;  3KSE D;  1BGS A;  3FZ5 A;  2STD A;  2F56 A;  2R4I A;  2WGR A;  1EA2 A;  2HZE B;  2NBS A;  3LXZ A;  4WHA A;  3FKA A;  1US1 A;  4EKZ A;  5AGY A;  5IEO A;  1USB A;  5KN2 A;  3DVX A;  1SIH A;  5HFG A;  5JWR B;  1PL1 A;  2KRT A;  4TR1 B;  2K8V A;  3MYT A;  3HIG A;  3CME 3;  3LEF A;  1XWG A;  4MLY A;  3D3L A;  1JJ2 2;  1ZYQ B;  5F07 A;  2WOH A;  3A5W A;  3DEX A;  3L9S A;  2BJX A;  2WZ9 A;  4OO5 A;  1KWI A;  3WOE B;  5B6M A;  3D4M A;  4DEJ A;  4PX1 A;  3HK4 A;  3U1W A;  5A4V A;  3V1W A;  1TI3 A;  1GP1 A;  2GS3 A;  3HDC A;  3FZW A;  2QGV A;  1U88 A;  3L9U A;  1I0X A;  4MF5 A;  5IER A;  2LRT A;  3HA9 A;  4NAX A;  5EL8 A;  2YOI A;  1OCV A;  4MJE A;  3BCI A;  3Q2P A;  1JKG A;  1AW9 A;  4IKH A;  3LYP A;  2PUK C;  2GQM A;  3E99 A;  1SJW A;  2ZHX B;  1M9B A;  1NWW A;  1UCK A;  4H61 A;  2GT6 A;  3VUR A;  4PEJ A;  4KFE A;  3BBY A;  3IPZ A;  3Q74 A;  3R3E A;  4J56 E;  4XTS A;  3TKQ A;  1BAY A;  4K61 A;  2GBX B;  1UCI A;  4HZB B;  5DRE A;  3QAV A;  2CIU A;  2B6M A;  3GKX A;  2VCZ A;  4X2O A;  1ZYN A;  2XR8 B;  3ERW A;  4X1U A;  4Q5F A;  1JZR A;  1CQS A;  2YFL B;  5AIF A;  3F3Q A;  2HMJ B;  3SXX A;  4TX4 A;  4O5Q A;  1RDS A;  1LOW A;  2MMZ A;  1LVN A;  4MH3 A;  8GSS A;  3F9S A;  1A2P A;  2DBC A;  2H0H A;  4HM5 B;  4BU4 A;  1E97 A;  1PL2 A;  5HR1 A;  1UUV B;  4JR6 A;  5CRD A;  1UCJ A;  5F8B A;  3B4P A;  1BNR A;  3GYK A;  3HVS A;  3IOS A;  4EC0 A;  3CCQ 3;  2C8U A;  1BSE A;  5IPH A;  4ECI A;  1Q40 B;  2VD1 A;  3O76 A;  1BNG A;  5B7C A;  1GLQ A;  4X43 A;  2I1U A;  1C72 A;  2LKU A;  3LYK A;  2KP1 A;  2B3S A;  2YZH A;  3MG3 A;  3TDG A;  1GY5 A;  4XBY A;  4V2N A;  5IF6 A;  1TTO A;  2R0C A;  4HEA 2;  2XH9 A;  4IT7 A;  1EG9 B;  3CXG A;  3J7Y k;  1T8E B;  4HJL B;  2JL4 A;  2ZL8 A;  2C3T A;  1BRG A;  2JAC A;  4R80 A;  5CRW A;  2C0D A;  2OA7 A;  1C54 A;  3DXB A;  4BL7 B;  4V1A g;  2IA7 A;  2FWG A;  2ON7 A;  1EQK A;  4LZI A;  2W56 B;  4MNN A;  3NXJ A;  3CNM A;  1WPI A;  4V2M A;  2CW9 A;  2CAQ A;  1IV9 A;  2FD3 A;  1UGH I;  1IQX A;  2MC8 A;  2Z76 A;  2W0Q A;  3DGQ A;  2BMR B;  1GOY A;  1TP9 A;  1I2F A;  2HML B;  3JUN A;  2SBL A;  3MKI A;  2IIY A;  4TN8 A;  2ZUP A;  3F0I A;  2GEY A;  2V6O A;  4BA7 A;  4FMB A;  1O8W A;  1SU9 A;  2HLS A;  2W03 A;  2C3N A;  1XWC A;  4BL2 A;  5ECH B;  2DJ1 A;  2LJA A;  1RN7 A;  5ECM B;  4GWR A;  1B2Z A;  2YJ7 A;  4RQX A;  2MBT A;  4BPY A;  3DRN A;  2GSQ A;  2HRN A;  3H93 A;  3KH7 A;  1A23 A;  1BVI A;  3U97 A;  4J5K A;  3DGM A;  3NM2 A;  4MZB A;  3JUQ A;  2H6Z A;  4R9K A;  2NPB A;  3KE7 A;  3GN3 A;  1DUG A;  1SAR A;  3M9J A;  1DE1 A;  4GSP A;  3NHX A;  4BVY A;  2DJ3 A;  2CX1 A;  1RQM A;  3GKN A;  5ECN B;  1M1K 4;  3KFQ C;  3FW2 A;  2PER A;  1WTH A;  1SKR B;  3GZY B;  3I6A A;  3RDE A;  20GS A;  1LOX A;  1WWJ A;  2PVO C;  1I5G A;  3F8H A;  1OAC A;  5HFI A;  4AJ7 A;  4JRF A;  1WRY A;  3HXS A;  4POL A;  2PNC A;  12GS A;  4KUN A;  1SQW A;  1QAF A;  2XPE A;  1LNI A;  3VFI A;  3RHB A;  1W02 A;  2YWM A;  1MDI A;  3ZIV A;  4A5P A;  1JN5 B;  5HR3 A;  1EEM A;  1B48 A;  1O7G B;  2RGQ A;  1A8Y A;  2B5E A;  2PMT A;  1NHO A;  4WBR D;  3SVA A;  1I8V A;  2G0F A;  2H70 A;  3H51 A;  1NM3 A;  3OWS A;  1X1W A;  1N8J A;  3K9M C;  5FWG A;  5G5E A;  3CTG A;  1PMT A;  2OTJ 3;  3VSY A;  1LQG C;  1WP0 A;  5ID2 B;  3WR2 A;  2AV4 A;  3WGD A;  4BVX B;  2B1K A;  2YZU A;  4AEQ A;  2IJY A;  2RLI A;  3EIN A;  3WDG B;  1K28 A;  4JRR A;  3KTB A;  5ELG A;  5ELA A;  3LTA A;  1B2U A;  3CCS 3;  3E3E A;  4HYZ A;  1I0V A;  2BO9 B;  3Q3F A;  5DCG A;  1LJR A;  3CMI A;  3JUO A;  3NBR A;  8RNT A;  1YIJ 3;  1BUQ A;  1VZZ A;  1QVF 2;  1BRI A;  4IBP A;  5RNT A;  3MSO A;  2VCX A;  4HM6 B;  3A2X A;  1YKA A;  3HJO A;  2YNX A;  1IVX A;  4RNT A;  3DMC A;  2N5F A;  2V32 A;  3PYJ A;  4EUY A;  4HI7 A;  1GLP A;  1FUT A;  4ML6 A;  1KBN A;  2WS2 A;  2XBQ A;  5AYR B;  4EV2 A;  4GQC A;  4MP4 A;  2X4A A;  4ZBD A;  5IOW A;  2X8H A;  4NMU A;  4L8E A;  5D81 A;  4NHZ A;  1GSS A;  1THX A;  2KP2 A;  3Q1C A;  3V92 A;  1KSI A;  1O81 A;  4K1U A;  4RZM A;  3G9B A;  2ZA4 A;  3BD2 A;  4RI6 A;  1N9E A;  1DMQ A;  1HNB A;  4XS4 A;  4YKF A;  1UC7 A;  4K5R A;  2GSR