1V57A

Crystal structure of the disulfide bond isomerase dsbg
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 68
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v57A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v57A03
1XOBA 4YQVA 1XIYA 4G10A 2GSSA 1B48A 4JU5A 4QL9A 1ERWA 4QQ7A 4HS1A 2GT6A 4EF0A 2H1AA 4MPGA 1HYUA 2ZCTA 3VWVA 3H79A 3TRXA 4V1Ap 2K6VA 5LD0A 1XWAA 4MF7A 4V2LA 3EVIA 5H5SA 3VURA 6GSUA 1G0TA 3KH7A 2PU9C 4MCUA 5JWRB 5IMZA 4IELA 3F4SA 2D2ZA 2V32A 4MA9A 2VLUA 1XWGA 3KIJA 3SBCA 1BQ7A 1I9DA 3D22A 3LJRA 2H0HA 2IYJA 4L5LA 2YANA 2LJKA 2KHPA 3F63A 2L4QA 2FD3A 4FO5A 2H0GA 4DVCA 1X0RA 3DVXA 4H86A 4N10A 3U5RE 3TKSA 3ME7A 1VF4A 2LJRA 3LYKA 1O81A 2RM6A 3A2XA 4F0CA 5L71A 2YPMA 3D21A 4IQ1A 4PQIA 3APSA 4MDCA 3Q74A 4TXOB 4EKZA 5D9XA 3TB2A 2AAWA 1TU8A 2JL4A 1ABAA 2C1YA 2PERA 4OCFA 2C4JA 4I5QA 2E2GA 3CRUA 3KXOA 3QAGA 5JCWA 1M7TA 3BJ5A 2O89A 4JE1A 2VCXA 5A4VA 2B7KA 1ZMAA 1ZYEA 2B7JA 1TI3A 4GF0A 4TR3A 1LJRA 4TR1A 3L9UA 4LLRA 4JZQA 3ZFBA 5IOXA 4O92A 5IMAA 3IBHA 2R4VA 3GKKA 1TKDB 3ZLPA 2MYGA 2VL2A 4DSSB 1ZGNA 2YWOA 4BVYA 3FR9A 1OC9B 3F3RA 1EP8A 1AQWA 5ECLB 5GAND 3IR4A 5JCGA 1H4OA 4KSOA 3CRTA 4EDZA 3DYRA 2R6KA 4OO5A 1G6WA 2DMLA 3F0IA 5IIZA 2X99A 5G30A 5EY6A 1G6YA 2IFQA 2JACA 4K2DA 2YJHA 5FHIA 3TCOA 1VGLA 1GSDA 5J3RA 2CVBA 3CSJA 3IRAA 1R26A 4ZBAA 5C00A 1Z9HA 3HKRA 5HR2A 2WB9A 5DJLA 4YAVA 3ZVJA 5GZZB 1XZOA 3KCMA 3WYWA 3FZAA 3D0ZA 3GA4A 1JFUA 2CAIA 1AIUA 4X43A 2C3NA 1KEBA 3M8NA 1V40A 3BCIA 5G1LA 2F51A 5DJMA 1TXXA 4ZB9A 3KMOA 1AXDA 1U3AA 3TJFA 1Y25A 4ZL7A 2RUEA 2XBIA 3G7JA 2IMFA 1GSEA 1SD8A 2LS5A 3ZL5A 1MD3A 2KP1A 5J5NA 1O7UA 2YZHA 1XOAA 1NM3A 1TDIA 1Z6MA 2J23A 1MEKA 5KN2A 2X8GA 2V6KA 4O7HA 1MDIA 1OE8A 1NSWA 4JR4A 2AYTA 5F06A 2HZFA 2WGRA 2NTOA 4JRRA 5DBQA 3H1NA 2B6MA 3MDKA 4EXJA 2RUFA 4POKA 4ML6A 4ID0A 3WT1A 1FO5A 5B8BA 1FVKA 2HZEA 1X5EA 2OACA 2CAQA 4HU9A 4J2FA 3KMNA 2GTUA 4BWQA 2LRCA 1EGRA 3GN3A 5DVBA 3S9FA 1ERVA 5COHA 2B3SA 2R37A 2IMIA 2P5RA 1GSFA 1W4VA 4YQMA 4GWRA 1OC8A 4TRXA 2DJ1A 3K8NA 2H71A 3A5WA 2LRTA 2AV4A 1ERUA 1XFLA 1TK0B 2QGVA 4IJ3A 3NIVA 2JZSA 3EU3A 5HFIA 4J57E 4TXVA 4ZIJA 4KNDA 4MMMA 6GSSA 1F3BA 3Q18A 1X9SB 2VOCA 1VF1A 6GSYA 1ZZYA 3QD9A 4EVMA 1SKSB 2GLRA 4OFMA 5EPFA 2I3YA 6GSVA 4MP4A 3WT2A 4LMVA 2FUG2 1JLVA 1Z7RA 5F8BA 2N5FA 4EL1A 2P5QA 2GZZA 1C72A 4LL1B 3PGTA 1M9AA 2VIMA 3P2AA 2EIRA 2H1DA 4Q5FA 1A0FA 5J9BA 22GSA 4NPBA 1TU7A 3F4RA 1MTCA 4ULXA 1M99A 1EV9A 6GSWA 3CBUA 1E2YA 1TTZA 1WRYA 1HD2A 3EE2A 3CTFA 1XPVA 5D8IA 4ZB8A 2FLSA 1OKTA 1GRXA 4XRDA 1B4PA 4BA7A 1ZCPA 2PN8A 2C8UA 1YKAA 3TRPA 3P90A 3PR8A 11GSA 1SJZA 3MSZA 5E59A 2LRNA 4PXOA 2M80A 4OFTA 5D93A 4E8HA 4XS1A 3FZ9A 3GSTA 3R2QA 2KOKA 3EYTA 5FT3A 5DAKA 3HJOA 1Z7PA 4ECCA 1WMJA 4AJ6A 1PKZA 2GDRA 5ID2B 5CP1A 4IS0A 1UN2A 2GSQA 2MBTA 2ZNMA 4LL4B 1OYJA 4OMVA 1GP1A 3O3TA 2LSTA 3GNJA 2HSHA 1F6MC 4CHSA 3FY7A 1DE1A 1T1VA 2YV7A 1EV4A 3DWVA 1UVZA 1GUKA 3LWAA 4XS4A 3P7XA 3UAPA 3W6GA 2EC4A 4O5RA 1T00A 4X0XA 3KEBA 4MLYA 3MWHA 2LNTA 3F9UA 2R2JA 4GLTA 1YF1A 1U87A 4IN0A 14GSA 3TGZA 2FWHA 4OFNA 3RPPA 4KSMA 2MMAA 5DDLA 2YOIA 2IY2A 2FWGA 1CQGA 16GSA 3DGQA 5GSTA 5ELGA 1M2BA 1A23A 4K8MA 1XW5A 2YJ7A 2DIYA 3US3A 3FKFA 2AB6A 3QDNA 3TRQA 3WGXA 5IQYA 3GURA 5F0GA 5D73A 4BPYA 1N2AA 2K18A 1ON4A 4TR4A 5AIVA 5ECHB 1PX7A 2XBQA 3PH9A 1XCCA 1G7EA 2J9HA 4NAXA 3D4MA 1PRXA 4N0VA 2OJLA 3GX8A 2WJUA 4X1UA 2H30A 4XS6A 5IM9A 1FB6A 1UC7A 3ERFA 2GQMA 4KH7A 1BYEA 6GSXA 4HQZA 3KTLA 1SK1A 4N11A 3E3EA 1X5DA 3C1RA 4I97A 4ZXGA 2OBKA 4ZB6A 3HVXA 1AAZA 3IV4A 1RQMA 4WXTA 1V98A 4I2UA 4PNGA 1I5GA 4TN8A 1FG4A 4OO4A 3GV1A 3L9SA 4KCAA 2BMXA 4EE0A 3TKSE 3VFIA 4NV2A 1V2AA 2JSYA 1WJKA 3L4NA 2FHEA 3FZ5A 4G19A 3VPTA 3ZYWA 4IGJA 2WRTA 3HVSA 1JZDA 5J4UA 3EWLA 3UIWA 1A0RP 2B5XA 4RUVA 2F8AA 2MZCA 4IP1A 2H1GA 1PA3A 2JU5A 1PL1A 1ZYQB 3E9JB 1THXA 3HJMA 2L57A 5FWGA 3L9VA 2C80A 4V1Ag 1ST9A 2M72A 3M0FA 1V9WA 1S3DA 5G2ZA 3FZ4A 5AN1A 1OAZA 5JCUA 5DQYA 3CYNA 2CVKA 4HEA2 2CZ3A 5HR0A 3HHVA 4HU7A 2B1KA 1K0OA 3ZIJA 4TKYA 1SYXA 3KM6A 1J9BA 3ZITA 1PD21 2OE3A 1FAAA 3GH9A 2ALBA 3ZIVA 4F9ZA 1W89A 17GSA 2WS2A 1AQXA 1ERTA 1Y6EA 1PN9A 1U3IA 3ZREA 1PX6A 3D4TA 2E0QA 4PX1A 3W8SA 2MMNA 2L6DA 4KE3A 4L8EA 2VO4A 3IPZA 2MMOA 4EC0A 1WP0A 4YQUA 5D9WA 3ZRDA 1OVNA 1EWXA 1EOGA 1GTIA 4HZ2A 5IO0A 3CXGA 3V1WA 3ERGA 3EC3A 2LTKA 4IBPA 2LV3A 1NHOA 3Q6OA 3IE3A 4GSTA 1ZOFA 2YN1A 1XBSA 1S3CA 2E7PA 1EEMA 2V1MA 4J56E 3IK9A 2DJJA 5D9VA 2GGTA 3IK7A 5DCGA 1GULA 1U88A 5B6NA 1WE0A 2V41A 4Z7XA 3KJYA 1SKRB 3BD2A 4Q5RA 4IQAA 1O85A 2WULA 5IOWA 3F6FA 1F9MA 3LGCA 5CRDA 1GSSA 2TRXA 4EDYA 4EUYA 5ECRB 3C71A 3HZ8A 5AISA 5KN0A 4MJBA 2NDOA 1TJDA 3LXZA 4HOJA 2GSRA 1A2LA 1PMTA 1HNAA 2K8VA 4TR1B 2PGTA 4NHZA 3GL5A 2A2RA 1WOUA 3VWXA 4OD7A 3I69A 3DD3A 2JZRA 4IP6A 4MF6A 5GAPD 1MDKA 4CDOA 4KA0A 3ME8A 5CO3A 3VPQA 2I81A 1EOHA 5ECIB 3HXSA 4RQRA 4WETA 3QR6A 1SL2B 1T4ZA 3GKNA 1K0BA 2C0EA 3GTUA 4KDUA 5HR3A 3RAZA 3TJKA 3LG6A 2M46A 3N9JA 1SK0A 2IFQB 4WR4A 1BAYA 1SYRA 3DIEA 2CA8A 1A8LA 1TRVA 1THOA 2L5LA 5IPGA 2DC5A 5KN1A 4BWSA 1YY7A 2LEGA 4AF2A 2XPDA 1GLPA 4GSNA 1HQOA 1FW1A 3LORA 3GIXA 19GSA 3IXRA 1H75A 1QQ2A 4HI7A 3VWWA 3JCML 5HFGA 2GSTA 1T3BA 4Q5QA 2A2SA 4AGSA 3HD5A 1O8XA 5ECPB 1HNCA 1BEDA 4TVEA 2VCTA 2OKAA 4JEDA 3GH6A 1XWCA 3QMXA 2F9SA 3C8EA 4F03A 1GL8A 3M9KA 4XCSA 3DXBA 2HRNA 5CREA 3MAKA 1CQHA 4D73A 4JBBA 4OCEA 3TKQA 5F07A 2G2QA 1R4WA 3F4TA 3IDVA 4OWYA 1MDJA 4MF5A 3FRCA 3EMXA 2H6XA 2YCDA 4K0NA 4NXIA 3NZNA 3HDCA 2FNOA 6GSTA 1GUHA 3G7YA 1GH2A 3F8UA 2OBIA 2JSZA 2MBSA 2FA4A 4NWYA 2JADA 2VL9A 2HZEB 1FVJA 4F2IA 4HDEA 1XVQA 2A4VA 5LNKe 1XW6A 2H75A 3DKSA 3H93A 4MZWA 2YZUA 1J08A 4LA1A 5DALA 2F3MA 2O8VB 1DSBA 1TRWA 1G7OA 3O76A 5HQPA 2HFDA 2FA8A 1GTAA 3WD6A 4LMWA 1TRSA 1XXUA 2FCHA 4XTSA 1VRSD 2H70A 4YAPA 5DQSA 3VWUA 1SENA 5ECSA 3IOSA 4ISDA 2C0DA 2CQ9A 2WDUA 2GQKA 2GQLA 3I9V2 1MD4A 3ISOA 3GKXA 3LEFA 5IMFA 5LCZA 3FEUA 1SKWB 3M3MA 5INYA 4PGTA 5B7CA 4ECJA 2HE3A 1TW9A 1GSUA 3RBTA 3ZMKA 1JZOA 2HRFA 3H8QA 1T4YA 1SJIA 4POBA 1JZWA 4XIHA 2I9HA 1K0AA 1WWJA 3C1SA 2EIQA 2N5AA 1OE7A 2VCVA 2O87A 3BBYA 3FW2A 4IVFA 4ZBBA 4EO3A 5CRHA 2IL3A 3QCPA 3QFAC 5CAXA 4XRAA 4ACSA 1YJ6A 2LJAA 1K3OA 4MH3A 3TOTA 3VI5A 1K0NA 2BTOT 2IJYA 3GX0A 4IJIA 3W8JA 4RI7A 3ZMLA 3KTBA 2DIZA 4K7OA 2TRCP 3ZZXA 3IHQA 4G9HA 4GTUA 3WGDA 4PQHA 2OE0A 2X64A 5DAKB 5H5QA 3GUSA 1A2MA 4RQXA 2IIYA 4BVXA 2WCIA 1TK8B 13GSA 1WIKA 4Q5NA 1YF0A 1AUCA 2DBCA 1R5AA 2DJ0A 3HVVA 3QFBC 4L0WA 4GSSA 2V2GA 4CW9A 4IW9A 2H6ZA 1LU4A 2VD1A 1M0UA 1RW1A 4DSQA 2HSYA 1EZKA 1DBYA 5ENUA 3OR5A 2XC2A 1M2DA 2ES7A 2VL3A 4XS4B 3GSSA 2DSAA 1A24A 2L4CA 1GNWA 1SL0B 3KP9A 4TXOA 1KNGA 4G2EA 3TOUA 2TIRA 3DRNA 4ZBDA 9GSSA 1F37A 2DMMA 1AQVA 3APQA 4L0UA 3UVHA 1BJXA 1HNBA 1GLQA 2LQOA 2PVOC 4HJ2A 2AUVA 2CZ2A 1N8JA 1B4QA 1TK5B 4KW6A 3QAWA 5D9TA 1Z3EA 1AC1A 3IC4A 5ECOB 3TJBA 2YWMA 3TKSC 18GSA 3EINA 3CTGA 3LFLA 1PL2A 3ERWA 4KGIA 5KEJA 4MH2A 3UL3A 1UA5A 4GQFA 4I2TA 4WBRD 