1V57A

Crystal structure of the disulfide bond isomerase dsbg
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
b'ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 68
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v57A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v57A03
1FB6A 2G2QA 2VCXA 2MBSA 2PPTA 2ON7A 4XRAA 4POKA 4N30A 16GSA 1A0FA 3VWUA 3KZQA 2QGVA 2MMNA 1XBSA 4IQAA 3MNGA 2LSTA 4JRRA 1V40A 3TUEA 3WT2A 2JU5A 3NZNA 4KA0A 3TOUA 4L8EA 1TU7A 1A2LA 4WR5A 1TK8B 3J7Yk 4ECBA 3GNJA 19GSA 2IN3A 5COHA 2LRNA 2YPMA 1MDKA 4YQVA 2FWEA 2I4AA 2MZCA 4GTUA 4N11A 2GTUA 2CVDA 4KH7A 1K3OA 1U3IA 5ECQB 2OE1A 5EY6A 4IW9A 3LSZA 1H4OA 2I1UA 3G7JA 4NXIA 1N2AA 2X8GA 5JWQB 5GSTA 17GSA 5AN1A 1GSUA 3QMXA 4O5RA 4OFMA 5HR2A 4IJIA 2X99A 4XHMA 2H66A 2A2RA 3CBUA 1PGTA 5ECMB 3ZL5A 4OO5A 1G6WA 3QFAC 2VAFA 4JU5A 2LS5A 2OADA 1IYIA 3D5JA 1U6TA 3D6IA 4KUNA 3WGDA 12GSA 4TXOA 4XS6A 2HNLA 3M9JA 2JL4A 4X0XA 1SYRA 4KCEA 1AQVA 1OC3A 3TJBA 5DVBA 2JZTA 1PKWA 1A2JA 3APQA 5J9CA 1WP0A 2IMEA 5EPFA 1S3DA 1OC9A 2WRTA 3HXSA 3RAZA 1OAZA 2AV4A 2H0GA 5IOWA 3GL3A 4H86A 4WBRD 3L9UA 4G19A 4P3YB 4V1Ap 1QQ2A 4MDCA 2WZ9A 1WMJA 4GSSA 4MABA 5L71A 1SJZA 4GWRA 1K0MA 2E7PA 1TRVA 4GSNA 2RM5A 4MF5A 3Q18A 5IMDA 3LQ7A 3APOA 2I81A 2C0EA 4WKWA 4OCFA 3TJJA 5DALB 2R4VA 4J56E 1EGOA 5CREA 4IP1A 2HSHA 3GSSA 2LJRA 3ISOA 1XVWA 4L5LA 5CYYA 2RUFA 2OE3A 1O73A 4IS0A 4EO3A 4XS1A 3US3A 6GSTA 1FVKA 4KW6A 4TR3A 3FZ9A 3TJGA 3EC3A 6GSVA 3UL3A 1Q98A 3ZZXA 2DJKA 3FY7A 4DSRA 14GSA 2MMOA 4MA9A 11GSA 1RQMA 1K0AA 3M3MA 4YAPA 2DLXA 2PWJA 1GTBA 4JE1A 3RHBA 5CP1A 4AJ6A 1B4PA 3QDNA 4KNDA 1Z7PA 4TXOB 3GFKA 3MWHA 2F8AA 3HKRA 5E4WA 1PA3A 1GUKA 1BX9A 1BQ7A 4HDEA 6GSWA 2F8FA 4Z7XA 2H71A 5IPHA 4KSMA 3RDWA 3F4TA 1JHBA 1J0FA 3FR3A 2CZ2A 2JACA 3CRUA 4PURA 3I43A 4YQMA 3VWVA 3PGTA 2LNTA 1X5DA 2IMDA 3RPNA 5FT3A 3MDKA 2O89A 3M1GA 18GSA 2DC5A 5FWGA 1PX7A 3EMXA 5D73A 3HVSA 3TJKA 1PN9A 3UVHA 5A4UA 4MH2A 5EVOA 3O76A 3GKKA 1XW5A 2R2JA 1FAAA 5J9BA 1B9XC 2L59A 4ZB8A 4NV5A 1V58A 4ZILA 4POMA 3HJPA 5GSSA 4XCSA 3TKSE 4LLRA 1XFLA 2OKAA 3EE2A 4MP4A 4YH2A 4PUFC 2VO4A 4X43A 5FHIA 5A5KA 4QQ7A 1X9SB 2RIIA 5IOXA 3H1NA 4MJBA 2L4QA 5B6NA 3ZYWA 2H01A 1T00A 6GSYA 5HR3A 1T4ZA 2FGXA 3FZ5A 1G7OA 1Z9HA 2VLVA 3KP9A 4GLTA 4K9ZA 22GSA 1UN2A 2LJKA 2M72A 2H1GA 4NHWA 9GSSA 1EEMA 1GTIA 3IAM2 3KEBA 2FNOA 2H1BA 3EU4A 2IY2A 2VCWA 1JZWA 1FW1A 1WPIA 5ECOB 3GUSA 2EIRA 4PXOA 1U87A 4HZ2A 2GSQA 1FO5A 1B48A 2OACA 3C1RA 4N10A 5J5NA 5LCZA 3W6GA 4BL7A 4I5QA 5ELGA 2EIQA 3Q6OA 2GQLA 3LFLA 3O6TA 3LJRA 4FH8A 4ILFA 2IMIA 5D9XA 2GDRA 1XOAA 3QFBC 2QSIA 4PQ1A 3IRAA 1EWXA 3L0HA 3DMLA 2DSAA 4JR4A 4TKYA 5HFIA 1MD3A 3L9VA 5JCUA 3KXOA 1Z3EA 6GSSA 1C72A 4MF7A 1SD9A 1VF1A 4EUYA 3GKNA 5H5RA 3GA4A 2YWNA 1ZYQB 4O7HA 3LXTA 2H73A 3P8WA 4O92A 1CQHA 1K3YA 3TCOA 1F3AA 1T4YA 2LEGA 1YY7A 4F0CA 2L4CA 1TRSA 3V1WA 1R26A 4XS4A 1IYHA 1OE7A 1EV9A 3IA1A 4BWQA 3IR4A 2TIRA 2AJQB 2GZPA 1X9WB 2AAWA 3HHVA 2A4VA 2FUG2 3TOTA 1K0BA 3HYPA 1SK1A 3N5OA 1XXUA 3M0FA 3HJOA 2VCQA 5F05A 3VI7A 2YP6A 1U3AA 4L0WA 5G31A 3F0IA 4KCAA 3NOFA 3HVXA 1F6MC 4ZL7A 3FR6A 3U6VA 4BVYA 1NHOA 3TKSC 1OYJA 1YF1A 5ECLB 3GH9A 1TDIA 3WT1A 4F0BA 5ECIB 4ZBBA 2VD1A 3HA9A 3TRXA 3FK8A 3PR8A 2L5LA 2X64A 5DBQA 4L5OA 2B3SA 3C7MA 1OC8A 3KTLA 1VGLA 4KDXA 6GSUA 2P0GA 4TRXA 3PH9A 1YQ1A 1O8XA 4K7IA 1GP1A 1KEBA 2KP1A 5CO3A 3ERWA 1XW9A 2V6OA 1ERTA 2B6MA 4ECCA 3ERGA 1MD4A 4IGJA 2GGTA 2N5BA 1M9AA 4ULXA 3WD6A 4F9ZA 3CTGA 3GYKA 5IMAA 1TRUA 4K7NA 2V2GA 5LD0A 2DJ3A 2D2ZA 3LXZA 1XIYA 4EE0A 1SJ6A 2N5FA 3GX0A 1SENA 4GF0A 3WGEA 1YKAA 5G5EA 4EDZA 2ON5A 2XHFA 2G0FA 3UIWA 3MAKA 4XS4B 5IM9A 4L0UA 1TOFA 3FW2A 3A2VA 1Z6MA 1VRSD 1T7PB 3A2XA 3A5WA 1A24A 2VLUA 1GUMA 3TKPA 1W4VA 1KTEA 2H76A 1HD2A 2PN8A 4ML6A 2FLSA 4ZIJA 1ZYEA 4O32A 2C8UA 2IMFA 4MJAA 4EKZA 3C73A 4F03A 1V2AA 3E0UA 4HU9A 4POBA 5INYA 3ZTLA 1ZZYA 3FKFA 1SD8A 3LG6A 1THOA 3CSIA 3TKSA 3ZVJD 2DJ1A 1H75A 3HZ8A 2EIOA 3CXGA 2F9SA 5ID2A 3H93A 5JCGA 4MPFA 2HZFA 1PKZA 2YJHA 3G7IA 1BAYA 3G9BA 1GWCA 3P90A 5F06A 2EC4A 3UARA 3VFIA 1E2YA 4GCIA 2GT6A 1LU4A 4NPBA 1TJDA 4V1Ag 5KN3A 4DSSA 3CTFA 2K6VA 2YANA 1TK0B 4DSQA 4EF0A 1TI3A 3C71A 1T1VA 1HNCA 1R5AA 2GQMA 3EVIA 1B4QA 4PNFA 2IFQA 3ZIJA 5F07A 3GURA 1XWAA 2CAIA 5GZZB 2VCZA 1AC1A 3KH9A 3P2AA 5GAPD 3UJ1A 3VURA 2YV7A 1S3CA 5HFGA 2Z9SA 1ZOFA 3DD3A 5HQPA 2YCDA 5ENUA 2YNXA 5C04A 2CZ3A 1GULA 5KN1A 5DCHA 3IDVA 1XW6A 4HI7A 3RBTA 1OKDA 2GZYA 2KHPA 5AISA 2QC7A 1XOBA 1I9DA 2R37A 5KN0A 3U5RE 1HQOA 3NIVA 5C00A 4GQFA 1K0DA 1MDJA 1QK8A 3UOMA 2YZHA 4KE3A 4EL1A 2LUSA 3W8SA 2O87A 2ZNMA 2JADA 2PERA 1GH2A 1W89A 5IMZA 4TR1A 3IBHA 2HI7A 5A4VA 1TXXA 4G10A 13GSA 3LGCA 2WCIA 4NV2A 4NWYA 1YDKA 3E3EA 2MMZA 1GUHA 2B1LA 4N0ZA 3F8UA 3RHCA 1A2MA 1SKSB 4TW5A 5D9VA 3D4TA 5G5FA 4OD7A 2H70A 3I9V2 2B5XA 4KDUA 3LYKA 3ZFLA 1XCCA 3BCIA 1SJIA 2C3QA 2C1YA 2WULA 3EURA 5LNKe 4I8BA 1M0UA 1EP7A 3L78A 1M2AA 2P5QA 10GSA 4K6XA 5IPGA 2DJ0A 4WETA 4WBJA 4GXZA 4EXJA 2N5AA 2DBCA 4PNGA 1XWCA 3CSHA 2IFQB 2X8CA 3S9FA 1DSBA 2F51A 3APSA 1OC9B 4CDOA 3FHKA 1NSWA 4JZQA 3KIJA 4IP6A 3M9KA 2IL3A 3CSJA 4AGSA 2FA8A 2P31A 4BVXA 4KB3A 4LMWA 2OE0A 3QD9A 2HZEA 4OMVA 2YWMA 4I6XA 3KH7A 1Q4JA 1V98A 2C0FA 2A2SA 4ACSA 3DWVA 2MYGA 5DAKA 3KGKA 3KCMA 4FYUA 3GHAA 4I2TA 2V41A 4GSTA 1BYEA 3EINA 2L6CA 2NPBA 2PVQA 4TR1B 3HJMA 3D0ZA 3VI5A 1UA5A 5D9WA 3EU3A 4WXTA 4Q5FA 1S3AA 2TRXA 2RLIA 3PINA 1QUWA 2C0GA 4XIHA 2WDUA 1GNEA 1WE0A 1O85A 2K8SA 1GSEA 3TKRA 3KMOA 4HJMA 3TGZA 3F4SA 2XBIA 4NAXA 3BD2A 3BCKA 4V2LA 1RK4A 3VLNA 2H1AA 3H79A 2CVKA 2H19A 2LNSA 3GN3A 4LL4B 3SWLA 1X5EA 1MDIA 1K0NA 5IO0A 4WR4A 4TOPA 3FR9A 4WEYA 2H74A 3F9UA 5G1LA 3K8NA 1JZDA 5DCGA 5J4UA 2VL3A 2MBTA 3VK9A 2H6ZA 1SU9A 2I3YA 1ST9A 2F3MA 3M8NA 3BOAA 2YJ7A 1EOHA 1BG5A 1UVZA 3H4KA 1AUCA 5IMVA 3FYGA 3BBYA 3G7YA 5DQSA 1N8JA 2VL9A 4HUAA 4ISDA 1OE8A 2C3NA 3HDCA 1QMVA 3CMIA 1ERVA 4HS1A 3DIEA 4XTSA 5CRDA 2JZSA 2HZEB 3GRXA 1X9MB 5KN2A 1THXA 3N9JA 1QFNA 1TTZA 1ML6A 3WYWA 3DVXA 3DKSA 4OWYA 2H8LA 4EC0A 1U88A 2XPEA 2YOIA 2IWTA 2CAQA 1Y6EA 3TJFA 3KD0A 3GTUA 3L4NA 3HD5A 5E59A 1OVNA 3TRPA 3A2WA 1SKRB 1R5PA 2HRNA 3IK7A 1GSFA 2NBSA 1PL1A 4MZCA 3D4MA 5H5QA 1K0CA 3IPZA 2GZZA 5DJLA 2M80A 5DQYA 1CQGA 3KP8A 2VCVA 4JR6A 2GVPA 3ME8A 4JBBA 2MMAA 2LTKA 20GSA 4I97A 2R5GA 4IBPA 1A23A 3KM6A 5IMFA 8GSSA 1FG4A 4LL1B 2PBJA 3IC4A 2YWOA 1YJ6A 2FHEA 3ZRDA 1VF3A 2OBIA 4HOJA 2C80A 1WOUA 4PX1A 4AJ7A 1VF4A 2BJXA 2IMKA 5IMCA 3RPPA 1USBA 2HE3A 4WF4A 3WGXA 2B7JA 5HFKA 2H30A 3TDGA 3DYRA 3LYPA 2YN1A 1GTAA 1ZL9A 4MZWA 2I9HA 4IELA 2HYXA 3HY2A 2DMMA 1JZOA 2B5YA 5ECKB 2VUPA 3F63A 4OO4A 4ECJA 5ELAA 1WJKA 2YWIA 3FEUA 1AXDA 2FWFA 4EDYA 2C3TA 2OBKA 3Q19A 1F2EA 1GSSA 1QGVA 2HSYA 3F6DA 3SBCA 3DEXA 2KOKA 2IYJA 3DXBA 1AQXA 1YEXA 2L6DA 1Z5YE 5CNWA 2VL2C 5IQYA 3HCZA 3LORA 4ZBAA 4RI6A 5G1KA 4GQCA 1GRXA 1R4WA 3UBKA 4JEDA 2XC2A 4QL7A 1E6BA 1A8LA 2E2GA 5HR0A 3GV1A 1DUGA 1O8WA 2PMTA 1HNBA 3IK9A 3DGQA 2WGRA 1DBYA 4OCEA 5CRHA 3HVVA 4PUAA 1M99A 4E8HA 3TKQA 1JFUA 2GSTA 2VIMA 1TKDB 1YZXA 4ECIA 3QAWA 1SK0A 2H1DA 3I69A 4J57E 5GAND 2C0DA 4Q5NA 1SL1B 2LJAA 4POLA 4OFTA 1G6YA 1G7EA 2BTOT 4QL9A 2DJJA 3UEMA 1A8YA 1HYUA 5DALA 1RW1A 2O85A 4ML1A 4TR0A 3OR5A 2IIYA 2OA7A 1I5GA 3I6AA 5CRWA 5ECHB 1J08A 1JLVA 5IIZA 4ZL8A 1GTUA 3ZMKA 5B7CA 3C1SA 2FA4A 4ZXGA 3J7Yb 2V6KA 3QPMA 3VWXA 2AYTA 4Q5RA 2WS2A 3O3TA 2ES7A 1EZKA 1DE2A 4I2UA 3QCPA 1YEPA 3ERFA 2E2MA 4FYCA 5G30A 2H0HA 4V2NA 3C8EA 4FIWA 1GSYA 2LQQA 5J3RA 2VCTA 2VL2A 1EGRA 5EL8A 1F37A 2HRFA 1O81A 2LRTA 2IJYA 2FY6A 4HU7A 3TRQA 2DIZA 2PU9C 4ZBDA 3KJYA 2CQ9A 2PUKC 1PMTA 1PSQA 3CRTA 4YAVA 4EVMA 4K7OA 4IHUA 3FRCA 4RQRA 4CHSA 2WFCA 4KAEA 2BMXA 4RI7A 1B9YC 3W8JA 1UC7A 2GLRA 4MF6A 4K8MA 1HNAA 3EYTA 2AHEA 1SL2B 5ECPB 3ED3A 2CX4A 2XBQA 3GL5A 1TU8A 1GSQA 1PRXA 3ZFBA 1WIKA 4HJ2A 5ID2B 4AF2A 2CX3A 3IHQA 1WRYA 4MJEA 1AW9A 3ZMLA 1GLQA 2J23A 1O7UA 2LQOA 5DJMA 4KSOA 5ECNB 4K0GA 2KUCA 2V32A 1ERWA 2X8HA 1ZGNA 2CV4A 1XPVA 1ABAA 2CA8A 1ILOA 5D9TA 4DSSB 4RUVA 2J9HA 4MCUA 1EEJA 4IKHA 5D93A 5ABRA 1SK2A 2HFDA 2GSRA 1Z7RA 3KTBA 3LEFA 4MK3A 4MMMA 2CVBA 4IN0A 2FCHA 2WB9A 3IXRA 2ZUPA 3E9JB 4D73A 5B8BA 1QXHA 4HQZA 1SYXA 5IO2A 1TRWA 2V1MA 2M46A 2RM6A 5JCWA 2B5EA 3MSZA 3R2QA 1EOGA 3IOSA 3F3RA 2TRCP 4MLYA 2JSZA 3VPQA 1XVQA 4XRDA 3D22A 4PGTA 3QR6A 3A3TA 1X0RA 4V2MA 2P5RA 1PD21 3GSTA 2ALBA 3ME7A 5AIXA 1YF0A 4X1UA 1Y25A 4HZ4A 4F2IA 4FYBA 4TN8A 3KMNA 4MH3A 2RUEA 3D21A 4TXVA 2H72A 1ZCPA 1AAZA 2GS3A 2YV9A 1JLWA 3Q74A 4NMUA 2C4JA 3GH6A 2JZRA 1NM3A 3F4RA 5F8BA 1FOVA 1ZMAA 4BPYA 1O6JA 5D8IA 1ACVA 1KNGA 1URMA 1YKCA 2VLTA 4CW9A 5G2ZA 2ZCTA 1T8EB 3L9SA 4TVEA 1X5CA 5AIVA 5HR1A 4ZB6A 2E0QA 2L5OA 4IJ3A 2YZUA 3HZ4A 4G9HA 2FD3A 2H6XA 1GSDA 1MEKA 1F9MA 4GRFA 1KBNA 2K8VA 1SL0B 2DIYA 3FZAA 4PQHA 5F0GA 2R6KA 2GSSA 5JWRB 3DRNA 3QAVA 2JSYA 6GSXA 1BEDA 2O7KA 2FWHA 5D96A 3GMFA 4RQXA 3ZIVA 4D73B 2PVOC 3DVWA 1BJXA 2DMLA 3IV4A 3GKXA 5H5SA 1M2BA 2FWGA 2XPDA 1TK5B 2K18A 1FVJA 4HEA2 3VWWA 2LKUA 4E8EA 4N0VA 1XZOA 5ECRB 3H8QA 4IVFA 1B8XA 5JWOB 2LRCA 2VOCA 1TW9A 5DAKB 1LBKA 2O8VB 1AIUA 5KEJA 1Z6NA 1J9BA 4YQUA 1XWGA 2IPAA 4ID0A 1GLPA 3ZVJA 2B1KA 4DVCA 2REMA 2NDOA 4DEJA 2H0IA 2LV3A 1T3BA 2GQKA 4LA1A 2CT6A 1LJRA 4KGIA 3FZ4A 2NVLA 1G0TA 2HT9A 1FHEA 1ON4A 1AQWA 4LMVA 1NW2A 1DE1A 3LWAA 1F3BA 1M7TA 1PL2A 2H6YA 4K0NA 1EP8A 1TP9A 3EMPA 1JZRA 3CYNA 1FB0A 4MZBA 1MTCA 7GSSA 2QKEA 1SKWB 3VPTA 2AUVA 2DJ2A 2KLXA 4KDYA 4PQIA 3TB2A 1A0RP 4F82A 2OJLA 5AGYA 1K0OA 4OFNA 3ZITA 4NHZA 2VD0A 3P7XA 5DDLA 5B6MA 3EWLA 4BA7A 1M9BA 1PX6A 1NHYA 2B7KA 2WJUA 2VM2A 2K9FA 5CAXA 5CRGA 4TR4A 1GNWA 4MPGA 3GIXA 3UVTA 1GL8A 2L57A 1K3LA 3ZREA 5ECSA 3UBLA 1R7HA 4FO5A 2KP2A 2R3XA 4WF5A 1XWBA 3IE3A 3F3QA 3UMAA 2AB6A 3GX8A 4KX4A 4K1FA 1V57A 2VM1A 4K2DA 1VF2A 3BJ5A 3ZLPA 4HQSA 4ZL9A 1PQNA 4AJ8A 4Q5QA 4MJCA 1WWJA 2HXKA 1ERUA 4G2EA 2GT5A 3GKMA 5A4WA 1XWKA 4BWSA 1V9WA 2HLSA 4ZB9A 1OKTA 3QAGA 3JCML 2NTOA 3AY8A 4IQ1A 3F6FA 5B8AA 1EV4A 4J2FA 3IAS2 1TI1A 3QOUA 3GTUB 3UAPA 5J41A 2PGTA 2H75A 1M2DA
chains in the Genus database with same CATH superfamily
