1V57A

Crystal structure of the disulfide bond isomerase dsbg
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 68
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v57A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v57A03
5G31A 4HZ2A 3TKSC 5E59A 4KSMA 4XS1A 2O85A 5EPFA 1IYHA 1S3CA 5G1KA 2PBJA 3CRUA 4K9ZA 4L8EA 3P8WA 4LMVA 4I2UA 1SKWB 1VF4A 2RM6A 5A4WA 3F6DA 1PX6A 1PKWA 5IMCA 4AGSA 3GUSA 5IIZA 1H75A 4WR5A 3UJ1A 1V98A 1GSYA 2GSTA 2GVPA 2RLIA 2RM5A 4XCSA 2YNXA 1VF1A 1M9AA 4F9ZA 1LU4A 3GTUA 1GUMA 3QCPA 1BX9A 4ID0A 4ZIJA 4I8BA 4IGJA 4FYCA 1TOFA 5DQSA 4PX1A 3OR5A 3FZ9A 5IM9A 4TVEA 1GSQA 1EV9A 2GSRA 4WF5A 2M72A 3CSHA 5IMFA 2GSQA 2ZNMA 4EDYA 3DXBA 4V1Ag 2PN8A 3O6TA 2M46A 18GSA 4ECCA 4K7NA 4F0CA 1U87A 3O3TA 3W8SA 2OA7A 2JU5A 4K6XA 4K8MA 2HLSA 5D93A 3ZLPA 2CA8A 1BG5A 1XVQA 4WKWA 1QGVA 4EC0A 2IMDA 4IP6A 3KXOA 2PERA 2LQOA 4MH2A 3KZQA 3GL5A 4MA9A 5A4UA 5H5RA 1GSDA 4HQSA 3CRTA 3TKRA 1GP1A 12GSA 2MYGA 3PR8A 2V2GA 1OE7A 5CRWA 5ECIB 5F0GA 3VWUA 4HOJA 5F06A 5GAND 2CVKA 2H75A 3SWLA 3N5OA 2B5YA 4KCEA 4K1FA 2LJRA 2H1GA 3GSTA 3F3QA 3TOTA 1YQ1A 2DC5A 1S3AA 2CAQA 3GL3A 1WP0A 2HE3A 4POKA 4O92A 3IXRA 5IPGA 5GSTA 3KH9A 2I9HA 3KMOA 4PURA 2VO4A 4AF2A 2HNLA 5G30A 4K0NA 5IO0A 3QFBC 3WYWA 3F0IA 2PPTA 1ILOA 3IE3A 4GCIA 3MWHA 4L5OA 2AYTA 2H1AA 5ECRB 2H6XA 4IKHA 2IMIA 4GQCA 3QR6A 4JEDA 1Q98A 2O87A 3H1NA 2GQLA 2X8CA 2H71A 1Z9HA 3IDVA 4GSTA 6GSVA 2H76A 3GN3A 3WT2A 1TKDB 3MDKA 4YQVA 1V58A 4LMWA 4MF5A 1T00A 3FY7A 2F9SA 3KTBA 1KNGA 3ZYWA 4F03A 4RI6A 4QQ7A 1WIKA 1WPIA 4DSSB 2OKAA 2REMA 5DBQA 2L6DA 2VOCA 2CZ3A 3EWLA 3IOSA 3FW2A 2C0DA 2EIOA 1OC3A 2YV9A 4BPYA 5AIXA 1ACVA 1W89A 3HD5A 1XWAA 2FWFA 1SK0A 2HI7A 5FT3A 3WGXA 2B5EA 5IQYA 5ECKB 2H01A 3ZZXA 1XIYA 1THXA 1AW9A 3TKSA 3L9UA 4X43A 1XFLA 3HJOA 1EOHA 4BWSA 2R37A 4YQMA 1WJKA 2KUCA 2PUKC 2BMXA 2CQ9A 5D9TA 3DKSA 1OVNA 1F6MC 4MPFA 2OE3A 3L78A 4PXOA 4CHSA 2YWNA 3HA9A 3G9BA 2IFQB 5D8IA 2LUSA 1GNWA 3BBYA 1O7UA 2CT6A 2LRCA 3ZVJA 1FW1A 1K0DA 1RQMA 4NXIA 3ZMLA 3FZAA 2GSSA 2E0QA 1VF2A 3D21A 4PQ1A 2L59A 4ECJA 3V1WA 3RHBA 1T4YA 1TI3A 1N2AA 3LXZA 3H93A 2DMLA 1OKTA 2MMOA 5DQYA 4TN8A 2VAFA 6GSSA 3HJMA 1Z7PA 1PQNA 2VLTA 3G7YA 5EVOA 3QD9A 1JLVA 3GSSA 3KP9A 4IVFA 4FYUA 4TRXA 4Z7XA 1VGLA 2M80A 2O7KA 2O8VB 4BWQA 1XPVA 4J57E 3NZNA 2H73A 1NSWA 4DSSA 1ZMAA 1GLQA 3D5JA 2AHEA 1WMJA 4BVXA 1OC8A 2DSAA 3E3EA 3WD6A 2QGVA 3IV4A 4ILFA 2B7JA 1ERTA 3C7MA 4OFTA 2JL4A 4IJIA 5IOXA 3QAWA 4IP1A 4GSSA 3RPPA 2HSHA 4XHMA 1ON4A 3JCML 5HFIA 5FHIA 3APSA 1DE1A 3GA4A 4ISDA 4ACSA 2C3NA 4O5RA 1VF3A 2ON7A 4RQRA 4YAPA 3VI7A 3LQ7A 4L5LA 2IMEA 4KAEA 3F4RA 4NHWA 4KGIA 2DLXA 1TXXA 2HRNA 1YY7A 2WS2A 5DJLA 3I69A 4HS1A 2YCDA 2VCZA 1H4OA 2WJUA 3LG6A 2LEGA 2IFQA 1O8WA 1XW6A 5HFKA 1TK0B 4JU5A 3CSIA 3WT1A 5DVBA 1YF1A 3QMXA 4FH8A 1EP7A 2YN1A 2FA4A 3UVHA 19GSA 2QKEA 3VI5A 1T8EB 2RUFA 2I4AA 1Y6EA 4FO5A 3FR3A 2NDOA 2TIRA 3ZREA 3TKSE 4PNGA 13GSA 2NPBA 3HYPA 5EY6A 3IPZA 2ZUPA 1V40A 4TR1A 4EF0A 3LSZA 2A4VA 2HZEB 5F8BA 5JCGA 1OE8A 1M99A 1A8YA 1I9DA 1PN9A 5CYYA 4O7HA 1IYIA 3ERWA 3J7Yb 1FVJA 1G0TA 1YEPA 3U6VA 3HHVA 3Q74A 1J0FA 3GHAA 1DSBA 1NM3A 2XHFA 3G7JA 1M2AA 3K8NA 5IO2A 2OACA 3FEUA 2FGXA 1SK1A 1ST9A 4KA0A 2LNSA 4G19A 2VD1A 4V1Ap 1TK5B 2C4JA 4IW9A 3TJGA 3HVVA 5LCZA 4TXOA 3TGZA 2LNTA 2GZPA 2GTUA 5ELGA 2YOIA 1AQXA 5CRHA 4HJMA 4NPBA 4JRRA 3BCIA 2VCXA 1HYUA 3F3RA 2L4QA 2F8FA 3PH9A 2MMZA 2DJ2A 2AAWA 2VCQA 4KX4A 5IMVA 2XPEA 3TJJA 1PKZA 1SKRB 2B3SA 2B1LA 3FYGA 1F3AA 2V1MA 1Z6NA 4L0UA 1WE0A 3D0ZA 4MLYA 2B5XA 1FVKA 1A2MA 4IQAA 4FYBA 1JZWA 1PL2A 3VWWA 1YKAA 1X9WB 2R5GA 1EEMA 22GSA 3GX8A 10GSA 2CV4A 4N10A 1K3YA 2GGTA 4ZL8A 1WOUA 2VUPA 2N5FA 1DE2A 2YWOA 2C80A 4FIWA 4MDCA 4OCFA 5HR1A 3EE2A 2CAIA 1U88A 2Z9SA 5ECOB 3QOUA 2VCWA 3GKNA 5DJMA 4POLA 2V6KA 1BQ7A 1Z3EA 4HZ4A 2FNOA 3RDWA 1LBKA 1JZDA 2X8GA 3VWVA 1GLPA 1GUKA 1A0FA 4I2TA 2H0HA 5D9XA 1FB0A 3RPNA 1E6BA 1A23A 1U3AA 1GTIA 4ULXA 5KN3A 4HUAA 3RBTA 4ZBDA 4MF6A 4MZCA 2XBIA 4MABA 2HXKA 3HVSA 4EXJA 1UC7A 1SENA 4BL7A 2JZSA 1QUWA 4OFNA 3ZL5A 1JZRA 3HY2A 2IIYA 5AIVA 2OJLA 2G2QA 3D6IA 4E8HA 7GSSA 1MEKA 5D96A 3UVTA 2F51A 3GV1A 3VPQA 4PUAA 1RW1A 3GKXA 2OE1A 3C71A 4QL9A 5KEJA 1ZCPA 2YWIA 3KIJA 3KJYA 2XPDA 2DIZA 1TRWA 3G7IA 2PVQA 1F3BA 5IMZA 4YAVA 3KGKA 4MK3A 4NMUA 4Q5NA 4J2FA 3IR4A 1XWKA 4J56E 1ZOFA 2EIRA 4HU7A 1TU7A 3E9JB 4LA1A 4XTSA 3TDGA 1Z7RA 4EO3A 4XS4B 3LFLA 2LJKA 4PQHA 1R7HA 1UVZA 4HU9A 1QMVA 3KEBA 1X9SB 1G7OA 2RUEA 2YJHA 2C0EA 3TUEA 1AQVA 1PA3A 3ZFLA 1XOBA 5CRGA 4GQFA 1FAAA 9GSSA 1W4VA 1X5CA 2CVBA 4X1UA 1GSEA 16GSA 2VL2C 1CQGA 5ECQB 3FZ5A 3VPTA 4IN0A 5B8AA 3PGTA 1K0OA 4GTUA 4N0ZA 5JCWA 1A2JA 5IMAA 4RQXA 5D9VA 1SK2A 3H4KA 1R4WA 1XOAA 3DGQA 4JE1A 3GNJA 5AISA 2FLSA 5ABRA 1PL1A 4X0XA 1EGRA 2YWMA 4ZB8A 5DCGA 2XC2A 3W6GA 2IWTA 2WDUA 4ZILA 3DIEA 1ZZYA 4MJAA 4H86A 3DVWA 2YPMA 3HZ4A 5B6MA 1GL8A 1MDKA 2YJ7A 17GSA 2I3YA 2LS5A 2P5QA 2DMMA 1ERWA 1HNAA 1N8JA 3CMIA 3N9JA 4CDOA 4IBPA 4WBRD 4IELA 1ML6A 2QC7A 4TW5A 3C1SA 1BEDA 1SL0B 2NVLA 2OE0A 2LKUA 2H74A 2IL3A 4IS0A 2V41A 2H0GA 4BA7A 6GSTA 1GULA 1XW5A 4O32A 3RAZA 4HDEA 1AQWA 2WGRA 1TRVA 3I9V2 1EZKA 1S3DA 2E2MA 1EEJA 1SJIA 3IK7A 4XS4A 3MSZA 2VCVA 1TJDA 3I43A 2HYXA 4OMVA 5INYA 2K8SA 5CNWA 3UMAA 5ELAA 6GSUA 1U3IA 3TRQA 3ERFA 4ECIA 4MCUA 5AGYA 3HJPA 3M8NA 4MJBA 1KBNA 2C3TA 2C0FA 5ECHB 4AJ7A 1AXDA 4G10A 4EL1A 4WR4A 5J9CA 1DUGA 4I97A 3J7Yk 4NHZA 1O81A 1TTZA 1A0RP 4TR3A 2AB6A 4KDYA 1G6WA 4TXVA 2MBTA 2K6VA 4D73B 3I6AA 3HCZA 4POBA 3GURA 1EGOA 1YJ6A 4N30A 3TB2A 1YEXA 3FRCA 4MF7A 2C0GA 1ZYQB 3GIXA 4L0WA 2YZUA 1HNBA 2HT9A 1PSQA 4ZBBA 4TOPA 1PMTA 3DWVA 1X5DA 2CVDA 4AJ8A 1M7TA 2ON5A 4XS6A 4G2EA 3ZIVA 5LD0A 2DJ0A 4OD7A 3WGDA 2VCTA 5JWOB 3GKKA 3LEFA 2GT6A 2L57A 2PVOC 3C1RA 3VURA 2DBCA 5A5KA 2H70A 1F2EA 5ECPB 3EINA 4JZQA 3QFAC 2L6CA 1XWBA 4GXZA 1PD21 1V57A 2PU9C 2FUG2 3ME8A 3RHCA 3GH9A 2WZ9A 1B8XA 5F07A 4KDXA 1BYEA 4V2MA 2AJQB 1QQ2A 2VL9A 4TKYA 4GLTA 1TRUA 2QSIA 3U5RE 2FD3A 3QAVA 2L4CA 4CW9A 2VL2A 3KM6A 4GF0A 1JLWA 3LXTA 1F37A 4WXTA 1SJZA 1O73A 1B48A 3M1GA 1SU9A 2K8VA 20GSA 2J9HA 4POMA 8GSSA 4DVCA 3EMXA 4MJCA 3ZFBA 1X5EA 2DJ3A 1A2LA 4D73A 2LQQA 2GT5A 5HR3A 1T4ZA 1GWCA 3A3TA 3M9KA 5J41A 5AN1A 3BD2A 4EKZA 3NIVA 4E8EA 4WEYA 3DYRA 4ZL7A 4K0GA 2MZCA 3BCKA 4XIHA 4NV5A 3SBCA 3QPMA 2H72A 3KH7A 1SJ6A 5H5SA 3GMFA 3MAKA 3IA1A 1I5GA 1T7PB 1ZYEA 3VFIA 3IBHA 4I6XA 4ML1A 3GRXA 4PQIA 5GSSA 1TI1A 4DEJA 3C73A 5ECSA 3LJRA 3UIWA 3APOA 1C72A 1K0BA 4PGTA 5ECLB 5G2ZA 2IMKA 1GSSA 3TRXA 1THOA 1FG4A 3F4SA 2N5BA 5C00A 4QL7A 1JZOA 4MPGA 3TKQA 3F6FA 2OBIA 2A2RA 1MDJA 4PNFA 1GNEA 5HQPA 5L71A 1FHEA 2WRTA 2FA8A 3BOAA 2HFDA 5CP1A 2F8AA 2KP1A 1MD3A 2JZRA 3M0FA 3P2AA 3CXGA 1R5AA 3A2VA 4JR6A 2PMTA 4N0VA 1OC9B 1HQOA 3TJBA 2R3XA 4V2LA 1K0MA 3ZITA 1GSUA 4KW6A 2C8UA 2LJAA 1TP9A 2E2GA 1JFUA 2H30A 2J23A 2H6YA 3LORA 1A8LA 1GTBA 4Q5RA 2DJJA 3GYKA 1K0AA 2PGTA 4HQZA 2NTOA 3P90A 3UBKA 3CTFA 2HZEA 3F8UA 1YZXA 1ZGNA 1R26A 5CREA 2GZZA 1B9YC 2G0FA 3ME7A 3FZ4A 4KB3A 2V32A 1XZOA 5DCHA 1GTUA 3L0HA 3ZIJA 1M9BA 2JACA 1LJRA 1YKCA 2FY6A 3BJ5A 3PINA 1XCCA 4KSOA 4MH3A 3DD3A 4ZB9A 2H8LA 1USBA 1GUHA 2DIYA 3KTLA 1J08A 5J5NA 2YANA 1T3BA 2LV3A 3LYKA 1T1VA 3Q18A 2JSZA 5C04A 3M3MA 6GSWA 1K0CA 4F0BA 4TR4A 3D4MA 5CAXA 2D2ZA 2P0GA 4MZWA 2GQMA 1X9MB 3P7XA 2YP6A 1MDIA 4MMMA 2H0IA 2IY2A 1BAYA 4MJEA 1SL1B 3FKFA 1OKDA 1XWCA 2I1UA 2FWHA 5ENUA 5HR2A 3ED3A 2A2SA 3EYTA 4IJ3A 4LL1B 3L9SA 1TK8B 3ZMKA 4ECBA 1U6TA 1G6YA 14GSA 2JZTA 3IK9A 1OC9A 4P3YB 5J4UA 2DJKA 1ZL9A 3CTGA 2GS3A 3O76A 1UA5A 3A5WA 3CSJA 3TOUA 3TCOA 4HJ2A 1B9XC 3CYNA 1YDKA 3HKRA 2MBSA 3ZRDA 3KMNA 3IAM2 4GRFA 2OADA 1NHYA 5ID2B 3HZ8A 2TRXA 1Z5YE 2H1BA 4MZBA 3Q6OA 4EUYA 3L9VA 1BJXA 5H5QA 3M9JA 3ZVJD 1XW9A 1TDIA 3LWAA 2BTOT 3L4NA 2VLUA 2H6ZA 2R6KA 1VRSD 4K7OA 3S9FA 1FOVA 4XRAA 2WFCA 2FHEA 5F05A 1AUCA 1GH2A 2RIIA 4JR4A 1GSFA 3EU4A 1K3OA 1SYXA 1FB6A 1V2AA 2HSYA 1PX7A 3DRNA 4DSQA 3ERGA 4F2IA 5G1LA 3CBUA 3NOFA 1XWGA 4XRDA 2IJYA 1SL2B 1Q4JA 2AV4A 4K2DA 2R2JA 5DAKB 3FR6A 2C3QA 1G7EA 2LTKA 2CX3A 3D22A 1TRSA 2F3MA 3F63A 1K3LA 4NV2A 4OWYA 2I81A 4MP4A 2GQKA 2KOKA 1EWXA 3Q19A 3H8QA 4LL4B 1Y25A 2XBQA 5J9BA 2V6OA 1E2YA 4PUFC 2IPAA 5G5FA 3H79A 2OBKA 2YZHA 1AC1A 1FO5A 4G9HA 1R5PA 3VWXA 3A2WA 1ABAA 4HI7A 2KP2A 5IMDA 5LNKe 3FHKA 3UOMA 3KCMA 2IN3A 5DDLA 4Q5QA 2E7PA 1XXUA 2B1KA 1JHBA 2K18A 4KE3A 1XVWA 3QAGA 5ID2A 1CQHA 3EC3A 1SKSB 3APQA 2VD0A 2AUVA 5JWRB 1K0NA 3VLNA 5JWQB 1WWJA 1QK8A 4V2NA 3D4TA 5GZZB 3IAS2 1B4QA 3HVXA 3UEMA 4JBBA 3VK9A 1OYJA 3TJKA 3E0UA 4DSRA 3GFKA 5DALB 4K7IA 1V9WA 2DJ1A 1PRXA 3DEXA 4N11A 3W8JA 1F9MA 4HEA2 2YV7A 4KUNA 5COHA 3TKPA 4TR1B 1EV4A 1TU8A 4EVMA 3US3A 3GX0A 4GWRA 5IPHA 3IHQA 2MMNA 1QFNA 2GLRA 5E4WA 1SD9A 2IYJA 5KN1A 5J3RA 5DAKA 2N5AA 1X0RA 2B7KA 3EURA 5JCUA 3QDNA 4KNDA 2HRFA 5CRDA 5IOWA 4RUVA 3R2QA 2VM2A 1MD4A 4ZB6A 3HXSA 2EC4A 3ISOA 5B6NA 4OFMA 2P31A 3C8EA 1UN2A 2GDRA 2C1YA 3UBLA 3DVXA 1SYRA 5HFGA 2VIMA 3UARA 1AAZA 1HNCA 2LSTA 5KN0A 1KEBA 2VL3A 1M2DA 4Q5FA 4TXOB 3A2XA 4GSNA 4ZL9A 1GRXA 3KP8A 3GH6A 2CZ2A 3EU3A 2NBSA 2K9FA 4AJ6A 2ES7A 2PWJA 1WRYA 3F4TA 4NWYA 6GSXA 2VLVA 2CX4A 1SD8A 1MTCA 1GTAA 5B8BA 2ALBA 3ZTLA 1O8XA 1A24A 2VM1A 4WBJA 2TRCP 2BJXA 4WF4A 2H1DA 4F82A 1M2BA 1M0UA 1ERVA 2KHPA 2KLXA 2EIQA 5DALA 6GSYA 2WB9A 4ZXGA 3TRPA 1RK4A 2FCHA 2FWEA 2ZCTA 5ECNB 1DBYA 5G5EA 3HDCA 3EMPA 3LGCA 3MNGA 3AY8A 3IC4A 4OO5A 1TW9A 5A4VA 3EVIA 1HD2A 1PGTA 3DMLA 4KCAA 3UL3A 5D9WA 5B7CA 2H19A 5D73A 2GZYA 4IHUA 3GTUB 2P5RA 1O6JA 2O89A 5HR0A 4KH7A 3IRAA 2X64A 1NW2A 5GAPD 1KTEA 1QXHA 3TJFA 1EP8A 4TR0A 2LRTA 1OAZA 4IQ1A 2JSYA 1XBSA 4WETA 2LRNA 3KD0A 3WGEA 2X8HA 5FWGA 1NHOA 4YH2A 4BVYA 1J9BA 5KN2A 4ML6A 4ZBAA 4NAXA 2L5LA 3F9UA 2WCIA 2FWGA 2IMFA 3FR9A 1Z6MA 11GSA 4LLRA 4EE0A 1EOGA 2R4VA 4EDZA 1AIUA 2MMAA 3LYPA 3UAPA 3FK8A 4I5QA 4RI7A 5EL8A 3GKMA 4KDUA 4OCEA 4YQUA 2HZFA 1URMA 2B6MA 1B4PA 1YF0A 2X99A 2L5OA 5CO3A 2H66A 2JADA 2WULA 4OO4A 1ERUA 5ECMB 1O85A
chains in the Genus database with same CATH superfamily