A;  2AAE A;  1YZX A;  1IYY A;  3VWV A;  1JB5 A;  1I9D A;  3M1G A;  3GMF A;  2J9H A;  2DKH A;  14GS A;  1QMV A;  1ZOF A;  4LSO A;  3A2V A;  3JUM A;  1VF4 A;  1OE8 A;  4XS4 B;  1ZO2 A;  1OKD A;  2ML5 A;  2HE3 A;  3WA3 A;  3I9V 2;  2LRN A;  1MD3 A;  1Q42 A;  2CX4 A;  4G0L A;  5G2Z A;  3P2A A;  4KDU A;  3RNT A;  2XEP A;  4CY8 A;  5ENU A;  3GH9 A;  3BOA A;  5ECR B;  2H6Y A;  2IFQ A;  3DIE A;  2DSA A;  3CC2 3;  4WXT A;  1G02 A;  4N6N B;  6STD A;  3EC3 A;  3LZA A;  4N3V A;  2H1G A;  2PBJ A;  1W6G A;  3GL3 A;  2IUJ A;  3LML A;  5ECI B;  1VQ6 3;  1FOH A;  2L6D A;  3MSZ A;  3IHG A;  4BVX A;  2FWE A;  2M72 A;  3IV4 A;  1HQO A;  3C71 A;  1PGT A;  1ABA A;  3Q6O A;  4ZBA A;  1VQ7 3;  1TUH A;  1MEK A;  4FYU A;  3FK8 A;  3QK9 A;  1QFN A;  2X8G A;  2GTU A;  1DVD A;  2IMD A;  3DH2 A;  2TRC P;  3NBJ A;  3NQZ A;  4V1A p;  4WFO A;  3VPT A;  2DKI A;  2P0G A;  1BNJ A;  1FG4 A;  1JNQ A;  4FCM A;  3RPN A;  2DJ2 A;  4U13 A;  5D9V A;  5DRV A;  1AXD A;  1LU4 A;  3EF8 A;  2BMO B;  1Z7P A;  1DSB A;  1LNH A;  4I2T A;  3WT1 A;  3NBB A;  3S29 A;  4K90 B;  1R5A A;  3F7S A;  1PYL A;  4FCZ A;  3MG1 A;  2KXG A;  2BT3 A;  1WMN A;  4HM8 B;  4BVY B;  5DQS A;  1S5A A;  1RGC A;  4XRD A;  11GS A;  2VIM A;  5L71 A;  1GUK A;  1GSE A;  2C3Q A;  4EVM A;  1F3B A;  2FGT A;  2TRX A;  1ROA A;  2H1D A;  3TKS E;  1XW5 A;  4Z2T A;  2H30 A;  3M8C A;  1VQP 3;  1TTZ A;  2YWN A;  1IDP A;  1ZCP A;  2IPA A;  4X2H A;  4HU9 A;  4K2D A;  4K5S A;  2X64 A;  5IMZ A;  5EVH A;  3G16 A;  3BND A;  2JZR A;  4IIA A;  3B4O A;  3C7M A;  1I2G A;  4HM0 B;  1MWR A;  4N11 A;  5C00 A;  1PX6 A;  4EYC A;  1B3S A;  2WCI A;  2YJH A;  2DC5 A;  1U3A A;  3WGE A;  1QGV A;  2F3M A;  1B27 A;  1SK1 A;  2K8S A;  2CFL A;  3KXO A;  1ISK A;  4ICY A;  4K1F A;  1JKG B;  2WFC A;  3FMW A;  5KP3 A;  1S3R A;  1GMR A;  1EOH A;  1TFK A;  5J4U A;  4QL9 A;  3IDV A;  1BYE A;  3QRD A;  1NO3 A;  4KB3 A;  5AIX A;  3SX1 A;  1X5C A;  1S3D A;  3O6T A;  4CW9 A;  3F6D A;  3HYP A;  4OFM A;  4OWY A;  3K8N A;  3UL5 A;  3DUK A;  1PFO A;  3CU3 A;  3UJM A;  4ECB A;  1WJK A;  2VCQ A;  1SYX A;  4G9H A;  4XRA A;  3S67 A;  1OPY A;  2R0G A;  1E3V A;  2KHP A;  3ROB A;  10GS A;  1UGI A;  3IAM 2;  5IO0 A;  3CPW 2;  4DSR A;  1OC9 A;  4MMM A;  3L0H A;  2KOK A;  3LWA A;  3G7J A;  4OMV A;  3G0K A;  1MWU A;  2P31 A;  2VM2 A;  5IQY A;  3ALA A;  3ZRD A;  4USS A;  2DJK A;  5IMV A;  3TKS C;  1GSU A;  4O92 A;  3CXC 2;  3VWX A;  1K3Y A;  1OKT A;  4CCV A;  5B6N A;  5EVO A;  3WHO A;  2HRK A;  2IME A;  4IQ1 A;  3VK9 A;  4XB5 A;  2BTO T;  4KCE A;  1OAZ A;  3S28 A;  3PGT A;  5BXQ A;  3QPM A;  1Q7Y 4;  1YJN 3;  1EP7 A;  3KII A;  3APO A;  2CC3 A;  3GSP A;  1OYJ A;  2C80 A;  1FA3 A;  4PQH A;  4HS1 A;  4TR0 A;  1BUJ A;  2CQ9 A;  1OH0 A;  3S5C A;  2H1B A;  1GS3 A;  4KND A;  1FYS A;  1JBR A;  2RFR A;  3BLZ A;  5CNW A;  1O8X A;  1XWK A;  1Y25 A;  3N9H A;  1RW1 A;  1K0B A;  4FH8 A;  1GUM A;  2RCD A;  3TJG A;  1YF1 A;  3PS8 A;  4WR4 A;  1IYI A;  4YQU A;  5F06 A;  1DMN A;  3JUP A;  1NHY A;  1VQ5 3;  1TOF A;  2AYT A;  3FR6 A;  1RGE A;  1SK0 A;  5CF1 A;  5ELJ A;  1F6M C;  1XG8 A;  3EMP A;  5DVB A;  2IFQ B;  5ECK B;  3WOF B;  7STD A;  1M0U A;  3FCS B;  3OR5 A;  2CZ2 A;  6GSY A;  1PX7 A;  1M90 4;  1N9J A;  2L6C A;  1ZX2 A;  1JB4 A;  4XHM A;  3SYU A;  1YVS A;  2E2V A;  5JBS A;  3FZ4 A;  4N10 A;  4PUR A;  3G71 3;  2HZF A;  1Z3E A;  1PA3 A;  3URP A;  5HQP A;  1BU4 A;  2M7O A;  2L5L A;  2MF7 A;  4MJC A;  4MJD A;  3GZB A;  1BED A;  1ERU A;  1W4V A;  2H19 A;  3DY5 A;  4BWQ A;  2CFW A;  4ECJ A;  1A2M A;  1X9W B;  4KVH A;  3QFA C;  1G6W A;  4GHO A;  4AJ6 A;  1AIU A;  2CWV A;  3CCL 3;  3STD A;  1VGL A;  4FYC A;  3ERF A;  1GSQ A;  6GSU A;  5GSP A;  1FW1 A;  1RGL A;  3GWR A;  1JN5 A;  2QA2 A;  1WQL B;  1TRS A;  3P90 A;  2JZT A;  9RNT A;  1EZK A;  4NV5 A;  1TW9 A;  2C0G A;  2LS5 A;  3CD6 3;  3ZG0 A;  4TKY A;  3ZYW A;  2E2U A;  2LQQ A;  1N5H A;  1OHS A;  3ZFL A;  5HFK A;  1JZW A;  3A76 A;  2ZDJ A;  3IRA A;  4HM7 B;  3BNE A;  1PN9 A;  4DSQ A;  5IG4 A;  1Q82 4;  4LLR A;  4TW5 A;  3KMN A;  1BQ7 A;  1BSC A;  4FMD A;  2R37 A;  1FGQ A;  1ULJ B;  3RGA A;  2YV9 