1FB6A 2KCDA 3RNTA 2G2QA 1KC84 3KSPA 2VCXA 1UCKA 3D9RA 2MBSA 1KD14 2PPTA 5M1AA 2ON7A 3DMCA 1HZ1A 4EV2A 4XRAA 2W04A 4POKA 4N30A 16GSA 3IC8A 1A0FA 3F40A 3VWUA 4EC6A 2DKHA 3KZQA 2QGVA 2MMNA 1XBSA 1F8NA 3Q2PA 3MNGA 4IQAA 2LSTA 3MYTA 4JRRA 1V40A 3TUEA 3FF0A 3WT2A 2JU5A 3NZNA 4KA0A 3TOUA 4L8EA 2M7OA 1TU7A 1A2LA 4WR5A 1TK8B 3J7Yk 4ECBA 5HOHA 3BNBA 3GNJA 19GSA 2IN3A 5COHA 3CXC2 2LRNA 1X1WA 2YPMA 1MDKA 4YQVA 1Y4KA 2FWEA 2I4AA 2MZCA 1LRAA 4GTUA 3FZWA 1W2B2 1YHQ3 3NX0A 4N11A 1OHSA 3SVAA 2GTUA 2CVDA 4KH7A 1WQLB 3JVCA 1W6GA 4G0LA 1K3OA 1U3IA 5ECQB 2OE1A 2WOFA 1M3JA 5EY6A 1GD4A 3FCSB 4IW9A 2K0MA 3LSZA 1C54A 4LZIA 1E3RA 1H4OA 2I1UA 2YX9A 3G7JA 5BVBA 4NXIA 4Q53A 1N2AA 2X8GA 5JWQB 5GSTA 17GSA 4O02B 5HGRA 1R4CA 1U5OA 3OXAA 7STDA 3MIXA 3LW9A 5AN1A 1RGAA 3HX8A 1GSUA 3QMXA 1HU9A 1TRPA 4O5RA 4OFMA 5HR2A 3EBTA 4JRFA 1RMSA 4IJIA 2X99A 4XHMA 2H66A 2A2RA 5ELUA 1PGTA 3CBUA 5ECMB 3ZL5A 1FGTA 5D83A 4OO5A 1G6WA 3QFAC 2VAFA 4N6LA 3B8LA 3A5EA 4JU5A 2LS5A 2OADA 1IYIA 2QGUA 2Z76A 3D5JA 1U6TA 4ICYA 8CHOA 3D6IA 4KUNA 3WGDA 12GSA 3ROBA 4TXOA 1VQ83 4XS6A 2CFWA 2HNLA 4BTWA 3GZYB 4K90B 2JL4A 3M9JA 3MYDA 4X0XA 1SYRA 4KCEA 1AQVA 1OC3A 3TJBA 2WGQA 1BSDA 5DVBA 2JZTA 1PKWA 1A2JA 5IEOA 4X2OA 3APQA 5J9CA 1WP0A 3DM8A 2IUJA 2IMEA 3KFQC 1RCLA 2O3OA 2W2CA 5EPFA 2AADA 1O7HB 1S3DA 5CXOA 1OC9A 1UCJA 2BMRB 2WRTA 1BSEA 3HXSA 5CK6A 3RAZA 1CH0A 3X40A 1OAZA 2AV4A 2H0GA 5IOWA 1DMNA 3GL3A 4H86A 4WBRD 3L9UA 4G19A 4FR9A 4P3YB 6RNTA 4V1Ap 1I2EA 2BO9B 3F8XA 4GL6A 1SQWA 1QQ2A 4MDCA 5IW9A 2WZ9A 1WMJA 4GSSA 4MABA 5L71A 1SJZA 4GWRA 2P09A 5AIGA 4FMCA 5AIIA 1K0MA 3LZAA 1Q814 1TRVA 2E7PA 2RM5A 4GSNA 4MF5A 1JKGA 2QA1A 3Q18A 5IMDA 3LQ7A 3APOA 2I81A 2C0EA 4WKWA 4OCFA 2XGNA 3TJJA 5DALB 2R4VA 2X4AA 4J56E 1EGOA 5CREA 3OWUA 4IP1A 2HSHA 3GSSA 2CKFB 2LJRA 2A2PA 1GD3A 3ISOA 1XVWA 1I70A 4L5LA 5CYYA 2RUFA 2OE3A 1UGHI 1RGGA 3Q3FA 1O73A 4IS0A 4XS1A 4EO3A 3US3A 6GSTA 1RGEA 5AIHA 1FVKA 4KW6A 2Y73A 3L0RA 4TR3A 3FZ9A 3TJGA 3EC3A 3AMOA 6GSVA 3DGMA 2D42A 2BNGA 2CHCA 3UL3A 1Q98A 4O3VA 2DJKA 3ZZXA 3FY7A 4DSRA 3EX9A 1W7CA 1FOHA 4HYZA 14GSA 2MMOA 2RNTA 4MA9A 11GSA 1RQMA 1K0AA 3M3MA 1TU5A 4YAPA 2KF4A 2DLXA 3WOEB 1B21A 3K63A 2PWJA 1GTBA 3UJMA 4JE1A 4ORLA 4TX4A 1RGHA 5CP1A 3RHBA 4AJ6A 3MPHA 1B4PA 5KP3A 4XDWA 3QDNA 4KNDA 1Z7PA 1JBTA 4TXOB 3GFKA 4L7KA 1RCKA 3MWHA 4IIAA 2F8AA 3HKRA 1BNSA 3RGRA 2KF3A 1BGSA 4BU4A 5E4WA 1I2GA 1PA3A 1D6UA 1AV4A 1GUKA 4EIPA 1BX9A 1BQ7A 4HDEA 6GSWA 2ZHXB 2F8FA 2H71A 4Z7XA 5IPHA 4KSMA 1I8VA 3RDWA 3F4TA 3IHGA 1J0FA 1JHBA 3FR3A 1WMOA 2CZ2A 5IG5A 2JACA 3CRUA 3EN8A 4PURA 3I43A 4YQMA 2SBLA 4KVHA 3PGTA 4KFDA 2LNTA 3VWVA 1X5DA 4Z2RA 2IMDA 1G96A 3RPNA 5FT3A 3MDKA 2O89A 2BMQB 3M1GA 1BSAA 18GSA 2DC5A 5FWGA 1PX7A 3EMXA 1YJ93 1DVDA 5D73A 4ZM8A 3HVSA 3TJKA 3PPUA 2HMJB 1IU7A 3WDGB 1PN9A 3UVHA 3IPTA 5A4UA 2QIYA 2V1LA 1RGKA 4MH2A 5EVOA 3O76A 3GKKA 1QMAA 1XW5A 1LNHA 3G4S3 1NJI4 3I0YA 3X3ZA 1M9GA 2R2JA 3URPA 3GSPA 1FAAA 5J9BA 3ZG5A 2JDIH 1GOYA 1B9XC 2L59A 4ZB8A 3UB1A 1YJW3 1NB3I 2R0GA 4LMIA 2JQ5A 4NV5A 1EKMA 1A2KA 1V58A 4ZILA 4POMA 3HJPA 5GSSA 4XCSA 3TKSE 4LLRA 1XFLA 2OKAA 3EE2A 4MP4A 4YH2A 4PUFC 4FMDA 2RGQA 2VO4A 4X43A 4HM7B 3X41A 5FHIA 5A5KA 4QQ7A 1X9SB 1IVUA 2RIIA 1K41A 4OK0A 5IOXA 2CWVA 1JB2A 3H1NA 4MJBA 2L4QA 5B6NA 1BVIA 3ZYWA 2H01A 1T00A 1TTOA 1W6YA 1OGZA 6GSYA 1T4ZA 4XBTA 1MOLA 5HR3A 2FGXA 3FZ5A 1LXEA 1G7OA 1Z9HA 2PZVA 1B27A 2VLVA 3KP9A 4GLTA 4HZ9B 4K9ZA 22GSA 1QVF2 2OOVC 3CCU3 5IG3A 1D6ZA 1UN2A 2LJKA 2M72A 2H1GA 4NHWA 9GSSA 1S5AA 1EEMA 4MMZB 1GTIA 1BAOA 2CFLA 5AIFA 3IAM2 3KEBA 2FNOA 2RSXA 2H1BA 4EV5A 3EU4A 2IY2A 2VCWA 1JZWA 2W9QA 1FW1A 1WPIA 3FGYA 5ECOB 1SIHA 3GUSA 2EIRA 4PXOA 2HRAA 2AAEA 3EC9A 1U87A 4HZ2A 1TRQA 2GSQA 1QALA 3HVNA 1B48A 2OACA 3C1RA 1FO5A 4N10A 5J5NA 1NO3A 3NBBA 5LCZA 2R0CA 3W6GA 4BL7A 5BU4A 1IT8A 4I5QA 3SX1A 4FCJA 3CCJ3 3SLUA 5ELGA 2EIQA 3Q6OA 2GQLA 3J7Yd 1FGOA 3LFLA 1VQQA 2B1XB 3O6TA 4GB5A 3LJRA 4FH8A 4ILFA 3UL6A 2IMIA 4HAAA 3DGYA 5D81A 2GDRA 5D9XA 3NBRA 1XOAA 3QFBC 2QSIA 4PQ1A 3IRAA 1EWXA 3L0HA 1ASKA 3DMLA 2DSAA 4JR4A 1PYLA 4TKYA 5HFIA 1MD3A 3L9VA 3FKAA 5JCUA 2P0XA 3KXOA 1Z3EA 6GSSA 1C72A 4MF7A 1YIT3 1SD9A 1VF1A 2CFDA 4EUYA 3GKNA 5H5RA 3GA4A 2YWNA 1GOVA 1ZYQB 4O7HA 3LXTA 2H73A 1BRGA 3CPW2 3P8WA 1K9M4 1LOXA 1ULIB 4O92A 1CQHA 4Z2TA 1K3YA 3NXJA 2BT3A 3K9MC 3TCOA 3KCHA 1F3AA 1T4YA 2LEGA 1YY7A 4F0CA 1I0XA 1AR0A 2L4CA 1MNLA 2IMJA 1TRSA 5GSPA 3V1WA 2W6JH 1R26A 2O9UX 4XS4A 3NV0B 1IYHA 4AKZA 1D6YA 1OE7A 1EV9A 1UCLA 3IA1A 4R9KA 2UGIA 4XBXA 4BWQA 1O7GB 3IR4A 3IJEB 1O7PB 1KQS2 2OOVA 2TIRA 4LGQA 4XM4A 2GZPA 2AJQB 1X9WB 3F9SA 2W03A 2AAWA 3HHVA 2A4VA 2FUG2 3TOTA 1K0BA 3VSYA 3U1WA 3PS8A 3UL5A 3HYPA 2SARA 5TGNA 1W02A 1SK1A 3N5OA 1BUJA 1XXUA 3M0FA 3FG4A 3LMLA 3HJOA 2VCQA 5F05A 3VI7A 2YP6A 1FA3A 1U3AA 1GSPA 1YVBI 4L0WA 5G31A 3F0IA 4KCAA 3NOFA 3HVXA 1F6MC 4ZL7A 1ZGXA 1NU3A 3FR6A 2KAAA 1IQ8A 3U6VA 4BVYA 1FYSA 1NHOA 3TKSC 1OYJA 2P0MA 1YF1A 5ECLB 3GH9A 1TDIA 3WT1A 2BMOB 4F0BA 1B2SA 2CX1A 3LXUX 5KP4A 4CY8A 3EQQB 5ECIB 1TIJA 1NWWA 4ZBBA 2VD1A 2BU4A 3HA9A 5G2GA 3TRXA 3FK8A 4RNZA 3PR8A 4O2HA 2L5LA 2X64A 5DBQA 3GZRA 1WTHA 4L5OA 2B3SA 5CF2A 3FH1A 3C7MA 1OC8A 3LYGA 3KTLA 1VGLA 4KDXA 2XSHB 3S27A 4QWTA 6GSUA 7GSPA 2P0GA 4TRXA 2GEXA 3PH9A 3F7XA 3BU4A 1YQ1A 3NM7A 1O8XA 4K7IA 1GP1A 1KEBA 2KP1A 5CO3A 3ERWA 2XH9A 1XW9A 2V6OA 1RN7A 1ERTA 4WWUC 3WODG 2B6MA 1JNQA 3ERGA 1MD4A 4ECCA 4IGJA 1VQL3 2YFJB 2GGTA 2Z77A 2N5BA 3BIRA 2WGOA 1M9AA 4ULXA 3S5CA 3WD6A 4F9ZA 2LYXA 3GAXA 3CTGA 3GYKA 5IMAA 3PCSA 1TRUA 1STDA 4LYLB 3D3LA 4K7NA 2V2GA 5BMUA 2WOHA 1OUNA 3STDA 5LD0A 2DJ3A 3GRDA 2D2ZA 3LXZA 1XIYA 4EE0A 1SJ6A 3DGLA 2N5FA 3GX0A 1SENA 4GF0A 1AVKA 3CD63 1YKAA 5G5EA 3WGEA 1OF5A 1OHOA 2W9PA 1RNBA 4EDZA 2ON5A 2XHFA 2G0FA 3UIWA 5AI1A 3MAKA 4XS4B 1B2UA 5IM9A 4L0UA 1TOFA 2BHMA 3OW22 3T8NA 3FW2A 3A2VA 1Z6MA 1VRSD 1T7PB 3A2XA 3A5WA 3CPOA 1A24A 2VLUA 1GUMA 3TKPA 3K7CA 1KTEA 1R4YA 1W4VA 2H76A 1HD2A 2PN8A 4ML6A 1NNVA 2FLSA 3U97A 4ZIJA 3ZFZA 1ZYEA 4O32A 2C8UA 2IMFA 3ALAA 4MJAA 4EKZA 3C73A 4F03A 1V2AA 3E0UA 1UUGB 3IMAB 4HM1B 4HU9A 2Z7AA 4POBA 5INYA 3ZTLA 1VQK3 3FF2A 1ZZYA 4PTSA 3FKFA 1SD8A 3LG6A 4HM8B 1THOA 3CSIA 3TKSA 3M8CA 2Z6BA 2QA43 4BVYB 3ZVJD 2DJ1A 1H75A 3HZ8A 2C11A 2EIOA 3CXGA 3AHWA 1BSBA 2HMLB 2F9SA 5ID2A 3H93A 1RRHA 5JCGA 4MPFA 2HZFA 1WMPA 1PKZA 4N6MA 2YJHA 1RGLA 3G7IA 3BNDA 1BAYA 3G9BA 1MWRA 1TUHA 5BXQA 1GWCA 4J5GA 3P90A 3EBYA 5F06A 2EC4A 2HRKA 3UARA 3VFIA 4R80A 5ELJA 1E2YA 4GCIA 2GT6A 3VGNA 1BOXA 1LU4A 3LTCA 4NPBA 1FZUA 1TJDA 4V1Ag 4K5RA 5KN3A 4DSSA 4WHAA 3CTFA 3EF8A 1IVVA 2K6VA 2YANA 1TK0B 4L8OA 4DSQA 3MG1A 4EF0A 1TI3A 1FGRA 3RDEA 3JUOA 3C71A 2MF7A 1RLSA 3BNEA 1T1VA 1HNCA 1JV2B 1R5AA 2F98A 3GZBA 5LC6A 2GQMA 3EVIA 1B4QA 1VZZA 4PNFA 2IFQA 1LOYA 3KZTA 3ZIJA 4HM4B 4IPBA 5F07A 1L5GB 3GURA 1XWAA 2CAIA 5GZZB 4EBGA 2VCZA 3B4OA 4OVMA 2ZDJA 1AC1A 3KH9A 4MMXB 3P2AA 1I3FA 3F7SA 5GAPD 3UJ1A 3VURA 2YV7A 1S3CA 1CEWI 5HFGA 2Z9SA 1MGRA 1ZOFA 3DD3A 5HQPA 2YCDA 1T2IA 3LT8A 3Q90A 3EHCA 5ENUA 2R0PA 2YNXA 5C04A 2CZ3A 1GULA 5KN1A 5DCHA 2DKIA 1GOUA 3IDVA 1XW6A 4HI7A 3RBTA 1OKDA 2GZYA 2KHPA 3WHOA 5AISA 2QC7A 1N5HA 1NDOB 4HM6B 3LTAA 4DKIA 1XOBA 1I9DA 2R37A 5KN0A 3U5RE 1HQOA 3NIVA 3WA3A 5C00A 4GQFA 1K0DA 1VQ93 1MDJA 5AEUB 1QK8A 3UOMA 2YZHA 2FGTA 4KE3A 4EL1A 2LUSA 1GY5A 3W8SA 2O87A 2ZNMA 2JADA 2PERA 2C4BA 1GH2A 1W89A 5FGOA 5IMZA 4TR1A 3IBHA 2HI7A 1Z1SA 5A4VA 1TXXA 1FUTA 2UZ8A 1K8A4 13GSA 4G10A 1W01A 1EQKA 3LGCA 3FMWA 4N6NB 2WCIA 4NV2A 4NWYA 5KOWA 3D4AA 1M1K4 1YDKA 3E3EA 1OHPA 2MMZA 1GUHA 2B1LA 4N0ZA 3F8UA 3RHCA 1A2MA 4HKVB 1VQ63 2RCDA 1SKSB 4TW5A 5D9VA 3D4TA 3GWRA 5G5FA 1G02A 4OD7A 4O8SA 2H70A 3I9V2 4K5SA 2B5XA 4I4KA 4KDUA 4HM5B 3LYKA 3AGNA 1BNIA 1BSCA 4KFEA 1XCCA 3ZFLA 3BCIA 1SJIA 2C3QA 1FUSA 2C1YA 2GBXB 1VQO3 3QK9A 2WULA 3EURA 5LNKe 1UUVB 4I8BA 4MNNA 1M0UA 1EP7A 3L78A 1M2AA 2P5QA 10GSA 4K6XA 5IPGA 5BRTA 3DXOA 2DJ0A 4WETA 3MWZA 4WBJA 4GXZA 2GBWB 1YNVX 4EXJA 2N5AA 2DBCA 2CW9A 4PNGA 1XWCA 3CSHA 2IFQB 2X8CA 3S9FA 1DSBA 2F51A 1FW7A 5LC7A 2CWTA 3APSA 1W4NA 4LSOA 1OC9B 4CDOA 3FHKA 1NSWA 4JZQA 3KIJA 4IP6A 3M9KA 5IG0A 1GYBA 2IL3A 3CSJA 4AGSA 2FA8A 2P31A 3MG3A 4BVXA 3GZXB 4KB3A 4LMWA 2OE0A 3QD9A 1OCVA 3FLJA 2HZEA 4OMVA 3BLZA 2F86B 2YWMA 4I6XA 3KH7A 1Q4JA 1JKGB 1V98A 2C0FA 4HVNA 2A2SA 4ACSA 2UX0A 3DWVA 2MYGA 4GHOA 3D79A 5EQLA 5DAKA 1US1A 2FXTA 1M1XB 3KGKA 3KCMA 4A5PA 4FYUA 1B3SA 3SYUA 3GHAA 4I2TA 2V41A 4GSTA 1BYEA 1JBSA 1Q40A 1RGFA 3EINA 5STDA 2L6CA 2NPBA 2PVQA 4TR1B 3AHSA 3HJMA 3D0ZA 1Q7HA 3VI5A 4MEIA 3CNXA 1UA5A 5D9WA 3EU3A 2XFSA 4MJDA 2W56A 2XEPA 4WXTA 1RTUA 2UUGC 4Q5FA 6STDA 1GMRA 1S3AA 3CC23 2TRXA 2RLIA 1VQM3 3PINA 1QUWA 3AMOB 2C0GA 1ROVA 4XIHA 3CCE3 2CFKA 5AEWB 2WDUA 1GNEA 1WE0A 1O85A 2K8SA 3QRDA 4KFFA 3I563 1GSEA 3CCQ3 3TKRA 3KMOA 4HJMA 3TGZA 1I3IA 4FCMA 5BIRA 4N6UA 3F4SA 2XBIA 4NAXA 3BD2A 2L4VA 3KN4A 3BCKA 4V2LA 1BIRA 3DZLA 1RK4A 3VLNA 1ULJB 2H1AA 3H79A 1X1YA 2CVKA 2H19A 2LNSA 3GN3A 4J8TA 4LL4B 7RNTA 1X5EA 3SWLA 4H61A 1MDIA 1K0NA 5IO0A 4WR4A 2CH9A 4WYKA 1ZYNA 3K0ZA 4KZ1A 4N6V0 3CCS3 4TOPA 1VQ53 3WR2A 3FR9A 4WEYA 2H74A 3S67A 3F9UA 5G1LA 1AY7A 3K8NA 2OWPA 5A0OB 1JZDA 5DCGA 5J4UA 2VL3A 2MBTA 3VK9A 2H6ZA 1SU9A 3G0KA 1AQZA 2I3YA 1ST9A 2HMMB 2F3MA 3M8NA 3BOAA 1C7HA 1QVG2 2YJ7A 1EOHA 1BG5A 1UVZA 3H4KA 1BU4A 1AUCA 5IMVA 3FYGA 3BBYA 3G7YA 5DQSA 1N8JA 2VL9A 4N3VA 3OWYA 4HUAA 2X49A 2R4IA 4ISDA 1OE8A 2C3NA 3HDCA 1QMVA 3CMIA 1B2MA 1ERVA 4HS1A 1RHLA 1ZO2A 3DIEA 1OH0A 4XTSA 5CRDA 2JZSA 2HZEB 3GRXA 1X9MB 5KN2A 1THXA 1V74A 3N9JA 4R1KA 1QFNA 1TTZA 1ML6A 4KF9A 5AYRB 3WYWA 1WMNA 2XF3A 3DVXA 2YFIB 3DKSA 4OWYA 1QJGA 1ZS7A 2H8LA 4EC0A 1U88A 2XPEA 2YOIA 2IWTA 2CAQA 1TFOA 3CCV3 1Y6EA 1IDPA 3TJFA 3KD0A 3GTUA 1JB4A 3L4NA 3HD5A 5E59A 1OVNA 3TRPA 4R9LA 3A2WA 1SKRB 1BRKA 1GS3A 1JRQA 2W56B 2KRTA 1R5PA 2HRNA 3IK7A 1GSFA 2NBSA 1PL1A 4RNTA 4MZCA 2R41A 5RNTA 3DGNA 3D4MA 5H5QA 1K0CA 3IPZA 2GZZA 5DJLA 2M80A 5DQYA 1CQGA 1S723 3S28A 3KP8A 2VCVA 1DETA 4JR6A 2GVPA 3ME8A 4JBBA 2MMAA 1VQP3 2LTKA 20GSA 2BIRA 2A15A 4I97A 2R5GA 4IBPA 1A23A 3KM6A 5IMFA 3PZWA 1VQ73 8GSSA 1FG4A 4LL1B 2PBJA 1A2VA 3IC4A 2YWOA 3CMA3 1YJ6A 4X4JA 2FHEA 3ZRDA 1VF3A 2OBIA 4HOJA 4K61A 2C80A 1WOUA 4K1VA 4Z2UA 4PX1A 2OTL3 1J2BA 4AJ7A 1VF4A 4HM3B 2BJXA 4HSCX 2IMKA 5IMCA 3RPPA 1USBA 2HE3A 4WF4A 4WYKB 3PGBA 3H3HA 3WGXA 2B7JA 3OV4A 3SXXA 3CCM3 5HFKA 2H30A 3TDGA 3DYRA 3LYPA 2XFTA 2YN1A 1GTAA 1ZL9A 4FQUA 4MZWA 4BL7B 2I9HA 4K1UA 1UI8A 4IELA 2RBIA 2HYXA 3HY2A 1TFKA 2CIUA 1YGEA 1ISKA 2DMMA 3EN1B 1JZOA 2B5YA 5ECKB 1E97A 2VUPA 3KKGA 3F63A 4OO4A 4BL3A 4ECJA 5ELAA 1WJKA 3E99A 8RNTA 1S3RA 2YWIA 3FEUA 1GMQA 1Q864 1AXDA 1PU4A 2FWFA 4EDYA 2W0QA 2F5WA 2C3TA 5D82A 1N5PA 5IERA 2OBKA 3Q19A 1F2EA 1GSSA 2HSMA 2CFGA 1QGVA 2HSYA 3F6DA 3SBCA 2QA2A 1W00A 3DEXA 1RNTA 2KOKA 2IYJA 1MWTA 3DXBA 1AQXA 3ER7A 1YEXA 4HBRA 1LOVA 2L6DA 3A5IA 3PCRA 1Z5YE 1A67A 5CNWA 2VL2C 2D1WA 5IQYA 1IK3A 3HCZA 3LORA 4ZBAA 4WP5A 4RI6A 9RNTA 5G1KA 4GQCA 5IG4A 1GRXA 5DRVA 1R4WA 2J8XB 3UBKA 1QAKA 4JEDA 2XC2A 1MGWA 4QL7A 1VQN3 1A8LA 1E6BA 1LOWA 3T8UA 2E2GA 5HR0A 3GV1A 1DUGA 1O8WA 2PMTA 3JUPA 3SOAA 1HNBA 3IK9A 3DGQA 4NHFA 2WGRA 1W6CA 4OCEA 1DBYA 5CRHA 3HVVA 4PUAA 1PFOA 1RDSA 1M99A 4E8HA 3I553 3TKQA 1JFUA 2GSTA 2VIMA 3NBJA 2ML6A 1AVLA 1TKDB 3D5GA 2E2TA 1RSNA 1YZXA 4ECIA 3QAWA 3KSED 1SK0A 2H1DA 3I69A 4J57E 5GAND 3OWSA 4USSA 1GY7A 1W5ZA 2C0DA 4Q5NA 1SL1B 2LJAA 2KF5A 4X2HA 4POLA 2Q07A 1B2ZA 3DUKA 1STFI 3HK4A 4OFTA 1BANA 1G6YA 3LTBA 2XSOB 1G7EA 2F5MA 3OX9A 2BTOT 4QL9A 2DJJA 4IT7A 3UEMA 1UDII 1A8YA 1HYUA 5DALA 1PFPA 1IQXA 1RW1A 4YKFA 2OQEC 4AKYA 2YFLB 2O85A 2GXFA 4ML1A 4TR0A 1DYUA 3OR5A 1I0VA 2IIYA 2OA7A 1I5GA 1YJN3 3I6AA 5CRWA 5ECHB 1J08A 1JLVA 5IIZA 4ZL8A 1GTUA 3ZMKA 5B7CA 1LQGC 3LOYA 3C1SA 2FA4A 4ZXGA 3J7Yb 1IQYA 2V6KA 4J9AA 3QPMA 2IA7A 3VWXA 2AYTA 4Q5RA 2WS2A 1MWUA 3O3TA 1W2ZA 2ES7A 2CC3A 1EZKA 3JUQA 1DE2A 1K734 4I2UA 3QCPA 1CYUA 2OTJ3 2MC8A 1YEPA 3HIGA 3ERFA 3PXMA 2E2MA 1BNFA 4FYCA 5G30A 1RN1A 3G6E3 1DVCA 3NHXA 2H0HA 4EYCA 4GSPA 4V2NA 3C8EA 4XDVA 4FIWA 1GSYA 2LQQA 5J3RA 1JN5A 2VCTA 3NQYA 2VL2A 1OGXA 1EGRA 5EL8A 1F37A 2ML5A 1O81A 4RBNA 2HRFA 2LRTA 1CQSA 1SIIA 2IJYA 1O7WB 2FY6A 4OUQA 4HU7A 3TRQA 2DIZA 2E2UA 1FGQA 2PU9C 4ZBDA 3KJYA 2CQ9A 2PUKC 1UI7A 4BIKA 1OF5B 1PMTA 2P05A 1PSQA 2CWUA 3CRTA 3X3XA 4HOHA 4YAVA 4EVMA 4K7OA 1UCIA 2CX0A 4CY6A 4IHUA 3HZPA 3FRCA 4RQRA 4CHSA 2WFCA 4KAEA 2BMXA 4RI7A 1B9YC 4WFOA 5JPUA 3W8JA 1UC7A 2C10A 3RGAA 2GLRA 4MF6A 4K8MA 4FCZA 1BRNL 1HNAA 3EYTA 2CG1A 3T0UA 1I2FA 1N8QA 1BRHA 3EE1A 1A2PA 3PYJA 1BUQA 2AHEA 1SL2B 5ECPB 3ED3A 2CX4A 2XBQA 1IVXA 2F4YA 2E2VA 5IF6A 1HYFA 3GL5A 1TU8A 1GSQA 1PRXA 4EW5A 1T5YA 3ZFBA 4BTXA 1WIKA 5M18A 4HJ2A 2OCTA 1IYYA 3CCL3 5ID2B 1CYVA 5JPPA 1K28A 4AF2A 3O8YA 