5G31A 1FGMA 1ZX2A 4HZ2A 3TKSC 5E59A 4KSMA 3FLJA 4XS1A 2O85A 5EPFA 1MNLA 7GSPA 1IYHA 1S3CA 5G1KA 2PBJA 3CRUA 4K9ZA 4L8EA 3MWZA 3P8WA 4LMVA 4I2UA 1SKWB 1VF4A 1YHQ3 4GB5A 2RM6A 1Y4KA 1J2BA 3ZFZA 4G0LA 5A4WA 3F6DA 4U13A 1PX6A 2E2UA 1PKWA 5IMCA 4AGSA 2W9QA 3EPTA 1ZYPA 3GUSA 5IIZA 1H75A 4WR5A 3UJ1A 4N3VA 4OVMA 5KP3A 1GS3A 1V98A 1VQP3 2KF5A 1GSYA 1MWTA 2GSTA 1O7PB 2GVPA 2RLIA 2RM5A 4XCSA 2YNXA 1VF1A 1M9AA 3PGBA 4F9ZA 1LU4A 3GTUA 1GUMA 3QCPA 1AQZA 1EA2A 5CXOA 1BX9A 4ID0A 2CK3H 4ZIJA 4I8BA 1SIIA 4IGJA 4FYCA 1TOFA 5DQSA 1UCKA 4PX1A 1RSNA 1I2GA 3OR5A 3CU3A 4J5GA 3FZ9A 5IM9A 3KE7A 4TVEA 2UUGC 1GSQA 1W01A 5IG4A 1EV9A 2GSRA 4PTSA 4WF5A 1US1A 2M72A 3CSHA 2M7OA 5CF1A 1HKXA 5IMFA 2GSQA 2ZNMA 4EDYA 3DXBA 4V1Ag 2ML5A 2PN8A 3O6TA 3UNLA 1YVBI 1GD4A 2M46A 18GSA 4ECCA 1GMRA 2J8XB 2V1LA 4K7NA 4F0CA 1VQ63 1U87A 4MEIA 1ZS7A 4K90B 1IVUA 3O3TA 3W8SA 1RGAA 2OA7A 3F8HA 2JU5A 1RKYA 4K6XA 4K8MA 2HLSA 5D93A 1WTHA 3ZLPA 4X2OA 1EKMA 2CA8A 1BG5A 4HM6B 1XVQA 3EB8A 4WKWA 1QGVA 4EC0A 2IMDA 2QA1A 4IP6A 2IUKA 3GWRA 3KXOA 1IT8A 2PERA 2LQOA 2P0XA 4MH2A 4HSCX 4KT3B 3KZQA 3GL5A 1YIJ3 4MA9A 5A4UA 5H5RA 1GSDA 3NV0B 4HQSA 1QALA 3CRTA 3AHWA 5GSPA 3TKRA 1GP1A 12GSA 2QIYA 2MYGA 3PR8A 3AMOA 2HRAA 1I0VA 2V2GA 4HVNA 1DE3A 1B27A 1OE7A 5CRWA 5ECIB 5F0GA 3VWUA 4HOJA 1K41A 5F06A 5GAND 1YGEA 2CVKA 2H75A 3BNEA 3F14A 3SWLA 3V99A 3EC9A 1L5GB 1I8VA 3GAXA 4LZIA 1QVG2 3N5OA 2B5YA 1K734 4KCEA 4K1FA 2LJRA 2H1GA 3GSTA 4IIAA 3F3QA 3HI7A 1BNGA 3TOTA 1YQ1A 2WGOA 1MOLA 1BRSA 1S3AA 2CAQA 2DC5A 3GL3A 1WP0A 2ZL8A 2HE3A 2XR8B 4O92A 4POKA 3X40A 3IXRA 5IPGA 1BOXA 5GSTA 2BIRA 3KH9A 2I9HA 3KMOA 4PURA 3CCE3 1W02A 2VO4A 3JUNA 4AF2A 2HNLA 1AVKA 3PCRA 5G30A 1U5OA 4K0NA 3WA3A 5IO0A 3QFBC 3WYWA 3F0IA 2PPTA 5AIIA 2STDA 1ILOA 3IE3A 4GCIA 3MWHA 4L5OA 1ROAA 5AYSC 2AYTA 2H1AA 4JF8A 6RNTA 1UI8A 3ER7A 4XBXA 5ECRB 1D6ZA 2H6XA 4IKHA 2IMIA 4GQCA 3QR6A 4JEDA 1BNIA 1K9M4 1Q98A 2O87A 2X8CA 2GQLA 3H1NA 2H71A 1Z9HA 3IDVA 4GSTA 6GSVA 2H76A 1B2ZA 3GN3A 3WT2A 1TKDB 1YJW3 2LYXA 1VQO3 3MDKA 1Q42A 4YQVA 3X3YA 1V58A 4LMWA 4MF5A 3CCU3 1BNSA 1T00A 3FY7A 2F9SA 3KTBA 1KNGA 4K1UA 5HGRA 3ZYWA 4F03A 4RI6A 1BU4A 1FYSA 1JNQA 2K3DA 4QQ7A 1WIKA 1WPIA 3NQZA 5IG5A 4DSSB 2OKAA 3K5TA 2REMA 1W2B2 5DBQA 3CCL3 4BVXB 2OOVC 2L6DA 1BGSA 2VOCA 2CZ3A 3EWLA 3IOSA 3FW2A 2AADA 2C0DA 1RGEA 2EIOA 2XF3A 1OC3A 4YKGA 2YV9A 2XFTA 4BPYA 5AIXA 3FG1A 1ACVA 1W89A 3HD5A 1XWAA 5BRTA 1A67A 2FWFA 1SK0A 2HI7A 3NBJA 5FT3A 1NU3A 4FMDA 2B5EA 3WGXA 3MYDA 5IQYA 3NV0A 4AKYA 3WODG 5IEPA 5ECKB 2H01A 2D42A 3ZZXA 3L0RA 4L7KA 1VQ53 1XIYA 1THXA 1AW9A 3TKSA 4LYLB 3L9UA 2K54A 4RNYA 4X43A 1XFLA 3HJOA 1EOHA 4BWSA 5AEWB 2R37A 4YQMA 1VQL3 1WJKA 1RN7A 2KUCA 2PUKC 4O3VA 2BMXA 2CQ9A 5D9TA 4XDWA 5FW5A 2RBIA 3DKSA 4Z2TA 1OVNA 4BTXA 3DH2A 1F6MC 4MPFA 2P0MA 2OE3A 5DRVA 1TU5A 2Z77A 2R0CA 4A5PA 3L78A 4PXOA 4CHSA 2YWNA 3HA9A 3G9BA 2IFQB 5D8IA 3MHEA 2LUSA 1GNWA 3BBYA 1TIJA 1O7UA 4X2HA 2CT6A 3H51A 2LRCA 3ZVJA 1FW1A 3H3HA 1W6GA 1K0DA 1RQMA 4NXIA 3ZMLA 2OCTA 1BRIA 3FZAA 5DREA 3NUVA 2GSSA 2E0QA 1VF2A 3WMDA 3D21A 4PQ1A 2L59A 4ECJA 3EE1A 3V1WA 1JB4A 3LMLA 3RHBA 1T4YA 1TI3A 1N2AA 2A2PA 3F7XA 3LXZA 2YFIB 3H93A 2DMLA 2XGNA 1OKTA 2MMOA 1HYFA 5DQYA 3NHXA 4TN8A 2VAFA 1LNIA 6GSSA 3HJMA 1Z7PA 5IERA 1PQNA 2VLTA 3G7YA 1B21A 5EVOA 3QD9A 1PYLA 1JLVA 4Q53A 3CCR3 4IPBA 3GSSA 3KP9A 4IVFA 4FYUA 2FNQA 3DXOA 1IT7A 4TRXA 4Z7XA 1VGLA 1BRHA 2M80A 2O7KA 2O8VB 4BWQA 1OPYA 1XPVA 4J57E 3NZNA 4N6LA 2H73A 1JJ22 4I4KA 1TFOA 2BT3A 1RGHA 1QAFA 1NSWA 4R9LA 1ZMAA 4DSSA 1GLQA 3D5JA 2AHEA 3NQYA 1WMJA 4BVXA 1IYYA 1OC8A 2DSAA 3E3EA 2KRTA 3WD6A 4CDLA 2L1SA 2QGVA 2HMNB 3IV4A 4ILFA 2B7JA 3V92A 1ERTA 3C7MA 3B8LA 1XG8A 2JL4A 4IJIA 4OFTA 1YVSA 2PNCA 5IOXA 3QAWA 4IP1A 3OWSA 4GSSA 3RPPA 2HSHA 3Q90A 4XHMA 1ON4A 3JCML 3WHOA 1GY5A 4FCMA 5FHIA 5HFIA 3APSA 1SIHA 1IQXA 3UJMA 2QEX3 3GA4A 4ISDA 1DE1A 4ACSA 2C3NA 3LXUX 4O5RA 3IMAB 1VF3A 1E97A 2ON7A 4RQRA 4YAPA 3VI7A 3LQ7A 4L5LA 2IMEA 4KAEA 5JPPA 3SOYA 3OV4A 1W4NA 2OQEC 4XM4A 3F4RA 3A5EA 4NHWA 4KGIA 5ELUA 2DLXA 4EXRA 1TXXA 4RZMA 3T8UA 1N5PA 2HRNA 1YY7A 2WS2A 5DJLA 3I69A 3CXC2 4HS1A 3SYUA 2VCZA 2YCDA 1H4OA 2WJUA 3LG6A 1BSEA 2LEGA 1T2HA 1AVLA 2HMLB 2IFQA 1BNEA 3X3XA 1O8WA 1XW6A 5HFKA 1TK0B 4JU5A 3CSIA 1LVNA 3WT1A 4HM8B 7STDA 5DVBA 1N8QA 1QJGA 3KN4A 1YF1A 3QMXA 4FH8A 1EP7A 3DM8A 2YN1A 2FA4A 3UVHA 1OUNA 19GSA 1JKGB 3BB9A 4ICYA 2QKEA 1VZZA 2X49A 3EQQB 3J7Yd 1Q7HA 3VI5A 1T8EB 1LOVA 2RUFA 3BNBA 2I4AA 1Y6EA 3FG4A 3ECFA 3S27A 4FO5A 3AGOA 2F5MA 3FR3A 2NDOA 2TIRA 3F9SA 3ZREA 3TKSE 4PNGA 13GSA 1UGHI 2NPBA 3HYPA 5CK6A 5EY6A 1T2IA 3IPZA 4N6NB 2ZUPA 1V40A 4TR1A 4FMAA 1FW7A 3SVAA 4EF0A 4WYKB 1O7NB 3LSZA 2A4VA 2HZEB 1IV7A 5F8BA 3RDEA 1W2ZA 5JCGA 3S67A 1KQS2 1OE8A 2OOVA 1M99A 2JDIH 1FGOA 3GRDA 3RGAA 1C54A 3LZAA 1A8YA 2F99A 1I9DA 1PN9A 5CYYA 5D82A 2WOHA 4FCJA 4O7HA 1IYIA 3N9HA 3ERWA 3J7Yb 1FVJA 1G0TA 1ZO2A 3EN1B 1YEPA 2PZVA 3U6VA 3HHVA 3WA2X 2Y74A 3Q74A 1J0FA 3GHAA 1DSBA 4EBGA 1NM3A 2XHFA 3G7JA 3B7CA 1M2AA 2BNGA 1VQ73 4K2XA 2A4HA 3K8NA 5IO2A 2OACA 3Q1CA 3BNCA 2UZ8A 4J8TA 3S29A 3FEUA 2FGXA 4KFEA 1SK1A 1ST9A 4KA0A 1NDOB 3LW9A 2P38A 2LNSA 4IT7A 3CCQ3 4G19A 1FGRA 3B4PA 2GBWB 4BTWA 2VD1A 4V1Ap 2CH9A 2CG0A 1WMNA 1TRPA 1X1WA 1TK5B 2C4JA 4IW9A 3TJGA 3HVVA 5LCZA 4TXOA 3TGZA 1VQK3 1JB5A 2LNTA 2KCDA 2GZPA 2MC8A 2GTUA 2KAAA 5ELGA 2YOIA 4XBTA 1IU7A 3MPHA 1GMPA 2GU1A 1AQXA 3JUOA 4BL7B 5CRHA 1KC84 4R9KA 4HJMA 1CYVA 2IMJA 4NPBA 4JRRA 2GSPA 3BCIA 2VCXA 1HYUA 3F3RA 2L4QA 2F8FA 3PH9A 4WHAA 2MMZA 1JBTA 1E3RA 3FGYA 2DJ2A 5AIFA 2QGUA 2AAWA 2CFWA 1B2UA 2VCQA 4KX4A 3K7CA 3MG1A 5IMVA 1ROVA 2XPEA 1JKGA 3TJJA 1PKZA 4NHFA 1SKRB 3HX8A 2B3SA 2MF7A 1GYBA 2B1XB 2B1LA 2XGLA 3FYGA 4HOHA 5KOWA 4O02B 1F3AA 2V1MA 1Q9EA 1I2FA 1Z6NA 4L0UA 1WE0A 3D0ZA 4MLYA 1V74A 2B5XA 3Q3FA 4G1MB 3JVCA 1FVKA 1A2MA 4IQAA 1PFPA 4FYBA 1JZWA 3IC8A 1UGIA 2W9PA 3T8NA 4WYKA 1PL2A 5TGNA 3VWWA 2INXA 1YKAA 4G0KA 1NNVA 1X9WB 2R5GA 2R4IA 3MG3A 1EEMA 3RGRA 22GSA 3GX8A 10GSA 4O5UA 2ZHXB 2QA2A 2CV4A 2ML6A 4N10A 1K3YA 2GGTA 4ZL8A 3FH1A 1WOUA 1R4CA 2VUPA 3LTCA 2N5FA 3DUKA 3F7SA 2CWUA 1DE2A 2YWOA 2C80A 2XSOB 1RGCA 4FIWA 4MDCA 4OCFA 4X4JA 5HR1A 3EE2A 3I563 1AR0A 4HJLB 2CAIA 2F5WA 1U88A 1FUTA 1ZYNA 2Z9SA 5ECOB 3QOUA 2VCWA 3DGMA 3GKNA 5DJMA 1GSPA 4POLA 2V6KA 4MNNA 3V98A 1BQ7A 1OF5A 5KP1A 1F8NA 2Y73A 1Z3EA 1I2EA 1STDA 1SARA 1BVIA 4KFDA 4HZ4A 2FNOA 3RDWA 1LBKA 1JZDA 2X8GA 2OQEA 3VWVA 4OK0A 3EF8A 1GLPA 1GUKA 3OXAA 4EW5A 1A0FA 4I2TA 2H0HA 5D9XA 1FB0A 1DMMA 1JB2A 5IW9A 3RPNA 1E6BA 1BRJA 1I70A 1A23A 1RDSA 1U3AA 1GTIA 4ULXA 5KN3A 4HUAA 3RBTA 4ZBDA 4MF6A 4MZCA 2XBIA 4MABA 3STDA 2HXKA 3HVSA 4EXJA 1UC7A 1SENA 1YI23 1AY7A 4BL7A 2JZSA 2OTJ3 1QUWA 4OFNA 3ZL5A 1LQMB 2WGQA 1JZRA 3HY2A 6GSPA 2IIYA 5AIVA 3D5IA 2OJLA 2G2QA 1BUJA 1TUHA 3D6IA 4E8HA 7GSSA 1RGFA 1MEKA 5D96A 2RNTA 1FUSA 3UVTA 2F51A 3GV1A 3VPQA 4PUAA 3GZRA 3FF2A 1RW1A 1BRGA 3GKXA 3ROBA 2OE1A 3C71A 4QL9A 3CC23 4HZBB 5KEJA 1ZCPA 1VQM3 2YWIA 3KIJA 3KJYA 4ORLA 2XPDA 2GEXA 2C10A 2DIZA 3CC43 4FMCA 1TRWA 3G7IA 2PVQA 1F3BA 5IMZA 4YAVA 3KGKA 4MK3A 4BIKA 4NMUA 4Q5NA 4J2FA 3IR4A 3BU4A 1XWKA 4J56E 4MMZB 1ZOFA 2EIRA 1PU4A 4HU7A 1GOUA 1CYUA 1TU7A 2XRXB 3E9JB 4LA1A 4XTSA 3TDGA 1JN5B 1BUQA 3QRDA 1Z7RA 4EO3A 4XS4B 3LFLA 2LJKA 1TRQA 4PQHA 1I3FA 1R7HA 1UVZA 2ZA4A 4HU9A 1QMVA 3KEBA 1X9SB 2BO9B 2HMJB 1RJOA 1G7OA 2RUEA 1PFOA 2YJHA 3LTDA 2C0EA 3TUEA 1AQVA 4GHOA 1PA3A 1XOBA 5CRGA 3ZFLA 4GQFA 1OHPA 1FAAA 9GSSA 1W4VA 1X5CA 2CVBA 3ALAA 4HM3B 1GSEA 16GSA 4X1UA 3VF1A 4HZ9B 2VL2C 4EV2A 1CQGA 4N6V0 5ECQB 3FZ5A 5AIGA 3VPTA 1BIRA 4IN0A 5B8AA 3PGTA 2F86B 1K0OA 2CHCA 4GTUA 4N0ZA 5JCWA 1A2JA 5IMAA 4RQXA 1S723 1U8CB 1BNJA 5D9VA 1SK2A 3H4KA 1R4WA 1XOAA 3DGQA 4JE1A 3GNJA 5AISA 2FLSA 5ABRA 1JRQA 1LOWA 3HK4A 1PL1A 4X0XA 1EGRA 2YWMA 1X1UA 4ZB8A 1Q40B 1RCLA 5DCGA 1B2SA 2CG1A 4EIQA 2XC2A 3W6GA 2IWTA 2WDUA 4ZILA 3DIEA 1ZZYA 1TP6A 4MJAA 1KSIA 4GL6A 1Z1SA 1A90A 4H86A 7RNTA 3DVWA 2YPMA 3HZ4A 5B6MA 1GL8A 1UCJA 3DGOA 1MDKA 2YJ7A 17GSA 5IG0A 2I3YA 1IK3A 3NX0A 1ULIB 3BLZA 2LS5A 2P5QA 2DMMA 1ERWA 1HNAA 1N8JA 3CMIA 3N9JA 4CDOA 4IBPA 4WBRD 4IELA 1ML6A 3CCM3 2QC7A 4TW5A 3C1SA 1BEDA 4AEQA 1SL0B 2RGQA 2F56A 2HSMA 2NVLA 2OE0A 4CY8A 4QWTA 2LKUA 2W04A 3GZXB 4HM7B 2GBXB 9RNTA 3F40A 1QMAA 2H74A 5EVHA 2IL3A 4IS0A 4OUQA 2V41A 2H0GA 4BA7A 1JV2B 6GSTA 3B4OA 1GULA 1XW5A 4O32A 1M904 3RAZA 4HDEA 1AQWA 2WGRA 1TRVA 3I9V2 1EZKA 2F4YA 1S3DA 2E2MA 2BMRB 1EEJA 1JN5A 1N9EA 1SJIA 3LTBA 3IK7A 2A15A 4XS4A 3MSZA 2VCVA 1TJDA 1G02A 3HZPA 2HYXA 3I43A 4H3UA 4LMIA 3SEDA 4OMVA 1E3VA 5INYA 2K8SA 5CNWA 2FXTA 3UMAA 5ELAA 6GSUA 1U3IA 3TRQA 4RBNA 1RCKA 2AAEA 3ERFA 4ECIA 1OACA 4MCUA 1NB3I 5AGYA 3HJPA 3M8NA 4MJBA 1YJ93 1KBNA 2C3TA 1IQ8A 2C0FA 3EX9A 5ECHB 4AJ7A 1AXDA 4G10A 4EL1A 4WR4A 5J9CA 1DUGA 4I97A 3J7Yk 4NHZA 1O81A 3CCJ3 1TTZA 4RNTA 1EUIC 1A0RP 4TR3A 2AB6A 2JQ5A 1YNVX 4KDYA 1UUVB 1G6WA 4TXVA 2MBTA 2L4VA 2K6VA 2P05A 5CLKA 3I6AA 4D73B 3HCZA 4POBA 3S5CA 2CX1A 3GURA 1BNFA 1EGOA 1YJ6A 4N30A 2DKHA 3TB2A 1YEXA 2UGIA 3FRCA 4MF7A 2C0GA 1ZYQB 1Q40A 1DMNA 3GIXA 3FKAA 4L0WA 2YZUA 1HNBA 1O7MB 2HT9A 5AYRB 1PSQA 4ZBBA 4TOPA 1PMTA 4PEJA 1VQ93 1RRHA 5KP4A 3DWVA 2SBLA 1FGQA 1X5DA 2CVDA 4AJ8A 3D4AA 3G713 4CCVA 1M7TA 2ON5A 4XS6A 3WDGB 4G2EA 3ZIVA 5EEOA 5LD0A 2DJ0A 4OD7A 3WGDA 1OHSA 1ASKA 2VCTA 3SLUA 5JWOB 1FOHA 1NJI4 6STDA 3GKKA 3LEFA 2KF4A 3WR2A 5I97A 2GT6A 1W00A 2BMQB 2L57A 1W6YA 2XSHB 2PVOC 3C1RA 3VURA 2DBCA 5A5KA 5AI1A 1WNHA 2H70A 1F2EA 4LGQA 5ECPB 3EINA 5KOXA 1CH0A 4JZQA 3QFAC 2L6CA 1XWBA 4GXZA 1PD21 1V57A 4BVYB 2PU9C 4J9AA 2FUG2 3ME8A 3RHCA 3GH9A 1MWRA 2WZ9A 1B8XA 5F07A 1W7CA 4KDXA 1DVDA 1A2PA 1BYEA 4V2MA 2AJQB 3VGNA 2IA7A 1QQ2A 2VL9A 1N9JA 4TKYA 4GLTA 1TRUA 2QSIA 2GEYA 2WO0A 3U5RE 1HZ1A 2XH9A 2C11A 2FD3A 3QAVA 2L4CA 4CW9A 2VL2A 1VQ43 3KM6A 3WOFB 4GF0A 1JLWA 3LXTA 1M3IA 1F37A 1DYUA 4HKVB 1SQWA 3UB1A 4WXTA 1SJZA 4L8PA 1O73A 1B48A 3KSPA 3M1GA 4KZ1A 4HM0B 1SU9A 4N6TA 2K8VA 2YFJB 20GSA 2J9HA 3CPOA 4POMA 8GSSA 4DVCA 3EMXA 4MJCA 3ZFBA 1X5EA 2DJ3A 1A2LA 4D73A 2LQQA 5IF6A 2GT5A 5HR3A 2XEPA 3UL6A 3NXJA 1T4ZA 1GWCA 5LC7A 1QAKA 3A3TA 3M9KA 1B20A 1MWUA 5J41A 5AN1A 3BD2A 4EKZA 3NIVA 4FR9A 5IEOA 4E8EA 1ULJB 4WEYA 3DYRA 2K0MA 1ISKA 1FUWA 1T5YA 4ZL7A 4K0GA 2MZCA 3BCKA 4XIHA 4NV5A 3SBCA 2GU3A 3QPMA 2H72A 3KCHA 3T0UA 3KH7A 2LQVA 3G0KA 1SJ6A 5H5SA 2R0GA 3GMFA 4TX4A 3WOEB 3MAKA 3IA1A 1M1K4 1I5GA 1T7PB 2ZDJA 1EQKA 3MKIA 1ZYEA 3VFIA 2P09A 1UUWB 3G8ZA 3IBHA 4I6XA 4ML1A 3GRXA 4PQIA 5GSSA 1M1XB 1TI1A 4DEJA 3KIIA 3C73A 5ECSA 1I3IA 3CMA3 3LJRA 3X42A 2CFLA 3UIWA 3APOA 1C72A 1K0BA 4PGTA 5M19A 5ECLB 5G2ZA 3DGLA 2IMKA 1GSSA 3TRXA 2Z76A 3D3LA 1THOA 1FG4A 3F4SA 2N5BA 5C00A 4QL7A 1JZOA 4MPGA 1B2XA 3TKQA 3F6FA 2I9WA 3GSPA 2OBIA 3MYTA 3CCV3 1W6CA 2A2RA 1MDJA 4PNFA 3OX9A 1GNEA 5HQPA 5L71A 1HU9A 3CQFA 1FHEA 1FGTA 4BTYA 2WRTA 2FA8A 1M9GA 1GOVA 2HFDA 3Q2PA 3BOAA 2Z6BA 2R0PA 5CP1A 3X41A 2F8AA 2KP1A 5RNTA 3M8CA 1MD3A 4KF9A 2JZRA 3M0FA 3P2AA 1LOXA 3CXGA 4XBYA 4HAAA 4CY6A 1R5AA 1Q814 3A2VA 4MJDA 4JR6A 2PMTA 4N0VA 4FMBA 3OWYA 1OC9B 1HQOA 3TJBA 2R3XA 4V2LA 1K0MA 3ZITA 1GSUA 4EIPA 4KW6A 2C8UA 2LJAA 1TP9A 2E2GA 1JFUA 2H30A 2J23A 2H6YA 3LORA 1A8LA 1GTBA 4Q5RA 2DJJA 1KWIA 3GYKA 1K0AA 2PGTA 3MG2A 4HQZA 2NTOA 3P90A 3UBKA 4EC6A 3CTFA 2BHMA 2HZEA 3F8UA 1YZXA 1ZGNA 4O2HA 3PZWA 1R26A 4Z2RA 4MMYB 5CREA 2GZZA 1B9YC 4BL2A 5ECMB 2G0FA 3ME7A 3FZ4A 5AEUB 4KB3A 2V32A 3JUQA 1XZOA 5DCHA 1GTUA 3L0HA 3ZIJA 1M9BA 2JACA 3N8BA 1LJRA 1YKCA 2HOHA 2FY6A 3BJ5A 3PCSA 2HMKB 1XCCA 3PINA 4KSOA 4MH3A 3DD3A 4ZB9A 2H8LA 1RTUA 1USBA 1GUHA 3D79A 2DIYA 1LOYA 3KTLA 1J08A 5J5NA 5BMUA 2YANA 1T3BA 1DMQA 3PS8A 2LV3A 2IUJA 3LYKA 1T1VA 4K1VA 2CFGA 3Q18A 4Z2UA 1BSDA 2JSZA 3CME3 5C04A 4K61A 1IVXA 3KSED 3M3MA 6GSWA 1K0CA 4F0BA 1RGGA 2SARA 1Q864 3D4MA 4TR4A 3K0ZA 5CAXA 2D2ZA 1RGKA 2P0GA 4MMXB 4MZWA 2GQMA 1X9MB 2R41A 1O7GB 3P7XA 2X4AA 2YP6A 1O7WB 1MDIA 5BVBA 4HM4B 4GSPA 4MMMA 2H0IA 2IY2A 2RFRA 1BAYA 4MJEA 1SL1B 4WWUC 3FKFA 2CX0A 2HMMB 5D81A 1OKDA 4WFOA 1XWCA 1RN4A 2I1UA 1VQ83 2FWHA 5ENUA 5HR2A 3ED3A 4N6UA 2A2SA 3EYTA 4IJ3A 4LL1B 3L9SA 3QK9A 1Q824 1TK8B 1W5ZA 3ZMKA 3IPTA 4ECBA 2CFDA 1U6TA 1O7HB 3NM2A 4CJNA 1G6YA 14GSA 1UCIA 1G96A 2JZTA 1BAOA 3IK9A 1OC9A 4P3YB 5J4UA 1DVCA 2DJKA 3NBRA 2DKIA 1BRNL 5M1AA 3JUPA 3SX1A 1MGWA 1ZL9A 2GXFA 1N5HA 1STFI 1R4YA 4USSA 3CTGA 1N8R4 2GS3A 3LOYA 3U1WA 5FGOA 3O76A 1UA5A 3CNXA 3CNMA 3A5WA 4BIRA 2C4BA 1EG9B 3CSJA 3TOUA 3EBTA 3TCOA 4HJ2A 2QA43 1B9XC 3CYNA 4HM1B 5BXQA 1YDKA 1Q7Y4 3HKRA 2MBSA 3ZRDA 1IDPA 2HMOB 1C7HA 3KMNA 3IAM2 1NB5I 5D83A 4GRFA 1B3SA 1UW1A 4ZM8A 2OADA 1NHYA 5ID2B 4YKFA 3CCS3 3HZ8A 2TRXA 1Z5YE 2H1BA 4MZBA 3DMCA 3Q6OA 2KXGA 3FCSB 4EUYA 3L9VA 1BJXA 5H5QA 4EYCA 2KF6A 2CW9A 3M9JA 3G4S3 3ZVJD 1PY3A 4RNZA 1XW9A 3GZYB 1TDIA 3LWAA 1GY6A 2BTOT 3L4NA 2VLUA 4K5RA 