A;  2GEX A;  3F8U A;  1GTI A;  5CP1 A;  2AJQ B;  5IMD A;  1KC8 4;  5HR0 A;  1AVK A;  5ID2 A;  1SL0 B;  4ZL7 A;  4KFD A;  1GUH A;  4EF0 A;  4XS6 A;  3M3M A;  1YY7 A;  1EV9 A;  4GXZ A;  1U8C B;  5IMA A;  3CC7 3;  4F0B A;  4AF2 A;  5ELU A;  4H86 A;  3T8N A;  4WF4 A;  3L9V A;  2C10 A;  1FVK A;  2XF3 A;  1FAA A;  1A24 A;  3RBT A;  2K3D A;  5AI1 A;  2DML A;  2XFS A;  1HYU A;  3LT9 A;  2HMO B;  3KIJ A;  2VOC A;  5LNK e;  2HYX A;  2F8A A;  2O7K A;  2LUS A;  4MMZ B;  2HMN B;  2YWO A;  1K8A 4;  1ASK A;  3HD5 A;  3OV4 A;  4WKW A;  2CFD A;  3UB1 A;  1UW1 A;  3AHW A;  4HZ9 B;  5FHI A;  2LJR A;  3C8E A;  4WP5 A;  4JF8 A;  1HKX A;  1STD A;  2A2P A;  2YP6 A;  2CG0 A;  9GSS A;  3HKR A;  2I9W A;  4IHU A;  4MDC A;  4HM2 B;  5IMF A;  4DSS B;  1A8L A;  5DJL A;  3GIX A;  3VWW A;  1J2B A;  4CDO A;  1FZU A;  1M9A A;  2C0E A;  5AEU B;  3RAZ A;  4HOH A;  1GTU A;  1TDI A;  5A0O B;  4TXO A;  2C4J A;  2P0M A;  3EVI A;  4KSO A;  1FGR A;  2F51 A;  5D96 A;  3FRC A;  2L57 A;  1UUG B;  1MWT A;  1AUC A;  1IV7 A;  3PH9 A;  4PXO A;  1BNF A;  1GMP A;  1TRW A;  4OD7 A;  1DMM A;  3CPO A;  2PN8 A;  3S9F A;  4Q5N A;  1FW7 A;  2XGL A;  1T3B A;  2W9P A;  3DXO A;  1M2D A;  2VLU A;  5M18 A;  5JWO B;  5J41 A;  1N8R 4;  3W6G A;  1JZD A;  3DGO A;  2PPT A;  4OCF A;  3X3X A;  4OK0 A;  1RK4 A;  3GFK A;  1X9S B;  1YVB I;  3UL3 A;  3IMA B;  1F37 A;  4XCS A;  1SEN A;  2OE1 A;  2W6J H;  2CFG A;  1BRH A;  1O73 A;  3CCR 3;  2AUV A;  1TRV A;  1TFO A;  1SD8 A;  1UI7 A;  3TRX A;  3CCM 3;  3HHV A;  1SD9 A;  5FT3 A;  3FLJ A;  2L59 A;  1QXH A;  3CRT A;  4LMV A;  4K9Z A;  5EEO A;  1WIK A;  1A90 A;  2A2R A;  3FH1 A;  3GAX A;  1O85 A;  4J2F A;  4F03 A;  1TXX A;  1W5Z A;  1HYF A;  4R9L A;  1B9X C;  1K41 A;  1RGG A;  4MMY B;  2XSH B;  4G10 A;  5M1A A;  5COH A;  5G31 A;  2AHE A;  3KD0 A;  3TJJ A;  2OBK A;  2UX0 A;  3BNB A;  4I4K A;  2RM6 A;  3F4T A;  4NPB A;  5IEN A;  3QMX A;  5IIZ A;  4BIR A;  2CH9 A;  1BAO A;  1BG5 A;  4LGQ A;  2WOF A;  3Q90 A;  3EPT A;  2IMF A;  2CVB A;  3GUR A;  2RSX A;  4XBT A;  4KT3 B;  1YGW A;  3QD9 A;  3H4K A;  1RNB A;  2A2S A;  1T7P B;  1YJ9 3;  4GST A;  4IW9 A;  4BWS A;  2TIR A;  4KDY A;  3LQ7 A;  4K2X A;  4TR1 A;  2XPD A;  3RHC A;  3J7Y d;  4HJM A;  2B5X A;  4RQR A;  3EX9 A;  2B7J A;  1MTC A;  1XZO A;  3K63 A;  5G1K A;  2IMI A;  1ON4 A;  1YEX A;  2VL2 C;  4K7I A;  1D6U A;  1BIR A;  4N6T A;  3DGL A;  3B8L A;  1NU3 A;  4NRE A;  4NXI A;  3ZZX A;  2OAD A;  1XXU A;  5KOX A;  2K9F A;  2OQE A;  3GH6 A;  1J08 A;  2IMJ A;  4YAV A;  1VF1 A;  5CRG A;  3ZMK A;  1RRH A;  4L8P A;  8CHO A;  1QJG A;  2L1S A;  1JZO A;  1OHP A;  5IG5 A;  4HM3 B;  2L4C A;  4N0Z A;  1KQS 2;  2HI7 A;  1N5P A;  4OCE A;  5GZZ B;  4PQI A;  4R1K A;  2I81 A;  4QQ7 A;  5BIR A;  5STD A;  2P5Q A;  3ISO A;  1CQH A;  3NQY A;  5IG0 A;  4O8S A;  4X0X A;  2HRA A;  4J9A A;  3VI5 A;  5ECQ B;  4EXJ A;  3NV0 A;  3KGK A;  4KZ1 A;  4ID0 A;  2OKA A;  3KN4 A;  1MD4 A;  1E6B A;  3I69 A;  5D82 A;  4DSS A;  4XDV A;  2GT5 A;  1AQW A;  2F9S A;  5CK6 A;  1PKZ A;  1MWS A;  3U5R E;  3PCR A;  5GST A;  1IQY A;  5CRE A;  1RMS A;  2SAR A;  4O5R A;  3I55 3;  2EIQ A;  4IN0 A;  1JLV A;  2YFI B;  4CDL A;  3MNG A;  2M46 A;  1GMQ A;  1OF5 A;  4F2I A;  4LL4 B;  3D4T A;  1RCL A;  2GQL A;  2X49 A;  1HD2 A;  4KW6 A;  1RRL A;  4CY6 A;  2RM5 A;  1G96 A;  1I3I A;  1H75 A;  1YKC A;  2LV3 A;  5AII A;  3TKR A;  2V41 A;  2FNO A;  4TR3 A;  3D9R A;  5D8I A;  1W2B 2;  3CRU A;  4I6X A;  4GLT A;  1ULI B;  2FGX A;  2QC7 A;  2R2J A;  1EGR A;  4HM4 B;  3F4R A;  3E0U A;  3TUE A;  1WNH A;  1DBY A;  4JE1 A;  1VQ9 3;  1VQ8 3;  1XFL A;  2CV4 A;  1OHO A;  3D21 A;  2LTK A;  1BNE A;  5DCH A;  3DML A;  5D73 A;  4ORL A;  1R26 A;  1DET A;  2GDR A;  4LA1 A;  4WWU C;  2QIY A;  2Z77 A;  2EIO A;  1EEJ A;  4KF9 A;  3IK9 A;  2REM A;  2EC4 A;  3KKG A;  4PNG A;  2XSO B;  1FB6 A;  3EBT A;  5C04 A;  3QDN A;  3QOU A;  1XW9 A;  1BNI A;  3TOT A;  1RJO A;  1NDO B;  2GZY A;  3NIV A;  3W8S A;  1PY3 A;  1GOV A;  2IN3 A;  1ZMA A;  1MDK A;  3ZIJ A;  1Q9E A;  3LTB A;  4O5U A;  4BL3 A;  5DAK A;  3D22 A;  2LQV A;  1O7N B;  1U87 A;  3QAW A;  1W6C A;  1AQV