2OQEA 1BRSA 2CX3A 1BRIA 3IHQA 1N9JA 3H51A 1WRYA 3NM2A 4MJEA 3CCR3 1AW9A 3ZMLA 1O7NB 1LVNA 3N54B 4U13A 1GLQA 4XB5A 1O7UA 2J23A 2LQOA 2Y74A 5DJMA 4KSOA 5FW5A 5ECNB 4K0GA 2KUCA 1BNEA 1HKXA 2V32A 1EUIC 1ERWA 2X8HA 1ZGNA 2CV4A 1XPVA 1ABAA 2INXA 2CA8A 1ILOA 5AYSC 3EPTA 5D9TA 4DSSB 4RUVA 2J9HA 4MCUA 1EEJA 4IKHA 2ZA4A 3R3EA 1FUWA 5D93A 5ABRA 3S29A 1SK2A 3JUNA 2HFDA 3ZG0A 2GSRA 2HOHA 4EIQA 3G8ZA 2HMNB 1Z7RA 5KOXA 3KTBA 3WOFB 3LEFA 2L1SA 4MK3A 4MMMA 2CVBA 4IN0A 3N9HA 1IV7A 2FCHA 2WB9A 3IXRA 4BTYA 1JN5B 2ZUPA 3E9JB 4D73A 5B8BA 1QXHA 2GU3A 2FNQA 4HQZA 1SYXA 5IO2A 1E3VA 1TRWA 1RGCA 2V1MA 2M46A 3EJVA 1OACA 2RM6A 5JCWA 3BNCA 3HI7A 2B5EA 4AEQA 3MSZA 3R2QA 3VF1A 4HM2B 1EOGA 1IVWA 3IOSA 5KP1A 3FSDA 1IT7A 1KSIA 2I9WA 1B20A 3F3RA 2TRCP 4MLYA 2JSZA 3VPQA 3G16A 2HMKB 3SEDA 1XVQA 4XRDA 3D22A 4PGTA 5IENA 3QR6A 3A3TA 2K54A 1UGIA 4RNYA 1X0RA 4V2MA 2P5RA 3AGOA 3V92A 3FG3A 4YKGA 1PD21 3Q1CA 2ALBA 3GSTA 3ME7A 4CPKA 3D5IA 3MKIA 5AIXA 1YF0A 4HZBB 4X1UA 1Y25A 4HZ4A 1N9EA 4G0KA 4F2IA 3KE7A 1RKYA 4FYBA 2XRXB 4TN8A 5DREA 3KMNA 1GY6A 4MH3A 2RUEA 3D21A 4TXVA 2H72A 1ZCPA 4N6TA 1AAZA 1O7MB 2GS3A 2YV9A 1JLWA 3ECFA 3UNLA 3Q74A 4HJLB 1UUWB 4NMUA 2C4JA 3GH6A 2JZRA 1NM3A 1YGWA 3F4RA 5F8BA 1M904 3CQFA 1FOVA 1ZMAA 4BPYA 1UW1A 1BNGA 1O6JA 5D8IA 1ACVA 4KT3B 1KNGA 1URMA 1YKCA 2VLTA 1Q42A 3SOYA 4CW9A 1ZX2A 5G2ZA 1VQ43 1U8CB 2ZCTA 1T8EB 3L9SA 2B24B 4TVEA 1X5CA 5AIVA 3F8HA 4R4KA 1GMPA 3N8BA 5HR1A 4ZB6A 2E0QA 2L5OA 4IJ3A 3NV0A 2YZUA 3HZ4A 1Q824 3K5TA 3NUVA 4CJNA 4G9HA 2FD3A 2H6XA 1GSDA 1MEKA 1F9MA 3FG1A 3HIIA 4GRFA 3X42A 2GSPA 3BB9A 4BIRA 2STDA 1LQMB 1KBNA 2K8VA 1SL0B 3CC73 2DIYA 3FZAA 3JUMA 4K2XA 4PQHA 5F0GA 2R6KA 1SARA 2GSSA 3CU3A 5JWRB 3DRNA 3QAVA 2JSYA 1RJOA 6GSXA 2QEX3 1BEDA 5CF1A 2O7KA 3A76A 3B7CA 4CDLA 2FWHA 3DY5A 5D96A 4STDA 3GMFA 4RQXA 3ZIVA 4D73B 2PVOC 3DVWA 1BJXA 2CG0A 1PY3A 2DMLA 3IV4A 2F99A 3GKXA 1BNRA 5H5SA 1M2BA 4H3UA 4XBYA 2FWGA 2XPDA 2GEYA 1TK5B 4HM0B 2K18A 1FVJA 4HEA2 3VWWA 2LQVA 5IEPA 1ROAA 2LKUA 4E8EA 4N0VA 1XZOA 4LEHA 4BVXB 3HOHA 4NREA 5ECRB 1JBRA 3H8QA 4IVFA 1B8XA 5JWOB 4EXRA 1T2HA 2LRCA 2VOCA 1XG8A 1RRLA 5JBSA 3X3YA 1TW9A 2F56A 4MMYB 2RFRA 5DAKB 1LBKA 2O8VB 1AIUA 5KEJA 1Z6NA 1J9BA 4YQUA 1RN4A 3CNMA 1XWGA 2IPAA 4ID0A 1GLPA 4RZMA 4O5UA 3ZVJA 1Q40B 2HMOB 1BNJA 1B2XA 3LH4A 2PNCA 1NB5I 2B1KA 4DVCA 2REMA 2NDOA 4G0IA 4DEJA 2H0IA 2LV3A 5M19A 3V99A 1T3BA 1QAFA 2GQKA 4LA1A 2CT6A 2XGLA 1LJRA 4KGIA 3FZ4A 2NVLA 1G0TA 3MHEA 2HT9A 1FHEA 1DMQA 1ON4A 1AQWA 4LMVA 4BL2A 1KWIA 1NW2A 1SJWA 1DE1A 1FGMA 3LWAA 1PL2A 1F3BA 1M7TA 3NQZA 2H6YA 2A4HA 1MWSA 4K0NA 2P38A 1YVSA 4PEJA 1N8R4 2KF6A 1EP8A 1TP9A 3EMPA 1JZRA 2CK3H 3CYNA 2GU1A 3EB8A 3F14A 3CME3 4J5KA 1FB0A 3CC43 3WA2X 3B4PA 3LTDA 1X1XA 4FMBA 4MZBA 1MTCA 7GSSA 2QKEA 1SKWB 3VPTA 2AUVA 2DJ2A 3MG2A 2KLXA 1BRJA 1LNIA 4KDYA 2IUKA 4PQIA 3TB2A 1A0RP 1JB5A 5EVHA 4F82A 2OJLA 1JJ22 5AGYA 1K0OA 4OFNA 3ZITA 4NHZA 2VD0A 5CLKA 3P7XA 5DDLA 3MSOA 4O5QA 3DH2A 5B6MA 3EWLA 4BA7A 1M9BA 1PX6A 1A90A 1OPYA 3WMDA 4CCVA 1M3IA 1NHYA 5I97A 2KXGA 2B7KA 1PN0A 3KIIA 2WJUA 2VM2A 2K9FA 5CAXA 2ZL8A 5CRGA 4TR4A 1GNWA 4JF8A 4MPGA 3GIXA 3UVTA 1GL8A 2L57A 1K3LA 3ZREA 5ECSA 3UBLA 1R7HA 4FO5A 2KP2A 3V98A 2R3XA 4WF5A 1XWBA 3IE3A 3F3QA 3UMAA 1EG9B 4G1MB 1IV9A 2AB6A 3GX8A 4KX4A 4K1FA 1Q7Y4 1V57A 2VM1A 1EA2A 4K2DA 1VF2A 3BJ5A 3ZLPA 4HQSA 4ZL9A 1DE3A 1PQNA 3DGOA 4AJ8A 4Q5QA 1DMMA 4MJCA 4N6OB 1WWJA 6GSPA 2HXKA 1ERUA 4G2EA 1Q9EA 2K3DA 2GT5A 3GKMA 5A4WA 2XR8B 1SPUA 4L8PA 1XWKA 4BWSA 3G713 1V9WA 2HLSA 4FMAA 1OKTA 1TP6A 5EEOA 3QAGA 4ZB9A 3JCML 2NTOA 3AY8A 4IQ1A 3F6FA 5B8AA 1EV4A 4J2FA 1YI23 1YIJ3 1X1UA 3IAS2 1TI1A 3QOUA 3GTUB 1WNHA 3UAPA 5J41A 2PGTA 3LT9A 2H75A 1ZYPA 1M2DA 2WO0A
chains in the Genus database with same CATH topology
1FB6A 2G2QA 2VCXA 2MBSA 2PPTA 2ON7A 4XRAA 4POKA 4N30A 16GSA 3IC8A 1A0FA 3VWUA 2DKHA 3KZQA 2QGVA 2MMNA 1XBSA 4IQAA 3MNGA 2LSTA 4JRRA 1V40A 3TUEA 3WT2A 2JU5A 3NZNA 4KA0A 3TOUA 4L8EA 1TU7A 1A2LA 4WR5A 1TK8B 3J7Yk 4ECBA 3GNJA 19GSA 2IN3A 5COHA 2LRNA 2YPMA 1MDKA 4YQVA 2FWEA 2I4AA 2MZCA 4GTUA 4N11A 2GTUA 2CVDA 4KH7A 4G0LA 1K3OA 1U3IA 5ECQB 2OE1A 5EY6A 4IW9A 3LSZA 1H4OA 2I1UA 3G7JA 4NXIA 1N2AA 2X8GA 5JWQB 5GSTA 17GSA 3MIXA 5AN1A 3LW9A 1GSUA 3QMXA 4O5RA 4OFMA 5HR2A 4IJIA 2X99A 4XHMA 2H66A 2A2RA 3CBUA 1PGTA 5ECMB 3ZL5A 4OO5A 1G6WA 3QFAC 2VAFA 4JU5A 2LS5A 2OADA 1IYIA 3D5JA 1U6TA 4ICYA 3D6IA 4KUNA 3WGDA 12GSA 4TXOA 4XS6A 2HNLA 3M9JA 2JL4A 3MYDA 4X0XA 1SYRA 4KCEA 1AQVA 1OC3A 3TJBA 5DVBA 2JZTA 1PKWA 1A2JA 3APQA 5J9CA 1WP0A 2IMEA 5EPFA 1S3DA 1OC9A 2WRTA 3HXSA 3RAZA 1OAZA 2AV4A 2H0GA 5IOWA 3GL3A 4H86A 4WBRD 3L9UA 4G19A 4P3YB 4V1Ap 1QQ2A 4MDCA 2WZ9A 1WMJA 4GSSA 4MABA 5L71A 1SJZA 4GWRA 1K0MA 2E7PA 1TRVA 4GSNA 2RM5A 4MF5A 2QA1A 3Q18A 5IMDA 3LQ7A 3APOA 2I81A 2C0EA 4WKWA 4OCFA 3TJJA 5DALB 2R4VA 2X4AA 4J56E 1EGOA 5CREA 4IP1A 2HSHA 3GSSA 2LJRA 2A2PA 3ISOA 1XVWA 4L5LA 5CYYA 2RUFA 2OE3A 1O73A 4IS0A 4EO3A 4XS1A 3US3A 6GSTA 1FVKA 4KW6A 4TR3A 3FZ9A 3TJGA 3EC3A 6GSVA 3UL3A 1Q98A 3ZZXA 2DJKA 3FY7A 4DSRA 1FOHA 14GSA 2MMOA 4MA9A 11GSA 1RQMA 1K0AA 3M3MA 4YAPA 2DLXA 2PWJA 1GTBA 4JE1A 3RHBA 5CP1A 4AJ6A 1B4PA 3QDNA 4KNDA 1Z7PA 4TXOB 3GFKA 3MWHA 2F8AA 3HKRA 5E4WA 1PA3A 1GUKA 4EIPA 1BX9A 1BQ7A 4HDEA 6GSWA 2F8FA 4Z7XA 2H71A 5IPHA 4KSMA 3RDWA 3F4TA 3IHGA 1J0FA 1JHBA 3FR3A 2CZ2A 2JACA 3CRUA 4PURA 3I43A 4YQMA 3VWVA 3PGTA 2LNTA 1X5DA 4Z2RA 2IMDA 3RPNA 5FT3A 3MDKA 2O89A 3M1GA 18GSA 2DC5A 5FWGA 1PX7A 3EMXA 5D73A 3HVSA 3TJKA 3PPUA 1PN9A 3UVHA 5A4UA 4MH2A 5EVOA 3O76A 3GKKA 1XW5A 2R2JA 1FAAA 5J9BA 1B9XC 2L59A 4ZB8A 2R0GA 4NV5A 1V58A 4ZILA 4POMA 3HJPA 5GSSA 4XCSA 3TKSE 4LLRA 1XFLA 2OKAA 3EE2A 4MP4A 4YH2A 4PUFC 2VO4A 4X43A 5FHIA 5A5KA 4QQ7A 1X9SB 2RIIA 5IOXA 3H1NA 4MJBA 2L4QA 5B6NA 3ZYWA 2H01A 1T00A 6GSYA 5HR3A 1T4ZA 2FGXA 3FZ5A 1G7OA 1Z9HA 2VLVA 3KP9A 4GLTA 4K9ZA 22GSA 1UN2A 2LJKA 2M72A 2H1GA 4NHWA 9GSSA 1EEMA 1GTIA 3IAM2 3KEBA 2FNOA 2H1BA 3EU4A 2IY2A 2VCWA 1JZWA 1FW1A 1WPIA 5ECOB 3GUSA 2EIRA 4PXOA 2HRAA 1U87A 4HZ2A 2GSQA 1FO5A 1B48A 2OACA 3C1RA 4N10A 5J5NA 5LCZA 2R0CA 3W6GA 4BL7A 4I5QA 5ELGA 2EIQA 3Q6OA 2GQLA 3LFLA 3O6TA 3LJRA 4FH8A 4ILFA 2IMIA 5D9XA 2GDRA 1XOAA 3QFBC 2QSIA 4PQ1A 3IRAA 1EWXA 3L0HA 3DMLA 2DSAA 4JR4A 4TKYA 5HFIA 1MD3A 3L9VA 5JCUA 3KXOA 1Z3EA 6GSSA 1C72A 4MF7A 1SD9A 1VF1A 4EUYA 3GKNA 5H5RA 3GA4A 2YWNA 1ZYQB 4O7HA 3LXTA 2H73A 3P8WA 4O92A 1CQHA 4Z2TA 1K3YA 3TCOA 1F3AA 1T4YA 2LEGA 1YY7A 4F0CA 2L4CA 1TRSA 3V1WA 1R26A 4XS4A 1IYHA 1OE7A 1EV9A 3IA1A 4BWQA 3IR4A 2TIRA 2AJQB 2GZPA 1X9WB 2AAWA 3HHVA 2A4VA 2FUG2 3TOTA 1K0BA 3HYPA 1SK1A 3N5OA 1XXUA 3M0FA 3HJOA 2VCQA 5F05A 3VI7A 2YP6A 1U3AA 4L0WA 5G31A 3F0IA 4KCAA 3NOFA 3HVXA 1F6MC 4ZL7A 3FR6A 3U6VA 4BVYA 1NHOA 3TKSC 1OYJA 1YF1A 5ECLB 3GH9A 1TDIA 3WT1A 4F0BA 4CY8A 5ECIB 4ZBBA 2VD1A 3HA9A 3TRXA 3FK8A 3PR8A 2L5LA 2X64A 5DBQA 4L5OA 2B3SA 3C7MA 1OC8A 3KTLA 1VGLA 4KDXA 6GSUA 2P0GA 4TRXA 3PH9A 1YQ1A 1O8XA 4K7IA 1GP1A 1KEBA 2KP1A 5CO3A 3ERWA 1XW9A 2V6OA 1ERTA 2B6MA 4ECCA 3ERGA 1MD4A 4IGJA 2GGTA 2N5BA 1M9AA 4ULXA 3WD6A 4F9ZA 3CTGA 3GYKA 5IMAA 1TRUA 4K7NA 2V2GA 5BMUA 5LD0A 2DJ3A 2D2ZA 3LXZA 1XIYA 4EE0A 1SJ6A 2N5FA 3GX0A 1SENA 4GF0A 3WGEA 1YKAA 5G5EA 4EDZA 2ON5A 2XHFA 2G0FA 3UIWA 3MAKA 4XS4B 5IM9A 4L0UA 1TOFA 3FW2A 3A2VA 1Z6MA 1VRSD 1T7PB 3A2XA 3A5WA 1A24A 2VLUA 1GUMA 3TKPA 1W4VA 1KTEA 2H76A 1HD2A 2PN8A 4ML6A 2FLSA 4ZIJA 1ZYEA 4O32A 2C8UA 2IMFA 4MJAA 4EKZA 3C73A 4F03A 1V2AA 3E0UA 4HU9A 4POBA 5INYA 3ZTLA 1ZZYA 4PTSA 3FKFA 1SD8A 3LG6A 1THOA 3CSIA 3TKSA 4BVYB 3ZVJD 2DJ1A 1H75A 3HZ8A 2EIOA 3CXGA 2F9SA 5ID2A 3H93A 5JCGA 4MPFA 2HZFA 1PKZA 2YJHA 3G7IA 1BAYA 3G9BA 1GWCA 3P90A 5F06A 2EC4A 2HRKA 3UARA 3VFIA 1E2YA 4GCIA 2GT6A 1LU4A 4NPBA 1TJDA 4V1Ag 4K5RA 5KN3A 4DSSA 3CTFA 2K6VA 2YANA 1TK0B 4DSQA 4EF0A 1TI3A 3C71A 1T1VA 1HNCA 1R5AA 2GQMA 3EVIA 1B4QA 4PNFA 2IFQA 3ZIJA 5F07A 3GURA 1XWAA 2CAIA 5GZZB 2VCZA 1AC1A 3KH9A 3P2AA 5GAPD 3UJ1A 3VURA 2YV7A 1S3CA 5HFGA 2Z9SA 1ZOFA 3DD3A 5HQPA 2YCDA 5ENUA 2R0PA 2YNXA 5C04A 2CZ3A 1GULA 5KN1A 5DCHA 2DKIA 3IDVA 1XW6A 4HI7A 3RBTA 1OKDA 2GZYA 2KHPA 5AISA 2QC7A 1XOBA 1I9DA 2R37A 5KN0A 3U5RE 1HQOA 3NIVA 5C00A 4GQFA 1K0DA 1MDJA 1QK8A 3UOMA 2YZHA 4KE3A 4EL1A 2LUSA 3W8SA 2O87A 2ZNMA 2JADA 2PERA 1GH2A 1W89A 5IMZA 4TR1A 3IBHA 2HI7A 5A4VA 1TXXA 2UZ8A 4G10A 13GSA 3LGCA 3FMWA 2WCIA 4NV2A 4NWYA 5KOWA 1YDKA 3E3EA 2MMZA 1GUHA 2B1LA 4N0ZA 3F8UA 3RHCA 1A2MA 1SKSB 4TW5A 5D9VA 3D4TA 5G5FA 4OD7A 2H70A 3I9V2 4K5SA 2B5XA 4KDUA 3LYKA 3ZFLA 1XCCA 3BCIA 1SJIA 2C3QA 2C1YA 2WULA 3EURA 5LNKe 4I8BA 4MNNA 1M0UA 1EP7A 3L78A 1M2AA 2P5QA 10GSA 4K6XA 5IPGA 5BRTA 2DJ0A 4WETA 4WBJA 4GXZA 4EXJA 2N5AA 2DBCA 4PNGA 1XWCA 3CSHA 2IFQB 2X8CA 3S9FA 1DSBA 2F51A 3APSA 1OC9B 4CDOA 3FHKA 1NSWA 4JZQA 3KIJA 4IP6A 3M9KA 2IL3A 3CSJA 4AGSA 2FA8A 2P31A 4BVXA 4KB3A 4LMWA 2OE0A 3QD9A 2HZEA 4OMVA 2YWMA 4I6XA 3KH7A 1Q4JA 1V98A 2C0FA 2A2SA 4ACSA 3DWVA 2MYGA 5DAKA 3KGKA 3KCMA 4A5PA 4FYUA 3GHAA 4I2TA 2V41A 4GSTA 1BYEA 3EINA 2L6CA 2NPBA 2PVQA 4TR1B 3HJMA 3D0ZA 3VI5A 1UA5A 5D9WA 3EU3A 4WXTA 4Q5FA 1S3AA 2TRXA 2RLIA 3PINA 1QUWA 2C0GA 4XIHA 2WDUA 1GNEA 1WE0A 1O85A 2K8SA 1GSEA 3TKRA 3KMOA 4HJMA 3TGZA 3F4SA 2XBIA 4NAXA 3BD2A 3BCKA 4V2LA 1RK4A 3VLNA 2H1AA 3H79A 2CVKA 2H19A 2LNSA 3GN3A 4LL4B 3SWLA 1X5EA 1MDIA 1K0NA 5IO0A 4WR4A 1ZYNA 4TOPA 3FR9A 4WEYA 2H74A 3F9UA 5G1LA 3K8NA 1JZDA 5DCGA 5J4UA 2VL3A 2MBTA 3VK9A 2H6ZA 1SU9A 2I3YA 1ST9A 2F3MA 3M8NA 3BOAA 2YJ7A 1EOHA 1BG5A 1UVZA 3H4KA 1AUCA 5IMVA 3FYGA 3BBYA 3G7YA 5DQSA 1N8JA 2VL9A 4HUAA 2X49A 4ISDA 1OE8A 2C3NA 3HDCA 1QMVA 3CMIA 1ERVA 4HS1A 3DIEA 4XTSA 5CRDA 2JZSA 2HZEB 3GRXA 1X9MB 5KN2A 1THXA 3N9JA 1QFNA 1TTZA 1ML6A 4KF9A 3WYWA 3DVXA 3DKSA 4OWYA 2H8LA 4EC0A 1U88A 2XPEA 2YOIA 2IWTA 2CAQA 1Y6EA 3TJFA 3KD0A 3GTUA 3L4NA 3HD5A 5E59A 1OVNA 3TRPA 3A2WA 1SKRB 1R5PA 2HRNA 3IK7A 1GSFA 2NBSA 1PL1A 4MZCA 3D4MA 5H5QA 1K0CA 3IPZA 2GZZA 5DJLA 2M80A 5DQYA 1CQGA 3KP8A 2VCVA 4JR6A 2GVPA 3ME8A 4JBBA 2MMAA 2LTKA 20GSA 4I97A 2R5GA 4IBPA 1A23A 3KM6A 5IMFA 8GSSA 1FG4A 4LL1B 2PBJA 3IC4A 2YWOA 1YJ6A 4X4JA 2FHEA 3ZRDA 1VF3A 2OBIA 4HOJA 2C80A 1WOUA 4Z2UA 4PX1A 4AJ7A 1VF4A 2BJXA 2IMKA 5IMCA 3RPPA 1USBA 2HE3A 4WF4A 3WGXA 2B7JA 5HFKA 2H30A 3TDGA 3DYRA 3LYPA 2YN1A 1GTAA 1ZL9A 4FQUA 4MZWA 4BL7B 2I9HA 4IELA 2HYXA 3HY2A 2DMMA 1JZOA 2B5YA 5ECKB 2VUPA 3F63A 4OO4A 4ECJA 5ELAA 1WJKA 2YWIA 3FEUA 1AXDA 2FWFA 4EDYA 2C3TA 2OBKA 3Q19A 1F2EA 1GSSA 2HSMA 1QGVA 2HSYA 3F6DA 3SBCA 2QA2A 3DEXA 2KOKA 2IYJA 3DXBA 1AQXA 1YEXA 2L6DA 3A5IA 1Z5YE 5CNWA 2VL2C 5IQYA 3HCZA 3LORA 4ZBAA 4RI6A 5G1KA 4GQCA 1GRXA 1R4WA 3UBKA 4JEDA 2XC2A 4QL7A 1E6BA 1A8LA 2E2GA 5HR0A 3GV1A 1DUGA 1O8WA 2PMTA 1HNBA 3IK9A 3DGQA 2WGRA 1DBYA 4OCEA 5CRHA 3HVVA 4PUAA 1M99A 4E8HA 3TKQA 1JFUA 2GSTA 2VIMA 1TKDB 1YZXA 4ECIA 3QAWA 1SK0A 2H1DA 3I69A 4J57E 5GAND 4USSA 2C0DA 4Q5NA 1SL1B 2LJAA 4POLA 4OFTA 1G6YA 1G7EA 2BTOT 4QL9A 2DJJA 3UEMA 1A8YA 1HYUA 5DALA 1RW1A 4YKFA 2O85A 4ML1A 4TR0A 3OR5A 2IIYA 2OA7A 1I5GA 3I6AA 5CRWA 5ECHB 1J08A 1JLVA 5IIZA 4ZL8A 1GTUA 3ZMKA 5B7CA 3C1SA 2FA4A 4ZXGA 3J7Yb 2V6KA 3QPMA 3VWXA 2AYTA 4Q5RA 2WS2A 3O3TA 2ES7A 1EZKA 1DE2A 4I2UA 3QCPA 1YEPA 3ERFA 2E2MA 4FYCA 5G30A 2H0HA 4V2NA 3C8EA 4FIWA 1GSYA 2LQQA 5J3RA 2VCTA 2VL2A 1EGRA 5EL8A 1F37A 2HRFA 1O81A 2LRTA 2IJYA 2FY6A 4HU7A 3TRQA 2DIZA 2PU9C 4ZBDA 3KJYA 2CQ9A 2PUKC 1PMTA 1PSQA 3CRTA 4YAVA 4EVMA 4K7OA 4CY6A 4IHUA 3FRCA 4RQRA 