1TP9A 4NMUA 3UBKA 4DSSA 1QFNA 1O8WA 1OC9A 3ED3A 2HXKA 3C73A 4WEYA 3HY2A 2JZTA 2CX4A 3TJGA 3BOAA 1V57A 4V2NA 2XPEA 5GSSA 1QGVA 1F3AA 2GZPA 2VM1A 2R3XA 4PURA 1O73A 2PPTA 2ON5A 3RPNA 1SK2A 2VL2C 1OC3A 5A4UA 4POMA 4ILFA 4BL7A 5IO2A 2LQQA 4ZL8A 5DCHA 1YEPA 3LXTA 5G5EA 2CX3A 2BJXA 2R5GA 2RLIA 4V2MA 4KDYA 2VCQA 4GRFA 5CRWA 2YWNA 5HFKA 2PBJA 3EMPA 3G9BA 2FY6A 3G7IA 5A5KA 5AGYA 3EURA 1X9WB 2E2MA 2MMZA 4HZ4A 3TKRA 3HZ4A 4IHUA 3GYKA 1R7HA 4K7IA 2RM5A 1TRUA 3J7Yk 3FK8A 1XW9A 3UBLA 4NHWA 2YV9A 2B5EA 1T7PB 3MNGA 2CT6A 3A3TA 3P8WA 5ABRA 2NVLA 12GSA 2O7KA 2VCZA 5IMVA 4KB3A 2AJQB 2B1LA 3HA9A 2LKUA 1VF3A 4F82A 2C3TA 4XHMA 2VUPA 4F0BA 1PKWA 1B9YC 1GUMA 3GL3A 3RHCA 2K8SA 1XWBA 3M9JA 5HR1A 4IKHA 4ZILA 4PUAA 2KUCA 3KD0A 1JHBA 2C0FA 3KGKA 2GS3A 1GTUA 5J9CA 3RHBA 1IYHA 1B9XC 3L0HA 4MJEA 3IA1A 3IAM2 3WGEA 1ZL9A 3SWLA 1E6BA 5ECMB 3KZQA 2H72A 1RK4A 4ECBA 1SU9A 2H1BA 5D96A 3FYGA 4PUFC 1DE2A 1EGOA 3I6AA 3D6IA 3QOUA 4DSRA 1YEXA 1X5CA 1TI1A 2XHFA 2HI7A 4FH8A 3L78A 3N5OA 4TR0A 3UARA 5C04A 3TJJA 1A8YA 2H76A 4NV5A 5ECQB 3O6TA 2IWTA 2REMA 3A2WA 2OADA 5JWOB 2LNSA 4O32A 2IPAA 3FHKA 4PNFA 1QXHA 1GNEA 1Q4JA 3C7MA 2PVQA 2KP2A 1PGTA 4GQCA 2I4AA 3LQ7A 3U6VA 4FIWA 2WFCA 3RDWA 2P0GA 4QL7A 3TDGA 5EL8A 3IAS2 4YH2A 1T8EB 2GT5A 2DLXA 1Z5YE 3VK9A 4E8EA 4KX4A 1BG5A 1S3AA 3GKMA 3VI7A 2GVPA 2V6OA 3ZFLA 3BCKA 3GMFA 2HT9A 4DEJA 5B8AA 1USBA 2RIIA 4FYCA 2C3QA 1K0DA 3TKPA 1PQNA 1FHEA 1EEJA 1QK8A 4MABA 4KDXA 2IMEA 3F6DA 1YQ1A 1FOVA 2IN3A 3M1GA 4MPFA 4KAEA 1WPIA 2VLVA 1K0CA 3Q19A 5JWQB 2HLSA 4K1FA 5G31A 4WF5A 1QUWA 3LYPA 2PMTA 4MJAA 20GSA 5CNWA 2QC7A 1QMVA 2L59A 4K0GA 1NHYA 2FGXA 3D5JA 2H0IA 3QAVA 2AHEA 3GTUB 1YKCA 3CMIA 1SJ6A 2X8HA 3H4KA 5EVOA 1V58A 2YWIA 5ECNB 3TUEA 2ZUPA 5ECKB 2QKEA 5ID2A 4ECIA 4GCIA 2PUKC 2HYXA 1M9BA 1DUGA 3QPMA 4GXZA 2N5BA 4KUNA 3ZVJD 2PWJA 3AY8A 4MK3A 1M2AA 2L5OA 3A2VA 4TW5A 2FWFA 4WBJA 1ILOA 2C0GA 4WR5A 4RI6A 4AJ7A 3I43A 1TOFA 5H5RA 5AIXA 1Z6NA 5J41A 1Q98A 2VCWA 4K7NA 10GSA 1KTEA 1K0MA 3NOFA 5IMDA 2P31A 5IMCA 2H6YA 4N0ZA 4I8BA 4MZCA 4FYUA 4FYBA 1JLWA 2CV4A 5E4WA 3UJ1A 4D73B 1A2JA 1AW9A 2GZYA 3DMLA 4HJMA 1SD9A 2VLTA 4JR6A 5F05A 4L5OA 3CSIA 2WZ9A 5IPHA 1F2EA 8GSSA 4I6XA 3ZTLA 2KLXA 3HJPA 3UOMA 2K9FA 5CYYA 2H73A 2H66A 1GSQA 1BX9A 3PINA 1ML6A 1YDKA 1R5PA 2OE1A 2B5YA 3UMAA 1URMA 3APOA 1ACVA 1XVWA 2X8CA 1O6JA 2O85A 4MZBA 1U6TA 3F3QA 3VLNA 7GSSA 3KP8A 5DALB 3UEMA 3HYPA 2VAFA 3GHAA 2QSIA 4P3YB 1B8XA 2YNXA 5ELAA 4K6XA 1FB0A 2H8LA 2DJKA 1VF2A 2EIOA 2NPBA 4WF4A 5A4WA 4MJCA 3HCZA 1LBKA 3FR3A 5CRGA 3CSHA 1IYIA 2F8FA 2G0FA 3FR6A 4K9ZA 3KH9A 4HQSA 2Z9SA 2OA7A 3EU4A 3J7Yb 4HUAA 1PSQA 2LUSA 2H01A 4WKWA 2H19A 2ON7A 5G5FA 1XWKA 2DJ2A 2VD0A 3DVWA 4POLA 4AJ8A 1EP7A 1KBNA 1NW2A 3LSZA 3E0UA 2L6CA 1GWCA 1J0FA 2IMDA 4TOPA 5KN3A 2FWEA 5G1KA 2CVDA 3DEXA 1YZXA 2IMKA 4ZL9A 1OKDA 2I1UA 2VM2A 1K3LA 3UVTA 1X9MB 4ML1A 2YP6A 4PQ1A 1GTBA 4KCEA 2DJ3A 1K3YA 1GSYA 1SL1B 3GRXA 5B6MA 4N30A 2NBSA 2HNLA 3GFKA 1JZRA 2H74A
chains in the Genus database with same CATH superfamily
1XOBA 4YQVA 1U8CB 1XIYA 4G10A 2GSSA 4BTWA 1Z1SA 3MPHA 1B48A 1O7NB 4JU5A 4QL9A 1ERWA 2W6JH 4QQ7A 4HS1A 2GT6A 4EF0A 3CPOA 1XG8A 2H1AA 3EE1A 1X1YA 4MPGA 3X40A 1HYUA 4O02B 2ZCTA 3VWVA 4HJLB 2W04A 3H79A 3TRXA 4V1Ap 2K6VA 4X2OA 5LD0A 1XWAA 4MF7A 4V2LA 3MG2A 3EVIA 2F5WA 5IEPA 1Q40A 5H5SA 4BVXB 3VURA 6GSUA 1G0TA 3KH7A 1YNVX 3FZWA 2PU9C 3NBJA 4MCUA 5JWRB 1GMPA 5IMZA 4IELA 3F4SA 2D2ZA 2V32A 4MA9A 3Q90A 2VLUA 1XWGA 3KIJA 3SBCA 1BQ7A 1I9DA 3K7CA 7STDA 4HM4B 5LC7A 2QIYA 3N8BA 3D22A 3LJRA 2OQEA 1DMNA 3F40A 3NBBA 5AI1A 2H0HA 2IYJA 4L5LA 2YANA 4H61A 1KQS2 4O3VA 2LJKA 3DUKA 2KHPA 2UZ8A 3F63A 1SPUA 5AIIA 2L4QA 2FD3A 4FO5A 2CFLA 2H0GA 4DVCA 1X0RA 4RBNA 3ALAA 4NREA 3DVXA 4H86A 4N10A 4N6UA 3U5RE 3TKSA 3ME7A 4BIKA 1VF4A 2LJRA 3LYKA 1O81A 2RM6A 4K2XA 3A2XA 4F0CA 5L71A 1ZYNA 2YPMA 3D21A 4IQ1A 3X3XA 4PQIA 1OPYA 3APSA 4Z2UA 1BUJA 4EIQA 4MDCA 1Q824 3Q74A 3KFQC 4TXOB 4HYZA 3LTBA 1MGRA 4EKZA 1SQWA 5D9XA 3TB2A 2AAWA 1TU8A 3M8CA 1B2ZA 1RNBA 2JL4A 2Y74A 1B3SA 1ABAA 2C1YA 2PERA 4OCFA 2C4JA 4I5QA 3JUMA 1I3FA 2E2GA 3CRUA 3KXOA 3QAGA 1LOVA 5JCWA 1M7TA 3BJ5A 2O89A 1VQP3 4JE1A 1W6CA 2VCXA 1US1A 5A4VA 3PYJA 2B7KA 1ZMAA 1GMRA 1ZYEA 2B7JA 1TI3A 4GF0A 4TR3A 1LJRA 4TR1A 1K41A 3EF8A 3L9UA 4LLRA 4GB5A 4JZQA 3ZFBA 5IOXA 4O92A 5IMAA 3IBHA 4QWTA 3AGOA 4R4KA 2R4VA 2KF4A 3GKKA 1SJWA 1TKDB 3U97A 3ZLPA 2MYGA 1RRHA 2VL2A 4DSSB 1ZGNA 2YWOA 1B2SA 4BVYA 3FR9A 1OC9B 1UUGB 3F3RA 1EP8A 1AQWA 5ECLB 5GAND 3IR4A 2GU1A 5JCGA 1H4OA 4KSOA 3CRTA 4EDZA 3DYRA 2R6KA 3CCM3 4OO5A 1G6WA 3URPA 5LC6A 4RNTA 1TUHA 2DMLA 3F0IA 1GOUA 5IIZA 1T2IA 2BMQB 2X99A 5G30A 2W2CA 5EY6A 1G6YA 5M18A 2IFQA 1KWIA 2JACA 2L4VA 4K2DA 2YJHA 5FHIA 2C10A 1VGLA 3TCOA 5EEOA 5RNTA 4J9AA 1GSDA 3OXAA 4GHOA 5J3RA 2CVBA 3CSJA 3IRAA 1R26A 1AVKA 4ZBAA 5C00A 1Z9HA 3HKRA 1IV9A 3B4OA 5HR2A 4KFEA 2WB9A 4KFFA 5DJLA 3DM8A 3MKIA 4YAVA 3ZVJA 1IVUA 5GZZB 1XZOA 5JPPA 3KCMA 2YFIB 3WYWA 4R1KA 3STDA 2F98A 3D3LA 2UGIA 3H3HA 3FZAA 3D0ZA 4STDA 3GA4A 3CPW2 1JFUA 2SBLA 1NNVA 2CAIA 1AIUA 3DGNA 2ZA4A 3HIIA 2C3NA 4X43A 1N9JA 3LTCA 1BNGA 1KEBA 3M8NA 1VQ43 1GMQA 1V40A 4HZ9B 3BCIA 1FA3A 1W6GA 5G1LA 2F51A 5DJMA 2HSMA 1TXXA 3WMDA 4ZB9A 4R9KA 4N3VA 3KMOA 1AXDA 1U3AA 3TJFA 3NM7A 4OUQA 1Y25A 3NV0A 4ZL7A 2RUEA 2XBIA 3G7JA 3G8ZA 2IMFA 4AKZA 1GSEA 3S29A 1SD8A 1NB3I 2LS5A 3ZL5A 1MD3A 2KP1A 5J5NA 1O7UA 2YZHA 3HOHA 1OUNA 1XOAA 1NM3A 4K90B 1TDIA 1I8VA 1Z6MA 2J23A 3BNBA 1MEKA 5KN2A 1IU7A 1W4NA 2X8GA 2V6KA 1OF5A 4O7HA 1MDIA 1OE8A 1NSWA 4BIRA 4JR4A 3CC43 2AYTA 3NX0A 1IVXA 5F06A 2HZFA 2BHMA 4KT3B 2WGRA 3F8HA 2NTOA 4JRRA 5DBQA 1A2PA 3H1NA 2B6MA 1DE3A 1M1K4 5IG0A 4HSCX 1OH0A 3MDKA 3PCSA 4EXJA 2RUFA 4POKA 4ML6A 1R4CA 3I553 2I9WA 1TIJA 4ID0A 3WT1A 1FO5A 5B8BA 1FVKA 2HZEA 1X5EA 2OACA 2CAQA 4HU9A 1NO3A 4J2FA 3KMNA 4CPKA 2GTUA 1VQ73 1BNEA 2QA2A 4BWQA 2LRCA 5BXQA 1EGRA 3X3ZA 3GN3A 1ASKA 5DVBA 2HMKB 1BU4A 1ERVA 5COHA 3S9FA 4CY6A 1ULIB 4K61A 2K0MA 4AKYA 4FMCA 4YKFA 2B3SA 3AHWA 2R37A 2IMIA 2P5RA 3GAXA 1GSFA 1W4VA 2K54A 2BIRA 4YQMA 1CYVA 4GWRA 1OC8A 3ROBA 4TRXA 2DJ1A 3K8NA 3FLJA 2H71A 2R0PA 3A5WA 2LRTA 2AV4A 1ERUA 1XFLA 2BU4A 1QAKA 1TK0B 1HZ1A 2QGVA 4IJ3A 2J8XB 3NIVA 2JZSA 3EU3A 5CLKA 5HFIA 2P38A 1LOWA 4J57E 4TXVA 1YGWA 4ZIJA 4KNDA 1UGHI 4MMMA 6GSSA 1F3BA 1WMPA 1NJI4 3Q18A 1X9SB 2D42A 1JB2A 2RGQA 2VOCA 3KE7A 3QK9A 1YIJ3 1VF1A 2P09A 6GSYA 1ZZYA 1BSAA 3QD9A 4EVMA 1SKSB 2GLRA 4OFMA 5BU4A 2KF3A 3PPUA 2I3YA 5EPFA 1YHQ3 2C4BA 6GSVA 1FUWA 4MP4A 3WT2A 4G0IA 4JRFA 4LMVA 3F7SA 2FUG2 1BOXA 2OTJ3 1JLVA 3MHEA 1Z7RA 5F8BA 2N5FA 5STDA 2W0QA 4EL1A 2P5QA 2GZZA 3OWYA 4FMAA 1C72A 1GD4A 4LL1B 3PGTA 1W2B2 1M9AA 2VIMA 2CW9A 3DY5A 3P2AA 2EIRA 4EV2A 2H1DA 1A0FA 4Q5FA 5J9BA 22GSA 4NPBA 3CCU3 1TU7A 3F4RA 1MTCA 4ULXA 1M99A 1EV9A 6GSWA 3CBUA 1SIIA 1YGEA 1E2YA 2LYXA 5BMUA 1TTZA 1WRYA 3MIXA 1E97A 1HD2A 5AYRB 4RNYA 3CCR3 1FGOA 5IEOA 3EE2A 5HGRA 2CG0A 1VQO3 3CTFA 1XPVA 