A;  3EC9 A;  3V99 A;  3G6E 3;  3GA4 A;  2O87 A;  1SKW B;  2MMO A;  1M1X B;  4XBX A;  1ZYP A;  3KCM A;  1AQZ A;  3ZFZ A;  1R4W A;  3G7I A;  1W89 A;  1CEW I;  3WA2 X;  5G1L A;  1JRQ A;  1DE2 A;  3D79 A;  3DWV A;  3GX8 A;  2AAD A;  1GTB A;  2RUE A;  3MAK A;  4CPK A;  5D9T A;  5B8A A;  1GY7 A;  5TGN A;  2BIR A;  1N8Q A;  2YFJ B;  2RII A;  3FZA A;  5AIH A;  4POK A;  1TKD B;  2XHF A;  1FVJ A;  5CXO A;  3IXR A;  3K7C A;  3IC8 A;  3ZVJ A;  2ZNM A;  2CVK A;  1UN2 A;  3BIR A;  1IK3 A;  5G2G A;  1UA5 A;  2VAF A;  2FLS A;  1ILO A;  1GSY A;  5BVB A;  1OGZ A;  2HZE A;  1SPU A;  1BX9 A;  1PSQ A;  2CFK A;  2XRX B;  4MJB A;  5JCG A;  4ULX A;  3LXU X;  2FNQ A;  17GS A;  1A0F A;  1QQ2 A;  3A2W A;  2HSM A;  3IHQ A;  1O7H B;  2JSZ A;  1WMJ A;  1RGH A;  1X5E A;  1EKM A;  1YI2 3;  4X4J A;  7GSS A;  5J9C A;  1MGW A;  1JLW A;  4MK3 A;  3APQ A;  2QGU A;  3EJV A;  4HM1 B;  4GB5 A;  3HVV A;  3EQQ B;  2X99 A;  1OC8 A;  2MZC A;  2FWH A;  3EUR A;  1O7M B;  1ZZY A;  2K18 A;  3CCJ 3;  1SJI A;  2JZS A;  2R0P A;  4IP6 A;  2F86 B;  3DVW A;  2FA8 A;  5ECO B;  3E9J B;  3V98 A;  4Z7X A;  3UOM A;  1ZS7 A;  1X1Y A;  3CSJ A;  5AYS C;  1F2E A;  3EN1 B;  5KEJ A;  1TU7 A;  1M9G A;  1YJW 3;  5DAK B;  4AKZ A;  4L5O A;  5KP4 A;  2HT9 A;  3HX8 A;  4AGS A;  4TVE A;  2B1X B;  3OX9 A;  1A2K A;  2B5Y A;  4BIK A;  1GSF A;  2HOH A;  3BB9 A;  5J5N A;  3RPP A;  4K7O A;  3ME7 A;  5INY A;  3H8Q A;  3FG3 A;  1BRN L;  1Q81 4;  3GKM A;  4N6M A;  2QA4 3;  1K0N A;  3H3H A;  4TR4 A;  1K3L A;  3MYD A;  3GRX A;  2FHE A;  3TKS A;  3K0Z A;  3F8X A;  4G19 A;  5B8B A;  2FXT A;  3APS A;  3AHS A;  1AV4 A;  3LTD A;  2WDU A;  3LYG A;  1QVG 2;  3PZW A;  3EHC A;  4HBR A;  1PD2 1;  1GRX A;  5HOH A;  4ZB9 A;  3X42 A;  4EL1 A;  3DZL A;  3PCS A;  3U6V A;  1GL8 A;  3CTF A;  1WMO A;  2B7K A;  2KF4 A;  1N2A A;  3JCM L;  2L4Q A;  4Q5Q A;  4LEH A;  1PFP A;  2QKE A;  1BRS A;  2CG1 A;  5IMC A;  3AY8 A;  4XS1 A;  1TJD A;  3ZIT A;  3CQF A;  1CQG A;  1V9W A;  3UBL A;  1B8X A;  3M9K A;  5IEP A;  5AIS A;  4KAE A;  3K5T A;  4O2H A;  5CYY A;  1RN1 A;  1IYH A;  2D2Z A;  2GST A;  2CHC A;  4N6O B;  1PN0 A;  1T00 A;  4ISD A;  3DKS A;  2KF5 A;  1F8N A;  1VRS D;  3GTU A;  3HJP A;  3KMO A;  5JPP A;  4J57 E;  3VF1 A;  4YH2 A;  1KNG A;  1AQX A;  1GY6 A;  3VLN A;  1UVZ A;  4KDX A;  1B2S A;  1IVV A;  3IAS 2;  4O02 B;  2V2G A;  4ZXG A;  3MPH A;  3HJM A;  3O8Y A;  3LXT A;  4O7H A;  2L4V A;  2H0G A;  4E8E A;  1HNA A;  1NW2 A;  5GAP D;  4D73 A;  4WR5 A;  2F5M A;  3SWL A;  2WGQ A;  4L5L A;  2CK3 H;  4LL1 B;  2RBI A;  3ZLP A;  2FY6 A;  3UL6 A;  2IUK A;  3OWU A;  5LD0 A;  5ECS A;  2ZCT A;  3DGN A;  4JED A;  2QA1 A;  1J0F A;  2YCD A;  3HOH A;  2KCD A;  4FMA A;  18GS A;  1UI8 A;  2OOV C;  5LC7 A;  4KGI A;  6GSP A;  4K1V A;  2KAA A;  4STD A;  3FKF A;  1B21 A;  4KSM A;  2OCT A;  2GU1 A;  1RN4 A;  2GU3 A;  1O6J A;  1TI1 A;  1A2V A;  3ZG5 A;  3D0Z A;  4HSC X;  3QFB C;  2GLR A;  4L0W A;  2VCV A;  2FWF A;  5E4W A;  1ST9 A;  1DYU A;  1PKW A;  4H3U A;  3N8B A;  4MPG A;  1OF5 B;  5F0G A;  3F6F A;  3SLU A;  4GL6 A;  4HUA A;  2FUG 2;  1WMP A;  3EMX A;  5GSS A;  2H0I A;  2C0F A;  4K0G A;  1B2M A;  1RKY A;  2R3X A;  3X3Z A;  4MPF A;  3TRQ A;  1SII A;  1ACV A;  1CYU A;  1YJ6 A;  1TU8 A;  1WOU A;  3T0U A;  4RBN A;  1STF I;  3G7Y A;  6GSW A;  1BSA A;  3KZT A;  3CCE 3;  3H1N A;  6GST A;  3GTU B;  1JHB A;  2GVP A;  1IU7 A;  2P09 A;  3QR6 A;  1M3I A;  1NB5 I;  2LNT A;  4LMI A;  2ALB A;  5E59 A;  4ZIL A;  3TB2 A;  5H5Q A;  4GQF A;  1Q40 A;  5CO3 A;  4N6L A;  3ZTL A;  5D9X A;  1TK0 B;  2O9U X;  3D5I A;  1W7C A;  4EXR A;  2FA4 A;  3TJK A;  1ZYE A;  1VQM 3;  3EU4 A;  3I43 A;  3UAP A;  2HRF A;  5EPF A;  1RHL A;  4EBG A;  2UUG C;  1TRQ A;  2A15 A;  3FF2 A;  2CT6 A;  2XBI A;  5ECP B;  5CLK A;  1S72 3;  1YIT 3;  1IT8 A;  3M8N A;  4DKI A;  2I3Y A;  2R41 A;  3FHK A;  4WYK A;  1T2H A;  5LC6 A;  3TGZ A;  3IR4 A;  3F3R A;  2GSP A;  4XM4 A;  3IE3 A;  4I5Q A;  2I4A A;  2HMM B;  4RNY A;  2J8X B;  1YGE A;  2Q07 A;  2VLT A;  1M3J A;  2B24 B;  1V57 A;  3FG1 A;  2KF3 A;  3O3T A;  5FW5 A;  3C73 A;  1AVL A;  1VQK 3;  4PUA A;  1EUI C;  