4CHSA 2WFCA 4KAEA 2BMXA 4RI7A 1B9YC 3W8JA 1UC7A 2GLRA 4MF6A 4K8MA 1HNAA 3EYTA 2AHEA 1SL2B 5ECPB 3ED3A 2CX4A 2XBQA 3GL5A 1TU8A 1GSQA 1PRXA 3ZFBA 1WIKA 4HJ2A 5ID2B 4AF2A 2CX3A 3IHQA 1WRYA 4MJEA 1AW9A 3ZMLA 1GLQA 2J23A 1O7UA 2LQOA 5DJMA 4KSOA 5ECNB 4K0GA 2KUCA 2V32A 1ERWA 2X8HA 1ZGNA 2CV4A 1XPVA 1ABAA 2CA8A 1ILOA 3EPTA 5D9TA 4DSSB 4RUVA 2J9HA 4MCUA 1EEJA 4IKHA 3R3EA 5D93A 5ABRA 1SK2A 2HFDA 2GSRA 4EIQA 1Z7RA 5KOXA 3KTBA 3LEFA 4MK3A 4MMMA 2CVBA 4IN0A 2FCHA 2WB9A 3IXRA 2ZUPA 3E9JB 4D73A 5B8BA 1QXHA 4HQZA 1SYXA 5IO2A 1TRWA 2V1MA 2M46A 2RM6A 5JCWA 2B5EA 3MSZA 3R2QA 1EOGA 3IOSA 3F3RA 2TRCP 4MLYA 2JSZA 3VPQA 1XVQA 4XRDA 3D22A 4PGTA 3QR6A 3A3TA 1X0RA 4V2MA 2P5RA 4YKGA 1PD21 3GSTA 2ALBA 3ME7A 5AIXA 1YF0A 4X1UA 1Y25A 4HZ4A 4G0KA 4F2IA 4FYBA 4TN8A 3KMNA 4MH3A 2RUEA 3D21A 4TXVA 2H72A 1ZCPA 1AAZA 2GS3A 2YV9A 1JLWA 3Q74A 4NMUA 2C4JA 3GH6A 2JZRA 1NM3A 3F4RA 5F8BA 1FOVA 1ZMAA 4BPYA 1O6JA 5D8IA 1ACVA 1KNGA 1URMA 1YKCA 2VLTA 4CW9A 5G2ZA 2ZCTA 1T8EB 3L9SA 4TVEA 1X5CA 5AIVA 5HR1A 4ZB6A 2E0QA 2L5OA 4IJ3A 2YZUA 3HZ4A 4G9HA 2FD3A 2H6XA 1GSDA 1MEKA 1F9MA 4GRFA 1KBNA 2K8VA 1SL0B 2DIYA 3FZAA 4PQHA 4K2XA 5F0GA 2R6KA 2GSSA 5JWRB 3DRNA 3QAVA 2JSYA 6GSXA 1BEDA 2O7KA 2FWHA 5D96A 3GMFA 4RQXA 3ZIVA 4D73B 2PVOC 3DVWA 1BJXA 2DMLA 3IV4A 3GKXA 5H5SA 1M2BA 2FWGA 2XPDA 1TK5B 2K18A 1FVJA 4HEA2 3VWWA 2LKUA 4E8EA 4N0VA 1XZOA 4BVXB 5ECRB 3H8QA 4IVFA 1B8XA 5JWOB 2LRCA 2VOCA 1TW9A 5DAKB 1LBKA 2O8VB 1AIUA 5KEJA 1Z6NA 1J9BA 4YQUA 1XWGA 2IPAA 4ID0A 1GLPA 4O5UA 3ZVJA 2B1KA 4DVCA 2REMA 2NDOA 4G0IA 4DEJA 2H0IA 2LV3A 1T3BA 2GQKA 4LA1A 2CT6A 1LJRA 4KGIA 3FZ4A 2NVLA 1G0TA 2HT9A 1FHEA 1ON4A 1AQWA 4LMVA 1NW2A 1DE1A 3LWAA 1F3BA 1M7TA 1PL2A 2H6YA 2A4HA 4K0NA 1EP8A 1TP9A 3EMPA 1JZRA 3CYNA 1FB0A 4MZBA 1MTCA 7GSSA 2QKEA 1SKWB 3VPTA 2AUVA 2DJ2A 2KLXA 4KDYA 4PQIA 3TB2A 1A0RP 4F82A 2OJLA 5AGYA 1K0OA 4OFNA 3ZITA 4NHZA 2VD0A 3P7XA 5DDLA 4O5QA 5B6MA 3EWLA 4BA7A 1M9BA 1PX6A 1NHYA 2B7KA 1PN0A 2WJUA 2VM2A 2K9FA 5CAXA 5CRGA 4TR4A 1GNWA 4MPGA 3GIXA 3UVTA 1GL8A 2L57A 1K3LA 3ZREA 5ECSA 3UBLA 1R7HA 4FO5A 2KP2A 2R3XA 4WF5A 1XWBA 3IE3A 3F3QA 3UMAA 2AB6A 3GX8A 4KX4A 4K1FA 1V57A 2VM1A 4K2DA 1VF2A 3BJ5A 3ZLPA 4HQSA 4ZL9A 1PQNA 4AJ8A 4Q5QA 4MJCA 1WWJA 2HXKA 1ERUA 4G2EA 2GT5A 3GKMA 5A4WA 1XWKA 4BWSA 1V9WA 2HLSA 4ZB9A 1OKTA 3QAGA 3JCML 2NTOA 3AY8A 4IQ1A 3F6FA 5B8AA 1EV4A 4J2FA 3IAS2 1TI1A 3QOUA 3GTUB 3UAPA 5J41A 2PGTA 2H75A 1ZYPA 1M2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FB6 A;  2G2Q A;  2VCX A;  2MBS A;  2PPT A;  2ON7 A;  4XRA A;  4POK A;  4N30 A;  16GS A;  1A0F A;  3VWU A;  3KZQ A;  2QGV A;  2MMN A;  1XBS A;  4IQA A;  3MNG A;  2LST A;  4JRR A;  1V40 A;  3TUE A;  3WT2 A;  2JU5 A;  3NZN A;  4KA0 A;  3TOU A;  4L8E A;  1TU7 A;  1A2L A;  4WR5 A;  1TK8 B;  3J7Y k;  4ECB A;  3GNJ A;  19GS A;  2IN3 A;  5COH A;  2LRN A;  2YPM A;  1MDK A;  4YQV A;  2FWE A;  2I4A A;  2MZC A;  4GTU A;  4N11 A;  2GTU A;  2CVD A;  4KH7 A;  1K3O A;  1U3I A;  5ECQ B;  2OE1 A;  5EY6 A;  4IW9 A;  3LSZ A;  1H4O A;  2I1U A;  3G7J A;  4NXI A;  1N2A A;  2X8G A;  5JWQ B;  5GST A;  17GS A;  5AN1 A;  1GSU A;  3QMX A;  4O5R A;  4OFM A;  5HR2 A;  4IJI A;  2X99 A;  4XHM A;  2H66 A;  2A2R A;  3CBU A;  1PGT A;  5ECM B;  3ZL5 A;  4OO5 A;  1G6W A;  3QFA C;  2VAF A;  4JU5 A;  2LS5 A;  2OAD A;  1IYI A;  3D5J A;  1U6T A;  3D6I A;  4KUN A;  3WGD A;  12GS A;  4TXO A;  4XS6 A;  2HNL A;  3M9J A;  2JL4 A;  4X0X A;  1SYR A;  4KCE A;  1AQV A;  1OC3 A;  3TJB A;  5DVB A;  2JZT A;  1PKW A;  1A2J A;  3APQ A;  5J9C A;  1WP0 A;  2IME A;  5EPF A;  1S3D A;  1OC9 A;  2WRT A;  3HXS A;  3RAZ A;  1OAZ A;  2AV4 A;  2H0G A;  5IOW A;  3GL3 A;  4H86 A;  4WBR D;  3L9U A;  4G19 A;  4P3Y B;  4V1A p;  1QQ2 A;  4MDC A;  2WZ9 A;  1WMJ A;  4GSS A;  4MAB A;  5L71 A;  1SJZ A;  4GWR A;  1K0M A;  2E7P A;  1TRV A;  4GSN A;  2RM5 A;  4MF5 A;  3Q18 A;  5IMD A;  3LQ7 A;  3APO A;  2I81 A;  2C0E A;  4WKW A;  4OCF A;  3TJJ A;  5DAL B;  2R4V A;  4J56 E;  1EGO A;  5CRE A;  4IP1 A;  2HSH A;  3GSS A;  2LJR A;  3ISO A;  1XVW A;  4L5L A;  5CYY A;  2RUF A;  2OE3 A;  1O73 A;  4IS0 A;  4EO3 A;  4XS1 A;  3US3 A;  6GST A;  1FVK A;  4KW6 A;  4TR3 A;  3FZ9 A;  3TJG A;  3EC3 A;  6GSV A;  3UL3 A;  1Q98 A;  3ZZX A;  2DJK A;  3FY7 A;  4DSR A;  14GS A;  2MMO A;  4MA9 A;  11GS A;  1RQM A;  1K0A A;  3M3M A;  4YAP A;  2DLX A;  2PWJ A;  1GTB A;  4JE1 A;  3RHB A;  5CP1 A;  4AJ6 A;  1B4P A;  3QDN A;  4KND A;  1Z7P A;  4TXO B;  3GFK A;  3MWH A;  2F8A A;  3HKR A;  5E4W A;  1PA3 A;  1GUK A;  1BX9 A;  1BQ7 A;  4HDE A;  6GSW A;  2F8F A;  4Z7X A;  2H71 A;  5IPH A;  4KSM A;  3RDW A;  3F4T A;  1JHB A;  1J0F A;  3FR3 A;  2CZ2 A;  2JAC A;  3CRU A;  4PUR A;  3I43 A;  4YQM A;  3VWV A;  3PGT A;  2LNT A;  1X5D A;  2IMD A;  3RPN A;  5FT3 A;  3MDK A;  2O89 A;  3M1G A;  18GS A;  2DC5 A;  5FWG A;  1PX7 A;  3EMX A;  5D73 A;  3HVS A;  3TJK A;  1PN9 A;  3UVH A;  5A4U A;  4MH2 A;  5EVO A;  3O76 A;  3GKK A;  1XW5 A;  2R2J A;  1FAA A;  5J9B A;  1B9X C;  2L59 A;  4ZB8 A;  4NV5 A;  1V58 A;  4ZIL A;  4POM A;  3HJP A;  5GSS A;  4XCS A;  3TKS E;  4LLR A;  1XFL A;  2OKA A;  3EE2 A;  4MP4 A;  4YH2 A;  4PUF C;  2VO4 A;  4X43 A;  5FHI A;  5A5K A;  4QQ7 A;  1X9S B;  2RII A;  5IOX A;  3H1N A;  4MJB A;  2L4Q A;  5B6N A;  3ZYW A;  2H01 A;  1T00 A;  6GSY A;  5HR3 A;  1T4Z A;  2FGX A;  3FZ5 A;  1G7O A;  1Z9H A;  2VLV A;  3KP9 A;  4GLT A;  4K9Z A;  22GS A;  1UN2 A;  2LJK A;  2M72 A;  2H1G A;  4NHW A;  9GSS A;  1EEM A;  1GTI A;  3IAM 2;  3KEB A;  2FNO A;  2H1B A;  3EU4 A;  2IY2 A;  2VCW A;  1JZW A;  1FW1 A;  1WPI A;  5ECO B;  3GUS A;  2EIR A;  4PXO A;  1U87 A;  4HZ2 A;  2GSQ A;  1FO5 A;  1B48 A;  2OAC A;  3C1R A;  4N10 A;  5J5N A;  5LCZ A;  3W6G A;  4BL7 A;  4I5Q A;  5ELG A;  2EIQ A;  3Q6O A;  2GQL A;  3LFL A;  3O6T A;  3LJR A;  4FH8 A;  4ILF A;  2IMI A;  5D9X A;  2GDR A;  1XOA A;  3QFB C;  2QSI A;  4PQ1 A;  3IRA A;  1EWX A;  3L0H A;  3DML A;  2DSA A;  4JR4 A;  4TKY A;  5HFI A;  1MD3 A;  3L9V A;  5JCU A;  3KXO A;  1Z3E A;  6GSS A;  1C72 A;  4MF7 A;  1SD9 A;  1VF1 A;  4EUY A;  3GKN A;  5H5R A;  3GA4 A;  2YWN A;  1ZYQ B;  4O7H A;  3LXT A;  2H73 A;  3P8W A;  4O92 A;  1CQH A;  1K3Y A;  3TCO A;  1F3A A;  1T4Y A;  2LEG A;  1YY7 A;  4F0C A;  2L4C A;  1TRS A;  3V1W A;  1R26 A;  4XS4 A;  1IYH A;  1OE7 A;  1EV9 A;  3IA1 A;  4BWQ A;  3IR4 A;  2TIR A;  2AJQ B;  2GZP A;  1X9W B;  2AAW A;  3HHV A;  2A4V A;  2FUG 2;  3TOT A;  1K0B A;  3HYP A;  1SK1 A;  3N5O A;  1XXU A;  3M0F A;  3HJO A;  2VCQ A;  5F05 A;  3VI7 A;  2YP6 A;  1U3A A;  4L0W A;  5G31 A;  3F0I A;  4KCA A;  3NOF A;  3HVX A;  1F6M C;  4ZL7 A;  3FR6 A;  3U6V A;  4BVY A;  1NHO A;  3TKS C;  1OYJ A;  1YF1 A;  5ECL B;  3GH9 A;  1TDI A;  3WT1 A;  4F0B A;  5ECI B;  4ZBB A;  2VD1 A;  3HA9 A;  3TRX A;  3FK8 A;  3PR8 A;  2L5L A;  2X64 A;  5DBQ A;  4L5O A;  2B3S A;  3C7M A;  1OC8 A;  3KTL A;  1VGL A;  4KDX A;  6GSU A;  2P0G A;  4TRX A;  3PH9 A;  1YQ1 A;  1O8X A;  4K7I A;  1GP1 A;  1KEB A;  2KP1 A;  5CO3 A;  3ERW A;  1XW9 A;  2V6O A;  1ERT A;  2B6M A;  4ECC A;  3ERG A;  1MD4 A;  4IGJ A;  2GGT A;  2N5B A;  1M9A A;  4ULX A;  3WD6 A;  4F9Z A;  3CTG A;  3GYK A;  5IMA A;  1TRU A;  4K7N A;  2V2G A;  5LD0 A;  2DJ3 A;  2D2Z A;  3LXZ A;  1XIY A;  4EE0 A;  1SJ6 A;  2N5F A;  3GX0 A;  1SEN A;  4GF0 A;  3WGE A;  1YKA A;  5G5E A;  4EDZ A;  2ON5 A;  2XHF A;  2G0F A;  3UIW A;  3MAK A;  4XS4 B;  5IM9 A;  4L0U A;  1TOF A;  3FW2 A;  3A2V A;  1Z6M A;  1VRS D;  1T7P B;  3A2X A;  3A5W A;  1A24 A;  2VLU A;  1GUM A;  3TKP A;  1W4V A;  1KTE A;  2H76 A;  1HD2 A;  2PN8 A;  4ML6 A;  2FLS A;  4ZIJ A;  1ZYE A;  4O32 A;  2C8U A;  2IMF A;  4MJA A;  4EKZ A;  3C73 A;  4F03 A;  1V2A A;  3E0U A;  4HU9 A;  4POB A;  5INY A;  3ZTL A;  1ZZY A;  3FKF A;  1SD8 A;  3LG6 A;  1THO A;  3CSI A;  3TKS A;  3ZVJ D;  2DJ1 A;  1H75 A;  3HZ8 A;  2EIO A;  3CXG A;  2F9S A;  5ID2 A;  3H93 A;  5JCG A;  4MPF A;  2HZF A;  1PKZ A;  2YJH A;  3G7I A;  1BAY A;  3G9B A;  1GWC A;  3P90 A;  5F06 A;  2EC4 A;  3UAR A;  3VFI A;  1E2Y A;  4GCI A;  2GT6 A;  1LU4 A;  4NPB A;  1TJD A;  4V1A g;  5KN3 A;  4DSS A;  3CTF A;  2K6V A;  2YAN A;  1TK0 B;  4DSQ A;  4EF0 A;  1TI3 A;  3C71 A;  1T1V A;  1HNC A;  1R5A A;  2GQM A;  3EVI A;  1B4Q A;  4PNF A;  2IFQ A;  3ZIJ A;  5F07 A;  3GUR A;  1XWA A;  2CAI A;  5GZZ B;  2VCZ A;  1AC1 A;  3KH9 A;  3P2A A;  5GAP D;  3UJ1 A;  3VUR A;  2YV7 A;  1S3C A;  5HFG A;  2Z9S A;  1ZOF A;  3DD3 A;  5HQP A;  2YCD A;  5ENU A;  2YNX A;  5C04 A;  2CZ3 A;  1GUL A;  5KN1 A;  5DCH A;  3IDV A;  1XW6 A;  4HI7 A;  3RBT A;  1OKD A;  2GZY A;  2KHP A;  5AIS A;  2QC7 A;  1XOB A;  1I9D A;  2R37 A;  5KN0 A;  3U5R E;  1HQO A;  3NIV A;  5C00 A;  4GQF A;  1K0D A;  1MDJ A;  1QK8 A;  3UOM A;  2YZH A;  4KE3 A;  4EL1 A;  2LUS A;  3W8S A;  2O87 A;  2ZNM A;  2JAD A;  2PER A;  1GH2 A;  1W89 A;  5IMZ A;  4TR1 A;  3IBH A;  2HI7 A;  5A4V A;  1TXX A;  4G10 A;  13GS A;  3LGC A;  2WCI A;  4NV2 A;  4NWY A;  1YDK A;  3E3E A;  2MMZ A;  1GUH A;  2B1L A;  4N0Z A;  3F8U A;  3RHC A;  1A2M A;  1SKS B;  4TW5 A;  5D9V A;  3D4T A;  5G5F A;  4OD7 A;  2H70 A;  3I9V 2;  2B5X A;  4KDU A;  3LYK A;  3ZFL A;  1XCC A;  3BCI A;  1SJI A;  2C3Q A;  2C1Y A;  2WUL A;  3EUR A;  5LNK e;  4I8B A;  1M0U A;  1EP7 A;  3L78 A;  1M2A A;  2P5Q A;  10GS A;  4K6X A;  5IPG A;  2DJ0 A;  4WET A;  4WBJ A;  4GXZ A;  4EXJ A;  2N5A A;  2DBC A;  4PNG A;  1XWC A;  3CSH A;  2IFQ B;  2X8C A;  3S9F A;  1DSB A;  2F51 A;  3APS A;  1OC9 B;  4CDO A;  3FHK A;  1NSW A;  4JZQ A;  3KIJ A;  4IP6 A;  3M9K A;  2IL3 A;  3CSJ A;  4AGS A;  2FA8 A;  2P31 A;  4BVX A;  4KB3 A;  4LMW A;  2OE0 A;  3QD9 A;  2HZE A;  4OMV A;  2YWM A;  4I6X A;  3KH7 A;  1Q4J A;  1V98 A;  2C0F A;  2A2S A;  4ACS A;  3DWV A;  2MYG A;  5DAK A;  3KGK A;  3KCM A;  4FYU A;  3GHA A;  4I2T A;  2V41 A;  4GST A;  1BYE A;  3EIN A;  2L6C A;  2NPB A;  2PVQ A;  4TR1 B;  3HJM A;  3D0Z A;  3VI5 A;  1UA5 A;  5D9W A;  3EU3 A;  4WXT A;  4Q5F A;  1S3A A;  2TRX A;  2RLI A;  3PIN A;  1QUW A;  2C0G A;  4XIH A;  2WDU A;  1GNE A;  1WE0 A;  1O85 A;  2K8S A;  1GSE A;  3TKR A;  3KMO A;  4HJM A;  3TGZ A;  3F4S A;  2XBI A;  4NAX A;  3BD2 A;  3BCK A;  4V2L A;  1RK4 A;  3VLN A;  2H1A A;  3H79 A;  2CVK A;  2H19 A;  2LNS A;  3GN3 A;  4LL4 B;  3SWL A;  1X5E A;  1MDI A;  1K0N A;  5IO0 A;  4WR4 A;  4TOP A;  3FR9 A;  4WEY A;  2H74 A;  3F9U A;  5G1L A;  3K8N A;  1JZD A;  5DCG A;  5J4U A;  2VL3 A;  2MBT A;  3VK9 A;  2H6Z A;  1SU9 A;  2I3Y A;  1ST9 A;  2F3M A;  3M8N A;  3BOA A;  2YJ7 A;  1EOH A;  1BG5 A;  1UVZ A;  3H4K A;  1AUC A;  5IMV A;  3FYG A;  3BBY A;  3G7Y A;  5DQS A;  1N8J A;  2VL9 A;  4HUA A;  4ISD A;  1OE8 A;  2C3N A;  3HDC A;  1QMV A;  3CMI A;  1ERV A;  4HS1 A;  3DIE A;  4XTS A;  5CRD A;  2JZS A;  2HZE B;  3GRX A;  1X9M B;  5KN2 A;  1THX A;  3N9J A;  1QFN A;  1TTZ A;  1ML6 A;  3WYW A;  3DVX A;  3DKS A;  4OWY A;  2H8L A;  4EC0 A;  1U88 A;  2XPE A;  2YOI A;  2IWT A;  2CAQ A;  1Y6E A;  3TJF A;  3KD0 A;  3GTU A;  3L4N A;  3HD5 A;  5E59 A;  1OVN A;  3TRP A;  3A2W A;  1SKR B;  1R5P A;  2HRN A;  3IK7 A;  1GSF A;  2NBS A;  1PL1 A;  4MZC A;  3D4M A;  5H5Q A;  1K0C A;  3IPZ A;  2GZZ A;  5DJL A;  2M80 A;  5DQY A;  1CQG A;  3KP8 A;  2VCV A;  4JR6 A;  2GVP A;  3ME8 A;  4JBB