5D8IA 4ZB8A 2FLSA 1OKTA 1GRXA 3FF0A 4XRDA 3SXXA 1B4PA 1A67A 4BA7A 1TP6A 1ZCPA 1BRNL 2Y73A 2PN8A 2C8UA 9RNTA 1YKAA 3TRPA 1S723 3P90A 3PR8A 11GSA 1SJZA 3MSZA 5E59A 2LRNA 3N54B 4PXOA 2OWPA 1UCIA 3FF2A 1W5ZA 2M80A 4OFTA 5D93A 4E8HA 3RGRA 4XS1A 3FZ9A 3GSTA 4O2HA 3R2QA 1Q7Y4 2KOKA 3EYTA 5FT3A 3DGOA 5DAKA 3HJOA 2QA1A 1Z7PA 4ECCA 1WMJA 4AJ6A 3JVCA 1PKZA 2JDIH 2GDRA 4HM8B 5ID2B 4WYKB 1IT7A 5CP1A 3PGBA 4IS0A 1UN2A 1VQM3 4ORLA 2GSQA 4KF9A 1JB5A 2MBTA 2ZNMA 4LL4B 1OYJA 4OMVA 3OWSA 4NHFA 1ROAA 1GP1A 3O3TA 2LSTA 3GNJA 2HSHA 4X4JA 1IQYA 1JN5A 1F6MC 4HM5B 4IT7A 1A2VA 4PTSA 2AADA 8RNTA 5DREA 4CHSA 3FY7A 1DE1A 1T1VA 2YV7A 1EV4A 1MOLA 4AEQA 4FCJA 2XFSA 3DWVA 1UVZA 3RDEA 2GEXA 1GUKA 4HM2B 3LWAA 2W9PA 4XS4A 3P7XA 3UAPA 1FUSA 1PN0A 3W6GA 1I0VA 2EC4A 4O5RA 1VQ53 1LNHA 1STDA 1T00A 1DETA 3SVAA 2RNTA 4X0XA 3KEBA 4MLYA 3UB1A 3MWHA 2LNTA 5M1AA 1GY5A 3F9UA 2R2JA 4GLTA 1YF1A 2RFRA 1BRHA 1U87A 4IIAA 4IN0A 14GSA 3TGZA 3PS8A 2FWHA 5KOXA 1LNIA 4OFNA 3RPPA 4KSMA 2MMAA 1RN1A 3FGYA 4HKVB 5DDLA 1FUTA 3FG3A 2IY2A 3BNCA 2YOIA 5CXOA 2FWGA 1CQGA 1M3IA 16GSA 2WOHA 2HMLB 3DGQA 3KSPA 1W2ZA 5GSTA 2E2VA 5ELGA 1M2BA 3SEDA 1A23A 2DKIA 3SOYA 4K8MA 4Q53A 1XW5A 1Y4KA 2HMNB 2YJ7A 3WDGB 2DIYA 3US3A 3FKFA 3JUPA 2WGQA 2AB6A 3NM2A 3QDNA 3TRQA 3WGXA 5IQYA 3GURA 3NXJA 5F0GA 5IG4A 5D73A 4BPYA 1N2AA 4EBGA 1ON4A 2K18A 4TR4A 5AIVA 1IVVA 5ECHB 2XRXB 1WTHA 2PZVA 2BO9B 1JBTA 1PX7A 2XBQA 1I70A 3PH9A 1XCCA 1G7EA 2J9HA 4NAXA 2W56B 4MJDA 3D4MA 1PRXA 4N0VA 5IW9A 4GSPA 2OJLA 3HIGA 3GX8A 1BRSA 3T0UA 2WJUA 4X1UA 2H30A 3FKAA 4XBYA 2HRKA 4XS6A 2GBWB 5IM9A 1FB6A 1RHLA 1UC7A 3ERFA 2GQMA 4KH7A 2R4IA 1BYEA 6GSXA 3CXC2 3AGNA 4HQZA 3KTLA 1MWTA 1SK1A 2ZHXB 4N11A 3E3EA 1X5DA 1VQ63 3C1RA 4I97A 4ZXGA 3MYTA 2OBKA 2CK3H 4ZB6A 3HVXA 1AAZA 3IV4A 1TU5A 1VQL3 1RQMA 3EB8A 1V98A 4WXTA 4I2UA 4PNGA 3AMOA 1I5GA 1FG4A 4TN8A 3D5GA 3Q1CA 1ZYPA 4OO4A 3GV1A 3L9SA 1O7WB 2F5MA 4KCAA 2BMXA 4EE0A 1Q9EA 3TKSE 3VFIA 4NV2A 3G0KA 1V2AA 1N9EA 2JSYA 3FG1A 4WHAA 1WJKA 3L4NA 2FHEA 3FZ5A 3LTDA 4G19A 1I2EA 3VPTA 3ZYWA 4IGJA 1EG9B 2WRTA 3HVSA 4JF8A 1JZDA 5J4UA 3EWLA 3UIWA 3OV4A 4BL3A 1A0RP 2B5XA 3WR2A 3LMLA 1JBRA 4RUVA 2F8AA 2MZCA 4IP1A 2H1GA 4L8PA 1PA3A 2JU5A 3GZBA 1PL1A 2X49A 1ZYQB 3E9JB 3DXOA 1THXA 3HJMA 2L57A 5FWGA 3L9VA 2C80A 4V1Ag 1ST9A 2M72A 3M0FA 1RKYA 1V9WA 1QMAA 1S3DA 5G2ZA 3FZ4A 5AN1A 5KOWA 1OAZA 1GY6A 5JCUA 4EV5A 5DQYA 3CYNA 2CVKA 4HZBB 4HEA2 2CZ3A 5HR0A 3HHVA 1GSPA 3EPTA 4HU7A 1RGHA 2B1KA 2KCDA 1K0OA 3ZIJA 4TKYA 3A5IA 4N6TA 1SYXA 5TGNA 4HM6B 1B2MA 3KM6A 3LT8A 1J9BA 3EBYA 3CME3 2QGUA 3ZITA 4O5UA 1PD21 2CWVA 2CKFB 2OE3A 1FAAA 3GH9A 2ALBA 3DMCA 3ZIVA 4F9ZA 1W89A 3T8UA 4RNZA 17GSA 2WS2A 1AQXA 3V98A 1ERTA 1Y6EA 1PN9A 1U3IA 3ZREA 2FNQA 4KVHA 5AIFA 1PX6A 3D4TA 2E0QA 4PX1A 3W8SA 2MMNA 1ZX2A 4U13A 2L6DA 4WFOA 1Q40B 4KE3A 4LEHA 1I2GA 1U5OA 4L8EA 3K63A 2VO4A 3IPZA 1N8R4 6RNTA 2MMOA 4EC0A 1WP0A 4YQUA 4XDWA 5D9WA 5IG5A 3ZRDA 1OVNA 1VZZA 1EWXA 1EOGA 1GTIA 4HZ2A 4KZ1A 5IO0A 3CXGA 3V1WA 3ERGA 4XBXA 3EC3A 1RCKA 2LTKA 4IBPA 2LV3A 1IQXA 1NHOA 3Q6OA 3IE3A 4GSTA 5M19A 1ZOFA 2YN1A 1XBSA 1S3CA 2E7PA 1EEMA 2V1MA 1SIHA 3D4AA 5CK6A 4J56E 3F9SA 3IK9A 2DJJA 2CFDA 5D9VA 2GGTA 1W02A 3IK7A 5DCGA 1GULA 1U88A 5B6NA 1WE0A 2XR8B 1AVLA 2V41A 3IHGA 4Z7XA 1BRGA 3KJYA 2CX1A 1SKRB 3BD2A 4Q5RA 3LH4A 4IQAA 1O85A 1GYBA 1N5HA 1HYFA 5ELJA 2XH9A 1FGMA 4X2HA 2WULA 1BSEA 5IOWA 4BL7B 3F6FA 1F9MA 3GZRA 2CC3A 3LGCA 3BNDA 3ECFA 1GSSA 5CRDA 2TRXA 4EDYA 2CFKA 4EUYA 5ECRB 3LTAA 5DRVA 3C71A 4TX4A 3RNTA 3VGNA 3HZ8A 5AISA 5KN0A 4MJBA 2NDOA 1D6ZA 1TJDA 3LXZA 4HOJA 1G02A 2GSRA 1A2LA 1PMTA 2R0CA 1HNAA 2K8VA 1MNLA 3KCHA 4TR1B 2PGTA 2XF3A 4NHZA 3GL5A 3RGAA 2KAAA 2A2RA 1WOUA 3VWXA 4OD7A 1WQLB 3I69A 3DD3A 2JZRA 3UJMA 4IP6A 4MF6A 3CQFA 5GAPD 1MDKA 3HVNA 4CDOA 4KA0A 1WMOA 4BVYB 3ME8A 4G0KA 3BU4A 2KXGA 5CO3A 3VPQA 2I81A 3MSOA 3D9RA 1EOHA 5ECIB 3HXSA 4BTXA 4RQRA 4WETA 3QR6A 1SL2B 1T4ZA 3GKNA 4FCMA 3B8LA 3ZG5A 1K0BA 2C0EA 3GTUA 4KDUA 1QVF2 5HR3A 3RAZA 3TJKA 5JBSA 3LG6A 2M46A 3N9JA 4EXRA 1SK0A 2IFQB 2OCTA 4WR4A 1ZO2A 3KKGA 1BAYA 1SYRA 1JB4A 3DIEA 2A15A 1LVNA 4HBRA 1FW7A 2CA8A 1A8LA 4J5GA 1TRVA 1THOA 1R4YA 2L5LA 2MF7A 3LOYA 5IPGA 1D6YA 2DC5A 5KN1A 4BWSA 3WOEB 1YY7A 3DGLA 2LEGA 3HZPA 4AF2A 2XPDA 1GLPA 4GSNA 1HQOA 1FW1A 3EX9A 3LORA 3GIXA 19GSA 3IXRA 1H75A 1LQGC 1QQ2A 4HI7A 3VWWA 3JCML 2GBXB 3G713 3BB9A 1MGWA 5HFGA 3KN4A 2GSTA 1T3BA 4Q5QA 3IMAB 1BNSA 1K9M4 2GXFA 2A2SA 4AGSA 3HD5A 1LOXA 1O8XA 5ECPB 1FOHA 1HNCA 1BEDA 4TVEA 2VCTA 2OKAA 3HI7A 4JEDA 3GH6A 1XWCA 3QMXA 3FCSB 1M904 2RSXA 3CCL3 2F9SA 3C8EA 4F03A 1GL8A 3M9KA 3I0YA 4XCSA 3DXBA 3NV0B 2HRNA 2A2PA 5CREA 3MYDA 1RGFA 3MAKA 1UCLA 1CQHA 3ER7A 4D73A 1M9GA 1G96A 4JBBA 4OCEA 3TKQA 3DGMA 5F07A 2G2QA 1R4WA 3F4TA 3IDVA 4OWYA 1MDJA 4MF5A 3FRCA 2CH9A 3EMXA 2H6XA 2YCDA 4K0NA 4NXIA 7GSPA 3IC8A 3NZNA 3HDCA 5GSPA 2FNOA 4HM1B 3V92A 6GSTA 1YI23 1GUHA 5EVHA 3G7YA 1GH2A 3GZYB 3F8UA 1GS3A 2OBIA 3BNEA 1RGAA 2JSZA 2MBSA 4EIPA 4HVNA 2FA4A 4G1MB 2F99A 3EHCA 4NWYA 2JADA 1FGQA 2VL9A 2HZEB 1FVJA 4F2IA 4HDEA 2CWTA 1XVQA 2A4VA 5LNKe 3F14A 4J5KA 4YKGA 2Z76A 1XW6A 5D83A 3VSYA 7RNTA 4CDLA 2H75A 3B4PA 1TTOA 3DKSA 2BMOB 3H93A 4MZWA 2YZUA 1J08A 4LA1A 5DALA 1E3VA 2F3MA 2O8VB 1DSBA 3KIIA 5AIGA 1TRWA 1G7OA 1YIT3 3O76A 3F7XA 5HQPA 2HFDA 2FA8A 2HMOB 2BT3A 1GTAA 3WD6A 4LMWA 1TRSA 3EQQB 1XXUA 2FCHA 1IV7A 4XTSA 1VRSD 1EA2A 2H70A 4YAPA 4FMDA 5DQSA 3VWUA 5CF1A 4DKIA 1SENA 5ECSA 1SARA 2P0XA 3IOSA 3CCS3 1RJOA 4ISDA 2C0DA 2CQ9A 2WDUA 4G0LA 2GQKA 4R80A 2GQLA 2XSHB 3I9V2 1BNFA 1JBSA 1CQSA 1MD4A 2X4AA 3ISOA 3GKXA 3LXUX 3LEFA 5IMFA 5LCZA 4L8OA 2P05A 3FSDA 3FEUA 1SKWB 3M3MA 2ML5A 1OHOA 5INYA 2XFTA 1EUIC 4PGTA 5B7CA 4ECJA 2HE3A 1TW9A 1GSUA 3RBTA 3ZMKA 1JZOA 2HRFA 3K9MC 3H8QA 3DGYA 1T4YA 1SJIA 4POBA 3R3EA 1UUWB 4FQUA 5ELUA 1JZWA 4XIHA 2I9HA 1K0AA 2HMMB 1T2HA 1WWJA 1IQ8A 2YX9A 3C1SA 4GL6A 4WWUC 2EIQA 3CC73 1OE7A 2N5AA 2VCVA 2O87A 3BBYA 3FW2A 2C11A 1DMMA 4HAAA 4IVFA 4ZBBA 4EO3A 2CFGA 1DVCA 5IG3A 5CRHA 2IL3A 3EN8A 3QCPA 3QFAC 5CAXA 4XRAA 1AY7A 1T5YA 5D81A 4MMYB 3PXMA 4ACSA 1BANA 1YJ6A 1LQMB 1MWUA 2FGTA 2LJAA 1K3OA 4K5SA 1GY7A 1JKGA 4MH3A 1BRJA 1UGIA 3TOTA 3VI5A 1K0NA 1VQN3 2BTOT 2IJYA 3GX0A 4IJIA 1TRQA 3W8JA 1JRQA 1RGCA 3Q3FA 4RI7A 3CNXA 5AEUB 4MMXB 3KTBA 1W6YA 3ZMLA 1BSCA 2DIZA 2KF6A 4K7OA 1PFPA 2OOVC 2TRCP 3ZZXA 3IHQA 4G9HA 2O9UX 2RCDA 4GTUA 3WGDA 4PQHA 3UNLA 2OE0A 1PFOA 2X64A 2B1XB 5DAKB 1C54A 1GOVA 5H5QA 3GUSA 1A2MA 1CYUA 2YFLB 4BTYA 4RQXA 3AHSA 2IIYA 2WO0A 3CMA3 2IUJA 4BVXA 3X42A 2WCIA 1TK8B 3FH1A 13GSA 1WIKA 4Q5NA 1YF0A 1AUCA 2DBCA 1R5AA 2DJ0A 2ML6A 3HVVA 3QFBC 4L0WA 4GSSA 1B20A 2V2GA 4CW9A 1OHPA 3IJEB 3DZLA 1Q7HA 4IW9A 1LXEA 2H6ZA 1LU4A 2VD1A 3EN1B 1M0UA 1RW1A 4DSQA 2HSYA 1DMQA 1EZKA 1J2BA 1DBYA 5ENUA 3X3YA 1KD14 3OR5A 2XC2A 1FYSA 1BVIA 1M2DA 2ES7A 2VL3A 1A90A 4XS4B 3GSSA 1STFI 2DSAA 1A24A 2L4CA 1RN7A 1GNWA 1LOYA 5BIRA 1RDSA 1Q42A 2Z6BA 3OX9A 1SL0B 