2C4B A;  4OVM A;  3GZX B;  4YQM A;  3HZP A;  1I70 A;  1V74 A;  3EWL A;  4NV2 A;  4P3Y B;  3KSP A;  1A0R P;  3LW9 A;  3EYT A;  1HZ1 A;  1ZGX A;  4MJA A;  4ZL8 A;  4XDW A;  1GSD A;  3EB8 A;  2INX A;  2NVL A;  5AIV A;  3DYR A;  4Q5R A;  2KUC A;  1JFU A;  2CZ3 A;  3FR9 A;  2LJK A;  5D83 A;  3NOF A;  4HDE A;  3C1R A;  3HI7 A;  4K7N A;  3ED3 A;  5GAN D;  3KJY A;  3RGR A;  4MZC A;  2DJJ A;  1RNT A;  4HAA A;  2P5R A;  2VL9 A;  2A4V A;  2VUP A;  3HZ8 A;  1G7O A;  3SOA A;  1T4Y A;  1GUL A;  1S3A A;  5EQL A;  2ON5 A;  1TRP A;  3WYW A;  1GYB A;  3OWY A;  1EP8 A;  3SOY A;  4DVC A;  3R2Q A;  2IYJ A;  3VPQ A;  1G0T A;  3PPU A;  3GHA A;  3P8W A;  2LNS A;  4F0C A;  5JWQ B;  1MDJ A;  4F82 A;  2H1A A;  2R5G A;  3PGB A;  5AIG A;  1B4P A;  1M7T A;  1ML6 A;  2VCW A;  2DIZ A;  4MCU A;  4IEL A;  1T4Z A;  2XGN A;  1URM A;  4PTS A;  1H4O A;  1S3C A;  3GRD A;  1FGO A;  2VM1 A;  2CAI A;  3ER7 A;  1J9B A;  1KTE A;  3LT8 A;  4MF6 A;  2AB6 A;  1XCC A;  4YKG A;  3UMA A;  2W56 A;  3NUV A;  4L7K A;  1T1V A;  3M0F A;  5DQY A;  3PXM A;  3DGY A;  1WE0 A;  3N54 B;  5EY6 A;  3LSZ A;  3BJ5 A;  1AR0 A;  2V1M A;  4EDY A;  1ZGN A;  4N6V 0;  4FMC A;  2PVQ A;  3GUS A;  4K0N A;  2F4Y A;  1V2A A;  1UCL A;  3L4N A;  4OFT A;  2YN1 A;  1XOB A;  3KEB A;  4O3V A;  2YPM A;  3T8U A;  3FR3 A;  1SYR A;  1VQN 3;  3LJR A;  1B2X A;  1Y6E A;  3HY2 A;  1E3R A;  2GBW B;  2V1L A;  4AJ8 A;  4FR9 A;  1BAN A;  3WGX A;  1LBK A;  3TCO A;  1GH2 A;  2ES7 A;  2NDO A;  3GL5 A;  1TK5 B;  1ERW A;  2F5W A;  2P0X A;  1GD3 A;  4NHF A;  2VO4 A;  1AAZ A;  2PGT A;  5BRT A;  3HVX A;  1R4C A;  5KOW A;  3AMO A;  2VL2 A;  1UUW B;  2E2T A;  4EE0 A; 
#chains in the Genus database with same CATH homology
 2AAW A;  5CRH A;  3LGC A;  2VCT A;  5ECL B;  4POM A;  4OO4 A;  4PGT A;  2H74 A;  4K6X A;  4KA0 A;  3UEM A;  4MH2 A;  2I9H A;  2HSH A;  5KN1 A;  1Z5Y E;  1K0O A;  3MWH A;  2WJU A;  4GTU A;  1QK8 A;  1E2Y A;  5F05 A;  1Q4J A;  1R5P A;  4F9Z A;  2VD0 A;  2Z9S A;  3PR8 A;  1M2B A;  2CA8 A;  3EU3 A;  3A3T A;  3ZFB A;  4ML1 A;  2LQO A;  2N5B A;  1OE7 A;  1EV4 A;  4RI7 A;  3LG6 A;  3W8J A;  2XC2 A;  3F63 A;  2DJ0 A;  4IGJ A;  4TOP A;  1VF2 A;  1XIY A;  4JR4 A;  2HNL A;  4Z2R A;  4ILF A;  3DD3 A;  2PWJ A;  3CYN A;  4G0K A;  3IA1 A;  1Z6N A;  2A4H A;  1K3O A;  1GTA A;  2HFD A;  2E0Q A;  4MAB A;  5DDL A;  2DIY A;  1GWC A;  4GF0 A;  2E2G A;  4FO5 A;  4WET A;  5J9B A;  4N0V A;  1GNW A;  3HCZ A;  5KN3 A;  3UJ1 A;  2CVD A;  3GV1 A;  2IMK A;  4KCA A;  1Z9H A;  3IBH A;  5DJM A;  3FYG A;  1X0R A;  3MDK A;  2FCH A;  5LCZ A;  3FEU A;  1A2J A;  2O89 A;  2WB9 A;  5JCW A;  2BMX A;  4GCI A;  1M99 A;  4V2L A;  3CSI A;  5A5K A;  1ERT A;  4NWY A;  1EGO A;  1AC1 A;  1YQ1 A;  4ZB8 A;  1NSW A;  5IO2 A;  2GGT A;  1XOA A;  5H5R A;  4OFN A;  1TK8 B;  4ZL9 A;  2R6K A;  4G0I A;  4WBJ A;  4GSS A;  2NTO A;  4HQS A;  1SL1 B;  3VI7 A;  3IC4 A;  3LFL A;  3WD6 A;  6GSV A;  1GNE A;  4HJ2 A;  1G7E A;  4PQ1 A;  4EDZ A;  22GS A;  1XWB A;  3ZL5 A;  2LST A;  2YAN A;  4TXV A;  4MF7 A;  4ZIJ A;  2DMM A;  4MZW A;  1SJZ A;  2EIR A;  1HNC A;  3TJB A;  6GSS A;  4JZQ A;  3WT2 A;  3US3 A;  3L78 A;  4KH7 A;  2KLX A;  5BMU A;  4FYB A;  1X5D A;  4TRX A;  1XWA A;  1FHE A;  4ACS A;  3ZRE A;  1OC9 B;  2E2M A;  2HXK A;  1O7U A;  2H71 A;  1FB0 A;  4KX4 A;  2C1Y A;  4E8H A;  2WUL A;  1M2A A;  2N5A A;  5KN0 A;  3KTL A;  5DAL B;  4N30 A;  4PNF A;  3D6I A;  5D9W A;  5A4U A;  3UVT A;  4ECC A;  3LOR A;  4POB A;  3ZML A;  5D93 A;  1PQN A;  3PIN A;  1F9M A;  1V98 A;  3QCP A;  2JU5 A;  4GSN A;  1THO A;  2H6X A;  2E7P A;  2H76 A;  1EWX A;  2O8V B;  4HZ4 A;  2OBI A;  3UBK A;  1SKS B;  2MMN A;  3ZVJ D;  4IJI A;  4JBB A;  5HR2 A;  1YDK A;  2OE3 A;  2HSY A;  2IL3 A;  5G30 A;  1TRU A;  3FZ9 A;  3P7X A;  2V6K A;  2JAD A;  1Q98 A;  2OE0 A;  4BL7 A;  1XBS A;  4ZB6 A;  3RDW A;  4HU7 A;  4KE3 A;  2L5O A;  5H5S A;  2H66 A;  2UZ8 A;  3EE2 A;  1K0A A;  1XW6 A;  2LRC A;  6GSX A;  2H75 A;  5IOX A;  4CHS A;  2B1L A;  3FY7 A;  1B4Q A;  3GST A;  4IJ3 A;  3CSH A;  2K6V A;  1XPV A;  4YQV A;  1XVQ A;  5CAX A;  3N5O A;  5A4W A;  4EIQ A;  1K0M A;  3TRP A;  1G6Y A;  