A;  2MMA A;  2LTK A;  20GS A;  4I97 A;  2R5G A;  4IBP A;  1A23 A;  3KM6 A;  5IMF A;  8GSS A;  1FG4 A;  4LL1 B;  2PBJ A;  3IC4 A;  2YWO A;  1YJ6 A;  2FHE A;  3ZRD A;  1VF3 A;  2OBI A;  4HOJ A;  2C80 A;  1WOU A;  4PX1 A;  4AJ7 A;  1VF4 A;  2BJX A;  2IMK A;  5IMC A;  3RPP A;  1USB A;  2HE3 A;  4WF4 A;  3WGX A;  2B7J A;  5HFK A;  2H30 A;  3TDG A;  3DYR A;  3LYP A;  2YN1 A;  1GTA A;  1ZL9 A;  4MZW A;  2I9H A;  4IEL A;  2HYX A;  3HY2 A;  2DMM A;  1JZO A;  2B5Y A;  5ECK B;  2VUP A;  3F63 A;  4OO4 A;  4ECJ A;  5ELA A;  1WJK A;  2YWI A;  3FEU A;  1AXD A;  2FWF A;  4EDY A;  2C3T A;  2OBK A;  3Q19 A;  1F2E A;  1GSS A;  1QGV A;  2HSY A;  3F6D A;  3SBC A;  3DEX A;  2KOK A;  2IYJ A;  3DXB A;  1AQX A;  1YEX A;  2L6D A;  1Z5Y E;  5CNW A;  2VL2 C;  5IQY A;  3HCZ A;  3LOR A;  4ZBA A;  4RI6 A;  5G1K A;  4GQC A;  1GRX A;  1R4W A;  3UBK A;  4JED A;  2XC2 A;  4QL7 A;  1E6B A;  1A8L A;  2E2G A;  5HR0 A;  3GV1 A;  1DUG A;  1O8W A;  2PMT A;  1HNB A;  3IK9 A;  3DGQ A;  2WGR A;  1DBY A;  4OCE A;  5CRH A;  3HVV A;  4PUA A;  1M99 A;  4E8H A;  3TKQ A;  1JFU A;  2GST A;  2VIM A;  1TKD B;  1YZX A;  4ECI A;  3QAW A;  1SK0 A;  2H1D A;  3I69 A;  4J57 E;  5GAN D;  2C0D A;  4Q5N A;  1SL1 B;  2LJA A;  4POL A;  4OFT A;  1G6Y A;  1G7E A;  2BTO T;  4QL9 A;  2DJJ A;  3UEM A;  1A8Y A;  1HYU A;  5DAL A;  1RW1 A;  2O85 A;  4ML1 A;  4TR0 A;  3OR5 A;  2IIY A;  2OA7 A;  1I5G A;  3I6A A;  5CRW A;  5ECH B;  1J08 A;  1JLV A;  5IIZ A;  4ZL8 A;  1GTU A;  3ZMK A;  5B7C A;  3C1S A;  2FA4 A;  4ZXG A;  3J7Y b;  2V6K A;  3QPM A;  3VWX A;  2AYT A;  4Q5R A;  2WS2 A;  3O3T A;  2ES7 A;  1EZK A;  1DE2 A;  4I2U A;  3QCP A;  1YEP A;  3ERF A;  2E2M A;  4FYC A;  5G30 A;  2H0H A;  4V2N A;  3C8E A;  4FIW A;  1GSY A;  2LQQ A;  5J3R A;  2VCT A;  2VL2 A;  1EGR A;  5EL8 A;  1F37 A;  2HRF A;  1O81 A;  2LRT A;  2IJY A;  2FY6 A;  4HU7 A;  3TRQ A;  2DIZ A;  2PU9 C;  4ZBD A;  3KJY A;  2CQ9 A;  2PUK C;  1PMT A;  1PSQ A;  3CRT A;  4YAV A;  4EVM A;  4K7O A;  4IHU A;  3FRC A;  4RQR A;  4CHS A;  2WFC A;  4KAE A;  2BMX A;  4RI7 A;  1B9Y C;  3W8J A;  1UC7 A;  2GLR A;  4MF6 A;  4K8M A;  1HNA A;  3EYT A;  2AHE A;  1SL2 B;  5ECP B;  3ED3 A;  2CX4 A;  2XBQ A;  3GL5 A;  1TU8 A;  1GSQ A;  1PRX A;  3ZFB A;  1WIK A;  4HJ2 A;  5ID2 B;  4AF2 A;  2CX3 A;  3IHQ A;  1WRY A;  4MJE A;  1AW9 A;  3ZML A;  1GLQ A;  2J23 A;  1O7U A;  2LQO A;  5DJM A;  4KSO A;  5ECN B;  4K0G A;  2KUC A;  2V32 A;  1ERW A;  2X8H A;  1ZGN A;  2CV4 A;  1XPV A;  1ABA A;  2CA8 A;  1ILO A;  5D9T A;  4DSS B;  4RUV A;  2J9H A;  4MCU A;  1EEJ A;  4IKH A;  5D93 A;  5ABR A;  1SK2 A;  2HFD A;  2GSR A;  1Z7R A;  3KTB A;  3LEF A;  4MK3 A;  4MMM A;  2CVB A;  4IN0 A;  2FCH A;  2WB9 A;  3IXR A;  2ZUP A;  3E9J B;  4D73 A;  5B8B A;  1QXH A;  4HQZ A;  1SYX A;  5IO2 A;  1TRW A;  2V1M A;  2M46 A;  2RM6 A;  5JCW A;  2B5E A;  3MSZ A;  3R2Q A;  1EOG A;  3IOS A;  3F3R A;  2TRC P;  4MLY A;  2JSZ A;  3VPQ A;  1XVQ A;  4XRD A;  3D22 A;  4PGT A;  3QR6 A;  3A3T A;  1X0R A;  4V2M A;  2P5R A;  1PD2 1;  3GST A;  2ALB A;  3ME7 A;  5AIX A;  1YF0 A;  4X1U A;  1Y25 A;  4HZ4 A;  4F2I A;  4FYB A;  4TN8 A;  3KMN A;  4MH3 A;  2RUE A;  3D21 A;  4TXV A;  2H72 A;  1ZCP A;  1AAZ A;  2GS3 A;  2YV9 A;  1JLW A;  3Q74 A;  4NMU A;  2C4J A;  3GH6 A;  2JZR A;  1NM3 A;  3F4R A;  5F8B A;  1FOV A;  1ZMA A;  4BPY A;  1O6J A;  5D8I A;  1ACV A;  1KNG A;  1URM A;  1YKC A;  2VLT A;  4CW9 A;  5G2Z A;  2ZCT A;  1T8E B;  3L9S A;  4TVE A;  1X5C A;  5AIV A;  5HR1 A;  4ZB6 A;  2E0Q A;  2L5O A;  4IJ3 A;  2YZU A;  3HZ4 A;  4G9H A;  2FD3 A;  2H6X A;  1GSD A;  1MEK A;  1F9M A;  4GRF A;  1KBN A;  2K8V A;  1SL0 B;  2DIY A;  3FZA A;  4PQH A;  5F0G A;  2R6K A;  2GSS A;  5JWR B;  3DRN A;  3QAV A;  2JSY A;  6GSX A;  1BED A;  2O7K A;  2FWH A;  5D96 A;  3GMF A;  4RQX A;  3ZIV A;  4D73 B;  2PVO C;  3DVW A;  1BJX A;  2DML A;  3IV4 A;  3GKX A;  5H5S A;  1M2B A;  2FWG A;  2XPD A;  1TK5 B;  2K18 A;  1FVJ A;  4HEA 2;  3VWW A;  2LKU A;  4E8E A;  4N0V A;  1XZO A;  5ECR B;  3H8Q A;  4IVF A;  1B8X A;  5JWO B;  2LRC A;  2VOC A;  1TW9 A;  5DAK B;  1LBK A;  2O8V B;  1AIU A;  5KEJ A;  1Z6N A;  1J9B A;  4YQU A;  1XWG A;  2IPA A;  4ID0 A;  1GLP A;  3ZVJ A;  2B1K A;  4DVC A;  2REM A;  2NDO A;  4DEJ A;  2H0I A;  2LV3 A;  1T3B A;  2GQK A;  4LA1 A;  2CT6 A;  1LJR A;  4KGI A;  3FZ4 A;  2NVL A;  1G0T A;  2HT9 A;  1FHE A;  1ON4 A;  1AQW A;  4LMV A;  1NW2 A;  1DE1 A;  3LWA A;  1F3B A;  1M7T A;  1PL2 A;  2H6Y A;  4K0N A;  1EP8 A;  1TP9 A;  3EMP A;  1JZR A;  3CYN A;  1FB0 A;  4MZB A;  1MTC A;  7GSS A;  2QKE A;  1SKW B;  3VPT A;  2AUV A;  2DJ2 A;  2KLX A;  4KDY A;  4PQI A;  3TB2 A;  1A0R P;  4F82 A;  2OJL A;  5AGY A;  1K0O A;  4OFN A;  3ZIT A;  4NHZ A;  2VD0 A;  3P7X A;  5DDL A;  5B6M A;  3EWL A;  4BA7 A;  1M9B A;  1PX6 A;  1NHY A;  2B7K A;  2WJU A;  2VM2 A;  2K9F A;  5CAX A;  5CRG A;  4TR4 A;  1GNW A;  4MPG A;  3GIX A;  3UVT A;  1GL8 A;  2L57 A;  1K3L A;  3ZRE A;  5ECS A;  3UBL A;  1R7H A;  4FO5 A;  2KP2 A;  2R3X A;  4WF5 A;  1XWB A;  3IE3 A;  3F3Q A;  3UMA A;  2AB6 A;  3GX8 A;  4KX4 A;  4K1F A;  1V57 A;  2VM1 A;  4K2D A;  1VF2 A;  3BJ5 A;  3ZLP A;  4HQS A;  4ZL9 A;  1PQN A;  4AJ8 A;  4Q5Q A;  4MJC A;  1WWJ A;  2HXK A;  1ERU A;  4G2E A;  2GT5 A;  3GKM A;  5A4W A;  1XWK A;  4BWS A;  1V9W A;  2HLS A;  4ZB9 A;  1OKT A;  3QAG A;  3JCM L;  2NTO A;  3AY8 A;  4IQ1 A;  3F6F A;  5B8A A;  1EV4 A;  4J2F A;  3IAS 2;  1TI1 A;  3QOU A;  3GTU B;  3UAP A;  5J41 A;  2PGT A;  2H75 A;  1M2D A; 
#chains in the Genus database with same CATH topology
 1FB6 A;  2KCD A;  3RNT A;  2G2Q A;  1KC8 4;  3KSP A;  2VCX A;  1UCK A;  3D9R A;  2MBS A;  1KD1 4;  2PPT A;  5M1A A;  2ON7 A;  3DMC A;  1HZ1 A;  4EV2 A;  4XRA A;  2W04 A;  4POK A;  4N30 A;  16GS A;  3IC8 A;  1A0F A;  3F40 A;  3VWU A;  4EC6 A;  2DKH A;  3KZQ A;  2QGV A;  2MMN A;  1XBS A;  1F8N A;  3Q2P A;  3MNG A;  4IQA A;  2LST A;  3MYT A;  4JRR A;  1V40 A;  3TUE A;  3FF0 A;  3WT2 A;  2JU5 A;  3NZN A;  4KA0 A;  3TOU A;  4L8E A;  2M7O A;  1TU7 A;  1A2L A;  4WR5 A;  1TK8 B;  3J7Y k;  4ECB A;  5HOH A;  3BNB A;  3GNJ A;  19GS A;  2IN3 A;  5COH A;  3CXC 2;  2LRN A;  1X1W A;  2YPM A;  1MDK A;  4YQV A;  1Y4K A;  2FWE A;  2I4A A;  2MZC A;  1LRA A;  4GTU A;  3FZW A;  1W2B 2;  1YHQ 3;  3NX0 A;  4N11 A;  1OHS A;  3SVA A;  2GTU A;  2CVD A;  4KH7 A;  1WQL B;  3JVC A;  1W6G A;  4G0L A;  1K3O A;  1U3I A;  5ECQ B;  2OE1 A;  2WOF A;  1M3J A;  5EY6 A;  1GD4 A;  3FCS B;  4IW9 A;  2K0M A;  3LSZ A;  1C54 A;  4LZI A;  1E3R A;  1H4O A;  2I1U A;  2YX9 A;  3G7J A;  5BVB A;  4NXI A;  4Q53 A;  1N2A A;  2X8G A;  5JWQ B;  5GST A;  17GS A;  4O02 B;  5HGR A;  1R4C A;  1U5O A;  3OXA A;  7STD A;  3MIX A;  3LW9 A;  5AN1 A;  1RGA A;  3HX8 A;  1GSU A;  3QMX A;  1HU9 A;  1TRP A;  4O5R A;  4OFM A;  5HR2 A;  3EBT A;  4JRF A;  1RMS A;  4IJI A;  2X99 A;  4XHM A;  2H66 A;  2A2R A;  5ELU A;  1PGT A;  3CBU A;  5ECM B;  3ZL5 A;  1FGT A;  5D83 A;  4OO5 A;  1G6W A;  3QFA C;  2VAF A;  4N6L A;  3B8L A;  3A5E A;  4JU5 A;  2LS5 A;  2OAD A;  1IYI A;  2QGU A;  2Z76 A;  3D5J A;  1U6T A;  4ICY A;  8CHO A;  3D6I A;  4KUN A;  3WGD A;  12GS A;  3ROB A;  4TXO A;  1VQ8 3;  4XS6 A;  2CFW A;  2HNL A;  4BTW A;  3GZY B;  4K90 B;  2JL4 A;  3M9J A;  3MYD A;  4X0X A;  1SYR A;  4KCE A;  1AQV A;  1OC3 A;  3TJB A;  2WGQ A;  1BSD A;  5DVB A;  2JZT A;  1PKW A;  1A2J A;  5IEO A;  4X2O A;  3APQ A;  5J9C A;  1WP0 A;  3DM8 A;  2IUJ A;  2IME A;  3KFQ C;  1RCL A;  2O3O A;  2W2C A;  5EPF A;  2AAD A;  1O7H B;  1S3D A;  5CXO A;  1OC9 A;  1UCJ A;  2BMR B;  2WRT A;  1BSE A;  3HXS A;  5CK6 A;  3RAZ A;  1CH0 A;  3X40 A;  1OAZ A;  2AV4 A;  2H0G A;  5IOW A;  1DMN A;  3GL3 A;  4H86 A;  4WBR D;  3L9U A;  4G19 A;  4FR9 A;  4P3Y B;  6RNT A;  4V1A p;  1I2E A;  2BO9 B;  3F8X A;  4GL6 A;  1SQW A;  1QQ2 A;  4MDC A;  5IW9 A;  2WZ9 A;  1WMJ A;  4GSS A;  4MAB A;  5L71 A;  1SJZ A;  4GWR A;  2P09 A;  5AIG A;  4FMC A;  5AII A;  1K0M A;  3LZA A;  1Q81 4;  1TRV A;  2E7P A;  2RM5 A;  4GSN A;  4MF5 A;  1JKG A;  2QA1 A;  3Q18 A;  5IMD A;  3LQ7 A;  3APO A;  2I81 A;  2C0E A;  4WKW A;  4OCF A;  2XGN A;  3TJJ A;  5DAL B;  2R4V A;  2X4A A;  4J56 E;  1EGO A;  5CRE A;  3OWU A;  4IP1 A;  2HSH A;  3GSS A;  2CKF B;  2LJR A;  2A2P A;  1GD3 A;  3ISO A;  1XVW A;  1I70 A;  4L5L A;  5CYY A;  2RUF A;  2OE3 A;  1UGH I;  1RGG A;  3Q3F A;  1O73 A;  4IS0 A;  4XS1 A;  4EO3 A;  3US3 A;  6GST A;  1RGE A;  5AIH A;  1FVK A;  4KW6 A;  2Y73 A;  3L0R A;  4TR3 A;  3FZ9 A;  3TJG A;  3EC3 A;  3AMO A;  6GSV A;  3DGM A;  2D42 A;  2BNG A;  2CHC A;  3UL3 A;  1Q98 A;  4O3V A;  2DJK A;  3ZZX A;  3FY7 A;  4DSR A;  3EX9 A;  1W7C A;  1FOH A;  4HYZ A;  14GS A;  2MMO A;  2RNT A;  4MA9 A;  11GS A;  1RQM A;  1K0A A;  3M3M A;  1TU5 A;  4YAP A;  2KF4 A;  2DLX A;  3WOE B;  1B21 A;  3K63 A;  2PWJ A;  1GTB A;  3UJM A;  4JE1 A;  4ORL A;  4TX4 A;  1RGH A;  5CP1 A;  3RHB A;  4AJ6 A;  3MPH A;  1B4P A;  5KP3 A;  4XDW A;  3QDN A;  4KND A;  1Z7P A;  1JBT A;  4TXO B;  3GFK A;  4L7K A;  1RCK A;  3MWH A;  4IIA A;  2F8A A;  3HKR A;  1BNS A;  3RGR A;  2KF3 A;  1BGS A;  4BU4 A;  5E4W A;  1I2G A;  1PA3 A;  1D6U A;  1AV4 A;  1GUK A;  4EIP A;  1BX9 A;  1BQ7 A;  4HDE A;  6GSW A;  2ZHX B;  2F8F A;  2H71 A;  4Z7X A;  5IPH A;  4KSM A;  1I8V A;  3RDW A;  3F4T A;  3IHG A;  1J0F A;  1JHB A;  3FR3 A;  1WMO A;  2CZ2 A;  5IG5 A;  2JAC A;  3CRU A;  3EN8 A;  4PUR A;  3I43 A;  4YQM A;  2SBL A;  4KVH A;  3PGT A;  4KFD A;  2LNT A;  3VWV A;  1X5D A;  4Z2R A;  2IMD A;  1G96 A;  3RPN A;  5FT3 A;  3MDK A;  2O89 A;  2BMQ B;  3M1G A;  1BSA A;  18GS A;  2DC5 A;  5FWG A;  1PX7 A;  3EMX A;  1YJ9 3;  1DVD A;  5D73 A;  4ZM8 A;  3HVS A;  3TJK A;  3PPU A;  2HMJ B;  1IU7 A;  3WDG B;  1PN9 A;  3UVH A;  3IPT A;  5A4U A;  2QIY A;  2V1L A;  1RGK A;  4MH2 A;  5EVO A;  3O76 A;  3GKK A;  1QMA A;  1XW5 A;  1LNH A;  3G4S 3;  1NJI 4;  3I0Y A;  3X3Z A;  1M9G A;  2R2J A;  3URP A;  3GSP A;  1FAA A;  5J9B A;  3ZG5 A;  2JDI H;  1GOY A;  1B9X C;  2L59 A;  4ZB8 A;  3UB1 A;  1YJW 3;  1NB3 I;  2R0G A;  4LMI A;  2JQ5 A;  4NV5 A;  1EKM A;  1A2K A;  1V58 A;  4ZIL A;  4POM A;  3HJP A;  5GSS A;  4XCS A;  3TKS E;  4LLR A;  1XFL A;  2OKA A;  3EE2 A;  4MP4 A;  4YH2 A;  4PUF C;  4FMD A;  2RGQ A;  2VO4 A;  4X43 A;  4HM7 B;  3X41 A;  5FHI A;  5A5K A;  4QQ7 A;  1X9S B;  1IVU A;  2RII A;  1K41 A;  4OK0 A;  5IOX A;  2CWV A;  1JB2 A;  3H1N A;  4MJB A;  2L4Q A;  5B6N A;  1BVI A;  3ZYW A;  2H01 A;  1T00 A;  1TTO A;  1W6Y A;  1OGZ A;  6GSY A;  1T4Z A;  4XBT A;  1MOL A;  5HR3 A;  2FGX A;  3FZ5 A;  1LXE A;  1G7O A;  1Z9H A;  2PZV A;  1B27 A;  2VLV A;  3KP9 A;  4GLT A;  4HZ9 B;  4K9Z A;  22GS A;  1QVF 2;  2OOV C;  3CCU 3;  5IG3 A;  1D6Z A;  1UN2 A;  2LJK A;  2M72 A;  2H1G A;  4NHW A;  9GSS A;  1S5A A;  1EEM A;  4MMZ B;  1GTI A;  1BAO A;  2CFL A;  5AIF A;  3IAM 2;  3KEB A;  2FNO A;  2RSX A;  2H1B A;  4EV5 A;  3EU4 A;  2IY2 A;  2VCW A;  1JZW A;  2W9Q A;  1FW1 A;  1WPI A;  3FGY A;  5ECO B;  1SIH A;  3GUS A;  2EIR A;  4PXO A;  2HRA A;  2AAE A;  3EC9 A;  1U87 A;  4HZ2 A;  1TRQ A;  2GSQ A;  1QAL A;  3HVN A;  1B48 A;  2OAC A;  3C1R A;  1FO5 A;  4N10 A;  5J5N A;  1NO3 A;  3NBB A;  5LCZ A;  2R0C A;  3W6G A;  4BL7 A;  