3KP9A 4TXOA 1KNGA 3SYUA 2ZL8A 1RNTA 1ULJB 4G2EA 1N8QA 3TOUA 2V1LA 2TIRA 3DRNA 4ZBDA 9GSSA 1F37A 2R41A 2K3DA 3MG1A 2DMMA 1AQVA 3APQA 4L0UA 3UVHA 2OQEC 1BJXA 1HNBA 1WMNA 1MWSA 1GLQA 2LQOA 1JJ22 2PVOC 2BMRB 4LMIA 4HJ2A 2AUVA 2CZ2A 1QJGA 1N8JA 1B4QA 4MMZB 1Q814 1AR0A 1TK5B 4KW6A 3QAWA 1BRIA 5D9TA 1Z3EA 1AC1A 3B7CA 2GEYA 2STDA 3IC4A 5ECOB 1OGXA 3FMWA 2YWMA 3TJBA 3TKSC 18GSA 1ZGXA 1I0XA 3EINA 4Z2TA 4BU4A 2JQ5A 3CTGA 1IYYA 4HOHA 3LFLA 1PL2A 3ERWA 4KGIA 5KEJA 4MH2A 5BVBA 3UL3A 1UA5A 4GQFA 4I2TA 4WBRD 1TP9A 4NMUA 3UBKA 1RMSA 1S3RA 5IF6A 4DSSA 1QFNA 3EJVA 1N5PA 1IDPA 1O8WA 1OC9A 1BNJA 3ED3A 4FCZA 4KFDA 3NBRA 1I2FA 4OVMA 2HXKA 3C73A 1YJ93 1KC84 4WEYA 3HY2A 1FGRA 3LT9A 4CY8A 3A5EA 1FGTA 1RGKA 4O5QA 1B21A 3N9HA 1HU9A 2JZTA 2CX4A 1WNHA 1B2UA 3BOAA 3TJGA 1V57A 2F56A 4O8SA 1BSBA 4V2NA 2XPEA 4USSA 5GSSA 1RCLA 1F3AA 1QGVA 2GZPA 2VM1A 1W7CA 2R3XA 4PURA 3WHOA 1O73A 3K5TA 2PPTA 2ON5A 3RPNA 1NDOB 5CF2A 1SK2A 2VL2C 1GOYA 1K734 1OC3A 5A4UA 3A76A 2Z7AA 3UL5A 4POMA 4ILFA 4BL7A 3AMOB 4N6MA 1BAOA 1IVWA 2LQQA 4ZL8A 5IO2A 1X1WA 5DCHA 1YEPA 3LXTA 5G5EA 2CX3A 2BJXA 2GU3A 2R5GA 2RLIA 4V2MA 4KDYA 2VCQA 3MWZA 4GRFA 2YWNA 5CRWA 5KP4A 5HFKA 2PBJA 1OHSA 3EMPA 3G9BA 2GSPA 2FY6A 2R0GA 5G2GA 3G7IA 5A5KA 5AGYA 3UL6A 3MG3A 3G4S3 3EURA 1M3JA 4K5RA 3QRDA 1X9WB 2E2MA 2MMZA 1OGZA 4HZ4A 3CCV3 3TKRA 3HZ4A 4FR9A 5AEWB 4IHUA 4EC6A 3GYKA 3GWRA 5BRTA 3WODG 1R7HA 1AQZA 4K7IA 3NQZA 4K1VA 2RM5A 1TRUA 3J7Yk 1BIRA 2QEX3 3FK8A 1ZS7A 1XW9A 4OK0A 3UBLA 4NHWA 2YV9A 2B5EA 1TFOA 4XB5A 1T7PB 3MNGA 3BLZA 3F8XA 2CT6A 3A3TA 3P8WA 1MWRA 5ABRA 4FMBA 2XSOB 2NVLA 4LZIA 12GSA 2O7KA 2VCZA 5IMVA 4KB3A 2AJQB 2B1LA 3HA9A 2LKUA 1VF3A 4F82A 1IT8A 3G6E3 2C3TA 4XHMA 1BRKA 3NQYA 2UX0A 2VUPA 1S5AA 4F0BA 1RRLA 1PKWA 1B9YC 3L0RA 1GUMA 3GL3A 3RHCA 2K8SA 3JUNA 1DVDA 1XWBA 3M9JA 5HR1A 4IKHA 1RSNA 4ZILA 4PUAA 2KUCA 3KD0A 1HKXA 1V74A 1LRAA 1JHBA 1X1XA 1BNIA 4I4KA 5HOHA 2C0FA 3KGKA 2GS3A 2YFJB 1GTUA 3CCQ3 5J9CA 3RHBA 1IYHA 1B9XC 3L0HA 3X41A 4MJEA 4RZMA 5KP1A 3IA1A 3IAM2 1CH0A 2CHCA 3WGEA 1UCJA 3CC23 1ZL9A 3SWLA 1E6BA 5ECMB 1I3IA 2XGNA 1VQ93 4J8TA 4N6OB 3KZQA 5I97A 2H72A 1UW1A 2LQVA 1RK4A 4ECBA 1SU9A 2H1BA 5D96A 3FYGA 2IA7A 4PUFC 1B2XA 1DE2A 1EGOA 1EQKA 3I6AA 3D6IA 3QOUA 4DSRA 1YEXA 1X5CA 1TI1A 2XHFA 2HI7A 4FH8A 3L78A 2HMJB 3N5OA 4TR0A 3UARA 3V99A 5C04A 3K0ZA 1A8YA 3TJJA 2H76A 4NV5A 5ECQB 3O6TA 2IWTA 1VQK3 2REMA 3A2WA 2OADA 1NWWA 3I563 2LNSA 4O32A 5JWOB 2IPAA 5FGOA 3FHKA 4PNFA 1GNEA 1QXHA 5EQLA 1Q4JA 3C7MA 2PVQA 2KP2A 1PGTA 4GQCA 2I4AA 3LQ7A 3U6VA 4FIWA 2WFCA 4HM7B 3RDWA 2P0GA 2Q07A 4QL7A 2W9QA 3TDGA 1A2KA 5EL8A 3IAS2 4YH2A 1T8EB 4EYCA 2GT5A 2DLXA 4XDVA 5IERA 1Z5YE 3VK9A 1K8A4 4E8EA 4KX4A 2CWUA 1BG5A 1S3AA 3GKMA 1UUVB 4IPBA 3VI7A 2GVPA 2F86B 2V6OA 3BCKA 3ZFLA 3GMFA 2HOHA 2HT9A 3JUOA 4DEJA 1YVSA 5B8AA 1USBA 2RIIA 4FYCA 2C3QA 2DKHA 1K0DA 3CU3A 3TKPA 3GZXB 1PQNA 3S67A 1FHEA 3LW9A 1EEJA 1QK8A 4MABA 1QALA 3LZAA 1RGEA 4KDXA 2IMEA 3F6DA 1YQ1A 1FOVA 3CCJ3 4CJNA 3WA2X 2IN3A 3M1GA 1CEWI 2ZDJA 4MPFA 4KAEA 1WPIA 3NUVA 3J7Yd 3LYGA 2VLVA 5JPUA 1K0CA 3Q19A 5JWQB 2HLSA 4K1FA 5G31A 4WF5A 1RLSA 2E2UA 1QUWA 3LYPA 2PMTA 4MJAA 1OF5B 20GSA 5CNWA 2W03A 2QC7A 1QMVA 2L59A 4K0GA 1NHYA 2FGXA 3D5JA 1BGSA 3G16A 2H0IA 3QAVA 3U1WA 1ROVA 3CCE3 2AHEA 3GTUB 1YKCA 3E99A 3CMIA 5AYSC 1SJ6A 2X8HA 3H4KA 4EW5A 5EVOA 1V58A 2YWIA 5ECNB 1DYUA 3TUEA 2ZUPA 5ECKB 1OCVA 2QKEA 5ID2A 4ECIA 4WYKA 4GCIA 2PUKC 4ZM8A 4HM3B 1YJN3 2HYXA 1M9BA 1PY3A 1TRPA 2WGOA 1DUGA 3GSPA 3QPMA 4GXZA 2N5BA 4KUNA 1B27A 3ZVJD 5FW5A 1E3RA 3NHXA 2PWJA 1PU4A 1NB5I 3AY8A 4MK3A 4ICYA 1M2AA 2L5OA 3SLUA 3A2VA 4TW5A 4MNNA 2XEPA 2AAEA 2FWFA 4WBJA 3EC9A 2KF5A 5A0OB 3O8YA 2CG1A 1ILOA 2C0GA 4WR5A 4RI6A 4AJ7A 3I43A 1TOFA 2D1WA 5H5RA 5AIXA 4LYLB 2PNCA 1Z6NA 5J41A 1BNRA 1Q98A 3JUQA 2VCWA 4K7NA 10GSA 1KTEA 1O7PB 1K0MA 3NOFA 5IMDA 2P31A 1BUQA 5IMCA 2H6YA 4HM0B 4N0ZA 3S28A 4I8BA 1RGGA 4MZCA 1RGLA 4FYUA 4FYBA 1UDII 1KSIA 1JLWA 1W00A 2FXTA 2CV4A 5E4WA 3UJ1A 4D73B 4Z2RA 1A2JA 1AW9A 2GZYA 3DMLA 4XM4A 1VQQA 2E2TA 4HJMA 3ZFZA 1SD9A 2VLTA 4JR6A 1JV2B 5F05A 2OTL3 4L5OA 3CSIA 6STDA 2WOFA 1IK3A 2WZ9A 5IPHA 1VQ83 3HX8A 1F2EA 8GSSA 4I6XA 4CCVA 3ZTLA 2KLXA 3D5IA 3VF1A 4WP5A 3HJPA 1ISKA 3UOMA 1UI7A 2K9FA 5CYYA 2H73A 2M7OA 8CHOA 1O7GB 2H66A 2CFWA 1GSQA 1BX9A 3PINA 1ML6A 3DH2A 1YDKA 2L1SA 2O3OA 1R5PA 5IENA 2OE1A 1K28A 2HRAA 2B5YA 3BIRA 5KP3A 1URMA 3APOA 2W56A 1ACVA 3UMAA 3WOFB 4R9LA 1XVWA 2X8CA 1GD3A 4N6NB 1EKMA 1O6JA 3SX1A 3IPTA 3CNMA 2O85A 2Z77A 4MZBA 1U6TA 3F3QA 2KRTA 4LGQA 1JNQA 3VLNA 1Q864 1O7MB 1F8NA 2F4YA 7GSSA 3EBTA 1RN4A 3KP8A 3Q2PA 4N6V0 5DALB 3UEMA 3HYPA 1FZUA 2P0MA 3HK4A 4H3UA 1BSDA 2VAFA 2CIUA 3GHAA 1PYLA 2QSIA 2SARA 4P3YB 1QVG2 1B8XA 4XBTA 2QA43 2YNXA 5ELAA 4K6XA 1FB0A 2H8LA 2DJKA 1D6UA 1VF2A 2EIOA 2NPBA 4WF4A 6GSPA 4BL2A 5A4WA 4MJCA 3HCZA 2UUGC 1LBKA 3FR3A 1M1XB 5CRGA 4N6LA 2RBIA 3OW22 3CSHA 3GRDA 4MEIA 3D79A 1IYIA 2F8FA 3KZTA 2INXA 2G0FA 2MC8A 3FR6A 4K9ZA 3KH9A 3H51A 2IMJA 2Z9SA 2OA7A 3EU4A 3PZWA 4HQSA 3J7Yb 4HUAA 1PSQA 1AV4A 1YJW3 2LUSA 2H01A 4WKWA 2H19A 4A5PA 2ON7A 1TFKA 5G5FA 2B24B 1X1UA 1XWKA 1UI8A 2DJ2A 2VD0A 3DVWA 1QAFA 4POLA 4AJ8A 1EP7A 1L5GB 1KBNA 5AIHA 5D82A 1NW2A 1UCKA 3LSZA 3E0UA 1JN5B 1C7HA 2L6CA 1GWCA 1J0FA 1O7HB 2IMDA 4TOPA 5KN3A 1W01A 2FWEA 5G1KA 2CVDA 3DEXA 3S27A 1YVBI 1NU3A 2CX0A 2OOVA 1YZXA 2IMKA 4ZL9A 1OKDA 1RTUA 3PCRA 2I1UA 1K3LA 2VM2A 3WA3A 3UVTA 3ZG0A 1X9MB 4ML1A 2BNGA 2A4HA 3OWUA 2YP6A 4PQ1A 4L7KA 1GTBA 4KCEA 4LSOA 2DJ3A 1K3YA 3T8NA 3CD63 1GSYA 1SL1B 3GRXA 3KSED 2IUKA 5B6MA 2XGLA 3S5CA 3FG4A 4K1UA 4N30A 1OACA 2NBSA 2HNLA 3GFKA 4PEJA 1JZRA 1JKGB 2H74A 3SOAA
chains in the Genus database with same CATH topology
1XOBA 4YQVA 1XIYA 4G10A 2GSSA 1B48A 4JU5A 4QL9A 1ERWA 4QQ7A 4HS1A 2GT6A 4EF0A 2H1AA 4MPGA 1HYUA 2ZCTA 3VWVA 3H79A 3TRXA 4V1Ap 2K6VA 5LD0A 1XWAA 4MF7A 4V2LA 3EVIA 5H5SA 4BVXB 3VURA 6GSUA 1G0TA 3KH7A 2PU9C 4MCUA 5JWRB 5IMZA 4IELA 3F4SA 2D2ZA 2V32A 4MA9A 2VLUA 1XWGA 3KIJA 3SBCA 1BQ7A 1I9DA 3D22A 3LJRA 2H0HA 2IYJA 4L5LA 2YANA 2LJKA 2UZ8A 2KHPA 3F63A 2L4QA 2FD3A 4FO5A 2H0GA 4DVCA 1X0RA 3DVXA 4H86A 4N10A 3U5RE 3TKSA 3ME7A 1VF4A 2LJRA 3LYKA 1O81A 2RM6A 4K2XA 3A2XA 4F0CA 5L71A 1ZYNA 2YPMA 3D21A 4IQ1A 4PQIA 3APSA 4Z2UA 4EIQA 4MDCA 3Q74A 4TXOB 4EKZA 5D9XA 3TB2A 2AAWA 1TU8A 2JL4A 1ABAA 2C1YA 2PERA 4OCFA 2C4JA 4I5QA 2E2GA 3CRUA 3KXOA 3QAGA 5JCWA 1M7TA 3BJ5A 2O89A 4JE1A 2VCXA 5A4VA 2B7KA 1ZMAA 1ZYEA 2B7JA 1TI3A 4GF0A 4TR3A 1LJRA 4TR1A 3L9UA 4LLRA 4JZQA 3ZFBA 5IOXA 4O92A 5IMAA 3IBHA 2R4VA 3GKKA 1TKDB 3ZLPA 2MYGA 2VL2A 4DSSB 1ZGNA 2YWOA 4BVYA 3FR9A 1OC9B 3F3RA 1EP8A 1AQWA 5ECLB 5GAND 3IR4A 5JCGA 1H4OA 4KSOA 3CRTA 4EDZA 3DYRA 2R6KA 4OO5A 1G6WA 2DMLA 3F0IA 5IIZA 2X99A 5G30A 5EY6A 1G6YA 2IFQA 2JACA 4K2DA 2YJHA 5FHIA 3TCOA 1VGLA 1GSDA 5J3RA 2CVBA 3CSJA 3IRAA 1R26A 4ZBAA 5C00A 1Z9HA 3HKRA 5HR2A 2WB9A 5DJLA 4YAVA 3ZVJA 5GZZB 1XZOA 3KCMA 3WYWA 3FZAA 3D0ZA 