3K9MC 2H6ZA 2R6KA 2W03A 3VSYA 2YFLB 3G16A 1VRSD 4K7OA 3S9FA 1FOVA 4XRAA 2WFCA 2FHEA 1OCVA 3DGNA 5F05A 3HIIA 1GOYA 2F98A 1AUCA 2CC3A 1GH2A 2RIIA 4JR4A 1GSFA 2CKFB 3EU4A 1K3OA 1SYXA 1FB6A 1B2MA 1V2AA 2HSYA 3D5GA 1RNBA 1PX7A 1YJN3 3DRNA 3I553 4DSQA 3IHGA 3ERGA 4F2IA 5G1LA 3CBUA 3NOFA 1XWGA 4XRDA 1S5AA 2IJYA 3OWUA 1OGZA 1BANA 1OHOA 3HIGA 1SL2B 1Q4JA 2AV4A 4K2DA 2R2JA 5DAKB 1BRKA 3FR6A 2C3QA 1G7EA 1TFKA 2LTKA 2CX3A 3D22A 1TTOA 1TRSA 3JUMA 3EJVA 1GY7A 1K3LA 2F3MA 3F63A 1FZUA 4NV2A 4OWYA 2I81A 4MP4A 2GQKA 2KOKA 2BU4A 2W0QA 1EWXA 3AGNA 1M3JA 2CWVA 3Q19A 1SPUA 4R80A 2BMOB 1IVWA 3H8QA 4LL4B 1Y25A 1JBSA 2XBQA 5J9BA 4CPKA 2V6OA 1E2YA 4PUFC 2IPAA 2Q07A 5G5FA 8CHOA 3H79A 2OBKA 2YZHA 1AC1A 1FO5A 1BSAA 3UL5A 1R5PA 4G9HA 1VQQA 3VWXA 3A2WA 1ABAA 4HI7A 2KP2A 3PPUA 5IMDA 4K5SA 5LNKe 3FHKA 3UOMA 3KCMA 2IN3A 5DDLA 4Q5QA 2E7PA 1XXUA 2CFKA 2B1KA 1JHBA 2K18A 3LTAA 4KE3A 1XVWA 3D9RA 1JBRA 1D6UA 3QAGA 5ID2A 1CQHA 3EC3A 5BU4A 1SKSB 3APQA 2VD0A 1LXEA 3O8YA 4AKZA 2AUVA 5JWRB 1K0NA 3VLNA 5JWQB 4JRFA 3KZTA 3A5IA 2UX0A 1WWJA 3DZLA 5M18A 1QK8A 1RN1A 1BNRA 4V2NA 3D4TA 1UI7A 5GZZB 5G2GA 1RMSA 3I0YA 3IAS2 1K28A 1B4QA 3HVXA 3UEMA 4JBBA 3VK9A 3LH4A 1OYJA 3E99A 3TJKA 1OGXA 3E0UA 4DSRA 3GFKA 5DALB 3FMWA 4K7IA 2W2CA 1V9WA 2DJ1A 1PRXA 1YGWA 4KVHA 3DEXA 4FCZA 5BIRA 4KFFA 2E2VA 4N11A 3W8JA 1F9MA 4HEA2 3R3EA 5A0OB 4STDA 3K63A 2XFSA 4HM5B 2YV7A 4KUNA 3HOHA 5ELJA 5COHA 4H61A 3FZWA 3TKPA 4TR1B 1CQSA 1EV4A 1TU8A 1NO3A 4EVMA 3MIXA 3BNDA 3US3A 3GX0A 4GWRA 5IPHA 3IHQA 2MMNA 1QFNA 2GLRA 5E4WA 1SD9A 2IYJA 5KN1A 1GMQA 5J3RA 3LYGA 5DAKA 2N5AA 2CWTA 3LT9A 3EN8A 5JBSA 1X0RA 1ZGXA 1AV4A 4O8SA 2B7KA 1NWWA 3EURA 5JCUA 3CD63 3QDNA 1RNTA 3PYJA 4KNDA 1WMPA 2HRFA 5CRDA 5IOWA 4RUVA 3R2QA 3DY5A 2FGTA 4HBRA 2VM2A 1MD4A 2RSXA 4BL3A 4ZB6A 3HXSA 4L8OA 2EC4A 2O9UX 3ISOA 1VQN3 1UUGB 5B6NA 4OFMA 5STDA 1BSBA 2CIUA 5IG3A 2P31A 3C8EA 1UN2A 2GDRA 2C1YA 3UBLA 1QVF2 3AHSA 3DVXA 1SYRA 5HFGA 2VIMA 1LQGC 1IQYA 4DKIA 3UARA 1AAZA 1K8A4 1HNCA 2LSTA 2WOFA 5KN0A 3NM7A 1WMOA 5CF2A 1KEBA 2VL3A 1M2DA 4Q5FA 1OH0A 4TXOB 3A2XA 1UCLA 1X1YA 2B24B 4GSNA 4ZL9A 1A2KA 1GRXA 4HM2B 3KP8A 1IVVA 8RNTA 3GH6A 2CZ2A 2O3OA 1FA3A 3EU3A 2NBSA 1MGRA 2KF3A 3F8XA 3CC73 2K9FA 2OTL3 4AJ6A 3EHCA 2ES7A 2PWJA 2W6JH 1WRYA 3ZG5A 4G0IA 3F4TA 2W56B 3GZBA 4NWYA 6GSXA 1RHLA 1I0XA 2VLVA 5IENA 2CX4A 3X3ZA 1SD8A 1MTCA 1GTAA 3DGYA 5B8BA 2ALBA 3ZTLA 1O8XA 1A24A 1X1XA 2VM1A 4WBJA 2TRCP 2BJXA 4WF4A 4BU4A 1RLSA 2H1DA 4XDVA 3RNTA 4F82A 1M2BA 1M0UA 1ERVA 2KHPA 2YX9A 2KLXA 2EIQA 5DALA 6GSYA 2WB9A 3S28A 1YIT3 4LSOA 4ZXGA 3TRPA 1PN0A 1RK4A 2RCDA 1A2VA 2FCHA 5AIHA 2FWEA 2ZCTA 5ECNB 4O5QA 1DBYA 5G5EA 3HDCA 1IV9A 3EMPA 3KFQC 3LGCA 3MNGA 4J5KA 3AY8A 3IC4A 1RGLA 3OW22 4OO5A 1TW9A 5A4VA 3EVIA 1HD2A 1PGTA 2OWPA 4EV5A 3DMLA 4KCAA 3UL3A 5D9WA 3URPA 4R1KA 1S3RA 5B7CA 2H19A 5D73A 2GZYA 3IJEB 4IHUA 3GTUB 3HVNA 2P5RA 1O6JA 4R4KA 2O89A 5HR0A 4HYZA 4KH7A 3N54B 4N6OB 3IRAA 1D6YA 2X64A 3SOAA 1NW2A 5GAPD 1KTEA 1QXHA 3TJFA 4XB5A 1EP8A 3MSOA 5JPUA 4LEHA 4TR0A 2LRTA 1OAZA 4IQ1A 1LNHA 1RRLA 1GD3A 2JSYA 1XBSA 4FQUA 2Z7AA 2HRKA 1KD14 4WETA 5LC6A 2LRNA 3KD0A 3NBBA 1WQLB 1OF5B 3WGEA 2X8HA 3CPW2 1NHOA 5FWGA 3SXXA 1DETA 4YH2A 4BVYA 1J9BA 5KN2A 4ML6A 4ZBAA 1MWSA 4NAXA 2E2TA 2L5LA 3F9UA 1LRAA 2WCIA 3EBYA 4WP5A 2FWGA 2IMFA 3FR9A 1Z6MA 11GSA 4LLRA 3G6E3 4EE0A 1EOGA 2R4VA 3FSDA 4EDZA 3KKGA 3FG3A 1CEWI 1AIUA 5HOHA 2MMAA 3LYPA 3UAPA 3FK8A 1UDII 3FF0A 4I5QA 4RI7A 3A76A 3GKMA 5EL8A 4KDUA 2D1WA 4OCEA 4YQUA 4NREA 3PXMA 2HZFA 2W56A 1URMA 2B6MA 3LT8A 3ZG0A 3BIRA 1B4PA 1YF0A 2X99A 5EQLA 2L5OA 1BSCA 5CO3A 2H66A 2JADA 2WULA 3AMOB 3U97A 4OO4A 1ERUA 1SJWA 4N6MA 1O85A
chains in the Genus database with same CATH topology
5G31A 4HZ2A 3TKSC 5E59A 4KSMA 4XS1A 2O85A 5EPFA 1IYHA 1S3CA 5G1KA 2PBJA 3CRUA 4K9ZA 4L8EA 3P8WA 4LMVA 4I2UA 1SKWB 1VF4A 2RM6A 4G0LA 5A4WA 3F6DA 1PX6A 1PKWA 5IMCA 4AGSA 3EPTA 1ZYPA 3GUSA 5IIZA 1H75A 4WR5A 3UJ1A 1V98A 1GSYA 2GSTA 2GVPA 2RLIA 2RM5A 4XCSA 2YNXA 1VF1A 1M9AA 4F9ZA 1LU4A 3GTUA 1GUMA 3QCPA 1BX9A 4ID0A 4ZIJA 4I8BA 4IGJA 4FYCA 1TOFA 5DQSA 4PX1A 3OR5A 3FZ9A 5IM9A 4TVEA 1GSQA 4PTSA 1EV9A 2GSRA 4WF5A 2M72A 3CSHA 5IMFA 2GSQA 2ZNMA 4EDYA 3DXBA 4V1Ag 2PN8A 3O6TA 2M46A 18GSA 4ECCA 4K7NA 4F0CA 1U87A 3O3TA 3W8SA 2OA7A 2JU5A 4K6XA 4K8MA 2HLSA 5D93A 3ZLPA 2CA8A 1BG5A 1XVQA 4WKWA 1QGVA 4EC0A 2IMDA 2QA1A 4IP6A 3KXOA 2PERA 2LQOA 4MH2A 3KZQA 3GL5A 4MA9A 5A4UA 5H5RA 1GSDA 4HQSA 3CRTA 3TKRA 1GP1A 12GSA 2MYGA 3PR8A 2HRAA 2V2GA 1OE7A 5CRWA 5ECIB 5F0GA 3VWUA 4HOJA 5F06A 5GAND 2CVKA 2H75A 3SWLA 3N5OA 2B5YA 4KCEA 4K1FA 2LJRA 2H1GA 3GSTA 3F3QA 3TOTA 1YQ1A 2DC5A 1S3AA 2CAQA 3GL3A 1WP0A 2HE3A 4POKA 4O92A 3IXRA 5IPGA 5GSTA 3KH9A 2I9HA 3KMOA 4PURA 2VO4A 4AF2A 2HNLA 5G30A 4K0NA 5IO0A 3QFBC 3WYWA 3F0IA 2PPTA 1ILOA 3IE3A 4GCIA 3MWHA 4L5OA 2AYTA 2H1AA 5ECRB 2H6XA 4IKHA 2IMIA 4GQCA 3QR6A 4JEDA 1Q98A 2O87A 3H1NA 2GQLA 2X8CA 2H71A 1Z9HA 4GSTA 3IDVA 6GSVA 2H76A 3GN3A 3WT2A 1TKDB 3MDKA 4YQVA 1V58A 4LMWA 4MF5A 1T00A 3FY7A 2F9SA 3KTBA 1KNGA 3ZYWA 4F03A 4RI6A 4QQ7A 1WIKA 1WPIA 4DSSB 2OKAA 2REMA 5DBQA 4BVXB 2L6DA 2VOCA 2CZ3A 3EWLA 3IOSA 3FW2A 2C0DA 2EIOA 1OC3A 4YKGA 2YV9A 4BPYA 5AIXA 1ACVA 1W89A 3HD5A 1XWAA 5BRTA 2FWFA 1SK0A 2HI7A 5FT3A 3WGXA 2B5EA 3MYDA 5IQYA 5ECKB 2H01A 3ZZXA 1XIYA 1THXA 1AW9A 3TKSA 3L9UA 4X43A 1XFLA 3HJOA 1EOHA 4BWSA 2R37A 4YQMA 1WJKA 2KUCA 2PUKC 2BMXA 2CQ9A 5D9TA 3DKSA 4Z2TA 1OVNA 1F6MC 4MPFA 2OE3A 2R0CA 4A5PA 3L78A 4PXOA 4CHSA 2YWNA 3HA9A 3G9BA 2IFQB 5D8IA 2LUSA 1GNWA 3BBYA 1O7UA 2CT6A 2LRCA 3ZVJA 1FW1A 1K0DA 1RQMA 4NXIA 3ZMLA 3FZAA 2GSSA 2E0QA 1VF2A 3D21A 4PQ1A 2L59A 4ECJA 3V1WA 3RHBA 1T4YA 1TI3A 1N2AA 2A2PA 3LXZA 3H93A 2DMLA 1OKTA 2MMOA 5DQYA 4TN8A 2VAFA 6GSSA 3HJMA 1Z7PA 1PQNA 2VLTA 3G7YA 5EVOA 3QD9A 1JLVA 3GSSA 3KP9A 4IVFA 4FYUA 4TRXA 4Z7XA 1VGLA 2M80A 2O7KA 2O8VB 4BWQA 1XPVA 4J57E 3NZNA 2H73A 1NSWA 4DSSA 1ZMAA 1GLQA 3D5JA 2AHEA 1WMJA 4BVXA 1OC8A 2DSAA 3E3EA 3WD6A 2QGVA 3IV4A 4ILFA 2B7JA 1ERTA 3C7MA 4OFTA 2JL4A 4IJIA 5IOXA 3QAWA 4IP1A 4GSSA 3RPPA 2HSHA 4XHMA 1ON4A 3JCML 5HFIA 5FHIA 3APSA 1DE1A 3GA4A 4ISDA 4ACSA 2C3NA 4O5RA 1VF3A 2ON7A 4RQRA 4YAPA 3VI7A 3LQ7A 4L5LA 2IMEA 4KAEA 3F4RA 4NHWA 4KGIA 2DLXA 1TXXA 2HRNA 1YY7A 2WS2A 5DJLA 3I69A 4HS1A 2YCDA 2VCZA 1H4OA 2WJUA 3LG6A 2LEGA 2IFQA 1O8WA 1XW6A 5HFKA 1TK0B 4JU5A 3CSIA 3WT1A 5DVBA 1YF1A 3QMXA 4FH8A 1EP7A 2YN1A 2FA4A 3UVHA 19GSA 4ICYA 2QKEA 2X49A 3VI5A 1T8EB 2RUFA 2I4AA 1Y6EA 4FO5A 3FR3A 2NDOA 2TIRA 3ZREA 3TKSE 4PNGA 13GSA 2NPBA 3HYPA 5EY6A 3IPZA 2ZUPA 1V40A 4TR1A 4EF0A 3LSZA 2A4VA 2HZEB 5F8BA 5JCGA 1OE8A 1M99A 1A8YA 1I9DA 1PN9A 5CYYA 4O7HA 1IYIA 3ERWA 3J7Yb 1FVJA 1G0TA 1YEPA 3U6VA 3HHVA 3Q74A 1J0FA 3GHAA 1DSBA 1NM3A 2XHFA 3G7JA 1M2AA 4K2XA 2A4HA 3K8NA 5IO2A 2OACA 2UZ8A 3FEUA 2FGXA 1SK1A 1ST9A 4KA0A 3LW9A 2LNSA 4G19A 2VD1A 4V1Ap 1TK5B 2C4JA 4IW9A 3TJGA 3HVVA 5LCZA 4TXOA 3TGZA 2LNTA 2GZPA 2GTUA 5ELGA 2YOIA 1AQXA 4BL7B 5CRHA 4HJMA 4NPBA 4JRRA 3BCIA 2VCXA 1HYUA 3F3RA 2L4QA 2F8FA 3PH9A 2MMZA 2DJ2A 2AAWA 2VCQA 4KX4A 5IMVA 2XPEA 3TJJA 1PKZA 1SKRB 2B3SA 2B1LA 3FYGA 5KOWA 1F3AA 2V1MA 1Z6NA 4L0UA 1WE0A 3D0ZA 4MLYA 2B5XA 1FVKA 1A2MA 4IQAA 4FYBA 1JZWA 3IC8A 1PL2A 3VWWA 1YKAA 4G0KA 1X9WB 2R5GA 1EEMA 22GSA 3GX8A 10GSA 4O5UA 2QA2A 2CV4A 4N10A 1K3YA 2GGTA 4ZL8A 1WOUA 2VUPA 2N5FA 1DE2A 2YWOA 2C80A 4FIWA 4MDCA 4OCFA 4X4JA 5HR1A 3EE2A 2CAIA 1U88A 1ZYNA 2Z9SA 5ECOB 3QOUA 2VCWA 3GKNA 5DJMA 4POLA 2V6KA 4MNNA 1BQ7A 1Z3EA 4HZ4A 2FNOA 3RDWA 1LBKA 1JZDA 2X8GA 3VWVA 1GLPA 1GUKA 1A0FA 4I2TA 2H0HA 5D9XA 1FB0A 3RPNA 1E6BA 1A23A 1U3AA 1GTIA 4ULXA 5KN3A 4HUAA 3RBTA 4ZBDA 4MF6A 4MZCA 2XBIA 4MABA 2HXKA 3HVSA 4EXJA 1UC7A 1SENA 4BL7A 2JZSA 1QUWA 4OFNA 3ZL5A 1JZRA 3HY2A 2IIYA 5AIVA 2OJLA 2G2QA 3D6IA 4E8HA 7GSSA 1MEKA 5D96A 3UVTA 2F51A 3GV1A 3VPQA 4PUAA 1RW1A 3GKXA 2OE1A 3C71A 4QL9A 5KEJA 1ZCPA 2YWIA 3KIJA 3KJYA 2XPDA 2DIZA 1TRWA 3G7IA 2PVQA 1F3BA 5IMZA 4YAVA 3KGKA 4MK3A 4NMUA 4Q5NA 4J2FA 3IR4A 1XWKA 4J56E 1ZOFA 2EIRA 4HU7A 1TU7A 3E9JB 4LA1A 4XTSA 3TDGA 1Z7RA 4EO3A 4XS4B 3LFLA 2LJKA 4PQHA 1R7HA 1UVZA 4HU9A 1QMVA 3KEBA 1X9SB 1G7OA 2RUEA 2YJHA 2C0EA 3TUEA 1AQVA 1PA3A 3ZFLA 1XOBA 5CRGA 4GQFA 1FAAA 9GSSA 1W4VA 1X5CA 2CVBA 4X1UA 1GSEA 16GSA 2VL2C 1CQGA 5ECQB 3FZ5A 3VPTA 4IN0A 5B8AA 3PGTA 1K0OA 4GTUA 4N0ZA 5JCWA 1A2JA 5IMAA 4RQXA 5D9VA 1SK2A 3H4KA 1R4WA 1XOAA 3DGQA 4JE1A 3GNJA 5AISA 2FLSA 5ABRA 1PL1A 4X0XA 1EGRA 2YWMA 4ZB8A 5DCGA 4EIQA 2XC2A 3W6GA 2IWTA 2WDUA 4ZILA 3DIEA 1ZZYA 4MJAA 4H86A 3DVWA 2YPMA 3HZ4A 5B6MA 1GL8A 1MDKA 2YJ7A 17GSA 2I3YA 2LS5A 2P5QA 2DMMA 1ERWA 1HNAA 1N8JA 3CMIA 3N9JA 4CDOA 4IBPA 4WBRD 4IELA 1ML6A 2QC7A 4TW5A 3C1SA 1BEDA 1SL0B 2HSMA 2NVLA 2OE0A 4CY8A 2LKUA 2H74A 2IL3A 4IS0A 2V41A 2H0GA 4BA7A 6GSTA 1GULA 1XW5A 4O32A 3RAZA 4HDEA 1AQWA 2WGRA 1TRVA 3I9V2 1EZKA 1S3DA 2E2MA 1EEJA 1SJIA 3IK7A 4XS4A 3MSZA 2VCVA 1TJDA 3I43A 2HYXA 4OMVA 5INYA 2K8SA 5CNWA 3UMAA 5ELAA 6GSUA 1U3IA 3TRQA 3ERFA 4ECIA 4MCUA 5AGYA 3HJPA 3M8NA 4MJBA 1KBNA 2C3TA 2C0FA 5ECHB 4AJ7A 1AXDA 4G10A 4EL1A 4WR4A 5J9CA 1DUGA 4I97A 3J7Yk 4NHZA 1O81A 1TTZA 1A0RP 4TR3A 2AB6A 4KDYA 1G6WA 4TXVA 2MBTA 2K6VA 4D73B 3I6AA 3HCZA 4POBA 3GURA 1EGOA 1YJ6A 4N30A 2DKHA 3TB2A 1YEXA 3FRCA 4MF7A 2C0GA 1ZYQB 3GIXA 4L0WA 2YZUA 1HNBA 2HT9A 1PSQA 4ZBBA 4TOPA 1PMTA 3DWVA 1X5DA 2CVDA 4AJ8A 1M7TA 2ON5A 4XS6A 4G2EA 3ZIVA 5LD0A 2DJ0A 4OD7A 3WGDA 2VCTA 5JWOB 1FOHA 3GKKA 3LEFA 2GT6A 2L57A 2PVOC 3C1RA 3VURA 2DBCA 5A5KA 2H70A 1F2EA 5ECPB 3EINA 5KOXA 4JZQA 3QFAC 2L6CA 1XWBA 4GXZA 1PD21 1V57A 4BVYB 2PU9C 2FUG2 3ME8A 3RHCA 3GH9A 2WZ9A 1B8XA 5F07A 4KDXA 1BYEA 4V2MA 2AJQB 1QQ2A 2VL9A 4TKYA 4GLTA 1TRUA 2QSIA 3U5RE 2FD3A 3QAVA 2L4CA 4CW9A 2VL2A 3KM6A 4GF0A 1JLWA 3LXTA 1F37A 4WXTA 1SJZA 1O73A 1B48A 3M1GA 1SU9A 2K8VA 20GSA 2J9HA 4POMA 8GSSA 4DVCA 3EMXA 4MJCA 3ZFBA 1X5EA 2DJ3A 1A2LA 4D73A 2LQQA 2GT5A 5HR3A 1T4ZA 1GWCA 3A3TA 3M9KA 5J41A 5AN1A 3BD2A 4EKZA 3NIVA 4E8EA 4WEYA 3DYRA 4ZL7A 4K0GA 2MZCA 3BCKA 4XIHA 4NV5A 3SBCA 3QPMA 2H72A 3KH7A 1SJ6A 5H5SA 2R0GA 3GMFA 3MAKA 3IA1A 1I5GA 1T7PB 1ZYEA 3VFIA 3IBHA 4I6XA 4ML1A 3GRXA 4PQIA 5GSSA 1TI1A 4DEJA 3C73A 5ECSA 3LJRA 3UIWA 3APOA 1C72A 1K0BA 4PGTA 5ECLB 5G2ZA 2IMKA 1GSSA 3TRXA 1THOA 1FG4A 3F4SA 2N5BA 5C00A 4QL7A 1JZOA 4MPGA 3TKQA 3F6FA 2OBIA 2A2RA 1MDJA 4PNFA 1GNEA 5HQPA 5L71A 1FHEA 2WRTA 2FA8A 3BOAA 2HFDA 5CP1A 2R0PA 2F8AA 2KP1A 1MD3A 4KF9A 2JZRA 3M0FA 3P2AA 3CXGA 4CY6A 1R5AA 3A2VA 4JR6A 2PMTA 4N0VA 1OC9B 1HQOA 3TJBA 2R3XA 4V2LA 1K0MA 3ZITA 1GSUA 4EIPA 4KW6A 2C8UA 2LJAA 1TP9A 2E2GA 1JFUA 2H30A 2J23A 2H6YA 3LORA 1A8LA 1GTBA 4Q5RA 2DJJA 3GYKA 1K0AA 2PGTA 4HQZA 2NTOA 3P90A 3UBKA 3CTFA 2HZEA 3F8UA 1YZXA 1ZGNA 1R26A 4Z2RA 5CREA 2GZZA 1B9YC 2G0FA 3ME7A 3FZ4A 4KB3A 2V32A 1XZOA 5DCHA 1GTUA 3L0HA 3ZIJA 1M9BA 2JACA 1LJRA 1YKCA 2FY6A 3BJ5A 3PINA 1XCCA 4KSOA 4MH3A 3DD3A 4ZB9A 2H8LA 1USBA 1GUHA 2DIYA 3KTLA 1J08A 5J5NA 5BMUA 2YANA 1T3BA 2LV3A 3LYKA 1T1VA 3Q18A 4Z2UA 2JSZA 5C04A 3M3MA 6GSWA 1K0CA 4F0BA 4TR4A 3D4MA 5CAXA 2D2ZA 2P0GA 4MZWA 2GQMA 1X9MB 3P7XA 2X4AA 2YP6A 1MDIA 4MMMA 2H0IA 2IY2A 1BAYA 4MJEA 1SL1B 3FKFA 1OKDA 1XWCA 2I1UA 2FWHA 5ENUA 5HR2A 3ED3A 2A2SA 3EYTA 4IJ3A 4LL1B 3L9SA 1TK8B 3ZMKA 4ECBA 1U6TA 1G6YA 14GSA 2JZTA 3IK9A 1OC9A 4P3YB 5J4UA 2DJKA 2DKIA 1ZL9A 4USSA 3CTGA 2GS3A 3O76A 1UA5A 3A5WA 3CSJA 3TOUA 3TCOA 4HJ2A 1B9XC 3CYNA 1YDKA 3HKRA 2MBSA 3ZRDA 3KMNA 3IAM2 