5BU4 A;  1IT8 A;  4I5Q A;  3SX1 A;  4FCJ A;  3CCJ 3;  3SLU A;  5ELG A;  2EIQ A;  3Q6O A;  2GQL A;  3J7Y d;  1FGO A;  3LFL A;  1VQQ A;  2B1X B;  3O6T A;  4GB5 A;  3LJR A;  4FH8 A;  4ILF A;  3UL6 A;  2IMI A;  4HAA A;  3DGY A;  5D81 A;  2GDR A;  5D9X A;  3NBR A;  1XOA A;  3QFB C;  2QSI A;  4PQ1 A;  3IRA A;  1EWX A;  3L0H A;  1ASK A;  3DML A;  2DSA A;  4JR4 A;  1PYL A;  4TKY A;  5HFI A;  1MD3 A;  3L9V A;  3FKA A;  5JCU A;  2P0X A;  3KXO A;  1Z3E A;  6GSS A;  1C72 A;  4MF7 A;  1YIT 3;  1SD9 A;  1VF1 A;  2CFD A;  4EUY A;  3GKN A;  5H5R A;  3GA4 A;  2YWN A;  1GOV A;  1ZYQ B;  4O7H A;  3LXT A;  2H73 A;  1BRG A;  3CPW 2;  3P8W A;  1K9M 4;  1LOX A;  1ULI B;  4O92 A;  1CQH A;  4Z2T A;  1K3Y A;  3NXJ A;  2BT3 A;  3K9M C;  3TCO A;  3KCH A;  1F3A A;  1T4Y A;  2LEG A;  1YY7 A;  4F0C A;  1I0X A;  1AR0 A;  2L4C A;  1MNL A;  2IMJ A;  1TRS A;  5GSP A;  3V1W A;  2W6J H;  1R26 A;  2O9U X;  4XS4 A;  3NV0 B;  1IYH A;  4AKZ A;  1D6Y A;  1OE7 A;  1EV9 A;  1UCL A;  3IA1 A;  4R9K A;  2UGI A;  4XBX A;  4BWQ A;  1O7G B;  3IR4 A;  3IJE B;  1O7P B;  1KQS 2;  2OOV A;  2TIR A;  4LGQ A;  4XM4 A;  2GZP A;  2AJQ B;  1X9W B;  3F9S A;  2W03 A;  2AAW A;  3HHV A;  2A4V A;  2FUG 2;  3TOT A;  1K0B A;  3VSY A;  3U1W A;  3PS8 A;  3UL5 A;  3HYP A;  2SAR A;  5TGN A;  1W02 A;  1SK1 A;  3N5O A;  1BUJ A;  1XXU A;  3M0F A;  3FG4 A;  3LML A;  3HJO A;  2VCQ A;  5F05 A;  3VI7 A;  2YP6 A;  1FA3 A;  1U3A A;  1GSP A;  1YVB I;  4L0W A;  5G31 A;  3F0I A;  4KCA A;  3NOF A;  3HVX A;  1F6M C;  4ZL7 A;  1ZGX A;  1NU3 A;  3FR6 A;  2KAA A;  1IQ8 A;  3U6V A;  4BVY A;  1FYS A;  1NHO A;  3TKS C;  1OYJ A;  2P0M A;  1YF1 A;  5ECL B;  3GH9 A;  1TDI A;  3WT1 A;  2BMO B;  4F0B A;  1B2S A;  2CX1 A;  3LXU X;  5KP4 A;  4CY8 A;  3EQQ B;  5ECI B;  1TIJ A;  1NWW A;  4ZBB A;  2VD1 A;  2BU4 A;  3HA9 A;  5G2G A;  3TRX A;  3FK8 A;  4RNZ A;  3PR8 A;  4O2H A;  2L5L A;  2X64 A;  5DBQ A;  3GZR A;  1WTH A;  4L5O A;  2B3S A;  5CF2 A;  3FH1 A;  3C7M A;  1OC8 A;  3LYG A;  3KTL A;  1VGL A;  4KDX A;  2XSH B;  3S27 A;  4QWT A;  6GSU A;  7GSP A;  2P0G A;  4TRX A;  2GEX A;  3PH9 A;  3F7X A;  3BU4 A;  1YQ1 A;  3NM7 A;  1O8X A;  4K7I A;  1GP1 A;  1KEB A;  2KP1 A;  5CO3 A;  3ERW A;  2XH9 A;  1XW9 A;  2V6O A;  1RN7 A;  1ERT A;  4WWU C;  3WOD G;  2B6M A;  1JNQ A;  3ERG A;  1MD4 A;  4ECC A;  4IGJ A;  1VQL 3;  2YFJ B;  2GGT A;  2Z77 A;  2N5B A;  3BIR A;  2WGO A;  1M9A A;  4ULX A;  3S5C A;  3WD6 A;  4F9Z A;  2LYX A;  3GAX A;  3CTG A;  3GYK A;  5IMA A;  3PCS A;  1TRU A;  1STD A;  4LYL B;  3D3L A;  4K7N A;  2V2G A;  5BMU A;  2WOH A;  1OUN A;  3STD A;  5LD0 A;  2DJ3 A;  3GRD A;  2D2Z A;  3LXZ A;  1XIY A;  4EE0 A;  1SJ6 A;  3DGL A;  2N5F A;  3GX0 A;  1SEN A;  4GF0 A;  1AVK A;  3CD6 3;  1YKA A;  5G5E A;  3WGE A;  1OF5 A;  1OHO A;  2W9P A;  1RNB A;  4EDZ A;  2ON5 A;  2XHF A;  2G0F A;  3UIW A;  5AI1 A;  3MAK A;  4XS4 B;  1B2U A;  5IM9 A;  4L0U A;  1TOF A;  2BHM A;  3OW2 2;  3T8N A;  3FW2 A;  3A2V A;  1Z6M A;  1VRS D;  1T7P B;  3A2X A;  3A5W A;  3CPO A;  1A24 A;  2VLU A;  1GUM A;  3TKP A;  3K7C A;  1KTE A;  1R4Y A;  1W4V A;  2H76 A;  1HD2 A;  2PN8 A;  4ML6 A;  1NNV A;  2FLS A;  3U97 A;  4ZIJ A;  3ZFZ A;  1ZYE A;  4O32 A;  2C8U A;  2IMF A;  3ALA A;  4MJA A;  4EKZ A;  3C73 A;  4F03 A;  1V2A A;  3E0U A;  1UUG B;  3IMA B;  4HM1 B;  4HU9 A;  2Z7A A;  4POB A;  5INY A;  3ZTL A;  1VQK 3;  3FF2 A;  1ZZY A;  4PTS A;  3FKF A;  1SD8 A;  3LG6 A;  4HM8 B;  1THO A;  3CSI A;  3TKS A;  3M8C A;  2Z6B A;  2QA4 3;  4BVY B;  3ZVJ D;  2DJ1 A;  1H75 A;  3HZ8 A;  2C11 A;  2EIO A;  3CXG A;  3AHW A;  1BSB A;  2HML B;  2F9S A;  5ID2 A;  3H93 A;  1RRH A;  5JCG A;  4MPF A;  2HZF A;  1WMP A;  1PKZ A;  4N6M A;  2YJH A;  1RGL A;  3G7I A;  3BND A;  1BAY A;  3G9B A;  1MWR A;  1TUH A;  5BXQ A;  1GWC A;  4J5G A;  3P90 A;  3EBY A;  5F06 A;  2EC4 A;  2HRK A;  3UAR A;  3VFI A;  4R80 A;  5ELJ A;  1E2Y A;  4GCI A;  2GT6 A;  3VGN A;  1BOX A;  1LU4 A;  3LTC A;  4NPB A;  1FZU A;  1TJD A;  4V1A g;  4K5R A;  5KN3 A;  4DSS A;  4WHA A;  3CTF A;  3EF8 A;  1IVV A;  2K6V A;  2YAN A;  1TK0 B;  4L8O A;  4DSQ A;  3MG1 A;  4EF0 A;  1TI3 A;  1FGR A;  3RDE A;  3JUO A;  3C71 A;  2MF7 A;  1RLS A;  3BNE A;  1T1V A;  1HNC A;  1JV2 B;  1R5A A;  2F98 A;  3GZB A;  5LC6 A;  2GQM A;  3EVI A;  1B4Q A;  1VZZ A;  4PNF A;  2IFQ A;  1LOY A;  3KZT A;  3ZIJ A;  4HM4 B;  4IPB A;  5F07 A;  1L5G B;  3GUR A;  1XWA A;  2CAI A;  5GZZ B;  4EBG A;  2VCZ A;  3B4O A;  4OVM A;  2ZDJ A;  1AC1 A;  3KH9 A;  4MMX B;  3P2A A;  1I3F A;  3F7S A;  5GAP D;  3UJ1 A;  3VUR A;  2YV7 A;  1S3C A;  1CEW I;  5HFG A;  2Z9S A;  1MGR A;  1ZOF A;  3DD3 A;  5HQP A;  2YCD A;  1T2I A;  3LT8 A;  3Q90 A;  3EHC A;  5ENU A;  2R0P A;  2YNX A;  5C04 A;  2CZ3 A;  1GUL A;  5KN1 A;  5DCH A;  2DKI A;  1GOU A;  3IDV A;  1XW6 A;  4HI7 A;  3RBT A;  1OKD A;  2GZY A;  2KHP A;  3WHO A;  5AIS A;  2QC7 A;  1N5H A;  1NDO B;  4HM6 B;  3LTA A;  4DKI A;  1XOB A;  1I9D A;  2R37 A;  5KN0 A;  3U5R E;  1HQO A;  3NIV A;  3WA3 A;  5C00 A;  4GQF A;  1K0D A;  1VQ9 3;  1MDJ A;  5AEU B;  1QK8 A;  3UOM A;  2YZH A;  2FGT A;  4KE3 A;  4EL1 A;  2LUS A;  1GY5 A;  3W8S A;  2O87 A;  2ZNM A;  2JAD A;  2PER A;  2C4B A;  1GH2 A;  1W89 A;  5FGO A;  5IMZ A;  4TR1 A;  3IBH A;  2HI7 A;  1Z1S A;  5A4V A;  1TXX A;  1FUT A;  2UZ8 A;  1K8A 4;  13GS A;  4G10 A;  1W01 A;  1EQK A;  3LGC A;  3FMW A;  4N6N B;  2WCI A;  4NV2 A;  4NWY A;  5KOW A;  3D4A A;  1M1K 4;  1YDK A;  3E3E A;  1OHP A;  2MMZ A;  1GUH A;  2B1L A;  4N0Z A;  3F8U A;  3RHC A;  1A2M A;  4HKV B;  1VQ6 3;  2RCD A;  1SKS B;  4TW5 A;  5D9V A;  3D4T A;  3GWR A;  5G5F A;  1G02 A;  4OD7 A;  4O8S A;  2H70 A;  3I9V 2;  4K5S A;  2B5X A;  4I4K A;  4KDU A;  4HM5 B;  3LYK A;  3AGN A;  1BNI A;  1BSC A;  4KFE A;  1XCC A;  3ZFL A;  3BCI A;  1SJI A;  2C3Q A;  1FUS A;  2C1Y A;  2GBX B;  1VQO 3;  3QK9 A;  2WUL A;  3EUR A;  5LNK e;  1UUV B;  4I8B A;  4MNN A;  1M0U A;  1EP7 A;  3L78 A;  1M2A A;  2P5Q A;  10GS A;  4K6X A;  5IPG A;  5BRT A;  3DXO A;  2DJ0 A;  4WET A;  3MWZ A;  4WBJ A;  4GXZ A;  2GBW B;  1YNV X;  4EXJ A;  2N5A A;  2DBC A;  2CW9 A;  4PNG A;  1XWC A;  3CSH A;  2IFQ B;  2X8C A;  3S9F A;  1DSB A;  2F51 A;  1FW7 A;  5LC7 A;  2CWT A;  3APS A;  1W4N A;  4LSO A;  1OC9 B;  4CDO A;  3FHK A;  1NSW A;  4JZQ A;  3KIJ A;  4IP6 A;  3M9K A;  5IG0 A;  1GYB A;  2IL3 A;  3CSJ A;  4AGS A;  2FA8 A;  2P31 A;  3MG3 A;  4BVX A;  3GZX B;  4KB3 A;  4LMW A;  2OE0 A;  3QD9 A;  1OCV A;  3FLJ A;  2HZE A;  4OMV A;  3BLZ A;  2F86 B;  2YWM A;  4I6X A;  3KH7 A;  1Q4J A;  1JKG B;  1V98 A;  2C0F A;  4HVN A;  2A2S A;  4ACS A;  2UX0 A;  3DWV A;  2MYG A;  4GHO A;  3D79 A;  5EQL A;  5DAK A;  1US1 A;  2FXT A;  1M1X B;  3KGK A;  3KCM A;  4A5P A;  4FYU A;  1B3S A;  3SYU A;  3GHA A;  4I2T A;  2V41 A;  4GST A;  1BYE A;  1JBS A;  1Q40 A;  1RGF A;  3EIN A;  5STD A;  2L6C A;  2NPB A;  2PVQ A;  4TR1 B;  3AHS A;  3HJM A;  3D0Z A;  1Q7H A;  3VI5 A;  4MEI A;  3CNX A;  1UA5 A;  5D9W A;  3EU3 A;  2XFS A;  4MJD A;  2W56 A;  2XEP A;  4WXT A;  1RTU A;  2UUG C;  4Q5F A;  6STD A;  1GMR A;  1S3A A;  3CC2 3;  2TRX A;  2RLI A;  1VQM 3;  3PIN A;  1QUW A;  3AMO B;  2C0G A;  1ROV A;  4XIH A;  3CCE 3;  2CFK A;  5AEW B;  2WDU A;  1GNE A;  1WE0 A;  1O85 A;  2K8S A;  3QRD A;  4KFF A;  3I56 3;  1GSE A;  3CCQ 3;  3TKR A;  3KMO A;  4HJM A;  3TGZ A;  1I3I A;  4FCM A;  5BIR A;  4N6U A;  3F4S A;  2XBI A;  4NAX A;  3BD2 A;  2L4V A;  3KN4 A;  3BCK A;  4V2L A;  1BIR A;  3DZL A;  1RK4 A;  3VLN A;  1ULJ B;  2H1A A;  3H79 A;  1X1Y A;  2CVK A;  2H19 A;  2LNS A;  3GN3 A;  4J8T A;  4LL4 B;  7RNT A;  1X5E A;  3SWL A;  4H61 A;  1MDI A;  1K0N A;  5IO0 A;  4WR4 A;  2CH9 A;  4WYK A;  1ZYN A;  3K0Z A;  4KZ1 A;  4N6V 0;  3CCS 3;  4TOP A;  1VQ5 3;  3WR2 A;  3FR9 A;  4WEY A;  2H74 A;  3S67 A;  3F9U A;  5G1L A;  1AY7 A;  3K8N A;  2OWP A;  5A0O B;  1JZD A;  5DCG A;  5J4U A;  2VL3 A;  2MBT A;  3VK9 A;  2H6Z A;  1SU9 A;  3G0K A;  1AQZ A;  2I3Y A;  1ST9 A;  2HMM B;  2F3M A;  3M8N A;  3BOA A;  1C7H A;  1QVG 2;  2YJ7 A;  1EOH A;  1BG5 A;  1UVZ A;  3H4K A;  1BU4 A;  1AUC A;  5IMV A;  3FYG A;  3BBY A;  3G7Y A;  5DQS A;  1N8J A;  2VL9 A;  4N3V A;  3OWY A;  4HUA A;  2X49 A;  2R4I A;  4ISD A;  1OE8 A;  2C3N A;  3HDC A;  1QMV A;  3CMI A;  1B2M A;  1ERV A;  4HS1 A;  1RHL A;  1ZO2 A;  3DIE A;  1OH0 A;  4XTS A;  5CRD A;  2JZS A;  2HZE B;  3GRX A;  1X9M B;  5KN2 A;  1THX A;  1V74 A;  3N9J A;  4R1K A;  1QFN A;  1TTZ A;  1ML6 A;  4KF9 A;  5AYR B;  3WYW A;  1WMN A;  2XF3 A;  3DVX A;  2YFI B;  3DKS A;  4OWY A;  1QJG A;  1ZS7 A;  2H8L A;  4EC0 A;  1U88 A;  2XPE A;  2YOI A;  2IWT A;  2CAQ A;  1TFO A;  3CCV 3;  1Y6E A;  1IDP A;  3TJF A;  3KD0 A;  3GTU A;  1JB4 A;  3L4N A;  3HD5 A;  5E59 A;  1OVN A;  3TRP A;  4R9L A;  3A2W A;  1SKR B;  1BRK A;  1GS3 A;  1JRQ A;  2W56 B;  2KRT A;  1R5P A;  2HRN A;  3IK7 A;  1GSF A;  2NBS A;  1PL1 A;  4RNT A;  4MZC A;  2R41 A;  5RNT A;  3DGN A;  3D4M A;  5H5Q A;  1K0C A;  3IPZ A;  2GZZ A;  5DJL A;  2M80 A;  5DQY A;  1CQG A;  1S72 3;  3S28 A;  3KP8 A;  2VCV A;  1DET A;  4JR6 A;  2GVP A;  3ME8 A;  4JBB A;  2MMA A;  1VQP 3;  2LTK A;  20GS A;  2BIR A;  2A15 A;  4I97 A;  2R5G A;  4IBP A;  1A23 A;  3KM6 A;  5IMF A;  3PZW A;  1VQ7 3;  8GSS A;  1FG4 A;  4LL1 B;  2PBJ A;  1A2V A;  3IC4 A;  2YWO A;  3CMA 3;  1YJ6 A;  4X4J A;  2FHE A;  3ZRD A;  1VF3 A;  2OBI A;  4HOJ A;  4K61 A;  2C80 A;  1WOU A;  4K1V A;  4Z2U A;  4PX1 A;  2OTL 3;  1J2B A;  4AJ7 A;  1VF4 A;  4HM3 B;  2BJX A;  4HSC X;  2IMK A;  5IMC A;  3RPP A;  1USB A;  2HE3 A;  4WF4 A;  4WYK B;  3PGB A;  3H3H A;  3WGX A;  2B7J A;  3OV4 A;  3SXX A;  3CCM 3;  5HFK A;  2H30 A;  3TDG A;  3DYR A;  3LYP A;  2XFT A;  2YN1 A;  1GTA A;  1ZL9 A;  4FQU A;  4MZW A;  4BL7 B;  2I9H A;  4K1U A;  1UI8 A;  4IEL A;  2RBI A;  2HYX A;  3HY2 A;  1TFK A;  2CIU A;  1YGE A;  1ISK A;  2DMM A;  3EN1 B;  1JZO A;  2B5Y A;  5ECK B;  1E97 A;  2VUP A;  3KKG A;  3F63 A;  4OO4 A;  4BL3 A;  4ECJ A;  5ELA A;  1WJK A;  3E99 A;  8RNT A;  1S3R A;  2YWI A;  3FEU A;  1GMQ A;  1Q86 4;  1AXD A;  1PU4 A;  2FWF A;  4EDY A;  2W0Q A;  2F5W A;  2C3T A;  5D82 A;  1N5P A;  5IER A;  2OBK A;  3Q19 A;  1F2E A;  1GSS A;  2HSM A;  2CFG A;  1QGV A;  2HSY A;  3F6D A;  3SBC A;  2QA2 A;  1W00 A;  3DEX A;  1RNT A;  2KOK A;  2IYJ A;  1MWT A;  3DXB A;  1AQX A;  3ER7 A;  1YEX A;  4HBR A;  1LOV A;  2L6D A;  3A5I A;  3PCR A;  1Z5Y E;  1A67 A;  5CNW A;  2VL2 C;  2D1W A;  5IQY A;  1IK3 A;  3HCZ A;  3LOR A;  4ZBA A;  4WP5 A;  4RI6 A;  9RNT A;  5G1K A;  4GQC A;  5IG4 A;  1GRX A;  5DRV A;  1R4W A;  2J8X B;  3UBK A;  1QAK A;  4JED A;  2XC2 A;  1MGW A;  4QL7 A;  1VQN 3;  1A8L A;  1E6B A;  1LOW A;  3T8U A;  2E2G A;  5HR0 A;  3GV1 A;  1DUG A;  1O8W A;  2PMT A;  3JUP A;  3SOA A;  1HNB A;  3IK9 A;  3DGQ A;  4NHF A;  2WGR A;  1W6C A;  4OCE A;  1DBY A;  5CRH A;  3HVV A;  4PUA A;  1PFO A;  1RDS A;  1M99 A;  4E8H A;  3I55 3;  3TKQ A;  1JFU A;  2GST A;  2VIM A;  3NBJ A;  2ML6 A;  1AVL A;  1TKD B;  3D5G A;  2E2T A;  1RSN A;  1YZX A;  4ECI A;  3QAW A;  3KSE D;  1SK0 A;  2H1D A;  3I69 A;  4J57 E;  5GAN D;  3OWS A;  4USS A;  1GY7 A;  1W5Z A;  2C0D A;  4Q5N A;  1SL1 B;  2LJA A;  2KF5 A;  4X2H A;  4POL A;  2Q07 