3GA4A 1JFUA 2CAIA 1AIUA 4X43A 2C3NA 1KEBA 3M8NA 1V40A 3BCIA 5G1LA 2F51A 5DJMA 2HSMA 1TXXA 4ZB9A 3KMOA 1AXDA 1U3AA 3TJFA 1Y25A 4ZL7A 2RUEA 2XBIA 3G7JA 2IMFA 1GSEA 1SD8A 2LS5A 3ZL5A 1MD3A 2KP1A 5J5NA 1O7UA 2YZHA 1XOAA 1NM3A 1TDIA 1Z6MA 2J23A 1MEKA 5KN2A 2X8GA 2V6KA 4O7HA 1MDIA 1OE8A 1NSWA 4JR4A 2AYTA 5F06A 2HZFA 2WGRA 2NTOA 4JRRA 5DBQA 3H1NA 2B6MA 3MDKA 4EXJA 2RUFA 4POKA 4ML6A 4ID0A 3WT1A 1FO5A 5B8BA 1FVKA 2HZEA 1X5EA 2OACA 2CAQA 4HU9A 4J2FA 3KMNA 2GTUA 2QA2A 4BWQA 2LRCA 1EGRA 3GN3A 5DVBA 3S9FA 1ERVA 5COHA 4CY6A 4YKFA 2B3SA 2R37A 2IMIA 2P5RA 1GSFA 1W4VA 4YQMA 4GWRA 1OC8A 4TRXA 2DJ1A 3K8NA 2H71A 2R0PA 3A5WA 2LRTA 2AV4A 1ERUA 1XFLA 1TK0B 2QGVA 4IJ3A 3NIVA 2JZSA 3EU3A 5HFIA 4J57E 4TXVA 4ZIJA 4KNDA 4MMMA 6GSSA 1F3BA 3Q18A 1X9SB 2VOCA 1VF1A 6GSYA 1ZZYA 3QD9A 4EVMA 1SKSB 2GLRA 4OFMA 3PPUA 5EPFA 2I3YA 6GSVA 4MP4A 3WT2A 4G0IA 4LMVA 2FUG2 1JLVA 1Z7RA 5F8BA 2N5FA 4EL1A 2P5QA 2GZZA 1C72A 4LL1B 3PGTA 1M9AA 2VIMA 3P2AA 2EIRA 2H1DA 4Q5FA 1A0FA 5J9BA 22GSA 4NPBA 1TU7A 3F4RA 1MTCA 4ULXA 1M99A 1EV9A 6GSWA 3CBUA 1E2YA 5BMUA 1TTZA 1WRYA 3MIXA 1HD2A 3EE2A 3CTFA 1XPVA 5D8IA 4ZB8A 2FLSA 1OKTA 1GRXA 4XRDA 1B4PA 4BA7A 1ZCPA 2PN8A 2C8UA 1YKAA 3TRPA 3P90A 3PR8A 11GSA 1SJZA 3MSZA 5E59A 2LRNA 4PXOA 2M80A 4OFTA 5D93A 4E8HA 4XS1A 3FZ9A 3GSTA 3R2QA 2KOKA 3EYTA 5FT3A 5DAKA 3HJOA 2QA1A 1Z7PA 4ECCA 1WMJA 4AJ6A 1PKZA 2GDRA 5ID2B 5CP1A 4IS0A 1UN2A 2GSQA 4KF9A 2MBTA 2ZNMA 4LL4B 1OYJA 4OMVA 1GP1A 3O3TA 2LSTA 3GNJA 2HSHA 4X4JA 1F6MC 4PTSA 4CHSA 3FY7A 1DE1A 1T1VA 2YV7A 1EV4A 3DWVA 1UVZA 1GUKA 3LWAA 4XS4A 3P7XA 3UAPA 1PN0A 3W6GA 2EC4A 4O5RA 1T00A 4X0XA 3KEBA 4MLYA 3MWHA 2LNTA 3F9UA 2R2JA 4GLTA 1YF1A 1U87A 4IN0A 14GSA 3TGZA 2FWHA 5KOXA 4OFNA 3RPPA 4KSMA 2MMAA 5DDLA 2YOIA 2IY2A 2FWGA 1CQGA 16GSA 3DGQA 5GSTA 5ELGA 1M2BA 1A23A 2DKIA 4K8MA 1XW5A 2YJ7A 2DIYA 3US3A 3FKFA 2AB6A 3QDNA 3TRQA 3WGXA 5IQYA 3GURA 5F0GA 5D73A 4BPYA 1N2AA 2K18A 1ON4A 4TR4A 5AIVA 5ECHB 1PX7A 2XBQA 3PH9A 1XCCA 1G7EA 2J9HA 4NAXA 3D4MA 1PRXA 4N0VA 2OJLA 3GX8A 2WJUA 4X1UA 2H30A 2HRKA 4XS6A 5IM9A 1FB6A 1UC7A 3ERFA 2GQMA 4KH7A 1BYEA 6GSXA 4HQZA 3KTLA 1SK1A 4N11A 3E3EA 1X5DA 3C1RA 4I97A 4ZXGA 2OBKA 4ZB6A 3HVXA 1AAZA 3IV4A 1RQMA 4WXTA 1V98A 4I2UA 4PNGA 1I5GA 4TN8A 1FG4A 1ZYPA 4OO4A 3GV1A 3L9SA 4KCAA 2BMXA 4EE0A 3TKSE 3VFIA 4NV2A 1V2AA 2JSYA 1WJKA 3L4NA 2FHEA 3FZ5A 4G19A 3VPTA 3ZYWA 4IGJA 2WRTA 3HVSA 1JZDA 5J4UA 3EWLA 3UIWA 1A0RP 2B5XA 4RUVA 2F8AA 2MZCA 4IP1A 2H1GA 1PA3A 2JU5A 1PL1A 2X49A 1ZYQB 3E9JB 1THXA 3HJMA 2L57A 5FWGA 3L9VA 2C80A 4V1Ag 1ST9A 2M72A 3M0FA 1V9WA 1S3DA 5G2ZA 3FZ4A 5AN1A 5KOWA 1OAZA 5JCUA 5DQYA 3CYNA 2CVKA 4HEA2 2CZ3A 5HR0A 3HHVA 3EPTA 4HU7A 2B1KA 1K0OA 3ZIJA 4TKYA 3A5IA 1SYXA 3KM6A 1J9BA 3ZITA 4O5UA 1PD21 2OE3A 1FAAA 3GH9A 2ALBA 3ZIVA 4F9ZA 1W89A 17GSA 2WS2A 1AQXA 1ERTA 1Y6EA 1PN9A 1U3IA 3ZREA 1PX6A 3D4TA 2E0QA 4PX1A 3W8SA 2MMNA 2L6DA 4KE3A 4L8EA 2VO4A 3IPZA 2MMOA 4EC0A 1WP0A 4YQUA 5D9WA 3ZRDA 1OVNA 1EWXA 1EOGA 1GTIA 4HZ2A 5IO0A 3CXGA 3V1WA 3ERGA 3EC3A 2LTKA 4IBPA 2LV3A 1NHOA 3Q6OA 3IE3A 4GSTA 1ZOFA 2YN1A 1XBSA 1S3CA 2E7PA 1EEMA 2V1MA 4J56E 3IK9A 2DJJA 5D9VA 2GGTA 3IK7A 5DCGA 1GULA 1U88A 5B6NA 1WE0A 2V41A 3IHGA 4Z7XA 3KJYA 1SKRB 3BD2A 4Q5RA 4IQAA 1O85A 2WULA 5IOWA 4BL7B 3F6FA 1F9MA 3LGCA 5CRDA 1GSSA 2TRXA 4EDYA 4EUYA 5ECRB 3C71A 3HZ8A 5AISA 5KN0A 4MJBA 2NDOA 1TJDA 3LXZA 4HOJA 2GSRA 1A2LA 1PMTA 2R0CA 1HNAA 2K8VA 4TR1B 2PGTA 4NHZA 3GL5A 2A2RA 1WOUA 3VWXA 4OD7A 3I69A 3DD3A 2JZRA 4IP6A 4MF6A 5GAPD 1MDKA 4CDOA 4KA0A 4BVYB 3ME8A 4G0KA 5CO3A 3VPQA 2I81A 1EOHA 5ECIB 3HXSA 4RQRA 4WETA 3QR6A 1SL2B 1T4ZA 3GKNA 1K0BA 2C0EA 3GTUA 4KDUA 5HR3A 3RAZA 3TJKA 3LG6A 2M46A 3N9JA 1SK0A 2IFQB 4WR4A 1BAYA 1SYRA 3DIEA 2CA8A 1A8LA 1TRVA 1THOA 2L5LA 5IPGA 2DC5A 5KN1A 4BWSA 1YY7A 2LEGA 4AF2A 2XPDA 1GLPA 4GSNA 1HQOA 1FW1A 3LORA 3GIXA 19GSA 3IXRA 1H75A 1QQ2A 4HI7A 3VWWA 3JCML 5HFGA 2GSTA 1T3BA 4Q5QA 2A2SA 4AGSA 3HD5A 1O8XA 5ECPB 1FOHA 1HNCA 1BEDA 4TVEA 2VCTA 2OKAA 4JEDA 3GH6A 1XWCA 3QMXA 2F9SA 3C8EA 4F03A 1GL8A 3M9KA 4XCSA 3DXBA 2HRNA 2A2PA 5CREA 3MYDA 3MAKA 1CQHA 4D73A 4JBBA 4OCEA 3TKQA 5F07A 2G2QA 1R4WA 3F4TA 3IDVA 4OWYA 1MDJA 4MF5A 3FRCA 3EMXA 2H6XA 2YCDA 4K0NA 4NXIA 3IC8A 3NZNA 3HDCA 2FNOA 6GSTA 1GUHA 3G7YA 1GH2A 3F8UA 2OBIA 2JSZA 2MBSA 4EIPA 2FA4A 4NWYA 2JADA 2VL9A 2HZEB 1FVJA 4F2IA 4HDEA 1XVQA 2A4VA 5LNKe 4YKGA 1XW6A 2H75A 3DKSA 3H93A 4MZWA 2YZUA 1J08A 4LA1A 5DALA 2F3MA 2O8VB 1DSBA 1TRWA 1G7OA 3O76A 5HQPA 2HFDA 2FA8A 1GTAA 3WD6A 4LMWA 1TRSA 1XXUA 2FCHA 4XTSA 1VRSD 2H70A 4YAPA 5DQSA 3VWUA 1SENA 5ECSA 3IOSA 4ISDA 2C0DA 2CQ9A 2WDUA 4G0LA 2GQKA 2GQLA 3I9V2 1MD4A 2X4AA 3ISOA 3GKXA 3LEFA 5IMFA 5LCZA 3FEUA 1SKWB 3M3MA 5INYA 4PGTA 5B7CA 4ECJA 2HE3A 1TW9A 1GSUA 3RBTA 3ZMKA 1JZOA 2HRFA 3H8QA 1T4YA 1SJIA 4POBA 3R3EA 4FQUA 1JZWA 4XIHA 2I9HA 1K0AA 1WWJA 3C1SA 2EIQA 2N5AA 1OE7A 2VCVA 2O87A 3BBYA 3FW2A 4IVFA 4ZBBA 4EO3A 5CRHA 2IL3A 3QCPA 3QFAC 5CAXA 4XRAA 4ACSA 1YJ6A 2LJAA 1K3OA 4K5SA 4MH3A 3TOTA 3VI5A 1K0NA 2BTOT 2IJYA 3GX0A 4IJIA 3W8JA 4RI7A 3ZMLA 3KTBA 2DIZA 4K7OA 2TRCP 3ZZXA 3IHQA 4G9HA 4GTUA 3WGDA 4PQHA 2OE0A 2X64A 5DAKB 5H5QA 3GUSA 1A2MA 4RQXA 2IIYA 4BVXA 2WCIA 1TK8B 13GSA 1WIKA 4Q5NA 1YF0A 1AUCA 2DBCA 1R5AA 2DJ0A 3HVVA 3QFBC 4L0WA 4GSSA 2V2GA 4CW9A 4IW9A 2H6ZA 1LU4A 2VD1A 1M0UA 1RW1A 4DSQA 2HSYA 1EZKA 1DBYA 5ENUA 3OR5A 2XC2A 1M2DA 2ES7A 2VL3A 4XS4B 3GSSA 2DSAA 1A24A 2L4CA 1GNWA 1SL0B 3KP9A 4TXOA 1KNGA 4G2EA 3TOUA 2TIRA 3DRNA 4ZBDA 9GSSA 1F37A 2DMMA 1AQVA 3APQA 4L0UA 3UVHA 1BJXA 1HNBA 1GLQA 2LQOA 2PVOC 4HJ2A 2AUVA 2CZ2A 1N8JA 1B4QA 1TK5B 4KW6A 3QAWA 5D9TA 1Z3EA 1AC1A 3IC4A 5ECOB 3FMWA 2YWMA 3TJBA 3TKSC 18GSA 3EINA 4Z2TA 3CTGA 3LFLA 1PL2A 3ERWA 4KGIA 5KEJA 4MH2A 3UL3A 1UA5A 4GQFA 4I2TA 4WBRD 1TP9A 4NMUA 3UBKA 4DSSA 1QFNA 1O8WA 1OC9A 3ED3A 2HXKA 3C73A 4WEYA 3HY2A 4CY8A 4O5QA 2JZTA 2CX4A 3TJGA 3BOAA 1V57A 4V2NA 2XPEA 4USSA 5GSSA 1QGVA 1F3AA 2GZPA 2VM1A 2R3XA 4PURA 1O73A 2PPTA 2ON5A 3RPNA 1SK2A 2VL2C 1OC3A 5A4UA 4POMA 4ILFA 4BL7A 5IO2A 2LQQA 4ZL8A 5DCHA 1YEPA 3LXTA 5G5EA 2CX3A 2BJXA 2R5GA 2RLIA 4V2MA 4KDYA 2VCQA 4GRFA 5CRWA 2YWNA 5HFKA 2PBJA 3EMPA 3G9BA 2FY6A 2R0GA 3G7IA 5A5KA 5AGYA 3EURA 4K5RA 1X9WB 2E2MA 2MMZA 4HZ4A 3TKRA 3HZ4A 4IHUA 3GYKA 5BRTA 1R7HA 4K7IA 2RM5A 1TRUA 3J7Yk 3FK8A 1XW9A 3UBLA 4NHWA 2YV9A 2B5EA 1T7PB 3MNGA 2CT6A 3A3TA 3P8WA 5ABRA 2NVLA 12GSA 2O7KA 2VCZA 5IMVA 4KB3A 2AJQB 2B1LA 3HA9A 2LKUA 1VF3A 4F82A 2C3TA 4XHMA 2VUPA 4F0BA 1PKWA 1B9YC 1GUMA 3GL3A 3RHCA 2K8SA 1XWBA 3M9JA 5HR1A 4IKHA 4ZILA 4PUAA 2KUCA 3KD0A 1JHBA 2C0FA 3KGKA 2GS3A 1GTUA 5J9CA 3RHBA 1IYHA 1B9XC 3L0HA 4MJEA 3IA1A 3IAM2 3WGEA 1ZL9A 3SWLA 1E6BA 5ECMB 3KZQA 2H72A 1RK4A 4ECBA 1SU9A 2H1BA 5D96A 3FYGA 4PUFC 1DE2A 1EGOA 3I6AA 3D6IA 3QOUA 4DSRA 1YEXA 1X5CA 1TI1A 2XHFA 2HI7A 4FH8A 3L78A 3N5OA 4TR0A 3UARA 5C04A 3TJJA 1A8YA 2H76A 4NV5A 5ECQB 3O6TA 2IWTA 2REMA 3A2WA 2OADA 5JWOB 2LNSA 4O32A 2IPAA 3FHKA 4PNFA 