1BJX A;  3TOU A;  1VF3 A;  2MBS A;  1PRX A;  4O32 A;  3A5I A;  2DLX A;  1FO5 A;  4HOJ A;  2VL3 A;  3NZN A;  2MMA A;  3KP8 A;  2YWI A;  5DBQ A;  2F8F A;  3ERG A;  4NHW A;  2LEG A;  4IS0 A;  4LMW A;  3Q18 A;  3VWU A;  1A2L A;  2GQK A;  3F4S A;  1OVN A;  1ERV A;  5IM9 A;  5JCU A;  5ABR A;  2RUF A;  4EO3 A;  4D73 B;  1SK2 A;  2WRT A;  2CX3 A;  1V40 A;  3D5J A;  3UVH A;  4RUV A;  2X8C A;  2IY2 A;  3MIX A;  4HZ2 A;  3N9J A;  4IQA A;  3J7Y b;  3GNJ A;  4ZBB A;  5G5F A;  1F3A A;  1U3I A;  1R7H A;  3GKK A;  4G2E A;  4L0U A;  3TKP A;  3GSS A;  2VLV A;  1X9M B;  4MA9 A;  1K0C A;  1SL2 B;  1OC3 A;  4GRF A;  1K0D A;  2YV7 A;  16GS A;  3IK7 A;  1SJ6 A;  3KH9 A;  4YAP A;  2GZP A;  3CBU A;  2IWT A;  3KP9 A;  4PUF C;  3KZQ A;  4FIW A;  1YEP A;  2H72 A;  1YF0 A;  4WF5 A;  2OAC A;  2M80 A;  5AN1 A;  4I2U A;  3KM6 A;  1EOG A;  2H73 A;  4WEY A;  3Q19 A;  3UAR A;  13GS A;  4QL7 A;  3QAG A;  2GSS A;  2J23 A;  2G2Q A;  4XIH A;  3H79 A;  1U6T A;  4EIP A;  1XVW A;  4IVF A;  1ZL9 A;  4K8M A;  2PU9 C;  4JU5 A;  1B9Y C;  4Z2U A;  5IPG A;  2MYG A;  2OJL A;  4I8B A;  1V58 A;  5DAL A;  19GS A;  1FOV A;  2O85 A;  2R4V A;  4HQZ A;  3UIW A;  1KEB A;  3C1S A;  1Z6M A;  4TXO B;  3F9U A;  3HZ4 A;  3TJF A;  2JSY A;  3ME8 A;  4FQU A;  4IP1 A;  1QUW A;  4I97 A;  3GX0 A;  2QSI A;  2H01 A;  1Z7R A;  5J3R A;  3BCK A;  3SBC A;  2GZZ A;  2H8L A;  3FZ5 A;  2WGR A;  2HZE B;  2NBS A;  3LXZ A;  4EKZ A;  5AGY A;  1USB A;  5KN2 A;  3DVX A;  5HFG A;  5JWR B;  1PL1 A;  4TR1 B;  2K8V A;  3LEF A;  1XWG A;  4MLY A;  1ZYQ B;  5F07 A;  3A5W A;  3DEX A;  3L9S A;  2BJX A;  2WZ9 A;  4OO5 A;  5B6M A;  3D4M A;  4DEJ A;  4PX1 A;  5A4V A;  3V1W A;  1TI3 A;  1GP1 A;  2GS3 A;  3HDC A;  2QGV A;  1U88 A;  3L9U A;  4MF5 A;  2LRT A;  3HA9 A;  4NAX A;  5EL8 A;  2YOI A;  4MJE A;  3BCI A;  1AW9 A;  4IKH A;  3LYP A;  2PUK C;  2GQM A;  1M9B A;  2GT6 A;  3VUR A;  3BBY A;  3IPZ A;  3Q74 A;  3R3E A;  4J56 E;  3TKQ A;  4XTS A;  1BAY A;  3QAV A;  2B6M A;  3GKX A;  2VCZ A;  1ZYN A;  3ERW A;  4X1U A;  4Q5F A;  1JZR A;  3F3Q A;  4O5Q A;  2MMZ A;  4MH3 A;  8GSS A;  2DBC A;  2H0H A;  1PL2 A;  5HR1 A;  4JR6 A;  5CRD A;  5F8B A;  3GYK A;  3HVS A;  3IOS A;  4EC0 A;  2C8U A;  5IPH A;  4ECI A;  2VD1 A;  3O76 A;  5B7C A;  1GLQ A;  4X43 A;  2I1U A;  1C72 A;  2LKU A;  3LYK A;  2KP1 A;  2B3S A;  2YZH A;  3TDG A;  4V2N A;  2R0C A;  4HEA 2;  3CXG A;  3J7Y k;  1T8E B;  2JL4 A;  2C3T A;  2JAC A;  5CRW A;  2C0D A;  2OA7 A;  3DXB A;  4BL7 B;  4V1A g;  2ON7 A;  2FWG A;  4MNN A;  1WPI A;  4V2M A;  2CAQ A;  2FD3 A;  3DGQ A;  1TP9 A;  2IIY A;  4TN8 A;  2ZUP A;  3F0I A;  2V6O A;  4BA7 A;  1O8W A;  1SU9 A;  2HLS A;  2C3N A;  1XWC A;  5ECH B;  2DJ1 A;  2LJA A;  5ECM B;  4GWR A;  2YJ7 A;  4RQX A;  2MBT A;  4BPY A;  3DRN A;  2GSQ A;  2HRN A;  3H93 A;  3KH7 A;  1A23 A;  4MZB A;  2H6Z A;  2NPB A;  3GN3 A;  1DUG A;  3M9J A;  1DE1 A;  4BVY A;  2DJ3 A;  1RQM A;  3GKN A;  5ECN B;  3FW2 A;  2PER A;  1SKR B;  3I6A A;  20GS A;  1WWJ A;  2PVO C;  1I5G A;  5HFI A;  4AJ7 A;  3HXS A;  1WRY A;  4POL A;  12GS A;  4KUN A;  2XPE A;  3VFI A;  3RHB A;  2YWM A;  1MDI A;  3ZIV A;  4A5P A;  5HR3 A;  1EEM A;  1B48 A;  1A8Y A;  2B5E A;  2PMT A;  1NHO A;  4WBR D;  2G0F A;  2H70 A;  1N8J A;  1NM3 A;  5FWG A;  5G5E A;  3CTG A;  1PMT A;  1WP0 A;  5ID2 B;  2AV4 A;  3WGD A;  4BVX B;  2B1K A;  2YZU A;  2IJY A;  2RLI A;  3EIN A;  4JRR A;  3KTB A;  5ELG A;  5ELA A;  3E3E A;  5DCG A;  1LJR A;  3CMI A;  4IBP A;  2VCX A;  3A2X A;  1YKA A;  3HJO A;  2YNX A;  2N5F A;  2V32 A;  4EUY A;  4HI7 A;  1GLP A;  4ML6 A;  1KBN A;  2WS2 A;  2XBQ A;  4GQC A;  4MP4 A;  2X4A A;  4ZBD A;  5IOW A;  2X8H A;  4NMU A;  4L8E A;  4NHZ A;  1GSS A;  1THX A;  2KP2 A;  1O81 A;  3G9B A;  3BD2 A;  4RI6 A;  1HNB A;  4XS4 A;  4YKF A;  1UC7 A;  4K5R A;  2GSR A;  1YZX A;  3VWV A;  1I9D A;  3M1G A;  3GMF A;  2J9H A;  2DKH A;  14GS A;  1QMV A;  1ZOF A;  3A2V A;  1VF4 A;  1OE8 A;  4XS4 B;  1OKD A;  2HE3 A;  3I9V 2;  2LRN A;  1MD3 A;  2CX4 A;  4G0L A;  5G2Z A;  3P2A A;  4KDU A;  4CY8 A;  5ENU A;  3GH9 A;  3BOA A;  5ECR B;  2H6Y A;  2IFQ A;  3DIE A;  2DSA A;  4WXT A;  3EC3 A;  2H1G A;  2PBJ A;  3GL3 A;  5ECI B;  1FOH A;  2L6D A;  3MSZ A;  3IHG A;  4BVX A;  2FWE A;  2M72 A;  3IV4 A;  1HQO A;  3C71 A;  1PGT A;  1ABA A;  3Q6O A;  4ZBA A;  1MEK A;  4FYU A;  3FK8 A;  1QFN A;  2X8G A;  2GTU A;  2IMD A;  2TRC P;  4V1A p;  3VPT A;  2DKI A;  2P0G A;  1FG4 A;  3RPN A;  2DJ2 A;  5D9V A;  1AXD A;  1LU4 A;  1Z7P A;  1DSB A;  4I2T A;  3WT1 A;  1R5A A;  4BVY B;  5DQS A;  4XRD A;  11GS A;  2VIM A;  5L71 A;  1GUK A;  1GSE A;  2C3Q A;  4EVM A;  1F3B A;  2TRX A;  2H1D A;  3TKS E;  1XW5 A;  4Z2T A;  2H30 A;  1TTZ A;  2YWN A;  1ZCP A;  2IPA A;  4HU9 A;  4K2D A;  4K5S A;  2X64 A;  5IMZ A;  2JZR A;  3C7M A;  4N11 A;  5C00 A;  1PX6 A;  2WCI A;  2YJH A;  2DC5 A;  1U3A A;  3WGE A;  1QGV A;  2F3M A;  1SK1 A;  2K8S A;  3KXO A;  4ICY A;  4K1F A;  2WFC A;  3FMW A;  1EOH A;  5J4U A;  4QL9 A;  3IDV A;  1BYE A;  4KB3 A;  5AIX A;  1X5C A;  1S3D A;  3O6T A;  4CW9 A;  3F6D A;  3HYP A;  4OFM A;  4OWY A;  3K8N A;  4ECB A;  1WJK A;  2VCQ A;  1SYX A;  4G9H A;  4XRA A;  2R0G A;  2KHP A;  10GS A;  3IAM 2;  5IO0 A;  4DSR A;  1OC9 A;  4MMM A;  3L0H A;  2KOK A;  3LWA A;  3G7J A;  4OMV A;  2P31 A;  2VM2 A;  5IQY A;  3ZRD A;  4USS A;  2DJK A;  5IMV A;  3TKS C;  1GSU A;  4O92 A;  3VWX A;  1K3Y A;  1OKT A;  5B6N A;  5EVO A;  2HRK A;  2IME A;  4IQ1 A;  3VK9 A;  2BTO T;  4KCE A;  1OAZ A;  3PGT A;  3QPM A;  1EP7 A;  3APO A;  1OYJ A;  2C80 A;  4PQH A;  4HS1 A;  4TR0 A;  2CQ9 A;  2H1B A;  4KND A;  5CNW A;  1O8X A;  1XWK A;  1Y25 A;  1RW1 A;  1K0B A;  4FH8 A;  1GUM A;  3TJG A;  1YF1 A;  4WR4 A;  1IYI A;  4YQU A;  5F06 A;  1NHY A;  2AYT A;  1TOF A;  3FR6 A;  1SK0 A;  1F6M C;  3EMP A;  5ECK B;  5DVB A;  2IFQ B;  1M0U A;  3OR5 A;  2CZ2 A;  6GSY A;  1PX7 A;  2L6C A;  4XHM A;  3FZ4 A;  4N10 A;  4PUR A;  2HZF A;  1Z3E A;  1PA3 A;  5HQP A;  2L5L A;  4MJC A;  1BED A;  1ERU A;  1W4V A;  2H19 A;  4BWQ A;  4ECJ A;  1A2M A;  1X9W B;  3QFA C;  1G6W A;  4AJ6 A;  1AIU A;  1VGL A;  4FYC A;  3ERF A;  1GSQ A;  6GSU A;  1FW1 A;  2QA2 A;  1TRS A;  3P90 A;  2JZT A;  1EZK A;  4NV5 A;  1TW9 A;  2C0G A;  2LS5 A;  4TKY A;  3ZYW A;  2LQQ A;  3ZFL A;  5HFK A;  1JZW A;  3IRA A;  1PN9 A;  4DSQ A;  4LLR A;  4TW5 A;  3KMN A;  1BQ7 A;  2R37 A;  2YV9 A;  3F8U A;  1GTI A;  5CP1 A;  2AJQ B;  5IMD A;  5HR0 A;  5ID2 A;  1SL0 B;  4ZL7 A;  1GUH A;  4EF0 A;  4XS6 A;  3M3M A;  1YY7 A;  1EV9 A;  4GXZ A;  5IMA A;  4F0B A;  4AF2 A;  4H86 A;  4WF4 A;  3L9V A;  1FVK A;  1FAA A;  1A24 A;  3RBT A;  2DML A;  1HYU A;  3KIJ A;  2VOC A;  5LNK e;  2HYX A;  2F8A A;  2O7K A;  2LUS A;  2YWO A;  4WKW A;  3HD5 A;  5FHI A;  2LJR A;  3C8E A;  2YP6 A;  2A2P A;  9GSS A;  3HKR A;  4IHU A;  4MDC A;  5IMF A;  4DSS B;  1A8L A;  5DJL A;  3GIX A;  3VWW A;  4CDO A;  1M9A A;  2C0E A;  3RAZ A;  1GTU A;  1TDI A;  4TXO A;  2C4J A;  3EVI A;  4KSO A;  2F51 A;  5D96 A;  3FRC A;  2L57 A;  1AUC A;  4PXO A;  3PH9 A;  1TRW A;  4OD7 A;  2PN8 A;  3S9F A;  4Q5N A;  1T3B A;  1M2D A;  2VLU A;  5JWO B;  5J41 A;  3W6G A;  1JZD A;  2PPT A;  4OCF A;  1RK4 A;  3GFK A;  1X9S B;  3UL3 A;  1F37 A;  4XCS A;  1SEN A;  2OE1 A;  1O73 A;  2AUV A;  1TRV A;  1SD8 A;  3TRX A;  3HHV A;  1SD9 A;  5FT3 A;  2L59 A;  1QXH A;  3CRT A;  4LMV A;  4K9Z A;  2A2R A;  1WIK A;  1O85 A;  4J2F A;  4F03 A;  1TXX A;  1B9X C;  4G10 A;  5COH A;  5G31 A;  2AHE A;  3TJJ A;  3KD0 A;  2OBK A;  2RM6 A;  3F4T A;  4NPB A;  3QMX A;  5IIZ A;  1BG5 A;  3EPT A;  2IMF A;  2CVB A;  3GUR A;  3QD9 A;  3H4K A;  2A2S A;  1T7P B;  4GST A;  4IW9 A;  4BWS A;  2TIR A;  4KDY A;  3LQ7 A;  4K2X A;  4TR1 A;  2XPD A;  3RHC A;  4HJM A;  2B5X A;  4RQR A;  2B7J A;  1MTC A;  1XZO A;  5G1K A;  2IMI A;  1ON4 A;  1YEX A;  2VL2 C;  4K7I A;  4NXI A;  3ZZX A;  2OAD A;  1XXU A;  5KOX A;  2K9F A;  3GH6 A;  1J08 A;  4YAV A;  1VF1 A;  5CRG A;  3ZMK A;  1JZO A;  2L4C A;  4N0Z A;  2HI7 A;  4OCE A;  5GZZ B;  4PQI A;  2I81 A;  4QQ7 A;  2P5Q A;  3ISO A;  1CQH A;  4X0X A;  2HRA A;  3VI5 A;  5ECQ B;  4EXJ A;  4ID0 A;  3KGK A;  2OKA A;  1MD4 A;  1E6B A;  3I69 A;  4DSS A;  2GT5 A;  1AQW A;  2F9S A;  1PKZ A;  3U5R E;  5GST A;  5CRE A;  4O5R A;  2EIQ A;  4IN0 A;  1JLV