A;  1B2Z A;  3DUK A;  1STF I;  3HK4 A;  4OFT A;  1BAN A;  1G6Y A;  3LTB A;  2XSO B;  1G7E A;  2F5M A;  3OX9 A;  2BTO T;  4QL9 A;  2DJJ A;  4IT7 A;  3UEM A;  1UDI I;  1A8Y A;  1HYU A;  5DAL A;  1PFP A;  1IQX A;  1RW1 A;  4YKF A;  2OQE C;  4AKY A;  2YFL B;  2O85 A;  2GXF A;  4ML1 A;  4TR0 A;  1DYU A;  3OR5 A;  1I0V A;  2IIY A;  2OA7 A;  1I5G A;  1YJN 3;  3I6A A;  5CRW A;  5ECH B;  1J08 A;  1JLV A;  5IIZ A;  4ZL8 A;  1GTU A;  3ZMK A;  5B7C A;  1LQG C;  3LOY A;  3C1S A;  2FA4 A;  4ZXG A;  3J7Y b;  1IQY A;  2V6K A;  4J9A A;  3QPM A;  2IA7 A;  3VWX A;  2AYT A;  4Q5R A;  2WS2 A;  1MWU A;  3O3T A;  1W2Z A;  2ES7 A;  2CC3 A;  1EZK A;  3JUQ A;  1DE2 A;  1K73 4;  4I2U A;  3QCP A;  1CYU A;  2OTJ 3;  2MC8 A;  1YEP A;  3HIG A;  3ERF A;  3PXM A;  2E2M A;  1BNF A;  4FYC A;  5G30 A;  1RN1 A;  3G6E 3;  1DVC A;  3NHX A;  2H0H A;  4EYC A;  4GSP A;  4V2N A;  3C8E A;  4XDV A;  4FIW A;  1GSY A;  2LQQ A;  5J3R A;  1JN5 A;  2VCT A;  3NQY A;  2VL2 A;  1OGX A;  1EGR A;  5EL8 A;  1F37 A;  2ML5 A;  1O81 A;  4RBN A;  2HRF A;  2LRT A;  1CQS A;  1SII A;  2IJY A;  1O7W B;  2FY6 A;  4OUQ A;  4HU7 A;  3TRQ A;  2DIZ A;  2E2U A;  1FGQ A;  2PU9 C;  4ZBD A;  3KJY A;  2CQ9 A;  2PUK C;  1UI7 A;  4BIK A;  1OF5 B;  1PMT A;  2P05 A;  1PSQ A;  2CWU A;  3CRT A;  3X3X A;  4HOH A;  4YAV A;  4EVM A;  4K7O A;  1UCI A;  2CX0 A;  4CY6 A;  4IHU A;  3HZP A;  3FRC A;  4RQR A;  4CHS A;  2WFC A;  4KAE A;  2BMX A;  4RI7 A;  1B9Y C;  4WFO A;  5JPU A;  3W8J A;  1UC7 A;  2C10 A;  3RGA A;  2GLR A;  4MF6 A;  4K8M A;  4FCZ A;  1BRN L;  1HNA A;  3EYT A;  2CG1 A;  3T0U A;  1I2F A;  1N8Q A;  1BRH A;  3EE1 A;  1A2P A;  3PYJ A;  1BUQ A;  2AHE A;  1SL2 B;  5ECP B;  3ED3 A;  2CX4 A;  2XBQ A;  1IVX A;  2F4Y A;  2E2V A;  5IF6 A;  1HYF A;  3GL5 A;  1TU8 A;  1GSQ A;  1PRX A;  4EW5 A;  1T5Y A;  3ZFB A;  4BTX A;  1WIK A;  5M18 A;  4HJ2 A;  2OCT A;  1IYY A;  3CCL 3;  5ID2 B;  1CYV A;  5JPP A;  1K28 A;  4AF2 A;  3O8Y A;  2OQE A;  1BRS A;  2CX3 A;  1BRI A;  3IHQ A;  1N9J A;  3H51 A;  1WRY A;  3NM2 A;  4MJE A;  3CCR 3;  1AW9 A;  3ZML A;  1O7N B;  1LVN A;  3N54 B;  4U13 A;  1GLQ A;  4XB5 A;  1O7U A;  2J23 A;  2LQO A;  2Y74 A;  5DJM A;  4KSO A;  5FW5 A;  5ECN B;  4K0G A;  2KUC A;  1BNE A;  1HKX A;  2V32 A;  1EUI C;  1ERW A;  2X8H A;  1ZGN A;  2CV4 A;  1XPV A;  1ABA A;  2INX A;  2CA8 A;  1ILO A;  5AYS C;  3EPT A;  5D9T A;  4DSS B;  4RUV A;  2J9H A;  4MCU A;  1EEJ A;  4IKH A;  2ZA4 A;  3R3E A;  1FUW A;  5D93 A;  5ABR A;  3S29 A;  1SK2 A;  3JUN A;  2HFD A;  3ZG0 A;  2GSR A;  2HOH A;  4EIQ A;  3G8Z A;  2HMN B;  1Z7R A;  5KOX A;  3KTB A;  3WOF B;  3LEF A;  2L1S A;  4MK3 A;  4MMM A;  2CVB A;  4IN0 A;  3N9H A;  1IV7 A;  2FCH A;  2WB9 A;  3IXR A;  4BTY A;  1JN5 B;  2ZUP A;  3E9J B;  4D73 A;  5B8B A;  1QXH A;  2GU3 A;  2FNQ A;  4HQZ A;  1SYX A;  5IO2 A;  1E3V A;  1TRW A;  1RGC A;  2V1M A;  2M46 A;  3EJV A;  1OAC A;  2RM6 A;  5JCW A;  3BNC A;  3HI7 A;  2B5E A;  4AEQ A;  3MSZ A;  3R2Q A;  3VF1 A;  4HM2 B;  1EOG A;  1IVW A;  3IOS A;  5KP1 A;  3FSD A;  1IT7 A;  1KSI A;  2I9W A;  1B20 A;  3F3R A;  2TRC P;  4MLY A;  2JSZ A;  3VPQ A;  3G16 A;  2HMK B;  3SED A;  1XVQ A;  4XRD A;  3D22 A;  4PGT A;  5IEN A;  3QR6 A;  3A3T A;  2K54 A;  1UGI A;  4RNY A;  1X0R A;  4V2M A;  2P5R A;  3AGO A;  3V92 A;  3FG3 A;  4YKG A;  1PD2 1;  3Q1C A;  2ALB A;  3GST A;  3ME7 A;  4CPK A;  3D5I A;  3MKI A;  5AIX A;  1YF0 A;  4HZB B;  4X1U A;  1Y25 A;  4HZ4 A;  1N9E A;  4G0K A;  4F2I A;  3KE7 A;  1RKY A;  4FYB A;  2XRX B;  4TN8 A;  5DRE A;  3KMN A;  1GY6 A;  4MH3 A;  2RUE A;  3D21 A;  4TXV A;  2H72 A;  1ZCP A;  4N6T A;  1AAZ A;  1O7M B;  2GS3 A;  2YV9 A;  1JLW A;  3ECF A;  3UNL A;  3Q74 A;  4HJL B;  1UUW B;  4NMU A;  2C4J A;  3GH6 A;  2JZR A;  1NM3 A;  1YGW A;  3F4R A;  5F8B A;  1M90 4;  3CQF A;  1FOV A;  1ZMA A;  4BPY A;  1UW1 A;  1BNG A;  1O6J A;  5D8I A;  1ACV A;  4KT3 B;  1KNG A;  1URM A;  1YKC A;  2VLT A;  1Q42 A;  3SOY A;  4CW9 A;  1ZX2 A;  5G2Z A;  1VQ4 3;  1U8C B;  2ZCT A;  1T8E B;  3L9S A;  2B24 B;  4TVE A;  1X5C A;  5AIV A;  3F8H A;  4R4K A;  1GMP A;  3N8B A;  5HR1 A;  4ZB6 A;  2E0Q A;  2L5O A;  4IJ3 A;  3NV0 A;  2YZU A;  3HZ4 A;  1Q82 4;  3K5T A;  3NUV A;  4CJN A;  4G9H A;  2FD3 A;  2H6X A;  1GSD A;  1MEK A;  1F9M A;  3FG1 A;  3HII A;  4GRF A;  3X42 A;  2GSP A;  3BB9 A;  4BIR A;  2STD A;  1LQM B;  1KBN A;  2K8V A;  1SL0 B;  3CC7 3;  2DIY A;  3FZA A;  3JUM A;  4K2X A;  4PQH A;  5F0G A;  2R6K A;  1SAR A;  2GSS A;  3CU3 A;  5JWR B;  3DRN A;  3QAV A;  2JSY A;  1RJO A;  6GSX A;  2QEX 3;  1BED A;  5CF1 A;  2O7K A;  3A76 A;  3B7C A;  4CDL A;  2FWH A;  3DY5 A;  5D96 A;  4STD A;  3GMF A;  4RQX A;  3ZIV A;  4D73 B;  2PVO C;  3DVW A;  1BJX A;  2CG0 A;  1PY3 A;  2DML A;  3IV4 A;  2F99 A;  3GKX A;  1BNR A;  5H5S A;  1M2B A;  4H3U A;  4XBY A;  2FWG A;  2XPD A;  2GEY A;  1TK5 B;  4HM0 B;  2K18 A;  1FVJ A;  4HEA 2;  3VWW A;  2LQV A;  5IEP A;  1ROA A;  2LKU A;  4E8E A;  4N0V A;  1XZO A;  4LEH A;  4BVX B;  3HOH A;  4NRE A;  5ECR B;  1JBR A;  3H8Q A;  4IVF A;  1B8X A;  5JWO B;  4EXR A;  1T2H A;  2LRC A;  2VOC A;  1XG8 A;  1RRL A;  5JBS A;  3X3Y A;  1TW9 A;  2F56 A;  4MMY B;  2RFR A;  5DAK B;  1LBK A;  2O8V B;  1AIU A;  5KEJ A;  1Z6N A;  1J9B A;  4YQU A;  1RN4 A;  3CNM A;  1XWG A;  2IPA A;  4ID0 A;  1GLP A;  4RZM A;  4O5U A;  3ZVJ A;  1Q40 B;  2HMO B;  1BNJ A;  1B2X A;  3LH4 A;  2PNC A;  1NB5 I;  2B1K A;  4DVC A;  2REM A;  2NDO A;  4G0I A;  4DEJ A;  2H0I A;  2LV3 A;  5M19 A;  3V99 A;  1T3B A;  1QAF A;  2GQK A;  4LA1 A;  2CT6 A;  2XGL A;  1LJR A;  4KGI A;  3FZ4 A;  2NVL A;  1G0T A;  3MHE A;  2HT9 A;  1FHE A;  1DMQ A;  1ON4 A;  1AQW A;  4LMV A;  4BL2 A;  1KWI A;  1NW2 A;  1SJW A;  1DE1 A;  1FGM A;  3LWA A;  1PL2 A;  1F3B A;  1M7T A;  3NQZ A;  2H6Y A;  2A4H A;  1MWS A;  4K0N A;  2P38 A;  1YVS A;  4PEJ A;  1N8R 4;  2KF6 A;  1EP8 A;  1TP9 A;  3EMP A;  1JZR A;  2CK3 H;  3CYN A;  2GU1 A;  3EB8 A;  3F14 A;  3CME 3;  4J5K A;  1FB0 A;  3CC4 3;  3WA2 X;  3B4P A;  3LTD A;  1X1X A;  4FMB A;  4MZB A;  1MTC A;  7GSS A;  2QKE A;  1SKW B;  3VPT A;  2AUV A;  2DJ2 A;  3MG2 A;  2KLX A;  1BRJ A;  1LNI A;  4KDY A;  2IUK A;  4PQI A;  3TB2 A;  1A0R P;  1JB5 A;  5EVH A;  4F82 A;  2OJL A;  1JJ2 2;  5AGY A;  1K0O A;  4OFN A;  3ZIT A;  4NHZ A;  2VD0 A;  5CLK A;  3P7X A;  5DDL A;  3MSO A;  4O5Q A;  3DH2 A;  5B6M A;  3EWL A;  4BA7 A;  1M9B A;  1PX6 A;  1A90 A;  1OPY A;  3WMD A;  4CCV A;  1M3I A;  1NHY A;  5I97 A;  2KXG A;  2B7K A;  1PN0 A;  3KII A;  2WJU A;  2VM2 A;  2K9F A;  5CAX A;  2ZL8 A;  5CRG A;  4TR4 A;  1GNW A;  4JF8 A;  4MPG A;  3GIX A;  3UVT A;  1GL8 A;  2L57 A;  1K3L A;  3ZRE A;  5ECS A;  3UBL A;  1R7H A;  4FO5 A;  2KP2 A;  3V98 A;  2R3X A;  4WF5 A;  1XWB A;  3IE3 A;  3F3Q A;  3UMA A;  1EG9 B;  4G1M B;  1IV9 A;  2AB6 A;  3GX8 A;  4KX4 A;  4K1F A;  1Q7Y 4;  1V57 A;  2VM1 A;  1EA2 A;  4K2D A;  1VF2 A;  3BJ5 A;  3ZLP A;  4HQS A;  4ZL9 A;  1DE3 A;  1PQN A;  3DGO A;  4AJ8 A;  4Q5Q A;  1DMM A;  4MJC A;  4N6O B;  1WWJ A;  6GSP A;  2HXK A;  1ERU A;  4G2E A;  1Q9E A;  2K3D A;  2GT5 A;  3GKM A;  5A4W A;  2XR8 B;  1SPU A;  4L8P A;  1XWK A;  4BWS A;  3G71 3;  1V9W A;  2HLS A;  4FMA A;  1OKT A;  1TP6 A;  5EEO A;  3QAG A;  4ZB9 A;  3JCM L;  2NTO A;  3AY8 A;  4IQ1 A;  3F6F A;  5B8A A;  1EV4 A;  4J2F A;  1YI2 3;  1YIJ 3;  1X1U A;  3IAS 2;  1TI1 A;  3QOU A;  3GTU B;  1WNH A;  3UAP A;  5J41 A;  2PGT A;  3LT9 A;  2H75 A;  1ZYP A;  1M2D A;  2WO0 A; 
#chains in the Genus database with same CATH homology
 1FB6 A;  2G2Q A;  2VCX A;  2MBS A;  2PPT A;  2ON7 A;  4XRA A;  4POK A;  4N30 A;  16GS A;  3IC8 A;  1A0F A;  3VWU A;  2DKH A;  3KZQ A;  2QGV A;  2MMN A;  1XBS A;  4IQA A;  3MNG A;  2LST A;  4JRR A;  1V40 A;  3TUE A;  3WT2 A;  2JU5 A;  3NZN A;  4KA0 A;  3TOU A;  4L8E A;  1TU7 A;  1A2L A;  4WR5 A;  1TK8 B;  3J7Y k;  4ECB A;  3GNJ A;  19GS A;  2IN3 A;  5COH A;  2LRN A;  2YPM A;  1MDK A;  4YQV A;  2FWE A;  2I4A A;  2MZC A;  4GTU A;  4N11 A;  2GTU A;  2CVD A;  4KH7 A;  4G0L A;  1K3O A;  1U3I A;  5ECQ B;  2OE1 A;  5EY6 A;  4IW9 A;  3LSZ A;  1H4O A;  2I1U A;  3G7J A;  4NXI A;  1N2A A;  2X8G A;  5JWQ B;  5GST A;  17GS A;  3MIX A;  5AN1 A;  3LW9 A;  1GSU A;  3QMX A;  4O5R A;  4OFM A;  5HR2 A;  4IJI A;  2X99 A;  4XHM A;  2H66 A;  2A2R A;  3CBU A;  1PGT A;  5ECM B;  3ZL5 A;  4OO5 A;  1G6W A;  3QFA C;  2VAF A;  4JU5 A;  2LS5 A;  2OAD A;  1IYI A;  3D5J A;  1U6T A;  4ICY A;  3D6I A;  4KUN A;  3WGD A;  12GS A;  4TXO A;  4XS6 A;  2HNL A;  3M9J A;  2JL4 A;  3MYD A;  4X0X A;  1SYR A;  4KCE A;  1AQV A;  1OC3 A;  3TJB A;  5DVB A;  2JZT A;  1PKW A;  1A2J A;  3APQ A;  5J9C A;  1WP0 A;  2IME A;  5EPF A;  1S3D A;  1OC9 A;  2WRT A;  3HXS A;  3RAZ A;  1OAZ A;  2AV4 A;  2H0G A;  5IOW A;  3GL3 A;  4H86 A;  4WBR D;  3L9U A;  4G19 A;  4P3Y B;  4V1A p;  1QQ2 A;  4MDC A;  2WZ9 A;  1WMJ A;  4GSS A;  4MAB A;  5L71 A;  1SJZ A;  4GWR A;  1K0M A;  2E7P A;  1TRV A;  4GSN A;  2RM5 A;  4MF5 A;  2QA1 A;  3Q18 A;  5IMD A;  3LQ7 A;  3APO A;  2I81 A;  2C0E A;  4WKW A;  4OCF A;  3TJJ A;  5DAL B;  2R4V A;  2X4A A;  4J56 E;  1EGO A;  5CRE A;  4IP1 A;  2HSH A;  3GSS A;  2LJR A;  2A2P A;  3ISO A;  1XVW A;  4L5L A;  5CYY A;  2RUF A;  2OE3 A;  1O73 A;  4IS0 A;  4EO3 A;  4XS1 A;  3US3 A;  6GST A;  1FVK A;  4KW6 A;  4TR3 A;  3FZ9 A;  3TJG A;  3EC3 A;  6GSV A;  3UL3 A;  1Q98 A;  3ZZX A;  2DJK A;  3FY7 A;  4DSR A;  1FOH A;  14GS A;  2MMO A;  4MA9 A;  11GS A;  1RQM A;  1K0A A;  3M3M A;  4YAP A;  2DLX A;  2PWJ A;  1GTB A;  4JE1 A;  3RHB A;  5CP1 A;  4AJ6 A;  1B4P A;  3QDN A;  4KND A;  1Z7P A;  4TXO B;  3GFK A;  3MWH A;  2F8A A;  3HKR A;  5E4W A;  1PA3 A;  1GUK A;  4EIP A;  1BX9 A;  1BQ7 A;  4HDE A;  6GSW A;  2F8F A;  4Z7X A;  2H71 A;  5IPH A;  4KSM A;  3RDW A;  3F4T A;  3IHG A;  1J0F A;  1JHB A;  3FR3 A;  2CZ2 A;  2JAC A;  3CRU A;  4PUR A;  3I43 A;  4YQM A;  3VWV A;  3PGT A;  2LNT A;  1X5D A;  4Z2R A;  2IMD A;  3RPN A;  5FT3 A;  3MDK A;  2O89 A;  3M1G A;  18GS A;  2DC5 A;  5FWG A;  1PX7 A;  3EMX A;  5D73 A;  3HVS A;  3TJK A;  3PPU A;  1PN9 A;  3UVH A;  5A4U A;  4MH2 A;  5EVO A;  3O76 A;  3GKK A;  1XW5 A;  2R2J A;  1FAA A;  5J9B A;  1B9X C;  2L59 A;  4ZB8 A;  2R0G A;  4NV5 A;  1V58 A;  4ZIL A;  4POM A;  3HJP A;  5GSS A;  4XCS A;  3TKS E;  4LLR A;  1XFL A;  2OKA A;  3EE2 A;  4MP4 A;  4YH2 A;  4PUF C;  2VO4 A;  4X43 A;  5FHI A;  5A5K A;  4QQ7 A;  1X9S B;  2RII A;  5IOX A;  3H1N A;  4MJB A;  2L4Q A;  5B6N A;  3ZYW A;  2H01 A;  1T00 A;  6GSY A;  5HR3 A;  1T4Z A;  2FGX A;  3FZ5 A;  1G7O A;  1Z9H A;  2VLV A;  3KP9 A;  4GLT A;  4K9Z A;  22GS A;  1UN2 A;  2LJK A;  2M72 A;  2H1G A;  4NHW A;  9GSS A;  1EEM A;  1GTI A;  3IAM 2;  3KEB A;  2FNO A;  2H1B A;  3EU4 A;  2IY2 A;  2VCW A;  1JZW A;  1FW1 A;  1WPI A;  5ECO B;  3GUS A;  2EIR A;  4PXO A;  2HRA A;  1U87 A;  4HZ2 A;  2GSQ A;  1FO5 A;  1B48 A;  2OAC A;  3C1R A;  4N10 A;  5J5N A;  5LCZ A;  2R0C A;  3W6G A;  4BL7 A;  4I5Q A;  5ELG A;  2EIQ A;  3Q6O A;  2GQL A;  3LFL A;  3O6T A;  3LJR A;  4FH8 A;  4ILF A;  2IMI A;  5D9X A;  2GDR A;  1XOA A;  3QFB C;  2QSI A;  4PQ1 A;  3IRA A;  1EWX A;  3L0H A;  3DML A;  2DSA A;  4JR4 A;  4TKY A;  5HFI A;  1MD3 A;  3L9V A;  5JCU A;  