1QXHA 1GNEA 1Q4JA 3C7MA 2PVQA 2KP2A 1PGTA 4GQCA 2I4AA 3LQ7A 3U6VA 4FIWA 2WFCA 3RDWA 2P0GA 4QL7A 3TDGA 5EL8A 3IAS2 4YH2A 1T8EB 2GT5A 2DLXA 1Z5YE 3VK9A 4E8EA 4KX4A 1BG5A 1S3AA 3GKMA 3VI7A 2GVPA 2V6OA 3ZFLA 3BCKA 3GMFA 2HT9A 4DEJA 5B8AA 1USBA 2RIIA 4FYCA 2C3QA 2DKHA 1K0DA 3TKPA 1PQNA 1FHEA 3LW9A 1EEJA 1QK8A 4MABA 4KDXA 2IMEA 3F6DA 1YQ1A 1FOVA 2IN3A 3M1GA 4MPFA 4KAEA 1WPIA 2VLVA 1K0CA 3Q19A 5JWQB 2HLSA 4K1FA 5G31A 4WF5A 1QUWA 3LYPA 2PMTA 4MJAA 20GSA 5CNWA 2QC7A 1QMVA 2L59A 4K0GA 1NHYA 2FGXA 3D5JA 2H0IA 3QAVA 2AHEA 3GTUB 1YKCA 3CMIA 1SJ6A 2X8HA 3H4KA 5EVOA 1V58A 2YWIA 5ECNB 3TUEA 2ZUPA 5ECKB 2QKEA 5ID2A 4ECIA 4GCIA 2PUKC 2HYXA 1M9BA 1DUGA 3QPMA 4GXZA 2N5BA 4KUNA 3ZVJD 2PWJA 3AY8A 4MK3A 4ICYA 1M2AA 2L5OA 3A2VA 4TW5A 4MNNA 2FWFA 4WBJA 1ILOA 2C0GA 4WR5A 4RI6A 4AJ7A 3I43A 1TOFA 5H5RA 5AIXA 1Z6NA 5J41A 1Q98A 2VCWA 4K7NA 10GSA 1KTEA 1K0MA 3NOFA 5IMDA 2P31A 5IMCA 2H6YA 4N0ZA 4I8BA 4MZCA 4FYUA 4FYBA 1JLWA 2CV4A 5E4WA 3UJ1A 4D73B 4Z2RA 1A2JA 1AW9A 2GZYA 3DMLA 4HJMA 1SD9A 2VLTA 4JR6A 5F05A 4L5OA 3CSIA 2WZ9A 5IPHA 1F2EA 8GSSA 4I6XA 3ZTLA 2KLXA 3HJPA 3UOMA 2K9FA 5CYYA 2H73A 2H66A 1GSQA 1BX9A 3PINA 1ML6A 1YDKA 1R5PA 2OE1A 2HRAA 2B5YA 3UMAA 1URMA 3APOA 1ACVA 1XVWA 2X8CA 1O6JA 2O85A 4MZBA 1U6TA 3F3QA 3VLNA 7GSSA 3KP8A 5DALB 3UEMA 3HYPA 2VAFA 3GHAA 2QSIA 4P3YB 1B8XA 2YNXA 5ELAA 4K6XA 1FB0A 2H8LA 2DJKA 1VF2A 2EIOA 2NPBA 4WF4A 5A4WA 4MJCA 3HCZA 1LBKA 3FR3A 5CRGA 3CSHA 1IYIA 2F8FA 2G0FA 3FR6A 4K9ZA 3KH9A 4HQSA 2Z9SA 2OA7A 3EU4A 3J7Yb 4HUAA 1PSQA 2LUSA 2H01A 4WKWA 2H19A 4A5PA 2ON7A 5G5FA 1XWKA 2DJ2A 2VD0A 3DVWA 4POLA 4AJ8A 1EP7A 1KBNA 1NW2A 3LSZA 3E0UA 2L6CA 1GWCA 1J0FA 2IMDA 4TOPA 5KN3A 2FWEA 5G1KA 2CVDA 3DEXA 1YZXA 2IMKA 4ZL9A 1OKDA 2I1UA 2VM2A 1K3LA 3UVTA 1X9MB 4ML1A 2A4HA 2YP6A 4PQ1A 1GTBA 4KCEA 2DJ3A 1K3YA 1GSYA 1SL1B 3GRXA 5B6MA 4N30A 2NBSA 2HNLA 3GFKA 1JZRA 2H74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOB A;  4YQV A;  1XIY A;  4G10 A;  2GSS A;  1B48 A;  4JU5 A;  4QL9 A;  1ERW A;  4QQ7 A;  4HS1 A;  2GT6 A;  4EF0 A;  2H1A A;  4MPG A;  1HYU A;  2ZCT A;  3VWV A;  3H79 A;  3TRX A;  4V1A p;  2K6V A;  5LD0 A;  1XWA A;  4MF7 A;  4V2L A;  3EVI A;  5H5S A;  3VUR A;  6GSU A;  1G0T A;  3KH7 A;  2PU9 C;  4MCU A;  5JWR B;  5IMZ A;  4IEL A;  3F4S A;  2D2Z A;  2V32 A;  4MA9 A;  2VLU A;  1XWG A;  3KIJ A;  3SBC A;  1BQ7 A;  1I9D A;  3D22 A;  3LJR A;  2H0H A;  2IYJ A;  4L5L A;  2YAN A;  2LJK A;  2KHP A;  3F63 A;  2L4Q A;  2FD3 A;  4FO5 A;  2H0G A;  4DVC A;  1X0R A;  3DVX A;  4H86 A;  4N10 A;  3U5R E;  3TKS A;  3ME7 A;  1VF4 A;  2LJR A;  3LYK A;  1O81 A;  2RM6 A;  3A2X A;  4F0C A;  5L71 A;  2YPM A;  3D21 A;  4IQ1 A;  4PQI A;  3APS A;  4MDC A;  3Q74 A;  4TXO B;  4EKZ A;  5D9X A;  3TB2 A;  2AAW A;  1TU8 A;  2JL4 A;  1ABA A;  2C1Y A;  2PER A;  4OCF A;  2C4J A;  4I5Q A;  2E2G A;  3CRU A;  3KXO A;  3QAG A;  5JCW A;  1M7T A;  3BJ5 A;  2O89 A;  4JE1 A;  2VCX A;  5A4V A;  2B7K A;  1ZMA A;  1ZYE A;  2B7J A;  1TI3 A;  4GF0 A;  4TR3 A;  1LJR A;  4TR1 A;  3L9U A;  4LLR A;  4JZQ A;  3ZFB A;  5IOX A;  4O92 A;  5IMA A;  3IBH A;  2R4V A;  3GKK A;  1TKD B;  3ZLP A;  2MYG A;  2VL2 A;  4DSS B;  1ZGN A;  2YWO A;  4BVY A;  3FR9 A;  1OC9 B;  3F3R A;  1EP8 A;  1AQW A;  5ECL B;  5GAN D;  3IR4 A;  5JCG A;  1H4O A;  4KSO A;  3CRT A;  4EDZ A;  3DYR A;  2R6K A;  4OO5 A;  1G6W A;  2DML A;  3F0I A;  5IIZ A;  2X99 A;  5G30 A;  5EY6 A;  1G6Y A;  2IFQ A;  2JAC A;  4K2D A;  2YJH A;  5FHI A;  3TCO A;  1VGL A;  1GSD A;  5J3R A;  2CVB A;  3CSJ A;  3IRA A;  1R26 A;  4ZBA A;  5C00 A;  1Z9H A;  3HKR A;  5HR2 A;  2WB9 A;  5DJL A;  4YAV A;  3ZVJ A;  5GZZ B;  1XZO A;  3KCM A;  3WYW A;  3FZA A;  3D0Z A;  3GA4 A;  1JFU A;  2CAI A;  1AIU A;  4X43 A;  2C3N A;  1KEB A;  3M8N A;  1V40 A;  3BCI A;  5G1L A;  2F51 A;  5DJM A;  1TXX A;  4ZB9 A;  3KMO A;  1AXD A;  1U3A A;  3TJF A;  1Y25 A;  4ZL7 A;  2RUE A;  2XBI A;  3G7J A;  2IMF A;  1GSE A;  1SD8 A;  2LS5 A;  3ZL5 A;  1MD3 A;  2KP1 A;  5J5N A;  1O7U A;  2YZH A;  1XOA A;  1NM3 A;  1TDI A;  1Z6M A;  2J23 A;  1MEK A;  5KN2 A;  2X8G A;  2V6K A;  4O7H A;  1MDI A;  1OE8 A;  1NSW A;  4JR4 A;  2AYT A;  5F06 A;  2HZF A;  2WGR A;  2NTO A;  4JRR A;  5DBQ A;  3H1N A;  2B6M A;  3MDK A;  4EXJ A;  2RUF A;  4POK A;  4ML6 A;  4ID0 A;  3WT1 A;  1FO5 A;  5B8B A;  1FVK A;  2HZE A;  1X5E A;  2OAC A;  2CAQ A;  4HU9 A;  4J2F A;  3KMN A;  2GTU A;  4BWQ A;  2LRC A;  1EGR A;  3GN3 A;  5DVB A;  3S9F A;  1ERV A;  5COH A;  2B3S A;  2R37 A;  2IMI A;  2P5R A;  1GSF A;  1W4V A;  4YQM A;  4GWR A;  1OC8 A;  4TRX A;  2DJ1 A;  3K8N A;  2H71 A;  3A5W A;  2LRT A;  2AV4 A;  1ERU A;  1XFL A;  1TK0 B;  2QGV A;  4IJ3 A;  3NIV A;  2JZS A;  3EU3 A;  5HFI A;  4J57 E;  4TXV A;  4ZIJ A;  4KND A;  4MMM A;  6GSS A;  1F3B A;  3Q18 A;  1X9S B;  2VOC A;  1VF1 A;  6GSY A;  1ZZY A;  3QD9 A;  4EVM A;  1SKS B;  2GLR A;  4OFM A;  5EPF A;  2I3Y A;  6GSV A;  4MP4 A;  3WT2 A;  4LMV A;  2FUG 2;  1JLV A;  1Z7R A;  5F8B A;  2N5F A;  4EL1 A;  2P5Q A;  2GZZ A;  1C72 A;  4LL1 B;  3PGT A;  1M9A A;  2VIM A;  3P2A A;  2EIR A;  2H1D A;  4Q5F A;  1A0F A;  5J9B A;  22GS A;  4NPB A;  1TU7 A;  3F4R A;  1MTC A;  4ULX A;  1M99 A;  1EV9 A;  6GSW A;  3CBU A;  1E2Y A;  1TTZ A;  1WRY A;  1HD2 A;  3EE2 A;  3CTF A;  1XPV A;  5D8I A;  4ZB8 A;  2FLS A;  1OKT A;  1GRX A;  4XRD A;  1B4P A;  4BA7 A;  1ZCP A;  2PN8 A;  2C8U A;  1YKA A;  3TRP A;  3P90 A;  3PR8 A;  11GS A;  1SJZ A;  3MSZ A;  5E59 A;  2LRN A;  4PXO A;  2M80 A;  4OFT A;  5D93 A;  4E8H A;  4XS1 A;  3FZ9 A;  3GST A;  3R2Q A;  2KOK A;  3EYT A;  5FT3 A;  5DAK A;  3HJO A;  1Z7P A;  4ECC A;  1WMJ A;  4AJ6 A;  1PKZ A;  2GDR A;  5ID2 B;  5CP1 A;  4IS0 A;  1UN2 A;  2GSQ A;  2MBT A;  2ZNM A;  4LL4 B;  1OYJ A;  4OMV A;  1GP1 A;  3O3T A;  2LST A;  3GNJ A;  2HSH A;  1F6M C;  4CHS A;  3FY7 A;  1DE1 A;  1T1V A;  2YV7 A;  1EV4 A;  3DWV A;  1UVZ A;  1GUK A;  3LWA A;  4XS4 A;  3P7X A;  3UAP A;  3W6G A;  2EC4 A;  4O5R A;  1T00 A;  4X0X A;  3KEB A;  4MLY A;  3MWH A;  2LNT A;  3F9U A;  2R2J A;  4GLT A;  1YF1 A;  1U87 A;  4IN0 A;  14GS A;  3TGZ A;  2FWH A;  4OFN A;  3RPP A;  4KSM A;  2MMA A;  5DDL A;  2YOI A;  2IY2 A;  2FWG A;  1CQG A;  16GS A;  3DGQ A;  5GST A;  5ELG A;  1M2B A;  1A23 A;  4K8M A;  1XW5 A;  2YJ7 A;  2DIY A;  3US3 A;  3FKF A;  2AB6 A;  3QDN A;  3TRQ A;  3WGX A;  5IQY A;  3GUR A;  5F0G A;  5D73 A;  4BPY A;  1N2A A;  2K18 A;  1ON4 A;  4TR4 A;  5AIV A;  5ECH B;  1PX7 A;  2XBQ A;  3PH9 A;  1XCC A;  1G7E A;  2J9H A;  4NAX A;  3D4M A;  1PRX A;  4N0V A;  2OJL A;  3GX8 A;  2WJU A;  4X1U A;  2H30 A;  4XS6 A;  5IM9 A;  1FB6 A;  1UC7 A;  3ERF A;  2GQM A;  4KH7 A;  1BYE A;  6GSX A;  4HQZ A;  3KTL A;  1SK1 A;  4N11 A;  3E3E A;  1X5D A;  3C1R A;  4I97 A;  4ZXG A;  2OBK A;  4ZB6 A;  3HVX A;  1AAZ A;  3IV4 A;  1RQM A;  4WXT A;  1V98 A;  4I2U A;  4PNG