4GRFA 2OADA 1NHYA 5ID2B 4YKFA 3HZ8A 2TRXA 1Z5YE 2H1BA 4MZBA 3Q6OA 4EUYA 3L9VA 1BJXA 5H5QA 3M9JA 3ZVJD 1XW9A 1TDIA 3LWAA 2BTOT 3L4NA 2VLUA 4K5RA 2H6ZA 2R6KA 1VRSD 4K7OA 3S9FA 1FOVA 4XRAA 2WFCA 2FHEA 5F05A 1AUCA 1GH2A 2RIIA 4JR4A 1GSFA 3EU4A 1K3OA 1SYXA 1FB6A 1V2AA 2HSYA 1PX7A 3DRNA 4DSQA 3IHGA 3ERGA 4F2IA 5G1LA 3CBUA 3NOFA 1XWGA 4XRDA 2IJYA 1SL2B 1Q4JA 2AV4A 4K2DA 2R2JA 5DAKB 3FR6A 2C3QA 1G7EA 2LTKA 2CX3A 3D22A 1TRSA 2F3MA 3F63A 1K3LA 4NV2A 4OWYA 2I81A 4MP4A 2GQKA 2KOKA 1EWXA 3Q19A 3H8QA 4LL4B 1Y25A 2XBQA 5J9BA 2V6OA 1E2YA 4PUFC 2IPAA 5G5FA 3H79A 2OBKA 2YZHA 1AC1A 1FO5A 4G9HA 1R5PA 3VWXA 3A2WA 1ABAA 4HI7A 2KP2A 3PPUA 5IMDA 4K5SA 5LNKe 3FHKA 3UOMA 3KCMA 2IN3A 5DDLA 4Q5QA 2E7PA 1XXUA 2B1KA 1JHBA 2K18A 4KE3A 1XVWA 3QAGA 5ID2A 1CQHA 3EC3A 1SKSB 3APQA 2VD0A 2AUVA 5JWRB 1K0NA 3VLNA 5JWQB 3A5IA 1WWJA 1QK8A 4V2NA 3D4TA 5GZZB 3IAS2 1B4QA 3HVXA 3UEMA 4JBBA 3VK9A 1OYJA 3TJKA 3E0UA 4DSRA 3GFKA 5DALB 3FMWA 4K7IA 1V9WA 2DJ1A 1PRXA 3DEXA 4N11A 3W8JA 1F9MA 4HEA2 3R3EA 2YV7A 4KUNA 5COHA 3TKPA 4TR1B 1EV4A 1TU8A 4EVMA 3MIXA 3US3A 3GX0A 4GWRA 5IPHA 3IHQA 2MMNA 1QFNA 2GLRA 5E4WA 1SD9A 2IYJA 5KN1A 5J3RA 5DAKA 2N5AA 1X0RA 2B7KA 3EURA 5JCUA 3QDNA 4KNDA 2HRFA 5CRDA 5IOWA 4RUVA 3R2QA 2VM2A 1MD4A 4ZB6A 3HXSA 2EC4A 3ISOA 5B6NA 4OFMA 2P31A 3C8EA 1UN2A 2GDRA 2C1YA 3UBLA 3DVXA 1SYRA 5HFGA 2VIMA 3UARA 1AAZA 1HNCA 2LSTA 5KN0A 1KEBA 2VL3A 1M2DA 4Q5FA 4TXOB 3A2XA 4GSNA 4ZL9A 1GRXA 3KP8A 3GH6A 2CZ2A 3EU3A 2NBSA 2K9FA 4AJ6A 2ES7A 2PWJA 1WRYA 4G0IA 3F4TA 4NWYA 6GSXA 2VLVA 2CX4A 1SD8A 1MTCA 1GTAA 5B8BA 2ALBA 3ZTLA 1O8XA 1A24A 2VM1A 4WBJA 2TRCP 2BJXA 4WF4A 2H1DA 4F82A 1M2BA 1M0UA 1ERVA 2KHPA 2KLXA 2EIQA 5DALA 6GSYA 2WB9A 4ZXGA 3TRPA 1PN0A 1RK4A 2FCHA 2FWEA 2ZCTA 5ECNB 4O5QA 1DBYA 5G5EA 3HDCA 3EMPA 3LGCA 3MNGA 3AY8A 3IC4A 4OO5A 1TW9A 5A4VA 3EVIA 1HD2A 1PGTA 3DMLA 4KCAA 3UL3A 5D9WA 5B7CA 2H19A 5D73A 2GZYA 4IHUA 3GTUB 2P5RA 1O6JA 2O89A 5HR0A 4KH7A 3IRAA 2X64A 1NW2A 5GAPD 1KTEA 1QXHA 3TJFA 1EP8A 4TR0A 2LRTA 1OAZA 4IQ1A 2JSYA 1XBSA 4FQUA 2HRKA 4WETA 2LRNA 3KD0A 3WGEA 2X8HA 5FWGA 1NHOA 4YH2A 4BVYA 1J9BA 5KN2A 4ML6A 4ZBAA 4NAXA 2L5LA 3F9UA 2WCIA 2FWGA 2IMFA 3FR9A 1Z6MA 11GSA 4LLRA 4EE0A 1EOGA 2R4VA 4EDZA 1AIUA 2MMAA 3LYPA 3UAPA 3FK8A 4I5QA 4RI7A 5EL8A 3GKMA 4KDUA 4OCEA 4YQUA 2HZFA 1URMA 2B6MA 1B4PA 1YF0A 2X99A 2L5OA 5CO3A 2H66A 2JADA 2WULA 4OO4A 1ERUA 5ECMB 1O85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G31 A;  4HZ2 A;  3TKS C;  5E59 A;  4KSM A;  4XS1 A;  2O85 A;  5EPF A;  1IYH A;  1S3C A;  5G1K A;  2PBJ A;  3CRU A;  4K9Z A;  4L8E A;  3P8W A;  4LMV A;  4I2U A;  1SKW B;  1VF4 A;  2RM6 A;  5A4W A;  3F6D A;  1PX6 A;  1PKW A;  5IMC A;  4AGS A;  3GUS A;  5IIZ A;  1H75 A;  4WR5 A;  3UJ1 A;  1V98 A;  1GSY A;  2GST A;  2GVP A;  2RLI A;  2RM5 A;  4XCS A;  2YNX A;  1VF1 A;  1M9A A;  4F9Z A;  1LU4 A;  3GTU A;  1GUM A;  3QCP A;  1BX9 A;  4ID0 A;  4ZIJ A;  4I8B A;  4IGJ A;  4FYC A;  1TOF A;  5DQS A;  4PX1 A;  3OR5 A;  3FZ9 A;  5IM9 A;  4TVE A;  1GSQ A;  1EV9 A;  2GSR A;  4WF5 A;  2M72 A;  3CSH A;  5IMF A;  2GSQ A;  2ZNM A;  4EDY A;  3DXB A;  4V1A g;  2PN8 A;  3O6T A;  2M46 A;  18GS A;  4ECC A;  4K7N A;  4F0C A;  1U87 A;  3O3T A;  3W8S A;  2OA7 A;  2JU5 A;  4K6X A;  4K8M A;  2HLS A;  5D93 A;  3ZLP A;  2CA8 A;  1BG5 A;  1XVQ A;  4WKW A;  1QGV A;  4EC0 A;  2IMD A;  4IP6 A;  3KXO A;  2PER A;  2LQO A;  4MH2 A;  3KZQ A;  3GL5 A;  4MA9 A;  5A4U A;  5H5R A;  1GSD A;  4HQS A;  3CRT A;  3TKR A;  1GP1 A;  12GS A;  2MYG A;  3PR8 A;  2V2G A;  1OE7 A;  5CRW A;  5ECI B;  5F0G A;  3VWU A;  4HOJ A;  5F06 A;  5GAN D;  2CVK A;  2H75 A;  3SWL A;  3N5O A;  2B5Y A;  4KCE A;  4K1F A;  2LJR A;  2H1G A;  3GST A;  3F3Q A;  3TOT A;  1YQ1 A;  2DC5 A;  1S3A A;  2CAQ A;  3GL3 A;  1WP0 A;  2HE3 A;  4POK A;  4O92 A;  3IXR A;  5IPG A;  5GST A;  3KH9 A;  2I9H A;  3KMO A;  4PUR A;  2VO4 A;  4AF2 A;  2HNL A;  5G30 A;  4K0N A;  5IO0 A;  3QFB C;  3WYW A;  3F0I A;  2PPT A;  1ILO A;  3IE3 A;  4GCI A;  3MWH A;  4L5O A;  2AYT A;  2H1A A;  5ECR B;  2H6X A;  4IKH A;  2IMI A;  4GQC A;  3QR6 A;  4JED A;  1Q98 A;  2O87 A;  3H1N A;  2GQL A;  2X8C A;  2H71 A;  1Z9H A;  3IDV A;  4GST A;  6GSV A;  2H76 A;  3GN3 A;  3WT2 A;  1TKD B;  3MDK A;  4YQV A;  1V58 A;  4LMW A;  4MF5 A;  1T00 A;  3FY7 A;  2F9S A;  3KTB A;  1KNG A;  3ZYW A;  4F03 A;  4RI6 A;  4QQ7 A;  1WIK A;  1WPI A;  4DSS B;  2OKA A;  2REM A;  5DBQ A;  2L6D A;  2VOC A;  2CZ3 A;  3EWL A;  3IOS A;  3FW2 A;  2C0D A;  2EIO A;  1OC3 A;  2YV9 A;  4BPY A;  5AIX A;  1ACV A;  1W89 A;  3HD5 A;  1XWA A;  2FWF A;  1SK0 A;  2HI7 A;  5FT3 A;  3WGX A;  2B5E A;  5IQY A;  5ECK B;  2H01 A;  3ZZX A;  1XIY A;  1THX A;  1AW9 A;  3TKS A;  3L9U A;  4X43 A;  1XFL A;  3HJO A;  1EOH A;  4BWS A;  2R37 A;  4YQM A;  1WJK A;  2KUC A;  2PUK C;  2BMX A;  2CQ9 A;  5D9T A;  3DKS A;  1OVN A;  1F6M C;  4MPF A;  2OE3 A;  3L78 A;  4PXO A;  4CHS A;  2YWN A;  3HA9 A;  3G9B A;  2IFQ B;  5D8I A;  2LUS A;  1GNW A;  3BBY A;  1O7U A;  2CT6 A;  2LRC A;  3ZVJ A;  1FW1 A;  1K0D A;  1RQM A;  4NXI A;  3ZML A;  3FZA A;  2GSS A;  2E0Q A;  1VF2 A;  3D21 A;  4PQ1 A;  2L59 A;  4ECJ A;  3V1W A;  3RHB A;  1T4Y A;  1TI3 A;  1N2A A;  3LXZ A;  3H93 A;  2DML A;  1OKT A;  2MMO A;  5DQY A;  4TN8 A;  2VAF A;  6GSS A;  3HJM A;  1Z7P A;  1PQN A;  2VLT A;  3G7Y A;  5EVO A;  3QD9 A;  1JLV A;  3GSS A;  3KP9 A;  4IVF A;  4FYU A;  4TRX A;  4Z7X A;  1VGL A;  2M80 A;  2O7K A;  2O8V B;  4BWQ A;  1XPV A;  4J57 E;  3NZN A;  2H73 A;  1NSW A;  4DSS A;  1ZMA A;  1GLQ A;  3D5J A;  2AHE A;  1WMJ A;  4BVX A;  1OC8 A;  2DSA A;  3E3E A;  3WD6 A;  2QGV A;  3IV4 A;  4ILF A;  2B7J A;  1ERT A;  3C7M A;  4OFT A;  2JL4 A;  4IJI A;  5IOX A;  3QAW A;  4IP1 A;  4GSS A;  3RPP A;  2HSH A;  4XHM A;  1ON4 A;  3JCM L;  5HFI A;  5FHI A;  3APS A;  1DE1 A;  3GA4 A;  4ISD A;  4ACS A;  2C3N A;  4O5R A;  1VF3 A;  2ON7 A;  4RQR A;  4YAP A;  3VI7 A;  3LQ7 A;  4L5L A;  2IME A;  4KAE A;  3F4R A;  4NHW A;  4KGI A;  2DLX A;  1TXX A;  2HRN A;  1YY7 A;  2WS2 A;  5DJL A;  3I69 A;  4HS1 A;  2YCD A;  2VCZ A;  1H4O A;  2WJU A;  3LG6 A;  2LEG A;  2IFQ A;  1O8W A;  1XW6 A;  5HFK A;  1TK0 B;  4JU5 A;  3CSI A;  3WT1 A;  5DVB A;  1YF1 A;  3QMX A;  4FH8 A;  1EP7 A;  2YN1 A;  2FA4 A;  3UVH A;  19GS A;  2QKE A;  3VI5 A;  1T8E B;  2RUF A;  2I4A A;  1Y6E A;  4FO5 A;  3FR3 A;  2NDO A;  2TIR A;  3ZRE A;  3TKS E;  4PNG A;  13GS A;  2NPB A;  3HYP A;  5EY6 A;  3IPZ A;  2ZUP A;  1V40 A;  4TR1 A;  4EF0 A;  3LSZ A;  2A4V A;  2HZE B;  5F8B A;  5JCG A;  1OE8 A;  1M99 A;  1A8Y A;  1I9D A;  1PN9 A;  5CYY A;  4O7H A;  1IYI A;  3ERW A;  3J7Y b;  1FVJ A;  1G0T A;  1YEP A;  3U6V A;  3HHV A;  3Q74 A;  1J0F A;  3GHA A;  1DSB A;  1NM3 A;  2XHF A;  3G7J A;  1M2A A;  3K8N A;  5IO2 A;  2OAC A;  3FEU A;  2FGX A;  1SK1 A;  1ST9 A;  4KA0 A;  2LNS A;  4G19 A;  2VD1 A;  4V1A p;  1TK5 B;  2C4J A;  4IW9 A;  3TJG A;  3HVV A;  5LCZ A;  4TXO A;  3TGZ A;  2LNT A;  2GZP A;  2GTU A;  5ELG A;  2YOI A;  1AQX A;  5CRH A;  4HJM A;  4NPB A;  4JRR A;  3BCI A;  2VCX A;  1HYU A;  3F3R A;  2L4Q A;  2F8F A;  3PH9 A;  2MMZ A;  2DJ2 A;  2AAW A;  2VCQ A;  4KX4 A;  5IMV A;  2XPE A;  3TJJ A;  1PKZ A;  1SKR B;  2B3S A;  2B1L A;  3FYG A;  1F3A A;  2V1M A;  1Z6N A;  4L0U A;  1WE0 A;  3D0Z A;  4MLY A;  2B5X A;  1FVK A;  1A2M A;  4IQA A;  4FYB A;  1JZW A;  1PL2 A;  3VWW A;  1YKA A;  1X9W B;  2R5G A;  1EEM A;  22GS A;  3GX8 A;  10GS A;  2CV4 A;  4N10 A;  1K3Y A;  2GGT A;  4ZL8 A;  1WOU A;  2VUP A;  2N5F A;  1DE2 A;  2YWO A;  2C80 A;  4FIW A;  4MDC A;  4OCF A;  5HR1 A;  3EE2 A;  2CAI A;  1U88 A;  2Z9S A;  5ECO B;  3QOU A;  2VCW A;  3GKN A;  5DJM A;  4POL A;  2V6K A;  1BQ7 A;  1Z3E A;  4HZ4 A;  2FNO A;  3RDW A;  1LBK A;  1JZD A;  2X8G A;  3VWV A;  1GLP A;  1GUK A;  1A0F A;  4I2T A;  2H0H A;  5D9X A;  1FB0 A;  3RPN A;  1E6B A;  1A23 A;  1U3A A;  1GTI A;  4ULX A;  5KN3 A;  4HUA A;  3RBT A;  4ZBD A;  4MF6 A;  4MZC A;  2XBI A;  4MAB A;  2HXK A;  3HVS A;  4EXJ A;  1UC7 A;  1SEN A;  4BL7 A;  2JZS A;  1QUW A;  4OFN A;  3ZL5 A;  1JZR A;  3HY2 A;  2IIY A;  5AIV A;  2OJL A;  2G2Q A;  3D6I A;  4E8H A;  7GSS A;  1MEK A;  5D96 A;  3UVT A;  2F51 A;  3GV1 A;  3VPQ A;  4PUA A;  1RW1 A;  3GKX A;  2OE1 A;  3C71 A;  4QL9 A;  5KEJ A;  1ZCP A;  2YWI A;  3KIJ A;  3KJY A;  2XPD A;  2DIZ A;  1TRW A;  3G7I A;  2PVQ A;  1F3B A;  5IMZ A;  4YAV A;  3KGK A;  4MK3 A;  4NMU A;  4Q5N A;  4J2F A;  3IR4 A;  1XWK A;  4J56 E;  1ZOF A;  2EIR A;  4HU7 A;  1TU7 A;  3E9J B;  4LA1 A;  4XTS A;  3TDG A;  1Z7R A;  4EO3 A;  4XS4 B;  3LFL A;  2LJK A;  4PQH A;  1R7H A;  1UVZ A;  4HU9 A;  1QMV A;  3KEB A;  1X9S B;  1G7O A;  2RUE A;  2YJH A;  2C0E A;  3TUE A;  1AQV A;  1PA3 A;  3ZFL A;  1XOB A;  5CRG A;  4GQF A;  1FAA A;  9GSS A;  1W4V A;  1X5C A;  2CVB A;  4X1U A;  1GSE A;  16GS A;  2VL2 C;  1CQG A;  5ECQ B;  3FZ5 A;  3VPT A;  4IN0 A;  5B8A A;  3PGT A;  1K0O A;  4GTU A;  4N0Z A;  5JCW A;  1A2J A;  5IMA A;  4RQX A;  5D9V A;  1SK2 A;  3H4K A;  1R4W A;  1XOA A;  3DGQ A;  4JE1 A;  3GNJ A;  5AIS A;  2FLS A;  5ABR A;  1PL1 A;  4X0X A;  1EGR A;  2YWM A;  4ZB8 A;  5DCG A;  2XC2 A;  3W6G A;  2IWT A;  2WDU A;  4ZIL A;  3DIE A;  1ZZY A;  4MJA A;  4H86 A;  3DVW A;  2YPM A;  3HZ4 A;  5B6M A;  1GL8 A;  1MDK A;  2YJ7 A;  17GS A;  2I3Y A;  2LS5 A;  2P5Q A;  2DMM A;  1ERW A;  1HNA A;  1N8J A;  3CMI A;  3N9J A;  4CDO A;  4IBP A;  4WBR D;  4IEL A;  1ML6 A;  2QC7 A;  4TW5 A;  3C1S A;  1BED A;  1SL0 B;  2NVL A;  2OE0 A;  2LKU A;  2H74 A;  2IL3 A;  4IS0 A;  2V41 A;  2H0G A;  4BA7 A;  6GST A;  1GUL A;  1XW5 A;  4O32 A;  3RAZ A;  4HDE A;  1AQW A;  2WGR A;  1TRV A;  3I9V 2;  1EZK A;  1S3D A;  2E2M A;  1EEJ A;  1SJI A;  3IK7 A;  4XS4 A;  3MSZ A;  2VCV A;  1TJD A;  3I43 A;  2HYX A;  4OMV A;  5INY A;  2K8S A;  5CNW A;  3UMA A;  5ELA A;  6GSU A;  1U3I A;  3TRQ A;  3ERF A;  4ECI A;  4MCU A;  5AGY A;  3HJP A;  3M8N A;  4MJB A;  1KBN A;  2C3T A;  2C0F A;  5ECH B;  4AJ7 A;  1AXD A;  4G10 A;  4EL1 A;  4WR4 A;  5J9C A;  1DUG A;  4I97 A;  3J7Y k;  4NHZ A;  1O81 A;  1TTZ A;  1A0R P;  4TR3 A;  2AB6 A;  4KDY A;  1G6W A;  4TXV A;  2MBT A;  2K6V A;  4D73 B;  3I6A A;  3HCZ A;  4POB A;  3GUR A;  1EGO A;  1YJ6 A;  4N30 A;  3TB2 A;  1YEX A;  3FRC A;  4MF7 A;  2C0G A;  1ZYQ B;  3GIX A;  4L0W A;  2YZU A;  1HNB A;  2HT9 A;  1PSQ A;  4ZBB A;  4TOP A;  1PMT A;  3DWV A;  1X5D A;  2CVD A;  4AJ8 A;  1M7T A;  2ON5 A;  4XS6 A;  4G2E A;  3ZIV A;  5LD0 A;  2DJ0 A;  4OD7 A;  3WGD A;  2VCT A;  5JWO B;  3GKK A;  3LEF A;  2GT6 A;  2L57 A;  2PVO C;  3C1R A;  3VUR A;  2DBC A;  5A5K A;  2H70 A;  1F2E A;  5ECP B;  3EIN A;  4JZQ A;  3QFA C;  2L6C A;  1XWB A;  4GXZ A;  1PD2 1;  1V57 A;  2PU9 C;  2FUG 2;  3ME8 A;  3RHC A;  3GH9 A;  2WZ9 A;  1B8X A;  5F07 A;  4KDX A;  1BYE A;  4V2M A;  2AJQ B;  1QQ2 A;  2VL9 A;  4TKY A;  4GLT A;  1TRU A;  2QSI A;  3U5R E;  2FD3 A;  3QAV A;  2L4C A;  4CW9 A;  2VL2 A;  3KM6 A;  4GF0 A;  1JLW A;  3LXT A;  1F37 A;  4WXT A;  1SJZ A;  1O73 A;  1B48 A;  3M1G A;  1SU9 A;  2K8V A;  20GS A;  2J9H A;  4POM A;  8GSS A;  4DVC A;  3EMX A;  4MJC A;  3ZFB A;  1X5E A;  2DJ3 A;  1A2L A;  4D73 A;  2LQQ A;  2GT5 A;  5HR3 A;  1T4Z A;  1GWC A;  3A3T A;  3M9K A;  5J41 A;  5AN1 A;  3BD2 A;  4EKZ A;  3NIV A;  4E8E A;  4WEY A;  3DYR A;  4ZL7 A;  4K0G A;  2MZC A;  3BCK A;  4XIH A;  4NV5 A;  3SBC A;  3QPM A;  2H72 A;  3KH7 A;  1SJ6 A;  5H5S A;  3GMF A;  3MAK A;  3IA1 A;  1I5G A;  1T7P B;  1ZYE A;  3VFI A;  3IBH A;  4I6X A;  4ML1 A;  3GRX A;  4PQI A;  5GSS A;  1TI1 A;  4DEJ A;  3C73 A;  5ECS A;  3LJR A;  3UIW A;  3APO A;  1C72 A;  1K0B A;  4PGT A;  5ECL B;  5G2Z A;  2IMK A;  1GSS A;  3TRX A;  1THO A;  1FG4 A;  3F4S A;  2N5B A;  5C00 A;  4QL7 A;  1JZO A;  4MPG A;  3TKQ A;  3F6F A;  2OBI A;  2A2R A;  1MDJ A;  4PNF A;  1GNE A;  5HQP A;  5L71 A;  1FHE A;  2WRT A;  2FA8 A;  3BOA A;  2HFD A;  5CP1 A;  2F8A A;  2KP1 A;  1MD3 A;  2JZR A;  3M0F A;  3P2A A;  3CXG A;  1R5A A;  3A2V A;  4JR6 A;  2PMT A;  4N0V A;  1OC9 B;  1HQO A;  3TJB A;  2R3X A;  4V2L A;  1K0M A;  3ZIT A;  1GSU A;  4KW6 A;  2C8U A;  2LJA A;  1TP9 A;  2E2G A;  1JFU A;  2H30 A;  2J23 A;  2H6Y A;  3LOR A;  1A8L A;  1GTB A;  4Q5R A;  2DJJ A;  3GYK A;  1K0A A;  2PGT A;  4HQZ A;  2NTO A;  3P90 A;  3UBK A;  3CTF A;  2HZE A;  3F8U A;  1YZX A;  1ZGN A;  1R26 A;  5CRE A;  2GZZ A;  1B9Y C;  2G0F A;  3ME7 A;  3FZ4 A;  4KB3 A;  2V32 A;  1XZO A;  5DCH A;  1GTU A;  3L0H A;  3ZIJ A;  1M9B A;  2JAC A;  1LJR A;  1YKC A;  2FY6 A;  3BJ5 A;  3PIN A;  1XCC A;  4KSO A;  4MH3 A;  3DD3 A;  4ZB9 A;  2H8L A;  1USB A;  1GUH A;  2DIY A;  3KTL A;  1J08 A;  5J5N A;  2YAN A;  1T3B A;  2LV3 A;  3LYK A;  1T1V A;  3Q18 A;  2JSZ A;  5C04 A;  3M3M A;  6GSW A;  1K0C A;  4F0B A;  4TR4 A;  3D4M A;  5CAX A;  2D2Z A;  2P0G A;  4MZW A;  2GQM A;  1X9M B;  3P7X A;  2YP6 A;  1MDI A;  4MMM A;  2H0I A;  2IY2 A;  1BAY A;  4MJE A;  1SL1 B;  3FKF A;  1OKD A;  1XWC A;  2I1U A;  2FWH A;  5ENU A;  5HR2 A;  3ED3 A;  2A2S A;  3EYT A;  4IJ3 A;  4LL1 B;  3L9S A;  1TK8 B;  3ZMK A;  4ECB A;  1U6T A;  1G6Y A;  14GS A;  2JZT A;  3IK9 A;  1OC9 A;  4P3Y B;  5J4U A;  2DJK A;  1ZL9 A;  3CTG A;  2GS3 A;  3O76 A;  1UA5 A;  3A5W A;  3CSJ A;  3TOU A;  3TCO A;  4HJ2 A;  1B9X C;  3CYN A;  1YDK A;  3HKR A;  2MBS A;  3ZRD A;  3KMN A;  3IAM 2;  4GRF A;  2OAD A;  1NHY A;  5ID2 B;  3HZ8 A;  2TRX A;  1Z5Y E;  2H1B A;  4MZB A;  3Q6O A;  4EUY A;  3L9V A;  1BJX A;  5H5Q A;  3M9J A;  3ZVJ D;  1XW9 A;  1TDI A;  3LWA A;  2BTO T;  3L4N A;  2VLU A;  2H6Z A;  2R6K A;  1VRS D;  4K7O A;  3S9F A;  1FOV A;  4XRA A;  2WFC A;  2FHE A;  5F05 A;  1AUC A;  1GH2 A;  2RII A;  4JR4 A;  1GSF A;  3EU4 A;  1K3O A;  1SYX A;  1FB6 A;  1V2A A;  2HSY A;  1PX7 A;  3DRN A;  4DSQ A;  3ERG A;  4F2I A;  5G1L A;  3CBU A;  3NOF A;  1XWG A;  4XRD A;  2IJY A;  1SL2 B;  1Q4J A;  2AV4 A;  4K2D A;  2R2J A;  5DAK B;  3FR6 A;  2C3Q A;  1G7E A;  2LTK A;  2CX3 A;  3D22 A;  1TRS A;  2F3M A;  3F63 A;  1K3L A;  4NV2 A;  4OWY A;  2I81 A;  4MP4 A;  2GQK A;  2KOK A;  1EWX A;  3Q19 A;  3H8Q A;  4LL4 B;  1Y25 A;  2XBQ A;  5J9B A;  2V6O A;  1E2Y A;  4PUF C;  2IPA A;  5G5F A;  3H79 A;  2OBK A;  2YZH A;  1AC1 A;  1FO5 A;  4G9H A;  1R5P A;  3VWX A;  3A2W A;  1ABA A;  4HI7 A;  2KP2 A;  5IMD A;  5LNK e;  3FHK A;  3UOM A;  3KCM A;  2IN3 A;  5DDL A;  4Q5Q A;  2E7P A;  1XXU A;  2B1K A;  1JHB A;  2K18 A;  4KE3 A;  1XVW A;  3QAG A;  5ID2 A;  1CQH A;  3EC3 A;  1SKS B;  3APQ A;  2VD0 A;  2AUV A;  5JWR B;  1K0N A;  3VLN A;  5JWQ B;  1WWJ A;  1QK8 A;  4V2N A;  3D4T A;  5GZZ B;  3IAS 2;  1B4Q A;  3HVX A;  3UEM A;  4JBB A;  3VK9 A;  1OYJ A;  3TJK A;  3E0U A;  4DSR A;  3GFK A;  5DAL B;  4K7I A;  1V9W A;  2DJ1 A;  1PRX A;  3DEX A;  4N11 A;  3W8J A;  1F9M A;  4HEA 2;  2YV7 A;  4KUN A;  5COH A;  3TKP A;  4TR1 B;  1EV4 A;  1TU8 A;  4EVM A;  3US3 A;  3GX0 A;  4GWR A;  5IPH A;  3IHQ A;  2MMN A;  1QFN A;  2GLR A;  5E4W A;  1SD9 A;  2IYJ A;  5KN1 A;  5J3R A;  5DAK A;  2N5A A;  1X0R A;  2B7K A;  3EUR A;  5JCU A;  3QDN A;  4KND A;  2HRF A;  5CRD A;  5IOW A;  4RUV A;  3R2Q A;  2VM2 A;  1MD4 A;  4ZB6 A;  3HXS A;  2EC4 A;  3ISO A;  5B6N A;  4OFM A;  2P31 A;  3C8E A;  1UN2 A;  2GDR A;  2C1Y A;  3UBL A;  3DVX A;  1SYR A;  5HFG A;  2VIM A;  3UAR A;  1AAZ A;  1HNC A;  2LST A;  5KN0 A;  1KEB A;  2VL3 A;  1M2D A;  4Q5F A;  4TXO B;  3A2X A;  4GSN A;  4ZL9 A;  1GRX A;  3KP8 A;  3GH6 A;  2CZ2 A;  3EU3 A;  2NBS A;  2K9F A;  4AJ6 A;  2ES7 A;  2PWJ A;  1WRY A;  3F4T A;  4NWY A;  6GSX A;  2VLV A;  2CX4 A;  1SD8 A;  1MTC A;  1GTA A;  5B8B A;  2ALB A;  3ZTL A;  1O8X A;  1A24 A;  2VM1 A;  4WBJ A;  2TRC P;  2BJX A;  4WF4 A;  2H1D A;  4F82 A;  1M2B A;  1M0U A;  1ERV A;  2KHP A;  2KLX A;  2EIQ A;  5DAL A;  6GSY A;  2WB9 A;  4ZXG A;  3TRP A;  1RK4 A;  2FCH A;  2FWE A;  2ZCT A;  5ECN B;  1DBY A;  5G5E A;  3HDC A;  3EMP A;  3LGC A;  3MNG A;  3AY8 A;  3IC4 A;  4OO5 A;  1TW9 A;  5A4V A;  3EVI A;  1HD2 A;  1PGT A;  3DML A;  4KCA A;  3UL3 A;  5D9W A;  5B7C A;  2H19 A;  5D73 A;  2GZY A;  4IHU A;  3GTU B;  2P5R A;  1O6J A;  2O89 A;  5HR0 A;  4KH7 A;  3IRA A;  2X64 A;  1NW2 A;  5GAP D;  1KTE A;  1QXH A;  3TJF A;  1EP8 A;  4TR0 A;  2LRT A;  1OAZ A;  4IQ1 A;  2JSY A;  1XBS A;  4WET A;  2LRN A;  3KD0 A;  3WGE A;  2X8H A;  5FWG A;  1NHO A;  4YH2 A;  4BVY A;  1J9B A;  5KN2 A;  4ML6 A;  4ZBA A;  4NAX A;  2L5L A;  3F9U A;  2WCI A;  2FWG A;  2IMF A;  3FR9 A;  1Z6M A;  11GS A;  4LLR A;  4EE0 A;  1EOG A;  2R4V A;  4EDZ A;  1AIU A;  2MMA A;  3LYP A;  3UAP A;  3FK8 A;  4I5Q A;  4RI7 A;  5EL8 A;  3GKM A;  4KDU A;  4OCE A;  4YQU A;  2HZF A;  1URM A;  2B6M A;  1B4P A;  1YF0 A;  2X99 A;  2L5O A;  5CO3 A;  2H66 A;  2JAD A;  2WUL A;  4OO4 A;  1ERU A;  5ECM B;  1O85 A; 
#chains in the Genus database with same CATH topology
 5G31 A;  1FGM A;  1ZX2 A;  4HZ2 A;  3TKS C;  5E59 A;  4KSM A;  3FLJ A;  4XS1 A;  2O85 A;  5EPF A;  1MNL A;  7GSP A;  1IYH A;  1S3C A;  5G1K A;  2PBJ A;  3CRU A;  4K9Z A;  4L8E A;  3MWZ A;  3P8W A;  4LMV A;  4I2U A;  1SKW B;  1VF4 A;  1YHQ 3;  4GB5 A;  2RM6 A;  1Y4K A;  1J2B A;  3ZFZ A;  4G0L A;  5A4W A;  3F6D A;  4U13 A;  1PX6 A;  2E2U A;  1PKW A;  5IMC A;  4AGS A;  2W9Q A;  3EPT A;  1ZYP A;  3GUS A;  5IIZ A;  1H75 A;  4WR5 A;  3UJ1 A;  4N3V A;  4OVM A;  5KP3 A;  1GS3 A;  1V98 A;  1VQP 3;  2KF5 A;  1GSY A;  1MWT A;  2GST A;  1O7P B;  2GVP A;  2RLI A;  2RM5 A;  4XCS A;  2YNX A;  1VF1 A;  1M9A A;  3PGB A;  4F9Z A;  1LU4 A;  3GTU A;  1GUM A;  3QCP A;  1AQZ A;  1EA2 A;  5CXO A;  1BX9 A;  4ID0 A;  2CK3 H;  4ZIJ A;  4I8B A;  1SII A;  4IGJ A;  4FYC A;  1TOF A;  5DQS A;  1UCK A;  4PX1 A;  1RSN A;  1I2G A;  3OR5 A;  3CU3 A;  4J5G A;  3FZ9 A;  5IM9 A;  3KE7 A;  4TVE A;  2UUG C;  1GSQ A;  1W01 A;  5IG4 A;  1EV9 A;  2GSR A;  4PTS A;  4WF5 A;  1US1 A;  2M72 A;  3CSH A;  2M7O A;  5CF1 A;  1HKX A;  5IMF A;  2GSQ A;  2ZNM A;  4EDY A;  3DXB A;  4V1A g;  2ML5 A;  2PN8 A;  3O6T A;  3UNL A;  1YVB I;  1GD4 A;  2M46 A;  18GS A;  4ECC A;  1GMR A;  2J8X B;  2V1L A;  4K7N A;  4F0C A;  1VQ6 3;  1U87 A;  4MEI A;  1ZS7 A;  4K90 B;  1IVU A;  3O3T A;  3W8S A;  1RGA A;  2OA7 A;  3F8H A;  2JU5 A;  1RKY A;  4K6X A;  4K8M A;  2HLS A;  5D93 A;  1WTH A;  3ZLP A;  4X2O A;  1EKM A;  2CA8 A;  1BG5 A;  4HM6 B;  1XVQ A;  3EB8 A;  4WKW A;  1QGV A;  4EC0 A;  2IMD A;  2QA1 A;  4IP6 A;  2IUK A;  3GWR A;  3KXO A;  1IT8 A;  2PER A;  2LQO A;  2P0X A;  4MH2 A;  4HSC X;  4KT3 B;  3KZQ A;  3GL5 A;  1YIJ 3;  4MA9 A;  5A4U A;  5H5R A;  1GSD A;  3NV0 B;  4HQS A;  1QAL A;  3CRT A;  3AHW A;  5GSP A;  3TKR A;  1GP1 A;  12GS A;  2QIY A;  2MYG A;  3PR8 A;  3AMO A;  2HRA A;  1I0V A;  2V2G A;  4HVN A;  1DE3 A;  1B27 A;  1OE7 A;  5CRW A;  5ECI B;  5F0G A;  3VWU A;  4HOJ A;  1K41 A;  5F06 A;  5GAN D;  1YGE A;  2CVK A;  2H75 A;  3BNE A;  3F14 A;  3SWL A;  3V99 A;  3EC9 A;  1L5G B;  1I8V A;  3GAX A;  4LZI A;  1QVG 2;  3N5O A;  2B5Y A;  1K73 4;  4KCE A;  4K1F A;  2LJR A;  2H1G A;  3GST A;  4IIA A;  3F3Q A;  3HI7 A;  1BNG A;  3TOT A;  1YQ1 A;  2WGO A;  1MOL A;  1BRS A;  1S3A A;  2CAQ A;  2DC5 A;  3GL3 A;  1WP0 A;  2ZL8 A;  2HE3 A;  2XR8 B;  4O92 A;  4POK A;  3X40 A;  3IXR A;  5IPG A;  1BOX A;  5GST A;  2BIR A;  3KH9 A;  2I9H A;  3KMO A;  4PUR A;  3CCE 3;  1W02 A;  2VO4 A;  3JUN A;  4AF2 A;  2HNL A;  1AVK A;  3PCR A;  5G30 A;  1U5O A;  4K0N A;  3WA3 A;  5IO0 A;  3QFB C;  3WYW A;  3F0I A;  2PPT A;  5AII A;  2STD A;  1ILO A;  3IE3 A;  4GCI A;  3MWH A;  4L5O A;  1ROA A;  5AYS C;  2AYT A;  2H1A A;  4JF8 A;  6RNT A;  1UI8 A;  3ER7 A;  4XBX A;  5ECR B;  1D6Z A;  2H6X A;  4IKH A;  2IMI A;  4GQC A;  3QR6 A;  4JED A;  1BNI A;  1K9M 4;  1Q98 A;  2O87 A;  2X8C A;  2GQL A;  3H1N A;  2H71 A;  1Z9H A;  3IDV A;  4GST A;  6GSV A;  2H76 A;  1B2Z A;  3GN3 A;  3WT2 A;  1TKD B;  1YJW 3;  2LYX A;  1VQO 3;  3MDK A;  1Q42 A;  4YQV A;  3X3Y A;  1V58 A;  4LMW A;  4MF5 A;  3CCU 3;  1BNS A;  1T00 A;  3FY7 A;  2F9S A;  3KTB A;  1KNG A;  4K1U A;  5HGR A;  3ZYW A;  4F03 A;  4RI6 A;  1BU4 A;  1FYS A;  1JNQ A;  2K3D A;  4QQ7 A;  1WIK A;  1WPI A;  3NQZ A;  5IG5 A;  4DSS B;  2OKA A;  3K5T A;  2REM A;  1W2B 2;  5DBQ A;  3CCL 3;  4BVX B;  2OOV C;  2L6D A;  1BGS A;  2VOC A;  2CZ3 A;  3EWL A;  3IOS A;  3FW2 A;  2AAD A;  2C0D A;  1RGE A;  2EIO A;  2XF3 A;  1OC3 A;  4YKG A;  2YV9 A;  2XFT A;  4BPY A;  5AIX A;  3FG1 A;  1ACV A;  1W89 A;  3HD5 A;  1XWA A;  5BRT A;  1A67 A;  2FWF A;  1SK0 A;  2HI7 A;  3NBJ A;  5FT3 A;  1NU3 A;  4FMD A;  2B5E A;  3WGX A;  3MYD A;  5IQY A;  3NV0 A;  4AKY A;  3WOD G;  5IEP A;  5ECK B;  2H01 A;  2D42 A;  3ZZX A;  3L0R A;  4L7K A;  1VQ5 3;  1XIY A;  1THX A;  1AW9 A;  3TKS A;  4LYL B;  3L9U A;  2K54 A;  4RNY A;  4X43 A;  1XFL A;  3HJO A;  1EOH A;  4BWS A;  5AEW B;  2R37 A;  4YQM A;  1VQL 3;  1WJK A;  1RN7 A;  2KUC A;  2PUK C;  4O3V A;  2BMX A;  2CQ9 A;  5D9T A;  4XDW A;  5FW5 A;  2RBI A;  3DKS A;  4Z2T A;  1OVN A;  4BTX A;  3DH2 A;  1F6M C;  4MPF A;  2P0M A;  2OE3 A;  5DRV A;  1TU5 A;  2Z77 A;  2R0C A;  4A5P A;  3L78 A;  4PXO A;  4CHS A;  2YWN A;  3HA9 A;  3G9B A;  2IFQ B;  5D8I A;  3MHE A;  2LUS A;  1GNW A;  3BBY A;  1TIJ A;  1O7U A;  4X2H A;  2CT6 A;  3H51 A;  2LRC A;  3ZVJ A;  1FW1 A;  3H3H A;  1W6G A;  1K0D A;  1RQM A;  4NXI A;  3ZML A;  2OCT A;  1BRI A;  3FZA A;  5DRE A;  3NUV A;  2GSS A;  2E0Q A;  1VF2 A;  3WMD A;  3D21 A;  4PQ1 A;  2L59 A;  4ECJ A;  3EE1 A;  3V1W A;  1JB4 A;  3LML A;  3RHB A;  1T4Y A;  1TI3 A;  1N2A A;  2A2P A;  3F7X A;  3LXZ A;  2YFI B;  3H93 A;  2DML A;  2XGN A;  1OKT A;  2MMO A;  1HYF A;  5DQY A;  3NHX A;  4TN8 A;  2VAF A;  1LNI A;  6GSS A;  3HJM A;  1Z7P A;  5IER A;  1PQN A;  2VLT A;  3G7Y A;  1B21 A;  5EVO A;  3QD9 A;  1PYL A;  1JLV A;  4Q53 A;  3CCR 3;  4IPB A;  3GSS A;  3KP9 A;  4IVF A;  4FYU A;  2FNQ A;  3DXO A;  1IT7 A;  4TRX A;  4Z7X A;  1VGL A;  1BRH A;  2M80 A;  2O7K A;  2O8V B;  4BWQ A;  1OPY A;  1XPV A;  4J57 E;  3NZN A;  4N6L A;  2H73 A;  1JJ2 2;  4I4K A;  1TFO A;  2BT3 A;  1RGH A;  1QAF A;  1NSW A;  4R9L A;  1ZMA A;  4DSS A;  1GLQ A;  3D5J A;  2AHE A;  3NQY A;  1WMJ A;  4BVX A;  1IYY A;  1OC8 A;  2DSA A;  3E3E A;  2KRT A;  3WD6 A;  4CDL A;  2L1S A;  2QGV A;  2HMN B;  3IV4 A;  4ILF A;  2B7J A;  3V92 A;  1ERT A;  3C7M A;  3B8L A;  1XG8 A;  2JL4 A;  4IJI A;  4OFT A;  1YVS A;  2PNC A;  5IOX A;  3QAW A;  4IP1 A;  3OWS A;  4GSS A;  3RPP A;  2HSH A;  3Q90 A;  4XHM A;  1ON4 A;  3JCM L;  3WHO A;  1GY5 A;  4FCM A;  5FHI A;  5HFI A;  3APS A;  