A;  3MNG A;  2M46 A;  4F2I A;  4LL4 B;  3D4T A;  2GQL A;  2X49 A;  1HD2 A;  4KW6 A;  4CY6 A;  2RM5 A;  1H75 A;  1YKC A;  2LV3 A;  3TKR A;  2V41 A;  2FNO A;  4TR3 A;  5D8I A;  3CRU A;  4I6X A;  4GLT A;  2FGX A;  2QC7 A;  2R2J A;  1EGR A;  3F4R A;  3E0U A;  3TUE A;  1DBY A;  4JE1 A;  1XFL A;  2CV4 A;  3D21 A;  2LTK A;  5DCH A;  3DML A;  5D73 A;  1R26 A;  2GDR A;  4LA1 A;  2EIO A;  1EEJ A;  4KF9 A;  3IK9 A;  2REM A;  2EC4 A;  4PNG A;  1FB6 A;  5C04 A;  3QDN A;  3QOU A;  1XW9 A;  3TOT A;  2GZY A;  3NIV A;  3W8S A;  2IN3 A;  1ZMA A;  1MDK A;  3ZIJ A;  4O5U A;  5DAK A;  3D22 A;  1U87 A;  3QAW A;  1AQV A;  3GA4 A;  2O87 A;  1SKW B;  2MMO A;  1ZYP A;  3KCM A;  1R4W A;  3G7I A;  1W89 A;  5G1L A;  1DE2 A;  3DWV A;  3GX8 A;  1GTB A;  2RUE A;  3MAK A;  5D9T A;  5B8A A;  2RII A;  3FZA A;  4POK A;  1TKD B;  2XHF A;  1FVJ A;  3IXR A;  3IC8 A;  3ZVJ A;  2ZNM A;  2CVK A;  1UN2 A;  2VAF A;  1ILO A;  1UA5 A;  2FLS A;  1GSY A;  2HZE A;  1PSQ A;  1BX9 A;  4MJB A;  5JCG A;  4ULX A;  17GS A;  1A0F A;  1QQ2 A;  3A2W A;  2HSM A;  3IHQ A;  2JSZ A;  1WMJ A;  1X5E A;  5J9C A;  4X4J A;  7GSS A;  1JLW A;  4MK3 A;  3APQ A;  3HVV A;  2X99 A;  1OC8 A;  2MZC A;  2FWH A;  3EUR A;  1ZZY A;  2K18 A;  1SJI A;  2JZS A;  2R0P A;  4IP6 A;  3DVW A;  2FA8 A;  5ECO B;  3E9J B;  4Z7X A;  3UOM A;  3CSJ A;  1F2E A;  5KEJ A;  1TU7 A;  5DAK B;  4L5O A;  2HT9 A;  4AGS A;  4TVE A;  2B5Y A;  1GSF A;  5J5N A;  3RPP A;  4K7O A;  3ME7 A;  5INY A;  3H8Q A;  3GKM A;  1K0N A;  4TR4 A;  1K3L A;  3MYD A;  3GRX A;  2FHE A;  3TKS A;  4G19 A;  5B8B A;  3APS A;  2WDU A;  1PD2 1;  1GRX A;  4ZB9 A;  4EL1 A;  3U6V A;  1GL8 A;  3CTF A;  2B7K A;  1N2A A;  3JCM L;  2L4Q A;  4Q5Q A;  2QKE A;  5IMC A;  3AY8 A;  4XS1 A;  1TJD A;  3ZIT A;  1CQG A;  1V9W A;  3UBL A;  1B8X A;  3M9K A;  5AIS A;  4KAE A;  5CYY A;  1IYH A;  2D2Z A;  2GST A;  1PN0 A;  1T00 A;  4ISD A;  3DKS A;  1VRS D;  3GTU A;  3HJP A;  3KMO A;  4J57 E;  3VLN A;  4YH2 A;  1KNG A;  1AQX A;  1UVZ A;  4KDX A;  3IAS 2;  2V2G A;  4ZXG A;  3HJM A;  3LXT A;  4O7H A;  4E8E A;  2H0G A;  1HNA A;  1NW2 A;  5GAP D;  4D73 A;  4WR5 A;  3SWL A;  4L5L A;  4LL1 B;  3ZLP A;  2FY6 A;  5LD0 A;  5ECS A;  2ZCT A;  4JED A;  2QA1 A;  1J0F A;  2YCD A;  18GS A;  4KGI A;  3FKF A;  4KSM A;  1O6J A;  1TI1 A;  3D0Z A;  3QFB C;  2GLR A;  4L0W A;  2VCV A;  2FWF A;  5E4W A;  1ST9 A;  1PKW A;  4MPG A;  5F0G A;  3F6F A;  4HUA A;  2FUG 2;  5GSS A;  3EMX A;  2H0I A;  2C0F A;  4K0G A;  2R3X A;  4MPF A;  3TRQ A;  1ACV A;  1YJ6 A;  1TU8 A;  1WOU A;  3G7Y A;  6GSW A;  3H1N A;  6GST A;  3GTU B;  1JHB A;  2GVP A;  3QR6 A;  2LNT A;  2ALB A;  5E59 A;  4ZIL A;  3TB2 A;  5H5Q A;  4GQF A;  5CO3 A;  3ZTL A;  5D9X A;  1TK0 B;  2FA4 A;  3TJK A;  1ZYE A;  3EU4 A;  3I43 A;  3UAP A;  2HRF A;  5EPF A;  2XBI A;  2CT6 A;  5ECP B;  3M8N A;  2I3Y A;  3FHK A;  3TGZ A;  3IR4 A;  3F3R A;  3IE3 A;  4I5Q A;  2I4A A;  2VLT A;  1V57 A;  3O3T A;  3C73 A;  4PUA A;  4YQM A;  4NV2 A;  3EWL A;  4P3Y B;  1A0R P;  3LW9 A;  3EYT A;  4MJA A;  4ZL8 A;  1GSD A;  2NVL A;  5AIV A;  3DYR A;  4Q5R A;  2KUC A;  3FR9 A;  1JFU A;  2CZ3 A;  2LJK A;  3NOF A;  4HDE A;  3C1R A;  4K7N A;  3ED3 A;  5GAN D;  3KJY A;  4MZC A;  2DJJ A;  2P5R A;  2VL9 A;  2A4V A;  2VUP A;  3HZ8 A;  1G7O A;  1T4Y A;  1GUL A;  1S3A A;  2ON5 A;  3WYW A;  1EP8 A;  4DVC A;  3R2Q A;  2IYJ A;  3VPQ A;  1G0T A;  3PPU A;  3GHA A;  3P8W A;  2LNS A;  4F0C A;  5JWQ B;  1MDJ A;  4F82 A;  2H1A A;  2R5G A;  1B4P A;  1M7T A;  1ML6 A;  2VCW A;  2DIZ A;  4MCU A;  4IEL A;  1T4Z A;  1URM A;  4PTS A;  1H4O A;  1S3C A;  2VM1 A;  2CAI A;  1J9B A;  1KTE A;  4MF6 A;  2AB6 A;  1XCC A;  4YKG A;  3UMA A;  1T1V A;  3M0F A;  5DQY A;  1WE0 A;  5EY6 A;  3LSZ A;  3BJ5 A;  2V1M A;  4EDY A;  1ZGN A;  2PVQ A;  4K0N A;  3GUS A;  1V2A A;  3L4N A;  4OFT A;  2YN1 A;  1XOB A;  3KEB A;  2YPM A;  3FR3 A;  1SYR A;  3LJR A;  1Y6E A;  3HY2 A;  4AJ8 A;  3WGX A;  1LBK A;  3TCO A;  1GH2 A;  2ES7 A;  2NDO A;  3GL5 A;  1TK5 B;  1ERW A;  2VO4 A;  1AAZ A;  2PGT A;  5BRT A;  3HVX A;  5KOW A;  2VL2 A;  4EE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...