A;  1I5G A;  4TN8 A;  1FG4 A;  4OO4 A;  3GV1 A;  3L9S A;  4KCA A;  2BMX A;  4EE0 A;  3TKS E;  3VFI A;  4NV2 A;  1V2A A;  2JSY A;  1WJK A;  3L4N A;  2FHE A;  3FZ5 A;  4G19 A;  3VPT A;  3ZYW A;  4IGJ A;  2WRT A;  3HVS A;  1JZD A;  5J4U A;  3EWL A;  3UIW A;  1A0R P;  2B5X A;  4RUV A;  2F8A A;  2MZC A;  4IP1 A;  2H1G A;  1PA3 A;  2JU5 A;  1PL1 A;  1ZYQ B;  3E9J B;  1THX A;  3HJM A;  2L57 A;  5FWG A;  3L9V A;  2C80 A;  4V1A g;  1ST9 A;  2M72 A;  3M0F A;  1V9W A;  1S3D A;  5G2Z A;  3FZ4 A;  5AN1 A;  1OAZ A;  5JCU A;  5DQY A;  3CYN A;  2CVK A;  4HEA 2;  2CZ3 A;  5HR0 A;  3HHV A;  4HU7 A;  2B1K A;  1K0O A;  3ZIJ A;  4TKY A;  1SYX A;  3KM6 A;  1J9B A;  3ZIT A;  1PD2 1;  2OE3 A;  1FAA A;  3GH9 A;  2ALB A;  3ZIV A;  4F9Z A;  1W89 A;  17GS A;  2WS2 A;  1AQX A;  1ERT A;  1Y6E A;  1PN9 A;  1U3I A;  3ZRE A;  1PX6 A;  3D4T A;  2E0Q A;  4PX1 A;  3W8S A;  2MMN A;  2L6D A;  4KE3 A;  4L8E A;  2VO4 A;  3IPZ A;  2MMO A;  4EC0 A;  1WP0 A;  4YQU A;  5D9W A;  3ZRD A;  1OVN A;  1EWX A;  1EOG A;  1GTI A;  4HZ2 A;  5IO0 A;  3CXG A;  3V1W A;  3ERG A;  3EC3 A;  2LTK A;  4IBP A;  2LV3 A;  1NHO A;  3Q6O A;  3IE3 A;  4GST A;  1ZOF A;  2YN1 A;  1XBS A;  1S3C A;  2E7P A;  1EEM A;  2V1M A;  4J56 E;  3IK9 A;  2DJJ A;  5D9V A;  2GGT A;  3IK7 A;  5DCG A;  1GUL A;  1U88 A;  5B6N A;  1WE0 A;  2V41 A;  4Z7X A;  3KJY A;  1SKR B;  3BD2 A;  4Q5R A;  4IQA A;  1O85 A;  2WUL A;  5IOW A;  3F6F A;  1F9M A;  3LGC A;  5CRD A;  1GSS A;  2TRX A;  4EDY A;  4EUY A;  5ECR B;  3C71 A;  3HZ8 A;  5AIS A;  5KN0 A;  4MJB A;  2NDO A;  1TJD A;  3LXZ A;  4HOJ A;  2GSR A;  1A2L A;  1PMT A;  1HNA A;  2K8V A;  4TR1 B;  2PGT A;  4NHZ A;  3GL5 A;  2A2R A;  1WOU A;  3VWX A;  4OD7 A;  3I69 A;  3DD3 A;  2JZR A;  4IP6 A;  4MF6 A;  5GAP D;  1MDK A;  4CDO A;  4KA0 A;  3ME8 A;  5CO3 A;  3VPQ A;  2I81 A;  1EOH A;  5ECI B;  3HXS A;  4RQR A;  4WET A;  3QR6 A;  1SL2 B;  1T4Z A;  3GKN A;  1K0B A;  2C0E A;  3GTU A;  4KDU A;  5HR3 A;  3RAZ A;  3TJK A;  3LG6 A;  2M46 A;  3N9J A;  1SK0 A;  2IFQ B;  4WR4 A;  1BAY A;  1SYR A;  3DIE A;  2CA8 A;  1A8L A;  1TRV A;  1THO A;  2L5L A;  5IPG A;  2DC5 A;  5KN1 A;  4BWS A;  1YY7 A;  2LEG A;  4AF2 A;  2XPD A;  1GLP A;  4GSN A;  1HQO A;  1FW1 A;  3LOR A;  3GIX A;  19GS A;  3IXR A;  1H75 A;  1QQ2 A;  4HI7 A;  3VWW A;  3JCM L;  5HFG A;  2GST A;  1T3B A;  4Q5Q A;  2A2S A;  4AGS A;  3HD5 A;  1O8X A;  5ECP B;  1HNC A;  1BED A;  4TVE A;  2VCT A;  2OKA A;  4JED A;  3GH6 A;  1XWC A;  3QMX A;  2F9S A;  3C8E A;  4F03 A;  1GL8 A;  3M9K A;  4XCS A;  3DXB A;  2HRN A;  5CRE A;  3MAK A;  1CQH A;  4D73 A;  4JBB A;  4OCE A;  3TKQ A;  5F07 A;  2G2Q A;  1R4W A;  3F4T A;  3IDV A;  4OWY A;  1MDJ A;  4MF5 A;  3FRC A;  3EMX A;  2H6X A;  2YCD A;  4K0N A;  4NXI A;  3NZN A;  3HDC A;  2FNO A;  6GST A;  1GUH A;  3G7Y A;  1GH2 A;  3F8U A;  2OBI A;  2JSZ A;  2MBS A;  2FA4 A;  4NWY A;  2JAD A;  2VL9 A;  2HZE B;  1FVJ A;  4F2I A;  4HDE A;  1XVQ A;  2A4V A;  5LNK e;  1XW6 A;  2H75 A;  3DKS A;  3H93 A;  4MZW A;  2YZU A;  1J08 A;  4LA1 A;  5DAL A;  2F3M A;  2O8V B;  1DSB A;  1TRW A;  1G7O A;  3O76 A;  5HQP A;  2HFD A;  2FA8 A;  1GTA A;  3WD6 A;  4LMW A;  1TRS A;  1XXU A;  2FCH A;  4XTS A;  1VRS D;  2H70 A;  4YAP A;  5DQS A;  3VWU A;  1SEN A;  5ECS A;  3IOS A;  4ISD A;  2C0D A;  2CQ9 A;  2WDU A;  2GQK A;  2GQL A;  3I9V 2;  1MD4 A;  3ISO A;  3GKX A;  3LEF A;  5IMF A;  5LCZ A;  3FEU A;  1SKW B;  3M3M A;  5INY A;  4PGT A;  5B7C A;  4ECJ A;  2HE3 A;  1TW9 A;  1GSU A;  3RBT A;  3ZMK A;  1JZO A;  2HRF A;  3H8Q A;  1T4Y A;  1SJI A;  4POB A;  1JZW A;  4XIH A;  2I9H A;  1K0A A;  1WWJ A;  3C1S A;  2EIQ A;  2N5A A;  1OE7 A;  2VCV A;  2O87 A;  3BBY A;  3FW2 A;  4IVF A;  4ZBB A;  4EO3 A;  5CRH A;  2IL3 A;  3QCP A;  3QFA C;  5CAX A;  4XRA A;  4ACS A;  1YJ6 A;  2LJA A;  1K3O A;  4MH3 A;  3TOT A;  3VI5 A;  1K0N A;  2BTO T;  2IJY A;  3GX0 A;  4IJI A;  3W8J A;  4RI7 A;  3ZML A;  3KTB A;  2DIZ A;  4K7O A;  2TRC P;  3ZZX A;  3IHQ A;  4G9H A;  4GTU A;  3WGD A;  4PQH A;  2OE0 A;  2X64 A;  5DAK B;  5H5Q A;  3GUS A;  1A2M A;  4RQX A;  2IIY A;  4BVX A;  2WCI A;  1TK8 B;  13GS A;  1WIK A;  4Q5N A;  1YF0 A;  1AUC A;  2DBC A;  1R5A A;  2DJ0 A;  3HVV A;  3QFB C;  4L0W A;  4GSS A;  2V2G A;  4CW9 A;  4IW9 A;  2H6Z A;  1LU4 A;  2VD1 A;  1M0U A;  1RW1 A;  4DSQ A;  2HSY A;  1EZK A;  1DBY A;  5ENU A;  3OR5 A;  2XC2 A;  1M2D A;  2ES7 A;  2VL3 A;  4XS4 B;  3GSS A;  2DSA A;  1A24 A;  2L4C A;  1GNW A;  1SL0 B;  3KP9 A;  4TXO A;  1KNG A;  4G2E A;  3TOU A;  2TIR A;  3DRN A;  4ZBD A;  9GSS A;  1F37 A;  2DMM A;  1AQV A;  3APQ A;  4L0U A;  3UVH A;  1BJX A;  1HNB A;  1GLQ A;  2LQO A;  2PVO C;  4HJ2 A;  2AUV A;  2CZ2 A;  1N8J A;  1B4Q A;  1TK5 B;  4KW6 A;  3QAW A;  5D9T A;  1Z3E A;  1AC1 A;  3IC4 A;  5ECO B;  3TJB A;  2YWM A;  3TKS C;  18GS A;  3EIN A;  3CTG A;  3LFL A;  1PL2 A;  3ERW A;  4KGI A;  5KEJ A;  4MH2 A;  3UL3 A;  1UA5 A;  4GQF A;  4I2T A;  4WBR D;  1TP9 A;  4NMU A;  3UBK A;  4DSS A;  1QFN A;  1O8W A;  1OC9 A;  3ED3 A;  2HXK A;  3C73 A;  4WEY A;  3HY2 A;  2JZT A;  2CX4 A;  3TJG A;  3BOA A;  1V57 A;  4V2N A;  2XPE A;  5GSS A;  1QGV A;  1F3A A;  2GZP A;  2VM1 A;  2R3X A;  4PUR A;  1O73 A;  2PPT A;  2ON5 A;  3RPN A;  1SK2 A;  2VL2 C;  1OC3 A;  5A4U A;  4POM A;  4ILF A;  4BL7 A;  5IO2 A;  2LQQ A;  4ZL8 A;  5DCH A;  1YEP A;  3LXT A;  5G5E A;  2CX3 A;  2BJX A;  2R5G A;  2RLI A;  4V2M A;  4KDY A;  2VCQ A;  4GRF A;  5CRW A;  2YWN A;  5HFK A;  2PBJ A;  3EMP A;  3G9B A;  2FY6 A;  3G7I A;  5A5K A;  5AGY A;  3EUR A;  1X9W B;  2E2M A;  2MMZ A;  4HZ4 A;  3TKR A;  3HZ4 A;  4IHU A;  3GYK A;  1R7H A;  4K7I A;  2RM5 A;  1TRU A;  3J7Y k;  3FK8 A;  1XW9 A;  3UBL A;  4NHW A;  2YV9 A;  2B5E A;  1T7P B;  3MNG A;  2CT6 A;  3A3T A;  3P8W A;  5ABR A;  2NVL A;  12GS A;  2O7K A;  2VCZ A;  5IMV A;  4KB3 A;  2AJQ B;  2B1L A;  3HA9 A;  2LKU A;  1VF3 A;  4F82 A;  2C3T A;  4XHM A;  2VUP A;  4F0B A;  1PKW A;  1B9Y C;  1GUM A;  3GL3 A;  3RHC A;  2K8S A;  1XWB A;  3M9J A;  5HR1 A;  4IKH A;  4ZIL A;  4PUA A;  2KUC A;  3KD0 A;  1JHB A;  2C0F A;  3KGK A;  2GS3 A;  1GTU A;  5J9C A;  3RHB A;  1IYH A;  1B9X C;  3L0H A;  4MJE A;  3IA1 A;  3IAM 2;  3WGE A;  1ZL9 A;  3SWL A;  1E6B A;  5ECM B;  3KZQ A;  2H72 A;  1RK4 A;  4ECB A;  1SU9 A;  2H1B A;  5D96 A;  3FYG A;  4PUF C;  1DE2 A;  1EGO A;  3I6A A;  3D6I A;  3QOU A;  4DSR A;  1YEX A;  1X5C A;  1TI1 A;  2XHF A;  2HI7 A;  4FH8 A;  3L78 A;  3N5O A;  4TR0 A;  3UAR A;  5C04 A;  3TJJ A;  1A8Y A;  2H76 A;  4NV5 A;  5ECQ B;  3O6T A;  2IWT A;  2REM A;  3A2W A;  2OAD A;  5JWO B;  2LNS A;  4O32 A;  2IPA A;  3FHK A;  4PNF A;  1QXH A;  1GNE A;  1Q4J A;  3C7M A;  2PVQ A;  2KP2 A;  1PGT A;  4GQC A;  2I4A A;  3LQ7 A;  3U6V A;  4FIW A;  2WFC A;  3RDW A;  2P0G A;  4QL7 A;  3TDG A;  5EL8 A;  3IAS 2;  4YH2 