1SIH A;  1IQX A;  3UJM A;  2QEX 3;  3GA4 A;  4ISD A;  1DE1 A;  4ACS A;  2C3N A;  3LXU X;  4O5R A;  3IMA B;  1VF3 A;  1E97 A;  2ON7 A;  4RQR A;  4YAP A;  3VI7 A;  3LQ7 A;  4L5L A;  2IME A;  4KAE A;  5JPP A;  3SOY A;  3OV4 A;  1W4N A;  2OQE C;  4XM4 A;  3F4R A;  3A5E A;  4NHW A;  4KGI A;  5ELU A;  2DLX A;  4EXR A;  1TXX A;  4RZM A;  3T8U A;  1N5P A;  2HRN A;  1YY7 A;  2WS2 A;  5DJL A;  3I69 A;  3CXC 2;  4HS1 A;  3SYU A;  2VCZ A;  2YCD A;  1H4O A;  2WJU A;  3LG6 A;  1BSE A;  2LEG A;  1T2H A;  1AVL A;  2HML B;  2IFQ A;  1BNE A;  3X3X A;  1O8W A;  1XW6 A;  5HFK A;  1TK0 B;  4JU5 A;  3CSI A;  1LVN A;  3WT1 A;  4HM8 B;  7STD A;  5DVB A;  1N8Q A;  1QJG A;  3KN4 A;  1YF1 A;  3QMX A;  4FH8 A;  1EP7 A;  3DM8 A;  2YN1 A;  2FA4 A;  3UVH A;  1OUN A;  19GS A;  1JKG B;  3BB9 A;  4ICY A;  2QKE A;  1VZZ A;  2X49 A;  3EQQ B;  3J7Y d;  1Q7H A;  3VI5 A;  1T8E B;  1LOV A;  2RUF A;  3BNB A;  2I4A A;  1Y6E A;  3FG4 A;  3ECF A;  3S27 A;  4FO5 A;  3AGO A;  2F5M A;  3FR3 A;  2NDO A;  2TIR A;  3F9S A;  3ZRE A;  3TKS E;  4PNG A;  13GS A;  1UGH I;  2NPB A;  3HYP A;  5CK6 A;  5EY6 A;  1T2I A;  3IPZ A;  4N6N B;  2ZUP A;  1V40 A;  4TR1 A;  4FMA A;  1FW7 A;  3SVA A;  4EF0 A;  4WYK B;  1O7N B;  3LSZ A;  2A4V A;  2HZE B;  1IV7 A;  5F8B A;  3RDE A;  1W2Z A;  5JCG A;  3S67 A;  1KQS 2;  1OE8 A;  2OOV A;  1M99 A;  2JDI H;  1FGO A;  3GRD A;  3RGA A;  1C54 A;  3LZA A;  1A8Y A;  2F99 A;  1I9D A;  1PN9 A;  5CYY A;  5D82 A;  2WOH A;  4FCJ A;  4O7H A;  1IYI A;  3N9H A;  3ERW A;  3J7Y b;  1FVJ A;  1G0T A;  1ZO2 A;  3EN1 B;  1YEP A;  2PZV A;  3U6V A;  3HHV A;  3WA2 X;  2Y74 A;  3Q74 A;  1J0F A;  3GHA A;  1DSB A;  4EBG A;  1NM3 A;  2XHF A;  3G7J A;  3B7C A;  1M2A A;  2BNG A;  1VQ7 3;  4K2X A;  2A4H A;  3K8N A;  5IO2 A;  2OAC A;  3Q1C A;  3BNC A;  2UZ8 A;  4J8T A;  3S29 A;  3FEU A;  2FGX A;  4KFE A;  1SK1 A;  1ST9 A;  4KA0 A;  1NDO B;  3LW9 A;  2P38 A;  2LNS A;  4IT7 A;  3CCQ 3;  4G19 A;  1FGR A;  3B4P A;  2GBW B;  4BTW A;  2VD1 A;  4V1A p;  2CH9 A;  2CG0 A;  1WMN A;  1TRP A;  1X1W A;  1TK5 B;  2C4J A;  4IW9 A;  3TJG A;  3HVV A;  5LCZ A;  4TXO A;  3TGZ A;  1VQK 3;  1JB5 A;  2LNT A;  2KCD A;  2GZP A;  2MC8 A;  2GTU A;  2KAA A;  5ELG A;  2YOI A;  4XBT A;  1IU7 A;  3MPH A;  1GMP A;  2GU1 A;  1AQX A;  3JUO A;  4BL7 B;  5CRH A;  1KC8 4;  4R9K A;  4HJM A;  1CYV A;  2IMJ A;  4NPB A;  4JRR A;  2GSP A;  3BCI A;  2VCX A;  1HYU A;  3F3R A;  2L4Q A;  2F8F A;  3PH9 A;  4WHA A;  2MMZ A;  1JBT A;  1E3R A;  3FGY A;  2DJ2 A;  5AIF A;  2QGU A;  2AAW A;  2CFW A;  1B2U A;  2VCQ A;  4KX4 A;  3K7C A;  3MG1 A;  5IMV A;  1ROV A;  2XPE A;  1JKG A;  3TJJ A;  1PKZ A;  4NHF A;  1SKR B;  3HX8 A;  2B3S A;  2MF7 A;  1GYB A;  2B1X B;  2B1L A;  2XGL A;  3FYG A;  4HOH A;  5KOW A;  4O02 B;  1F3A A;  2V1M A;  1Q9E A;  1I2F A;  1Z6N A;  4L0U A;  1WE0 A;  3D0Z A;  4MLY A;  1V74 A;  2B5X A;  3Q3F A;  4G1M B;  3JVC A;  1FVK A;  1A2M A;  4IQA A;  1PFP A;  4FYB A;  1JZW A;  3IC8 A;  1UGI A;  2W9P A;  3T8N A;  4WYK A;  1PL2 A;  5TGN A;  3VWW A;  2INX A;  1YKA A;  4G0K A;  1NNV A;  1X9W B;  2R5G A;  2R4I A;  3MG3 A;  1EEM A;  3RGR A;  22GS A;  3GX8 A;  10GS A;  4O5U A;  2ZHX B;  2QA2 A;  2CV4 A;  2ML6 A;  4N10 A;  1K3Y A;  2GGT A;  4ZL8 A;  3FH1 A;  1WOU A;  1R4C A;  2VUP A;  3LTC A;  2N5F A;  3DUK A;  3F7S A;  2CWU A;  1DE2 A;  2YWO A;  2C80 A;  2XSO B;  1RGC A;  4FIW A;  4MDC A;  4OCF A;  4X4J A;  5HR1 A;  3EE2 A;  3I56 3;  1AR0 A;  4HJL B;  2CAI A;  2F5W A;  1U88 A;  1FUT A;  1ZYN A;  2Z9S A;  5ECO B;  3QOU A;  2VCW A;  3DGM A;  3GKN A;  5DJM A;  1GSP A;  4POL A;  2V6K A;  4MNN A;  3V98 A;  1BQ7 A;  1OF5 A;  5KP1 A;  1F8N A;  2Y73 A;  1Z3E A;  1I2E A;  1STD A;  1SAR A;  1BVI A;  4KFD A;  4HZ4 A;  2FNO A;  3RDW A;  1LBK A;  1JZD A;  2X8G A;  2OQE A;  3VWV A;  4OK0 A;  3EF8 A;  1GLP A;  1GUK A;  3OXA A;  4EW5 A;  1A0F A;  4I2T A;  2H0H A;  5D9X A;  1FB0 A;  1DMM A;  1JB2 A;  5IW9 A;  3RPN A;  1E6B A;  1BRJ A;  1I70 A;  1A23 A;  1RDS A;  1U3A A;  1GTI A;  4ULX A;  5KN3 A;  4HUA A;  3RBT A;  4ZBD A;  4MF6 A;  4MZC A;  2XBI A;  4MAB A;  3STD A;  2HXK A;  3HVS A;  4EXJ A;  1UC7 A;  1SEN A;  1YI2 3;  1AY7 A;  4BL7 A;  2JZS A;  2OTJ 3;  1QUW A;  4OFN A;  3ZL5 A;  1LQM B;  2WGQ A;  1JZR A;  3HY2 A;  6GSP A;  2IIY A;  5AIV A;  3D5I A;  2OJL A;  2G2Q A;  1BUJ A;  1TUH A;  3D6I A;  4E8H A;  7GSS A;  1RGF A;  1MEK A;  5D96 A;  2RNT A;  1FUS A;  3UVT A;  2F51 A;  3GV1 A;  3VPQ A;  4PUA A;  3GZR A;  3FF2 A;  1RW1 A;  1BRG A;  3GKX A;  3ROB A;  2OE1 A;  3C71 A;  4QL9 A;  3CC2 3;  4HZB B;  5KEJ A;  1ZCP A;  1VQM 3;  2YWI A;  3KIJ A;  3KJY A;  4ORL A;  2XPD A;  2GEX A;  2C10 A;  2DIZ A;  3CC4 3;  4FMC A;  1TRW A;  3G7I A;  2PVQ A;  1F3B A;  5IMZ A;  4YAV A;  3KGK A;  4MK3 A;  4BIK A;  4NMU A;  4Q5N A;  4J2F A;  3IR4 A;  3BU4 A;  1XWK A;  4J56 E;  4MMZ B;  1ZOF A;  2EIR A;  1PU4 A;  4HU7 A;  1GOU A;  1CYU A;  1TU7 A;  2XRX B;  3E9J B;  4LA1 A;  4XTS A;  3TDG A;  1JN5 B;  1BUQ A;  3QRD A;  1Z7R A;  4EO3 A;  4XS4 B;  3LFL A;  2LJK A;  1TRQ A;  4PQH A;  1I3F A;  1R7H A;  1UVZ A;  2ZA4 A;  4HU9 A;  1QMV A;  3KEB A;  1X9S B;  2BO9 B;  2HMJ B;  1RJO A;  1G7O A;  2RUE A;  1PFO A;  2YJH A;  3LTD A;  2C0E A;  3TUE A;  1AQV A;  4GHO A;  1PA3 A;  1XOB A;  5CRG A;  3ZFL A;  4GQF A;  1OHP A;  1FAA A;  9GSS A;  1W4V A;  1X5C A;  2CVB A;  3ALA A;  4HM3 B;  1GSE A;  16GS A;  4X1U A;  3VF1 A;  4HZ9 B;  2VL2 C;  4EV2 A;  1CQG A;  4N6V 0;  5ECQ B;  3FZ5 A;  5AIG A;  3VPT A;  1BIR A;  4IN0 A;  5B8A A;  3PGT A;  2F86 B;  1K0O A;  2CHC A;  4GTU A;  4N0Z A;  5JCW A;  1A2J A;  5IMA A;  4RQX A;  1S72 3;  1U8C B;  1BNJ A;  5D9V A;  1SK2 A;  3H4K A;  1R4W A;  1XOA A;  3DGQ A;  4JE1 A;  3GNJ A;  5AIS A;  2FLS A;  5ABR A;  1JRQ A;  1LOW A;  3HK4 A;  1PL1 A;  4X0X A;  1EGR A;  2YWM A;  1X1U A;  4ZB8 A;  1Q40 B;  1RCL A;  5DCG A;  1B2S A;  2CG1 A;  4EIQ A;  2XC2 A;  3W6G A;  2IWT A;  2WDU A;  4ZIL A;  3DIE A;  1ZZY A;  1TP6 A;  4MJA A;  1KSI A;  4GL6 A;  1Z1S A;  1A90 A;  4H86 A;  7RNT A;  3DVW A;  2YPM A;  3HZ4 A;  5B6M A;  1GL8 A;  1UCJ A;  3DGO A;  1MDK A;  2YJ7 A;  17GS A;  5IG0 A;  2I3Y A;  1IK3 A;  3NX0 A;  1ULI B;  3BLZ A;  2LS5 A;  2P5Q A;  2DMM A;  1ERW A;  1HNA A;  1N8J A;  3CMI A;  3N9J A;  4CDO A;  4IBP A;  4WBR D;  4IEL A;  1ML6 A;  3CCM 3;  2QC7 A;  4TW5 A;  3C1S A;  1BED A;  4AEQ A;  1SL0 B;  2RGQ A;  2F56 A;  2HSM A;  2NVL A;  2OE0 A;  4CY8 A;  4QWT A;  2LKU A;  2W04 A;  3GZX B;  4HM7 B;  2GBX B;  9RNT A;  3F40 A;  1QMA A;  2H74 A;  5EVH A;  2IL3 A;  4IS0 A;  4OUQ A;  2V41 A;  2H0G A;  4BA7 A;  1JV2 B;  6GST A;  3B4O A;  1GUL A;  1XW5 A;  4O32 A;  1M90 4;  3RAZ A;  4HDE A;  1AQW A;  2WGR A;  1TRV A;  3I9V 2;  1EZK A;  2F4Y A;  1S3D A;  2E2M A;  2BMR B;  1EEJ A;  1JN5 A;  1N9E A;  1SJI A;  3LTB A;  3IK7 A;  2A15 A;  4XS4 A;  3MSZ A;  2VCV A;  1TJD A;  1G02 A;  3HZP A;  2HYX A;  3I43 A;  4H3U A;  4LMI A;  3SED A;  4OMV A;  1E3V A;  5INY A;  2K8S A;  5CNW A;  2FXT A;  3UMA A;  5ELA A;  6GSU A;  1U3I A;  3TRQ A;  4RBN A;  1RCK A;  2AAE A;  3ERF A;  4ECI A;  1OAC A;  4MCU A;  1NB3 I;  5AGY A;  3HJP A;  3M8N A;  4MJB A;  1YJ9 3;  1KBN A;  2C3T A;  1IQ8 A;  2C0F A;  3EX9 A;  5ECH B;  4AJ7 A;  1AXD A;  4G10 A;  4EL1 A;  4WR4 A;  5J9C A;  1DUG A;  4I97 A;  3J7Y k;  4NHZ A;  1O81 A;  3CCJ 3;  1TTZ A;  4RNT A;  1EUI C;  1A0R P;  4TR3 A;  2AB6 A;  2JQ5 A;  1YNV X;  4KDY A;  1UUV B;  1G6W A;  4TXV A;  2MBT A;  2L4V A;  2K6V A;  2P05 A;  5CLK A;  3I6A A;  4D73 B;  3HCZ A;  4POB A;  3S5C A;  2CX1 A;  3GUR A;  1BNF A;  1EGO A;  1YJ6 A;  4N30 A;  2DKH A;  3TB2 A;  1YEX A;  2UGI A;  3FRC A;  4MF7 A;  2C0G A;  1ZYQ B;  1Q40 A;  1DMN A;  3GIX A;  3FKA A;  4L0W A;  2YZU A;  1HNB A;  1O7M B;  2HT9 A;  5AYR B;  1PSQ A;  4ZBB A;  4TOP A;  1PMT A;  4PEJ A;  1VQ9 3;  1RRH A;  5KP4 A;  3DWV A;  2SBL A;  1FGQ A;  1X5D A;  2CVD A;  4AJ8 A;  3D4A A;  3G71 3;  4CCV A;  1M7T A;  2ON5 A;  4XS6 A;  3WDG B;  4G2E A;  3ZIV A;  5EEO A;  5LD0 A;  2DJ0 A;  4OD7 A;  3WGD A;  1OHS A;  1ASK A;  2VCT A;  3SLU A;  5JWO B;  1FOH A;  1NJI 4;  6STD A;  3GKK A;  3LEF A;  2KF4 A;  3WR2 A;  5I97 A;  2GT6 A;  1W00 A;  2BMQ B;  2L57 A;  1W6Y A;  2XSH B;  2PVO C;  3C1R A;  3VUR A;  2DBC A;  5A5K A;  5AI1 A;  1WNH A;  2H70 A;  1F2E A;  4LGQ A;  5ECP B;  3EIN A;  5KOX A;  1CH0 A;  4JZQ A;  3QFA C;  2L6C A;  1XWB A;  4GXZ A;  1PD2 1;  1V57 A;  4BVY B;  2PU9 C;  4J9A A;  2FUG 2;  3ME8 A;  3RHC A;  3GH9 A;  1MWR A;  2WZ9 A;  1B8X A;  5F07 A;  1W7C A;  4KDX A;  1DVD A;  1A2P A;  1BYE A;  4V2M A;  2AJQ B;  3VGN A;  2IA7 A;  1QQ2 A;  2VL9 A;  1N9J A;  4TKY A;  4GLT A;  1TRU A;  2QSI A;  2GEY A;  2WO0 A;  3U5R E;  1HZ1 A;  2XH9 A;  2C11 A;  2FD3 A;  3QAV A;  2L4C A;  4CW9 A;  2VL2 A;  1VQ4 3;  3KM6 A;  3WOF B;  4GF0 A;  1JLW A;  3LXT A;  1M3I A;  1F37 A;  1DYU A;  4HKV B;  1SQW A;  3UB1 A;  4WXT A;  1SJZ A;  4L8P A;  1O73 A;  1B48 A;  3KSP A;  3M1G A;  4KZ1 A;  4HM0 B;  1SU9 A;  4N6T A;  2K8V A;  2YFJ B;  20GS A;  2J9H A;  3CPO A;  4POM A;  8GSS A;  4DVC A;  3EMX A;  4MJC A;  3ZFB A;  1X5E A;  2DJ3 A;  1A2L A;  4D73 A;  2LQQ A;  5IF6 A;  2GT5 A;  5HR3 A;  2XEP A;  3UL6 A;  3NXJ A;  1T4Z A;  1GWC A;  5LC7 A;  1QAK A;  3A3T A;  3M9K A;  1B20 A;  1MWU A;  5J41 A;  5AN1 A;  3BD2 A;  4EKZ A;  3NIV A;  4FR9 A;  5IEO A;  4E8E A;  1ULJ B;  4WEY A;  3DYR A;  2K0M A;  1ISK A;  1FUW A;  1T5Y A;  4ZL7 A;  4K0G A;  2MZC A;  3BCK A;  4XIH A;  4NV5 A;  3SBC A;  2GU3 A;  3QPM A;  2H72 A;  3KCH A;  3T0U A;  3KH7 A;  2LQV A;  3G0K A;  1SJ6 A;  5H5S A;  2R0G A;  3GMF A;  4TX4 A;  3WOE B;  3MAK A;  3IA1 A;  1M1K 4;  1I5G A;  1T7P B;  2ZDJ A;  1EQK A;  3MKI A;  1ZYE A;  3VFI A;  2P09 A;  1UUW B;  3G8Z A;  3IBH A;  4I6X A;  4ML1 A;  3GRX A;  4PQI A;  5GSS A;  1M1X B;  1TI1 A;  4DEJ A;  3KII A;  3C73 A;  5ECS A;  1I3I A;  3CMA 3;  3LJR A;  3X42 A;  2CFL A;  3UIW A;  3APO A;  1C72 A;  1K0B A;  4PGT A;  5M19 A;  5ECL B;  5G2Z A;  3DGL A;  2IMK A;  1GSS A;  3TRX A;  2Z76 A;  3D3L A;  1THO A;  1FG4 A;  3F4S A;  2N5B A;  5C00 A;  4QL7 A;  1JZO A;  4MPG A;  1B2X A;  3TKQ A;  3F6F A;  2I9W A;  3GSP A;  2OBI A;  3MYT A;  3CCV 3;  1W6C A;  2A2R A;  1MDJ A;  4PNF A;  3OX9 A;  1GNE A;  5HQP A;  5L71 A;  1HU9 A;  3CQF A;  1FHE A;  1FGT A;  4BTY A;  2WRT A;  2FA8 A;  1M9G A;  1GOV A;  2HFD A;  3Q2P A;  3BOA A;  2Z6B A;  2R0P A;  5CP1 A;  3X41 A;  2F8A A;  2KP1 A;  5RNT A;  3M8C A;  1MD3 A;  4KF9 A;  2JZR A;  3M0F A;  3P2A A;  1LOX A;  3CXG A;  4XBY A;  4HAA A;  4CY6 A;  1R5A A;  1Q81 4;  3A2V A;  4MJD A;  4JR6 A;  2PMT A;  4N0V A;  4FMB A;  3OWY A;  1OC9 B;  1HQO A;  3TJB A;  2R3X A;  4V2L A;  1K0M A;  3ZIT A;  1GSU A;  4EIP A;  4KW6 A;  2C8U A;  2LJA A;  1TP9 A;  2E2G A;  1JFU A;  2H30 A;  2J23 A;  2H6Y A;  3LOR A;  1A8L A;  1GTB A;  4Q5R A;  2DJJ A;  1KWI A;  3GYK A;  1K0A A;  2PGT A;  3MG2 A;  4HQZ A;  2NTO A;  3P90 A;  3UBK A;  4EC6 A;  3CTF A;  2BHM A;  2HZE A;  3F8U A;  1YZX A;  1ZGN A;  4O2H A;  3PZW A;  1R26 A;  4Z2R A;  4MMY B;  5CRE A;  2GZZ A;  1B9Y C;  4BL2 A;  5ECM B;  2G0F A;  3ME7 A;  3FZ4 A;  5AEU B;  4KB3 A;  2V32 A;  3JUQ A;  1XZO A;  5DCH A;  1GTU A;  3L0H A;  3ZIJ A;  