3KXO A;  1Z3E A;  6GSS A;  1C72 A;  4MF7 A;  1SD9 A;  1VF1 A;  4EUY A;  3GKN A;  5H5R A;  3GA4 A;  2YWN A;  1ZYQ B;  4O7H A;  3LXT A;  2H73 A;  3P8W A;  4O92 A;  1CQH A;  4Z2T A;  1K3Y A;  3TCO A;  1F3A A;  1T4Y A;  2LEG A;  1YY7 A;  4F0C A;  2L4C A;  1TRS A;  3V1W A;  1R26 A;  4XS4 A;  1IYH A;  1OE7 A;  1EV9 A;  3IA1 A;  4BWQ A;  3IR4 A;  2TIR A;  2AJQ B;  2GZP A;  1X9W B;  2AAW A;  3HHV A;  2A4V A;  2FUG 2;  3TOT A;  1K0B A;  3HYP A;  1SK1 A;  3N5O A;  1XXU A;  3M0F A;  3HJO A;  2VCQ A;  5F05 A;  3VI7 A;  2YP6 A;  1U3A A;  4L0W A;  5G31 A;  3F0I A;  4KCA A;  3NOF A;  3HVX A;  1F6M C;  4ZL7 A;  3FR6 A;  3U6V A;  4BVY A;  1NHO A;  3TKS C;  1OYJ A;  1YF1 A;  5ECL B;  3GH9 A;  1TDI A;  3WT1 A;  4F0B A;  4CY8 A;  5ECI B;  4ZBB A;  2VD1 A;  3HA9 A;  3TRX A;  3FK8 A;  3PR8 A;  2L5L A;  2X64 A;  5DBQ A;  4L5O A;  2B3S A;  3C7M A;  1OC8 A;  3KTL A;  1VGL A;  4KDX A;  6GSU A;  2P0G A;  4TRX A;  3PH9 A;  1YQ1 A;  1O8X A;  4K7I A;  1GP1 A;  1KEB A;  2KP1 A;  5CO3 A;  3ERW A;  1XW9 A;  2V6O A;  1ERT A;  2B6M A;  4ECC A;  3ERG A;  1MD4 A;  4IGJ A;  2GGT A;  2N5B A;  1M9A A;  4ULX A;  3WD6 A;  4F9Z A;  3CTG A;  3GYK A;  5IMA A;  1TRU A;  4K7N A;  2V2G A;  5BMU A;  5LD0 A;  2DJ3 A;  2D2Z A;  3LXZ A;  1XIY A;  4EE0 A;  1SJ6 A;  2N5F A;  3GX0 A;  1SEN A;  4GF0 A;  3WGE A;  1YKA A;  5G5E A;  4EDZ A;  2ON5 A;  2XHF A;  2G0F A;  3UIW A;  3MAK A;  4XS4 B;  5IM9 A;  4L0U A;  1TOF A;  3FW2 A;  3A2V A;  1Z6M A;  1VRS D;  1T7P B;  3A2X A;  3A5W A;  1A24 A;  2VLU A;  1GUM A;  3TKP A;  1W4V A;  1KTE A;  2H76 A;  1HD2 A;  2PN8 A;  4ML6 A;  2FLS A;  4ZIJ A;  1ZYE A;  4O32 A;  2C8U A;  2IMF A;  4MJA A;  4EKZ A;  3C73 A;  4F03 A;  1V2A A;  3E0U A;  4HU9 A;  4POB A;  5INY A;  3ZTL A;  1ZZY A;  4PTS A;  3FKF A;  1SD8 A;  3LG6 A;  1THO A;  3CSI A;  3TKS A;  4BVY B;  3ZVJ D;  2DJ1 A;  1H75 A;  3HZ8 A;  2EIO A;  3CXG A;  2F9S A;  5ID2 A;  3H93 A;  5JCG A;  4MPF A;  2HZF A;  1PKZ A;  2YJH A;  3G7I A;  1BAY A;  3G9B A;  1GWC A;  3P90 A;  5F06 A;  2EC4 A;  2HRK A;  3UAR A;  3VFI A;  1E2Y A;  4GCI A;  2GT6 A;  1LU4 A;  4NPB A;  1TJD A;  4V1A g;  4K5R A;  5KN3 A;  4DSS A;  3CTF A;  2K6V A;  2YAN A;  1TK0 B;  4DSQ A;  4EF0 A;  1TI3 A;  3C71 A;  1T1V A;  1HNC A;  1R5A A;  2GQM A;  3EVI A;  1B4Q A;  4PNF A;  2IFQ A;  3ZIJ A;  5F07 A;  3GUR A;  1XWA A;  2CAI A;  5GZZ B;  2VCZ A;  1AC1 A;  3KH9 A;  3P2A A;  5GAP D;  3UJ1 A;  3VUR A;  2YV7 A;  1S3C A;  5HFG A;  2Z9S A;  1ZOF A;  3DD3 A;  5HQP A;  2YCD A;  5ENU A;  2R0P A;  2YNX A;  5C04 A;  2CZ3 A;  1GUL A;  5KN1 A;  5DCH A;  2DKI A;  3IDV A;  1XW6 A;  4HI7 A;  3RBT A;  1OKD A;  2GZY A;  2KHP A;  5AIS A;  2QC7 A;  1XOB A;  1I9D A;  2R37 A;  5KN0 A;  3U5R E;  1HQO A;  3NIV A;  5C00 A;  4GQF A;  1K0D A;  1MDJ A;  1QK8 A;  3UOM A;  2YZH A;  4KE3 A;  4EL1 A;  2LUS A;  3W8S A;  2O87 A;  2ZNM A;  2JAD A;  2PER A;  1GH2 A;  1W89 A;  5IMZ A;  4TR1 A;  3IBH A;  2HI7 A;  5A4V A;  1TXX A;  2UZ8 A;  4G10 A;  13GS A;  3LGC A;  3FMW A;  2WCI A;  4NV2 A;  4NWY A;  5KOW A;  1YDK A;  3E3E A;  2MMZ A;  1GUH A;  2B1L A;  4N0Z A;  3F8U A;  3RHC A;  1A2M A;  1SKS B;  4TW5 A;  5D9V A;  3D4T A;  5G5F A;  4OD7 A;  2H70 A;  3I9V 2;  4K5S A;  2B5X A;  4KDU A;  3LYK A;  3ZFL A;  1XCC A;  3BCI A;  1SJI A;  2C3Q A;  2C1Y A;  2WUL A;  3EUR A;  5LNK e;  4I8B A;  4MNN A;  1M0U A;  1EP7 A;  3L78 A;  1M2A A;  2P5Q A;  10GS A;  4K6X A;  5IPG A;  5BRT A;  2DJ0 A;  4WET A;  4WBJ A;  4GXZ A;  4EXJ A;  2N5A A;  2DBC A;  4PNG A;  1XWC A;  3CSH A;  2IFQ B;  2X8C A;  3S9F A;  1DSB A;  2F51 A;  3APS A;  1OC9 B;  4CDO A;  3FHK A;  1NSW A;  4JZQ A;  3KIJ A;  4IP6 A;  3M9K A;  2IL3 A;  3CSJ A;  4AGS A;  2FA8 A;  2P31 A;  4BVX A;  4KB3 A;  4LMW A;  2OE0 A;  3QD9 A;  2HZE A;  4OMV A;  2YWM A;  4I6X A;  3KH7 A;  1Q4J A;  1V98 A;  2C0F A;  2A2S A;  4ACS A;  3DWV A;  2MYG A;  5DAK A;  3KGK A;  3KCM A;  4A5P A;  4FYU A;  3GHA A;  4I2T A;  2V41 A;  4GST A;  1BYE A;  3EIN A;  2L6C A;  2NPB A;  2PVQ A;  4TR1 B;  3HJM A;  3D0Z A;  3VI5 A;  1UA5 A;  5D9W A;  3EU3 A;  4WXT A;  4Q5F A;  1S3A A;  2TRX A;  2RLI A;  3PIN A;  1QUW A;  2C0G A;  4XIH A;  2WDU A;  1GNE A;  1WE0 A;  1O85 A;  2K8S A;  1GSE A;  3TKR A;  3KMO A;  4HJM A;  3TGZ A;  3F4S A;  2XBI A;  4NAX A;  3BD2 A;  3BCK A;  4V2L A;  1RK4 A;  3VLN A;  2H1A A;  3H79 A;  2CVK A;  2H19 A;  2LNS A;  3GN3 A;  4LL4 B;  3SWL A;  1X5E A;  1MDI A;  1K0N A;  5IO0 A;  4WR4 A;  1ZYN A;  4TOP A;  3FR9 A;  4WEY A;  2H74 A;  3F9U A;  5G1L A;  3K8N A;  1JZD A;  5DCG A;  5J4U A;  2VL3 A;  2MBT A;  3VK9 A;  2H6Z A;  1SU9 A;  2I3Y A;  1ST9 A;  2F3M A;  3M8N A;  3BOA A;  2YJ7 A;  1EOH A;  1BG5 A;  1UVZ A;  3H4K A;  1AUC A;  5IMV A;  3FYG A;  3BBY A;  3G7Y A;  5DQS A;  1N8J A;  2VL9 A;  4HUA A;  2X49 A;  4ISD A;  1OE8 A;  2C3N A;  3HDC A;  1QMV A;  3CMI A;  1ERV A;  4HS1 A;  3DIE A;  4XTS A;  5CRD A;  2JZS A;  2HZE B;  3GRX A;  1X9M B;  5KN2 A;  1THX A;  3N9J A;  1QFN A;  1TTZ A;  1ML6 A;  4KF9 A;  3WYW A;  3DVX A;  3DKS A;  4OWY A;  2H8L A;  4EC0 A;  1U88 A;  2XPE A;  2YOI A;  2IWT A;  2CAQ A;  1Y6E A;  3TJF A;  3KD0 A;  3GTU A;  3L4N A;  3HD5 A;  5E59 A;  1OVN A;  3TRP A;  3A2W A;  1SKR B;  1R5P A;  2HRN A;  3IK7 A;  1GSF A;  2NBS A;  1PL1 A;  4MZC A;  3D4M A;  5H5Q A;  1K0C A;  3IPZ A;  2GZZ A;  5DJL A;  2M80 A;  5DQY A;  1CQG A;  3KP8 A;  2VCV A;  4JR6 A;  2GVP A;  3ME8 A;  4JBB A;  2MMA A;  2LTK A;  20GS A;  4I97 A;  2R5G A;  4IBP A;  1A23 A;  3KM6 A;  5IMF A;  8GSS A;  1FG4 A;  4LL1 B;  2PBJ A;  3IC4 A;  2YWO A;  1YJ6 A;  4X4J A;  2FHE A;  3ZRD A;  1VF3 A;  2OBI A;  4HOJ A;  2C80 A;  1WOU A;  4Z2U A;  4PX1 A;  4AJ7 A;  1VF4 A;  2BJX A;  2IMK A;  5IMC A;  3RPP A;  1USB A;  2HE3 A;  4WF4 A;  3WGX A;  2B7J A;  5HFK A;  2H30 A;  3TDG A;  3DYR A;  3LYP A;  2YN1 A;  1GTA A;  1ZL9 A;  4FQU A;  4MZW A;  4BL7 B;  2I9H A;  4IEL A;  2HYX A;  3HY2 A;  2DMM A;  1JZO A;  2B5Y A;  5ECK B;  2VUP A;  3F63 A;  4OO4 A;  4ECJ A;  5ELA A;  1WJK A;  2YWI A;  3FEU A;  1AXD A;  2FWF A;  4EDY A;  2C3T A;  2OBK A;  3Q19 A;  1F2E A;  1GSS A;  2HSM A;  1QGV A;  2HSY A;  3F6D A;  3SBC A;  2QA2 A;  3DEX A;  2KOK A;  2IYJ A;  3DXB A;  1AQX A;  1YEX A;  2L6D A;  3A5I A;  1Z5Y E;  5CNW A;  2VL2 C;  5IQY A;  3HCZ A;  3LOR A;  4ZBA A;  4RI6 A;  5G1K A;  4GQC A;  1GRX A;  1R4W A;  3UBK A;  4JED A;  2XC2 A;  4QL7 A;  1E6B A;  1A8L A;  2E2G A;  5HR0 A;  3GV1 A;  1DUG A;  1O8W A;  2PMT A;  1HNB A;  3IK9 A;  3DGQ A;  2WGR A;  1DBY A;  4OCE A;  5CRH A;  3HVV A;  4PUA A;  1M99 A;  4E8H A;  3TKQ A;  1JFU A;  2GST A;  2VIM A;  1TKD B;  1YZX A;  4ECI A;  3QAW A;  1SK0 A;  2H1D A;  3I69 A;  4J57 E;  5GAN D;  4USS A;  2C0D A;  4Q5N A;  1SL1 B;  2LJA A;  4POL A;  4OFT A;  1G6Y A;  1G7E A;  2BTO T;  4QL9 A;  2DJJ A;  3UEM A;  1A8Y A;  1HYU A;  5DAL A;  1RW1 A;  4YKF A;  2O85 A;  4ML1 A;  4TR0 A;  3OR5 A;  2IIY A;  2OA7 A;  1I5G A;  3I6A A;  5CRW A;  5ECH B;  1J08 A;  1JLV A;  5IIZ A;  4ZL8 A;  1GTU A;  3ZMK A;  5B7C A;  3C1S A;  2FA4 A;  4ZXG A;  3J7Y b;  2V6K A;  3QPM A;  3VWX A;  2AYT A;  4Q5R A;  2WS2 A;  3O3T A;  2ES7 A;  1EZK A;  1DE2 A;  4I2U A;  3QCP A;  1YEP A;  3ERF A;  2E2M A;  4FYC A;  5G30 A;  2H0H A;  4V2N A;  3C8E A;  4FIW A;  1GSY A;  2LQQ A;  5J3R A;  2VCT A;  2VL2 A;  1EGR A;  5EL8 A;  1F37 A;  2HRF A;  1O81 A;  2LRT A;  2IJY A;  2FY6 A;  4HU7 A;  3TRQ A;  2DIZ A;  2PU9 C;  4ZBD A;  3KJY A;  2CQ9 A;  2PUK C;  1PMT A;  1PSQ A;  3CRT A;  4YAV A;  4EVM A;  4K7O A;  4CY6 A;  4IHU A;  3FRC A;  4RQR A;  4CHS A;  2WFC A;  4KAE A;  2BMX A;  4RI7 A;  1B9Y C;  3W8J A;  1UC7 A;  2GLR A;  4MF6 A;  4K8M A;  1HNA A;  3EYT A;  2AHE A;  1SL2 B;  5ECP B;  3ED3 A;  2CX4 A;  2XBQ A;  3GL5 A;  1TU8 A;  1GSQ A;  1PRX A;  3ZFB A;  1WIK A;  4HJ2 A;  5ID2 B;  4AF2 A;  2CX3 A;  3IHQ A;  1WRY A;  4MJE A;  1AW9 A;  3ZML A;  1GLQ A;  2J23 A;  1O7U A;  2LQO A;  5DJM A;  4KSO A;  5ECN B;  4K0G A;  2KUC A;  2V32 A;  1ERW A;  2X8H A;  1ZGN A;  2CV4 A;  1XPV A;  1ABA A;  2CA8 A;  1ILO A;  3EPT A;  5D9T A;  4DSS B;  4RUV A;  2J9H A;  4MCU A;  1EEJ A;  4IKH A;  3R3E A;  5D93 A;  5ABR A;  1SK2 A;  2HFD A;  2GSR A;  4EIQ A;  1Z7R A;  5KOX A;  3KTB A;  3LEF A;  4MK3 A;  4MMM A;  2CVB A;  4IN0 A;  2FCH A;  2WB9 A;  3IXR A;  2ZUP A;  3E9J B;  4D73 A;  5B8B A;  1QXH A;  4HQZ A;  1SYX A;  5IO2 A;  1TRW A;  2V1M A;  2M46 A;  2RM6 A;  5JCW A;  2B5E A;  3MSZ A;  3R2Q A;  1EOG A;  3IOS A;  3F3R A;  2TRC P;  4MLY A;  2JSZ A;  3VPQ A;  1XVQ A;  4XRD A;  3D22 A;  4PGT A;  3QR6 A;  3A3T A;  1X0R A;  4V2M A;  2P5R A;  4YKG A;  1PD2 1;  3GST A;  2ALB A;  3ME7 A;  5AIX A;  1YF0 A;  4X1U A;  1Y25 A;  4HZ4 A;  4G0K A;  4F2I A;  4FYB A;  4TN8 A;  3KMN A;  4MH3 A;  2RUE A;  3D21 A;  4TXV A;  2H72 A;  1ZCP A;  1AAZ A;  2GS3 A;  2YV9 A;  1JLW A;  3Q74 A;  4NMU A;  2C4J A;  3GH6 A;  2JZR A;  1NM3 A;  3F4R A;  5F8B A;  1FOV A;  1ZMA A;  4BPY A;  1O6J A;  5D8I A;  1ACV A;  1KNG A;  1URM A;  1YKC A;  2VLT A;  4CW9 A;  5G2Z A;  2ZCT A;  1T8E B;  3L9S A;  4TVE A;  1X5C A;  5AIV A;  5HR1 A;  4ZB6 A;  2E0Q A;  2L5O A;  4IJ3 A;  2YZU A;  3HZ4 A;  4G9H A;  2FD3 A;  2H6X A;  1GSD A;  1MEK A;  1F9M A;  4GRF A;  1KBN A;  2K8V A;  1SL0 B;  2DIY A;  3FZA A;  4PQH A;  4K2X A;  5F0G A;  2R6K A;  2GSS A;  5JWR B;  3DRN A;  3QAV A;  2JSY A;  6GSX A;  1BED A;  2O7K A;  2FWH A;  5D96 A;  3GMF A;  4RQX A;  3ZIV A;  4D73 B;  2PVO C;  3DVW A;  1BJX A;  2DML A;  3IV4 A;  3GKX A;  5H5S A;  1M2B A;  2FWG A;  2XPD A;  1TK5 B;  2K18 A;  1FVJ A;  4HEA 2;  3VWW A;  2LKU A;  4E8E A;  4N0V A;  1XZO A;  4BVX B;  5ECR B;  3H8Q A;  4IVF A;  1B8X A;  5JWO B;  2LRC A;  2VOC A;  1TW9 A;  5DAK B;  1LBK A;  2O8V B;  1AIU A;  5KEJ A;  1Z6N A;  1J9B A;  4YQU A;  1XWG A;  2IPA A;  4ID0 A;  1GLP A;  4O5U A;  3ZVJ A;  2B1K A;  4DVC A;  2REM A;  2NDO A;  4G0I A;  4DEJ A;  2H0I A;  2LV3 A;  1T3B A;  2GQK A;  4LA1 A;  2CT6 A;  1LJR A;  4KGI A;  3FZ4 A;  2NVL A;  1G0T A;  2HT9 A;  1FHE A;  1ON4 A;  1AQW A;  4LMV A;  1NW2 A;  1DE1 A;  3LWA A;  1F3B A;  1M7T A;  1PL2 A;  2H6Y A;  2A4H A;  4K0N A;  1EP8 A;  1TP9 A;  3EMP A;  1JZR A;  3CYN A;  1FB0 A;  4MZB A;  1MTC A;  7GSS A;  2QKE A;  1SKW B;  3VPT A;  2AUV A;  2DJ2 A;  2KLX A;  4KDY A;  4PQI A;  3TB2 A;  1A0R P;  4F82 A;  2OJL A;  5AGY A;  1K0O A;  4OFN A;  3ZIT A;  4NHZ A;  2VD0 A;  3P7X A;  5DDL A;  4O5Q A;  5B6M A;  3EWL A;  4BA7 A;  1M9B A;  1PX6 A;  1NHY A;  2B7K A;  1PN0 A;  2WJU A;  2VM2 A;  2K9F A;  5CAX A;  5CRG A;  4TR4 A;  1GNW A;  4MPG A;  3GIX A;  3UVT A;  1GL8 A;  2L57 A;  1K3L A;  3ZRE A;  5ECS A;  3UBL A;  1R7H A;  4FO5 A;  2KP2 A;  2R3X A;  4WF5 A;  1XWB A;  3IE3 A;  3F3Q A;  3UMA A;  2AB6 A;  3GX8 A;  4KX4 A;  4K1F A;  1V57 A;  2VM1 A;  4K2D A;  1VF2 A;  3BJ5 A;  3ZLP A;  4HQS A;  4ZL9 A;  1PQN A;  4AJ8 A;  4Q5Q A;  4MJC A;  1WWJ A;  2HXK A;  1ERU A;  4G2E A;  2GT5 A;  3GKM A;  5A4W A;  1XWK A;  4BWS A;  1V9W A;  2HLS A;  4ZB9 A;  1OKT A;  3QAG A;  3JCM L;  2NTO A;  3AY8 A;  4IQ1 A;  3F6F A;  5B8A A;  1EV4 A;  4J2F A;  3IAS 2;  1TI1 A;  3QOU A;  3GTU B;  3UAP A;  5J41 A;  2PGT A;  2H75 A;  1ZYP A;  1M2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...