1M9B A;  2JAC A;  3N8B A;  1LJR A;  1YKC A;  2HOH A;  2FY6 A;  3BJ5 A;  3PCS A;  2HMK B;  1XCC A;  3PIN A;  4KSO A;  4MH3 A;  3DD3 A;  4ZB9 A;  2H8L A;  1RTU A;  1USB A;  1GUH A;  3D79 A;  2DIY A;  1LOY A;  3KTL A;  1J08 A;  5J5N A;  5BMU A;  2YAN A;  1T3B A;  1DMQ A;  3PS8 A;  2LV3 A;  2IUJ A;  3LYK A;  1T1V A;  4K1V A;  2CFG A;  3Q18 A;  4Z2U A;  1BSD A;  2JSZ A;  3CME 3;  5C04 A;  4K61 A;  1IVX A;  3KSE D;  3M3M A;  6GSW A;  1K0C A;  4F0B A;  1RGG A;  2SAR A;  1Q86 4;  3D4M A;  4TR4 A;  3K0Z A;  5CAX A;  2D2Z A;  1RGK A;  2P0G A;  4MMX B;  4MZW A;  2GQM A;  1X9M B;  2R41 A;  1O7G B;  3P7X A;  2X4A A;  2YP6 A;  1O7W B;  1MDI A;  5BVB A;  4HM4 B;  4GSP A;  4MMM A;  2H0I A;  2IY2 A;  2RFR A;  1BAY A;  4MJE A;  1SL1 B;  4WWU C;  3FKF A;  2CX0 A;  2HMM B;  5D81 A;  1OKD A;  4WFO A;  1XWC A;  1RN4 A;  2I1U A;  1VQ8 3;  2FWH A;  5ENU A;  5HR2 A;  3ED3 A;  4N6U A;  2A2S A;  3EYT A;  4IJ3 A;  4LL1 B;  3L9S A;  3QK9 A;  1Q82 4;  1TK8 B;  1W5Z A;  3ZMK A;  3IPT A;  4ECB A;  2CFD A;  1U6T A;  1O7H B;  3NM2 A;  4CJN A;  1G6Y A;  14GS A;  1UCI A;  1G96 A;  2JZT A;  1BAO A;  3IK9 A;  1OC9 A;  4P3Y B;  5J4U A;  1DVC A;  2DJK A;  3NBR A;  2DKI A;  1BRN L;  5M1A A;  3JUP A;  3SX1 A;  1MGW A;  1ZL9 A;  2GXF A;  1N5H A;  1STF I;  1R4Y A;  4USS A;  3CTG A;  1N8R 4;  2GS3 A;  3LOY A;  3U1W A;  5FGO A;  3O76 A;  1UA5 A;  3CNX A;  3CNM A;  3A5W A;  4BIR A;  2C4B A;  1EG9 B;  3CSJ A;  3TOU A;  3EBT A;  3TCO A;  4HJ2 A;  2QA4 3;  1B9X C;  3CYN A;  4HM1 B;  5BXQ A;  1YDK A;  1Q7Y 4;  3HKR A;  2MBS A;  3ZRD A;  1IDP A;  2HMO B;  1C7H A;  3KMN A;  3IAM 2;  1NB5 I;  5D83 A;  4GRF A;  1B3S A;  1UW1 A;  4ZM8 A;  2OAD A;  1NHY A;  5ID2 B;  4YKF A;  3CCS 3;  3HZ8 A;  2TRX A;  1Z5Y E;  2H1B A;  4MZB A;  3DMC A;  3Q6O A;  2KXG A;  3FCS B;  4EUY A;  3L9V A;  1BJX A;  5H5Q A;  4EYC A;  2KF6 A;  2CW9 A;  3M9J A;  3G4S 3;  3ZVJ D;  1PY3 A;  4RNZ A;  1XW9 A;  3GZY B;  1TDI A;  3LWA A;  1GY6 A;  2BTO T;  3L4N A;  2VLU A;  4K5R A;  3K9M C;  2H6Z A;  2R6K A;  2W03 A;  3VSY A;  2YFL B;  3G16 A;  1VRS D;  4K7O A;  3S9F A;  1FOV A;  4XRA A;  2WFC A;  2FHE A;  1OCV A;  3DGN A;  5F05 A;  3HII A;  1GOY A;  2F98 A;  1AUC A;  2CC3 A;  1GH2 A;  2RII A;  4JR4 A;  1GSF A;  2CKF B;  3EU4 A;  1K3O A;  1SYX A;  1FB6 A;  1B2M A;  1V2A A;  2HSY A;  3D5G A;  1RNB A;  1PX7 A;  1YJN 3;  3DRN A;  3I55 3;  4DSQ A;  3IHG A;  3ERG A;  4F2I A;  5G1L A;  3CBU A;  3NOF A;  1XWG A;  4XRD A;  1S5A A;  2IJY A;  3OWU A;  1OGZ A;  1BAN A;  1OHO A;  3HIG A;  1SL2 B;  1Q4J A;  2AV4 A;  4K2D A;  2R2J A;  5DAK B;  1BRK A;  3FR6 A;  2C3Q A;  1G7E A;  1TFK A;  2LTK A;  2CX3 A;  3D22 A;  1TTO A;  1TRS A;  3JUM A;  3EJV A;  1GY7 A;  1K3L A;  2F3M A;  3F63 A;  1FZU A;  4NV2 A;  4OWY A;  2I81 A;  4MP4 A;  2GQK A;  2KOK A;  2BU4 A;  2W0Q A;  1EWX A;  3AGN A;  1M3J A;  2CWV A;  3Q19 A;  1SPU A;  4R80 A;  2BMO B;  1IVW A;  3H8Q A;  4LL4 B;  1Y25 A;  1JBS A;  2XBQ A;  5J9B A;  4CPK A;  2V6O A;  1E2Y A;  4PUF C;  2IPA A;  2Q07 A;  5G5F A;  8CHO A;  3H79 A;  2OBK A;  2YZH A;  1AC1 A;  1FO5 A;  1BSA A;  3UL5 A;  1R5P A;  4G9H A;  1VQQ A;  3VWX A;  3A2W A;  1ABA A;  4HI7 A;  2KP2 A;  3PPU A;  5IMD A;  4K5S A;  5LNK e;  3FHK A;  3UOM A;  3KCM A;  2IN3 A;  5DDL A;  4Q5Q A;  2E7P A;  1XXU A;  2CFK A;  2B1K A;  1JHB A;  2K18 A;  3LTA A;  4KE3 A;  1XVW A;  3D9R A;  1JBR A;  1D6U A;  3QAG A;  5ID2 A;  1CQH A;  3EC3 A;  5BU4 A;  1SKS B;  3APQ A;  2VD0 A;  1LXE A;  3O8Y A;  4AKZ A;  2AUV A;  5JWR B;  1K0N A;  3VLN A;  5JWQ B;  4JRF A;  3KZT A;  3A5I A;  2UX0 A;  1WWJ A;  3DZL A;  5M18 A;  1QK8 A;  1RN1 A;  1BNR A;  4V2N A;  3D4T A;  1UI7 A;  5GZZ B;  5G2G A;  1RMS A;  3I0Y A;  3IAS 2;  1K28 A;  1B4Q A;  3HVX A;  3UEM A;  4JBB A;  3VK9 A;  3LH4 A;  1OYJ A;  3E99 A;  3TJK A;  1OGX A;  3E0U A;  4DSR A;  3GFK A;  5DAL B;  3FMW A;  4K7I A;  2W2C A;  1V9W A;  2DJ1 A;  1PRX A;  1YGW A;  4KVH A;  3DEX A;  4FCZ A;  5BIR A;  4KFF A;  2E2V A;  4N11 A;  3W8J A;  1F9M A;  4HEA 2;  3R3E A;  5A0O B;  4STD A;  3K63 A;  2XFS A;  4HM5 B;  2YV7 A;  4KUN A;  3HOH A;  5ELJ A;  5COH A;  4H61 A;  3FZW A;  3TKP A;  4TR1 B;  1CQS A;  1EV4 A;  1TU8 A;  1NO3 A;  4EVM A;  3MIX A;  3BND A;  3US3 A;  3GX0 A;  4GWR A;  5IPH A;  3IHQ A;  2MMN A;  1QFN A;  2GLR A;  5E4W A;  1SD9 A;  2IYJ A;  5KN1 A;  1GMQ A;  5J3R A;  3LYG A;  5DAK A;  2N5A A;  2CWT A;  3LT9 A;  3EN8 A;  5JBS A;  1X0R A;  1ZGX A;  1AV4 A;  4O8S A;  2B7K A;  1NWW A;  3EUR A;  5JCU A;  3CD6 3;  3QDN A;  1RNT A;  3PYJ A;  4KND A;  1WMP A;  2HRF A;  5CRD A;  5IOW A;  4RUV A;  3R2Q A;  3DY5 A;  2FGT A;  4HBR A;  2VM2 A;  1MD4 A;  2RSX A;  4BL3 A;  4ZB6 A;  3HXS A;  4L8O A;  2EC4 A;  2O9U X;  3ISO A;  1VQN 3;  1UUG B;  5B6N A;  4OFM A;  5STD A;  1BSB A;  2CIU A;  5IG3 A;  2P31 A;  3C8E A;  1UN2 A;  2GDR A;  2C1Y A;  3UBL A;  1QVF 2;  3AHS A;  3DVX A;  1SYR A;  5HFG A;  2VIM A;  1LQG C;  1IQY A;  4DKI A;  3UAR A;  1AAZ A;  1K8A 4;  1HNC A;  2LST A;  2WOF A;  5KN0 A;  3NM7 A;  1WMO A;  5CF2 A;  1KEB A;  2VL3 A;  1M2D A;  4Q5F A;  1OH0 A;  4TXO B;  3A2X A;  1UCL A;  1X1Y A;  2B24 B;  4GSN A;  4ZL9 A;  1A2K A;  1GRX A;  4HM2 B;  3KP8 A;  1IVV A;  8RNT A;  3GH6 A;  2CZ2 A;  2O3O A;  1FA3 A;  3EU3 A;  2NBS A;  1MGR A;  2KF3 A;  3F8X A;  3CC7 3;  2K9F A;  2OTL 3;  4AJ6 A;  3EHC A;  2ES7 A;  2PWJ A;  2W6J H;  1WRY A;  3ZG5 A;  4G0I A;  3F4T A;  2W56 B;  3GZB A;  4NWY A;  6GSX A;  1RHL A;  1I0X A;  2VLV A;  5IEN A;  2CX4 A;  3X3Z A;  1SD8 A;  1MTC A;  1GTA A;  3DGY A;  5B8B A;  2ALB A;  3ZTL A;  1O8X A;  1A24 A;  1X1X A;  2VM1 A;  4WBJ A;  2TRC P;  2BJX A;  4WF4 A;  4BU4 A;  1RLS A;  2H1D A;  4XDV A;  3RNT A;  4F82 A;  1M2B A;  1M0U A;  1ERV A;  2KHP A;  2YX9 A;  2KLX A;  2EIQ A;  5DAL A;  6GSY A;  2WB9 A;  3S28 A;  1YIT 3;  4LSO A;  4ZXG A;  3TRP A;  1PN0 A;  1RK4 A;  2RCD A;  1A2V A;  2FCH A;  5AIH A;  2FWE A;  2ZCT A;  5ECN B;  4O5Q A;  1DBY A;  5G5E A;  3HDC A;  1IV9 A;  3EMP A;  3KFQ C;  3LGC A;  3MNG A;  4J5K A;  3AY8 A;  3IC4 A;  1RGL A;  3OW2 2;  4OO5 A;  1TW9 A;  5A4V A;  3EVI A;  1HD2 A;  1PGT A;  2OWP A;  4EV5 A;  3DML A;  4KCA A;  3UL3 A;  5D9W A;  3URP A;  4R1K A;  1S3R A;  5B7C A;  2H19 A;  5D73 A;  2GZY A;  3IJE B;  4IHU A;  3GTU B;  3HVN A;  2P5R A;  1O6J A;  4R4K A;  2O89 A;  5HR0 A;  4HYZ A;  4KH7 A;  3N54 B;  4N6O B;  3IRA A;  1D6Y A;  2X64 A;  3SOA A;  1NW2 A;  5GAP D;  1KTE A;  1QXH A;  3TJF A;  4XB5 A;  1EP8 A;  3MSO A;  5JPU A;  4LEH A;  4TR0 A;  2LRT A;  1OAZ A;  4IQ1 A;  1LNH A;  1RRL A;  1GD3 A;  2JSY A;  1XBS A;  4FQU A;  2Z7A A;  2HRK A;  1KD1 4;  4WET A;  5LC6 A;  2LRN A;  3KD0 A;  3NBB A;  1WQL B;  1OF5 B;  3WGE A;  2X8H A;  3CPW 2;  1NHO A;  5FWG A;  3SXX A;  1DET A;  4YH2 A;  4BVY A;  1J9B A;  5KN2 A;  4ML6 A;  4ZBA A;  1MWS A;  4NAX A;  2E2T A;  2L5L A;  3F9U A;  1LRA A;  2WCI A;  3EBY A;  4WP5 A;  2FWG A;  2IMF A;  3FR9 A;  1Z6M A;  11GS A;  4LLR A;  3G6E 3;  4EE0 A;  1EOG A;  2R4V A;  3FSD A;  4EDZ A;  3KKG A;  3FG3 A;  1CEW I;  1AIU A;  5HOH A;  2MMA A;  3LYP A;  3UAP A;  3FK8 A;  1UDI I;  3FF0 A;  4I5Q A;  4RI7 A;  3A76 A;  3GKM A;  5EL8 A;  4KDU A;  2D1W A;  4OCE A;  4YQU A;  4NRE A;  3PXM A;  2HZF A;  2W56 A;  1URM A;  2B6M A;  3LT8 A;  3ZG0 A;  3BIR A;  1B4P A;  1YF0 A;  2X99 A;  5EQL A;  2L5O A;  1BSC A;  5CO3 A;  2H66 A;  2JAD A;  2WUL A;  3AMO B;  3U97 A;  4OO4 A;  1ERU A;  1SJW A;  4N6M A;  1O85 A; 
#chains in the Genus database with same CATH homology
 5G31 A;  4HZ2 A;  3TKS C;  5E59 A;  4KSM A;  4XS1 A;  2O85 A;  5EPF A;  1IYH A;  1S3C A;  5G1K A;  2PBJ A;  3CRU A;  4K9Z A;  4L8E A;  3P8W A;  4LMV A;  4I2U A;  1SKW B;  1VF4 A;  2RM6 A;  4G0L A;  5A4W A;  3F6D A;  1PX6 A;  1PKW A;  5IMC A;  4AGS A;  3EPT A;  1ZYP A;  3GUS A;  5IIZ A;  1H75 A;  4WR5 A;  3UJ1 A;  1V98 A;  1GSY A;  2GST A;  2GVP A;  2RLI A;  2RM5 A;  4XCS A;  2YNX A;  1VF1 A;  1M9A A;  4F9Z A;  1LU4 A;  3GTU A;  1GUM A;  3QCP A;  1BX9 A;  4ID0 A;  4ZIJ A;  4I8B A;  4IGJ A;  4FYC A;  1TOF A;  5DQS A;  4PX1 A;  3OR5 A;  3FZ9 A;  5IM9 A;  4TVE A;  1GSQ A;  4PTS A;  1EV9 A;  2GSR A;  4WF5 A;  2M72 A;  3CSH A;  5IMF A;  2GSQ A;  2ZNM A;  4EDY A;  3DXB A;  4V1A g;  2PN8 A;  3O6T A;  2M46 A;  18GS A;  4ECC A;  4K7N A;  4F0C A;  1U87 A;  3O3T A;  3W8S A;  2OA7 A;  2JU5 A;  4K6X A;  4K8M A;  2HLS A;  5D93 A;  3ZLP A;  2CA8 A;  1BG5 A;  1XVQ A;  4WKW A;  1QGV A;  4EC0 A;  2IMD A;  2QA1 A;  4IP6 A;  3KXO A;  2PER A;  2LQO A;  4MH2 A;  3KZQ A;  3GL5 A;  4MA9 A;  5A4U A;  5H5R A;  1GSD A;  4HQS A;  3CRT A;  3TKR A;  1GP1 A;  12GS A;  2MYG A;  3PR8 A;  2HRA A;  2V2G A;  1OE7 A;  5CRW A;  5ECI B;  5F0G A;  3VWU A;  4HOJ A;  5F06 A;  5GAN D;  2CVK A;  2H75 A;  3SWL A;  3N5O A;  2B5Y A;  4KCE A;  4K1F A;  2LJR A;  2H1G A;  3GST A;  3F3Q A;  3TOT A;  1YQ1 A;  2DC5 A;  1S3A A;  2CAQ A;  3GL3 A;  1WP0 A;  2HE3 A;  4POK A;  4O92 A;  3IXR A;  5IPG A;  5GST A;  3KH9 A;  2I9H A;  3KMO A;  4PUR A;  2VO4 A;  4AF2 A;  2HNL A;  5G30 A;  4K0N A;  5IO0 A;  3QFB C;  3WYW A;  3F0I A;  2PPT A;  1ILO A;  3IE3 A;  4GCI A;  3MWH A;  4L5O A;  2AYT A;  2H1A A;  5ECR B;  2H6X A;  4IKH A;  2IMI A;  4GQC A;  3QR6 A;  4JED A;  1Q98 A;  2O87 A;  3H1N A;  2GQL A;  2X8C A;  2H71 A;  1Z9H A;  4GST A;  3IDV A;  6GSV A;  2H76 A;  3GN3 A;  3WT2 A;  1TKD B;  3MDK A;  4YQV A;  1V58 A;  4LMW A;  4MF5 A;  1T00 A;  3FY7 A;  2F9S A;  3KTB A;  1KNG A;  3ZYW A;  4F03 A;  4RI6 A;  4QQ7 A;  1WIK A;  1WPI A;  4DSS B;  2OKA A;  2REM A;  5DBQ A;  4BVX B;  2L6D A;  2VOC A;  2CZ3 A;  3EWL A;  3IOS A;  3FW2 A;  2C0D A;  2EIO A;  1OC3 A;  4YKG A;  2YV9 A;  4BPY A;  5AIX A;  1ACV A;  1W89 A;  3HD5 A;  1XWA A;  5BRT A;  2FWF A;  1SK0 A;  2HI7 A;  5FT3 A;  3WGX A;  2B5E A;  3MYD A;  5IQY A;  5ECK B;  2H01 A;  3ZZX A;  1XIY A;  1THX A;  1AW9 A;  3TKS A;  3L9U A;  4X43 A;  1XFL A;  3HJO A;  1EOH A;  4BWS A;  2R37 A;  4YQM A;  1WJK A;  2KUC A;  2PUK C;  2BMX A;  2CQ9 A;  5D9T A;  3DKS A;  4Z2T A;  1OVN A;  1F6M C;  4MPF A;  2OE3 A;  2R0C A;  4A5P A;  3L78 A;  4PXO A;  4CHS A;  2YWN A;  3HA9 A;  3G9B A;  2IFQ B;  5D8I A;  2LUS A;  1GNW A;  3BBY A;  1O7U A;  2CT6 A;  2LRC A;  3ZVJ A;  1FW1 A;  1K0D A;  1RQM A;  4NXI A;  3ZML A;  3FZA A;  2GSS A;  2E0Q A;  1VF2 A;  3D21 A;  4PQ1 A;  2L59 A;  4ECJ A;  3V1W A;  3RHB A;  1T4Y A;  1TI3 A;  1N2A A;  2A2P A;  3LXZ A;  3H93 A;  2DML A;  1OKT A;  2MMO A;  5DQY A;  4TN8 A;  2VAF A;  6GSS A;  3HJM A;  1Z7P A;  1PQN A;  2VLT A;  3G7Y A;  5EVO A;  3QD9 A;  1JLV A;  3GSS A;  3KP9 A;  4IVF A;  4FYU A;  4TRX A;  4Z7X A;  1VGL A;  2M80 A;  2O7K A;  2O8V B;  4BWQ A;  1XPV A;  4J57 E;  3NZN A;  2H73 A;  1NSW A;  4DSS A;  1ZMA A;  1GLQ A;  3D5J A;  2AHE A;  1WMJ A;  4BVX A;  1OC8 A;  2DSA A;  3E3E A;  3WD6 A;  2QGV A;  3IV4 A;  4ILF A;  2B7J A;  1ERT A;  3C7M A;  4OFT A;  2JL4 A;  4IJI A;  5IOX A;  3QAW A;  4IP1 A;  4GSS A;  3RPP A;  2HSH A;  4XHM A;  1ON4 A;  3JCM L;  5HFI A;  5FHI A;  3APS A;  1DE1 A;  3GA4 A;  4ISD A;  4ACS A;  2C3N A;  4O5R A;  1VF3 A;  2ON7 A;  4RQR A;  4YAP A;  3VI7 A;  3LQ7 A;  4L5L A;  2IME A;  4KAE A;  3F4R A;  4NHW A;  4KGI A;  2DLX A;  1TXX A;  2HRN A;  1YY7 A;  2WS2 A;  5DJL A;  3I69 A;  4HS1 A;  2YCD A;  2VCZ A;  1H4O A;  2WJU A;  3LG6 A;  2LEG A;  2IFQ A;  1O8W A;  1XW6 A;  5HFK A;  1TK0 B;  4JU5 A;  3CSI A;  3WT1 A;  5DVB A;  1YF1 A;  3QMX A;  4FH8 A;  1EP7 A;  2YN1 A;  2FA4 A;  3UVH A;  19GS A;  4ICY A;  2QKE A;  2X49 A;  3VI5 A;  1T8E B;  2RUF A;  2I4A A;  1Y6E A;  4FO5 A;  3FR3 A;  2NDO A;  2TIR A;  3ZRE A;  3TKS E;  4PNG A;  13GS A;  2NPB A;  3HYP A;  5EY6 A;  3IPZ A;  2ZUP A;  1V40 A;  4TR1 A;  4EF0 A;  3LSZ A;  2A4V A;  2HZE B;  5F8B A;  5JCG A;  1OE8 A;  1M99 A;  1A8Y A;  1I9D A;  1PN9 A;  5CYY A;  4O7H A;  1IYI A;  3ERW A;  3J7Y b;  1FVJ A;  1G0T A;  1YEP A;  3U6V A;  3HHV A;  3Q74 A;  1J0F A;  3GHA A;  1DSB A;  1NM3 A;  2XHF A;  3G7J A;  1M2A A;  4K2X A;  2A4H A;  3K8N A;  5IO2 A;  2OAC A;  2UZ8 A;  3FEU A;  2FGX A;  1SK1 A;  1ST9 A;  4KA0 A;  3LW9 A;  2LNS A;  4G19 A;  2VD1 A;  4V1A p;  1TK5 B;  2C4J A;  4IW9 A;  3TJG A;  3HVV A;  5LCZ A;  4TXO A;  3TGZ A;  2LNT A;  2GZP A;  2GTU A;  5ELG A;  2YOI A;  1AQX A;  4BL7 B;  5CRH A;  4HJM A;  4NPB A;  4JRR A;  3BCI A;  2VCX A;  1HYU A;  3F3R A;  2L4Q A;  2F8F A;  3PH9 A;  2MMZ A;  2DJ2 A;  2AAW A;  2VCQ A;  4KX4 A;  5IMV A;  2XPE A;  3TJJ A;  1PKZ A;  1SKR B;  2B3S A;  2B1L A;  3FYG A;  5KOW A;  1F3A A;  2V1M A;  1Z6N A;  4L0U A;  1WE0 A;  3D0Z A;  4MLY A;  2B5X A;  1FVK A;  1A2M A;  4IQA A;  4FYB A;  1JZW A;  3IC8 A;  1PL2 A;  3VWW A;  1YKA A;  4G0K A;  1X9W B;  2R5G A;  1EEM A;  22GS A;  3GX8 A;  10GS A;  4O5U A;  2QA2 A;  2CV4 A;  4N10 A;  1K3Y A;  2GGT A;  4ZL8 A;  1WOU A;  2VUP A;  2N5F A;  1DE2 A;  2YWO A;  2C80 A;  4FIW A;  4MDC A;  4OCF A;  4X4J A;  5HR1 A;  3EE2 A;  2CAI A;  1U88 A;  1ZYN A;  2Z9S A;  5ECO B;  3QOU A;  2VCW A;  3GKN A;  5DJM A;  4POL A;  2V6K A;  4MNN A;  1BQ7 A;  1Z3E A;  4HZ4 A;  2FNO A;  3RDW A;  1LBK A;  1JZD A;  2X8G A;  3VWV A;  1GLP A;  1GUK A;  1A0F A;  4I2T A;  2H0H A;  5D9X A;  1FB0 A;  3RPN A;  1E6B A;  1A23 A;  1U3A A;  1GTI A;  4ULX A;  5KN3 A;  4HUA A;  3RBT A;  4ZBD A;  4MF6 A;  4MZC A;  2XBI A;  4MAB A;  2HXK A;  3HVS A;  4EXJ A;  1UC7 A;  1SEN A;  4BL7 A;  2JZS A;  1QUW A;  4OFN A;  3ZL5 A;  1JZR A;  3HY2 A;  2IIY A;  5AIV A;  2OJL A;  2G2Q A;  3D6I A;  4E8H A;  7GSS A;  1MEK A;  5D96 A;  3UVT A;  2F51 A;  3GV1 A;  3VPQ A;  4PUA A;  1RW1 A;  3GKX A;  2OE1 A;  3C71 A;  4QL9 A;  5KEJ A;  1ZCP A;  2YWI A;  3KIJ A;  3KJY A;  2XPD A;  2DIZ A;  1TRW A;  3G7I A;  2PVQ A;  1F3B A;  5IMZ A;  4YAV A;  3KGK A;  4MK3 A;  4NMU A;  4Q5N A;  4J2F A;  3IR4 A;  1XWK A;  4J56 E;  1ZOF A;  2EIR A;  4HU7 A;  1TU7 A;  3E9J B;  4LA1 A;  4XTS A;  3TDG A;  1Z7R A;  4EO3 A;  4XS4 B;  3LFL A;  2LJK A;  4PQH A;  1R7H A;  1UVZ A;  4HU9 A;  1QMV A;  3KEB A;  1X9S B;  1G7O A;  2RUE A;  2YJH A;  2C0E A;  3TUE A;  1AQV A;  1PA3 A;  3ZFL A;  1XOB A;  5CRG A;  4GQF A;  1FAA A;  9GSS A;  1W4V A;  1X5C A;  2CVB A;  4X1U A;  1GSE A;  16GS A;  2VL2 C;  1CQG A;  5ECQ B;  3FZ5 A;  3VPT A;  4IN0 A;  5B8A A;  3PGT A;  1K0O A;  4GTU A;  4N0Z A;  5JCW A;  1A2J A;  5IMA A;  4RQX A;  5D9V A;  1SK2 A;  3H4K A;  1R4W A;  1XOA A;  3DGQ A;  4JE1 A;  3GNJ A;  5AIS A;  2FLS A;  5ABR A;  1PL1 A;  4X0X A;  1EGR A;  2YWM A;  4ZB8 A;  5DCG A;  4EIQ A;  2XC2 A;  3W6G A;  2IWT A;  2WDU A;  4ZIL A;  3DIE A;  1ZZY A;  4MJA A;  4H86 A;  3DVW A;  2YPM A;  3HZ4 A;  5B6M A;  1GL8 A;  1MDK A;  2YJ7 A;  17GS A;  2I3Y A;  2LS5 A;  2P5Q A;  2DMM A;  1ERW A;  1HNA A;  1N8J A;  3CMI A;  3N9J A;  4CDO A;  4IBP A;  4WBR D;  4IEL A;  1ML6 A;  2QC7 A;  4TW5 A;  3C1S A;  1BED A;  1SL0 B;  2HSM A;  2NVL A;  2OE0 A;  4CY8 A;  2LKU A;  2H74 A;  2IL3 A;  4IS0 A;  2V41 A;  2H0G A;  4BA7 A;  6GST A;  1GUL A;  1XW5 A;  4O32 A;  3RAZ A;  4HDE A;  1AQW A;  2WGR A;  1TRV A;  3I9V 2;  1EZK A;  1S3D A;  2E2M A;  1EEJ A;  1SJI A;  3IK7 A;  4XS4 A;  3MSZ A;  2VCV A;  1TJD A;  3I43 A;  2HYX A;  4OMV A;  5INY A;  2K8S A;  5CNW A;  3UMA A;  5ELA A;  6GSU A;  1U3I A;  3TRQ A;  3ERF A;  4ECI A;  4MCU A;  5AGY A;  3HJP A;  3M8N A;  4MJB A;  1KBN A;  2C3T A;  2C0F A;  5ECH B;  4AJ7 A;  1AXD A;  4G10 A;  4EL1 A;  4WR4 A;  5J9C A;  1DUG A;  4I97 A;  3J7Y k;  4NHZ A;  1O81 A;  1TTZ A;  1A0R P;  4TR3 A;  2AB6 A;  4KDY A;  1G6W A;  4TXV A;  2MBT A;  2K6V A;  4D73 B;  3I6A A;  3HCZ A;  4POB A;  3GUR A;  1EGO A;  1YJ6 A;  4N30 A;  2DKH A;  3TB2 A;  1YEX A;  3FRC A;  4MF7 A;  2C0G A;  1ZYQ B;  3GIX A;  4L0W A;  2YZU A;  1HNB A;  2HT9 A;  1PSQ A;  4ZBB A;  4TOP A;  1PMT A;  3DWV A;  1X5D A;  2CVD A;  4AJ8 A;  1M7T A;  2ON5 A;  4XS6 A;  4G2E A;  3ZIV A;  5LD0 A;  2DJ0 A;  4OD7 A;  3WGD A;  2VCT A;  5JWO B;  1FOH A;  3GKK A;  3LEF A;  2GT6 A;  2L57 A;  2PVO C;  3C1R A;  3VUR A;  2DBC A;  5A5K A;  2H70 A;  1F2E A;  5ECP B;  3EIN A;  5KOX A;  4JZQ A;  3QFA C;  2L6C A;  1XWB A;  4GXZ A;  1PD2 1;  1V57 A;  4BVY B;  2PU9 C;  2FUG 2;  3ME8 A;  3RHC A;  3GH9 A;  2WZ9 A;  1B8X A;  5F07 A;  4KDX A;  1BYE A;  4V2M A;  2AJQ B;  1QQ2 A;  2VL9 A;  4TKY A;  4GLT A;  1TRU A;  2QSI A;  3U5R E;  2FD3 A;  3QAV A;  2L4C A;  4CW9 A;  2VL2 A;  3KM6 A;  4GF0 A;  1JLW A;  3LXT A;  1F37 A;  4WXT A;  1SJZ A;  1O73 A;  1B48 A;  3M1G A;  1SU9 A;  2K8V A;  20GS A;  2J9H A;  4POM A;  8GSS A;  4DVC A;  3EMX A;  4MJC A;  3ZFB A;  1X5E A;  2DJ3 A;  1A2L A;  4D73 A;  2LQQ A;  2GT5 A;  5HR3 A;  1T4Z A;  1GWC A;  3A3T A;  3M9K A;  5J41 A;  5AN1 A;  3BD2 A;  4EKZ A;  3NIV A;  4E8E A;  4WEY A;  3DYR A;  4ZL7 A;  4K0G A;  2MZC A;  3BCK A;  4XIH A;  4NV5 A;  3SBC A;  3QPM A;  2H72 A;  3KH7 A;  1SJ6 A;  5H5S A;  2R0G A;  3GMF A;  3MAK A;  3IA1 A;  1I5G A;  1T7P B;  1ZYE A;  3VFI A;  3IBH A;  4I6X A;  4ML1 A;  3GRX A;  4PQI A;  5GSS A;  1TI1 A;  4DEJ A;  3C73 A;  5ECS A;  3LJR A;  3UIW A;  3APO A;  1C72 A;  1K0B A;  4PGT A;  5ECL B;  5G2Z A;  2IMK A;  1GSS A;  3TRX A;  1THO A;  1FG4 A;  3F4S A;  2N5B A;  5C00 A;  4QL7 A;  1JZO A;  4MPG A;  3TKQ A;  3F6F A;  2OBI A;  2A2R A;  1MDJ A;  4PNF A;  1GNE A;  5HQP A;  5L71 A;  1FHE A;  2WRT A;  2FA8 A;  3BOA A;  2HFD A;  5CP1 A;  2R0P A;  2F8A A;  2KP1 A;  1MD3 A;  4KF9 A;  2JZR A;  3M0F A;  3P2A A;  3CXG A;  4CY6 A;  1R5A A;  3A2V A;  4JR6 A;  2PMT A;  4N0V A;  1OC9 B;  1HQO A;  3TJB A;  2R3X A;  4V2L A;  1K0M A;  3ZIT A;  1GSU A;  4EIP A;  4KW6 A;  2C8U A;  2LJA A;  1TP9 A;  2E2G A;  1JFU A;  2H30 A;  2J23 A;  2H6Y A;  3LOR A;  1A8L A;  1GTB A;  4Q5R A;  2DJJ A;  3GYK A;  1K0A A;  2PGT A;  4HQZ A;  2NTO A;  3P90 A;  3UBK A;  3CTF A;  2HZE A;  3F8U A;  1YZX A;  1ZGN A;  1R26 A;  4Z2R A;  5CRE A;  2GZZ A;  1B9Y C;  2G0F A;  3ME7 A;  3FZ4 A;  4KB3 A;  2V32 A;  1XZO A;  5DCH A;  1GTU A;  3L0H A;  3ZIJ A;  1M9B A;  2JAC A;  1LJR A;  1YKC A;  2FY6 A;  3BJ5 A;  3PIN A;  1XCC A;  4KSO A;  4MH3 A;  3DD3 A;  4ZB9 A;  2H8L A;  1USB A;  1GUH A;  2DIY A;  3KTL A;  1J08 A;  5J5N A;  5BMU A;  2YAN A;  1T3B A;  2LV3 A;  3LYK A;  1T1V A;  3Q18 A;  4Z2U A;  2JSZ A;  5C04 A;  3M3M A;  6GSW A;  1K0C A;  4F0B A;  4TR4 A;  3D4M A;  5CAX A;  2D2Z A;  2P0G A;  4MZW A;  2GQM A;  1X9M B;  3P7X A;  2X4A A;  2YP6 A;  1MDI A;  4MMM A;  2H0I A;  2IY2 A;  1BAY A;  4MJE A;  1SL1 B;  3FKF A;  1OKD A;  1XWC A;  2I1U A;  2FWH A;  5ENU A;  5HR2 A;  3ED3 A;  2A2S A;  3EYT A;  4IJ3 A;  4LL1 B;  3L9S A;  1TK8 B;  3ZMK A;  4ECB A;  1U6T A;  1G6Y A;  14GS A;  2JZT A;  3IK9 A;  1OC9 A;  4P3Y B;  5J4U A;  2DJK A;  2DKI A;  1ZL9 A;  4USS A;  3CTG A;  2GS3 A;  3O76 A;  1UA5 A;  3A5W A;  3CSJ A;  3TOU A;  3TCO A;  4HJ2 A;  1B9X C;  3CYN A;  1YDK A;  3HKR A;  2MBS A;  3ZRD A;  3KMN A;  3IAM 2;  4GRF A;  2OAD A;  1NHY A;  5ID2 B;  4YKF A;  3HZ8 A;  2TRX A;  1Z5Y E;  2H1B A;  4MZB A;  3Q6O A;  4EUY A;  3L9V A;  1BJX A;  5H5Q A;  3M9J A;  3ZVJ D;  1XW9 A;  1TDI A;  3LWA A;  2BTO T;  3L4N A;  2VLU A;  4K5R A;  2H6Z A;  2R6K A;  1VRS D;  4K7O A;  3S9F A;  1FOV A;  4XRA A;  2WFC A;  2FHE A;  5F05 A;  1AUC A;  1GH2 A;  2RII A;  4JR4 A;  1GSF A;  3EU4 A;  1K3O A;  1SYX A;  1FB6 A;  1V2A A;  2HSY A;  1PX7 A;  3DRN A;  4DSQ A;  3IHG A;  3ERG A;  4F2I A;  5G1L A;  3CBU A;  3NOF A;  1XWG A;  4XRD A;  2IJY A;  1SL2 B;  1Q4J A;  2AV4 A;  4K2D A;  2R2J A;  5DAK B;  3FR6 A;  2C3Q A;  1G7E A;  2LTK A;  2CX3 A;  3D22 A;  1TRS A;  2F3M A;  3F63 A;  1K3L A;  4NV2 A;  4OWY A;  2I81 A;  4MP4 A;  2GQK A;  2KOK A;  1EWX A;  3Q19 A;  3H8Q A;  4LL4 B;  1Y25 A;  2XBQ A;  5J9B A;  2V6O A;  1E2Y A;  4PUF C;  2IPA A;  5G5F A;  3H79 A;  2OBK A;  2YZH A;  1AC1 A;  1FO5 A;  4G9H A;  1R5P A;  3VWX A;  3A2W A;  1ABA A;  4HI7 A;  2KP2 A;  3PPU A;  5IMD A;  4K5S A;  5LNK e;  3FHK A;  3UOM A;  3KCM A;  2IN3 A;  5DDL A;  4Q5Q A;  2E7P A;  1XXU A;  2B1K A;  1JHB A;  2K18 A;  4KE3 A;  1XVW A;  3QAG A;  5ID2 A;  1CQH A;  3EC3 A;  1SKS B;  3APQ A;  2VD0 A;  2AUV A;  5JWR B;  1K0N A;  3VLN A;  5JWQ B;  3A5I A;  1WWJ A;  1QK8 A;  4V2N A;  3D4T A;  5GZZ B;  3IAS 2;  1B4Q A;  3HVX A;  3UEM A;  4JBB A;  3VK9 A;  1OYJ A;  3TJK A;  3E0U A;  4DSR A;  3GFK A;  5DAL B;  3FMW A;  4K7I A;  1V9W A;  2DJ1 A;  1PRX A;  3DEX A;  4N11 A;  3W8J A;  1F9M A;  4HEA 2;  3R3E A;  2YV7 A;  4KUN A;  5COH A;  3TKP A;  4TR1 B;  1EV4 A;  1TU8 A;  4EVM A;  3MIX A;  3US3 A;  3GX0 A;  4GWR A;  5IPH A;  3IHQ A;  2MMN A;  1QFN A;  2GLR A;  5E4W A;  1SD9 A;  2IYJ A;  5KN1 A;  5J3R A;  5DAK A;  2N5A A;  1X0R A;  2B7K A;  3EUR A;  5JCU A;  3QDN A;  4KND A;  2HRF A;  5CRD A;  5IOW A;  4RUV A;  3R2Q A;  2VM2 A;  1MD4 A;  4ZB6 A;  3HXS A;  2EC4 A;  3ISO A;  5B6N A;  4OFM A;  2P31 A;  3C8E A;  1UN2 A;  2GDR A;  2C1Y A;  3UBL A;  3DVX A;  1SYR A;  5HFG A;  2VIM A;  3UAR A;  1AAZ A;  1HNC A;  2LST A;  5KN0 A;  1KEB A;  2VL3 A;  1M2D A;  4Q5F A;  4TXO B;  3A2X A;  4GSN A;  4ZL9 A;  1GRX A;  3KP8 A;  3GH6 A;  2CZ2 A;  3EU3 A;  2NBS A;  2K9F A;  4AJ6 A;  2ES7 A;  2PWJ A;  1WRY A;  4G0I A;  3F4T A;  4NWY A;  6GSX A;  2VLV A;  2CX4 A;  1SD8 A;  1MTC A;  1GTA A;  5B8B A;  2ALB A;  3ZTL A;  1O8X A;  1A24 A;  2VM1 A;  4WBJ A;  2TRC P;  2BJX A;  4WF4 A;  2H1D A;  4F82 A;  1M2B A;  1M0U A;  1ERV A;  2KHP A;  2KLX A;  2EIQ A;  5DAL A;  6GSY A;  2WB9 A;  4ZXG A;  3TRP A;  1PN0 A;  1RK4 A;  2FCH A;  2FWE A;  2ZCT A;  5ECN B;  4O5Q A;  1DBY A;  5G5E A;  3HDC A;  3EMP A;  3LGC A;  3MNG A;  3AY8 A;  3IC4 A;  4OO5 A;  1TW9 A;  5A4V A;  3EVI A;  1HD2 A;  1PGT A;  3DML A;  4KCA A;  3UL3 A;  5D9W A;  5B7C A;  2H19 A;  5D73 A;  2GZY A;  4IHU A;  3GTU B;  2P5R A;  1O6J A;  2O89 A;  5HR0 A;  4KH7 A;  3IRA A;  2X64 A;  1NW2 A;  5GAP D;  1KTE A;  1QXH A;  3TJF A;  1EP8 A;  4TR0 A;  2LRT A;  1OAZ A;  4IQ1 A;  2JSY A;  1XBS A;  4FQU A;  2HRK A;  4WET A;  2LRN A;  3KD0 A;  3WGE A;  2X8H A;  5FWG A;  1NHO A;  4YH2 A;  4BVY A;  1J9B A;  5KN2 A;  4ML6 A;  4ZBA A;  4NAX A;  2L5L A;  3F9U A;  2WCI A;  2FWG A;  2IMF A;  3FR9 A;  1Z6M A;  11GS A;  4LLR A;  4EE0 A;  1EOG A;  2R4V A;  4EDZ A;  1AIU A;  2MMA A;  3LYP A;  3UAP A;  3FK8 A;  4I5Q A;  4RI7 A;  5EL8 A;  3GKM A;  4KDU A;  4OCE A;  4YQU A;  2HZF A;  1URM A;  2B6M A;  1B4P A;  1YF0 A;  2X99 A;  2L5O A;  5CO3 A;  2H66 A;  2JAD A;  2WUL A;  4OO4 A;  1ERU A;  5ECM B;  1O85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...