A;  1T8E B;  2GT5 A;  2DLX A;  1Z5Y E;  3VK9 A;  4E8E A;  4KX4 A;  1BG5 A;  1S3A A;  3GKM A;  3VI7 A;  2GVP A;  2V6O A;  3ZFL A;  3BCK A;  3GMF A;  2HT9 A;  4DEJ A;  5B8A A;  1USB A;  2RII A;  4FYC A;  2C3Q A;  1K0D A;  3TKP A;  1PQN A;  1FHE A;  1EEJ A;  1QK8 A;  4MAB A;  4KDX A;  2IME A;  3F6D A;  1YQ1 A;  1FOV A;  2IN3 A;  3M1G A;  4MPF A;  4KAE A;  1WPI A;  2VLV A;  1K0C A;  3Q19 A;  5JWQ B;  2HLS A;  4K1F A;  5G31 A;  4WF5 A;  1QUW A;  3LYP A;  2PMT A;  4MJA A;  20GS A;  5CNW A;  2QC7 A;  1QMV A;  2L59 A;  4K0G A;  1NHY A;  2FGX A;  3D5J A;  2H0I A;  3QAV A;  2AHE A;  3GTU B;  1YKC A;  3CMI A;  1SJ6 A;  2X8H A;  3H4K A;  5EVO A;  1V58 A;  2YWI A;  5ECN B;  3TUE A;  2ZUP A;  5ECK B;  2QKE A;  5ID2 A;  4ECI A;  4GCI A;  2PUK C;  2HYX A;  1M9B A;  1DUG A;  3QPM A;  4GXZ A;  2N5B A;  4KUN A;  3ZVJ D;  2PWJ A;  3AY8 A;  4MK3 A;  1M2A A;  2L5O A;  3A2V A;  4TW5 A;  2FWF A;  4WBJ A;  1ILO A;  2C0G A;  4WR5 A;  4RI6 A;  4AJ7 A;  3I43 A;  1TOF A;  5H5R A;  5AIX A;  1Z6N A;  5J41 A;  1Q98 A;  2VCW A;  4K7N A;  10GS A;  1KTE A;  1K0M A;  3NOF A;  5IMD A;  2P31 A;  5IMC A;  2H6Y A;  4N0Z A;  4I8B A;  4MZC A;  4FYU A;  4FYB A;  1JLW A;  2CV4 A;  5E4W A;  3UJ1 A;  4D73 B;  1A2J A;  1AW9 A;  2GZY A;  3DML A;  4HJM A;  1SD9 A;  2VLT A;  4JR6 A;  5F05 A;  4L5O A;  3CSI A;  2WZ9 A;  5IPH A;  1F2E A;  8GSS A;  4I6X A;  3ZTL A;  2KLX A;  3HJP A;  3UOM A;  2K9F A;  5CYY A;  2H73 A;  2H66 A;  1GSQ A;  1BX9 A;  3PIN A;  1ML6 A;  1YDK A;  1R5P A;  2OE1 A;  2B5Y A;  3UMA A;  1URM A;  3APO A;  1ACV A;  1XVW A;  2X8C A;  1O6J A;  2O85 A;  4MZB A;  1U6T A;  3F3Q A;  3VLN A;  7GSS A;  3KP8 A;  5DAL B;  3UEM A;  3HYP A;  2VAF A;  3GHA A;  2QSI A;  4P3Y B;  1B8X A;  2YNX A;  5ELA A;  4K6X A;  1FB0 A;  2H8L A;  2DJK A;  1VF2 A;  2EIO A;  2NPB A;  4WF4 A;  5A4W A;  4MJC A;  3HCZ A;  1LBK A;  3FR3 A;  5CRG A;  3CSH A;  1IYI A;  2F8F A;  2G0F A;  3FR6 A;  4K9Z A;  3KH9 A;  4HQS A;  2Z9S A;  2OA7 A;  3EU4 A;  3J7Y b;  4HUA A;  1PSQ A;  2LUS A;  2H01 A;  4WKW A;  2H19 A;  2ON7 A;  5G5F A;  1XWK A;  2DJ2 A;  2VD0 A;  3DVW A;  4POL A;  4AJ8 A;  1EP7 A;  1KBN A;  1NW2 A;  3LSZ A;  3E0U A;  2L6C A;  1GWC A;  1J0F A;  2IMD A;  4TOP A;  5KN3 A;  2FWE A;  5G1K A;  2CVD A;  3DEX A;  1YZX A;  2IMK A;  4ZL9 A;  1OKD A;  2I1U A;  2VM2 A;  1K3L A;  3UVT A;  1X9M B;  4ML1 A;  2YP6 A;  4PQ1 A;  1GTB A;  4KCE A;  2DJ3 A;  1K3Y A;  1GSY A;  1SL1 B;  3GRX A;  5B6M A;  4N30 A;  2NBS A;  2HNL A;  3GFK A;  1JZR A;  2H74 A; 
#chains in the Genus database with same CATH topology
 1XOB A;  4YQV A;  1U8C B;  1XIY A;  4G10 A;  2GSS A;  4BTW A;  1Z1S A;  3MPH A;  1B48 A;  1O7N B;  4JU5 A;  4QL9 A;  1ERW A;  2W6J H;  4QQ7 A;  4HS1 A;  2GT6 A;  4EF0 A;  3CPO A;  1XG8 A;  2H1A A;  3EE1 A;  1X1Y A;  4MPG A;  3X40 A;  1HYU A;  4O02 B;  2ZCT A;  3VWV A;  4HJL B;  2W04 A;  3H79 A;  3TRX A;  4V1A p;  2K6V A;  4X2O A;  5LD0 A;  1XWA A;  4MF7 A;  4V2L A;  3MG2 A;  3EVI A;  2F5W A;  5IEP A;  1Q40 A;  5H5S A;  4BVX B;  3VUR A;  6GSU A;  1G0T A;  3KH7 A;  1YNV X;  3FZW A;  2PU9 C;  3NBJ A;  4MCU A;  5JWR B;  1GMP A;  5IMZ A;  4IEL A;  3F4S A;  2D2Z A;  2V32 A;  4MA9 A;  3Q90 A;  2VLU A;  1XWG A;  3KIJ A;  3SBC A;  1BQ7 A;  1I9D A;  3K7C A;  7STD A;  4HM4 B;  5LC7 A;  2QIY A;  3N8B A;  3D22 A;  3LJR A;  2OQE A;  1DMN A;  3F40 A;  3NBB A;  5AI1 A;  2H0H A;  2IYJ A;  4L5L A;  2YAN A;  4H61 A;  1KQS 2;  4O3V A;  2LJK A;  3DUK A;  2KHP A;  2UZ8 A;  3F63 A;  1SPU A;  5AII A;  2L4Q A;  2FD3 A;  4FO5 A;  2CFL A;  2H0G A;  4DVC A;  1X0R A;  4RBN A;  3ALA A;  4NRE A;  3DVX A;  4H86 A;  4N10 A;  4N6U A;  3U5R E;  3TKS A;  3ME7 A;  4BIK A;  1VF4 A;  2LJR A;  3LYK A;  1O81 A;  2RM6 A;  4K2X A;  3A2X A;  4F0C A;  5L71 A;  1ZYN A;  2YPM A;  3D21 A;  4IQ1 A;  3X3X A;  4PQI A;  1OPY A;  3APS A;  4Z2U A;  1BUJ A;  4EIQ A;  4MDC A;  1Q82 4;  3Q74 A;  3KFQ C;  4TXO B;  4HYZ A;  3LTB A;  1MGR A;  4EKZ A;  1SQW A;  5D9X A;  3TB2 A;  2AAW A;  1TU8 A;  3M8C A;  1B2Z A;  1RNB A;  2JL4 A;  2Y74 A;  1B3S A;  1ABA A;  2C1Y A;  2PER A;  4OCF A;  2C4J A;  4I5Q A;  3JUM A;  1I3F A;  2E2G A;  3CRU A;  3KXO A;  3QAG A;  1LOV A;  5JCW A;  1M7T A;  3BJ5 A;  2O89 A;  1VQP 3;  4JE1 A;  1W6C A;  2VCX A;  1US1 A;  5A4V A;  3PYJ A;  2B7K A;  1ZMA A;  1GMR A;  1ZYE A;  2B7J A;  1TI3 A;  4GF0 A;  4TR3 A;  1LJR A;  4TR1 A;  1K41 A;  3EF8 A;  3L9U A;  4LLR A;  4GB5 A;  4JZQ A;  3ZFB A;  5IOX A;  4O92 A;  5IMA A;  3IBH A;  4QWT A;  3AGO A;  4R4K A;  2R4V A;  2KF4 A;  3GKK A;  1SJW A;  1TKD B;  3U97 A;  3ZLP A;  2MYG A;  1RRH A;  2VL2 A;  4DSS B;  1ZGN A;  2YWO A;  1B2S A;  4BVY A;  3FR9 A;  1OC9 B;  1UUG B;  3F3R A;  1EP8 A;  1AQW A;  5ECL B;  5GAN D;  3IR4 A;  2GU1 A;  5JCG A;  1H4O A;  4KSO A;  3CRT A;  4EDZ A;  3DYR A;  2R6K A;  3CCM 3;  4OO5 A;  1G6W A;  3URP A;  5LC6 A;  4RNT A;  1TUH A;  2DML A;  3F0I A;  1GOU A;  5IIZ A;  1T2I A;  2BMQ B;  2X99 A;  5G30 A;  2W2C A;  5EY6 A;  1G6Y A;  5M18 A;  2IFQ A;  1KWI A;  2JAC A;  2L4V A;  4K2D A;  2YJH A;  5FHI A;  2C10 A;  1VGL A;  3TCO A;  5EEO A;  5RNT A;  4J9A A;  1GSD A;  3OXA A;  4GHO A;  5J3R A;  2CVB A;  3CSJ A;  3IRA A;  1R26 A;  1AVK A;  4ZBA A;  5C00 A;  1Z9H A;  3HKR A;  1IV9 A;  3B4O A;  5HR2 A;  4KFE A;  2WB9 A;  4KFF A;  5DJL A;  3DM8 A;  3MKI A;  4YAV A;  3ZVJ A;  1IVU A;  5GZZ B;  1XZO A;  5JPP A;  3KCM A;  2YFI B;  3WYW A;  4R1K A;  3STD A;  2F98 A;  3D3L A;  2UGI A;  3H3H A;  3FZA A;  3D0Z A;  4STD A;  3GA4 A;  3CPW 2;  1JFU A;  2SBL A;  1NNV A;  2CAI A;  1AIU A;  3DGN A;  2ZA4 A;  3HII A;  2C3N A;  4X43 A;  1N9J A;  3LTC A;  1BNG A;  1KEB A;  3M8N A;  1VQ4 3;  1GMQ A;  1V40 A;  4HZ9 B;  3BCI A;  1FA3 A;  1W6G A;  5G1L A;  2F51 A;  5DJM A;  2HSM A;  1TXX A;  3WMD A;  4ZB9 A;  4R9K A;  4N3V A;  3KMO A;  1AXD A;  1U3A A;  3TJF A;  3NM7 A;  4OUQ A;  1Y25 A;  3NV0 A;  4ZL7 A;  2RUE A;  2XBI A;  3G7J A;  3G8Z A;  2IMF A;  4AKZ A;  1GSE A;  3S29 A;  1SD8 A;  1NB3 I;  2LS5 A;  3ZL5 A;  1MD3 A;  2KP1 A;  5J5N A;  1O7U A;  2YZH A;  3HOH A;  1OUN A;  1XOA A;  1NM3 A;  4K90 B;  1TDI A;  1I8V A;  1Z6M A;  2J23 A;  3BNB A;  1MEK A;  5KN2 A;  1IU7 A;  1W4N A;  2X8G A;  2V6K A;  1OF5 A;  4O7H A;  1MDI A;  1OE8 A;  1NSW A;  4BIR A;  4JR4 A;  3CC4 3;  2AYT A;  3NX0 A;  1IVX A;  5F06 A;  2HZF A;  2BHM A;  4KT3 B;  2WGR A;  3F8H A;  2NTO A;  4JRR A;  5DBQ A;  1A2P A;  3H1N A;  2B6M A;  1DE3 A;  1M1K 4;  5IG0 A;  4HSC X;  1OH0 A;  3MDK A;  3PCS A;  4EXJ A;  2RUF A;  4POK A;  4ML6 A;  1R4C A;  3I55 3;  2I9W A;  1TIJ A;  4ID0 A;  3WT1 A;  1FO5 A;  5B8B A;  1FVK A;  2HZE A;  1X5E A;  2OAC A;  2CAQ A;  4HU9 A;  1NO3 A;  4J2F A;  3KMN A;  4CPK A;  2GTU A;  1VQ7 3;  1BNE A;  2QA2 A;  4BWQ A;  2LRC A;  5BXQ A;  1EGR A;  3X3Z A;  3GN3 A;  1ASK A;  5DVB A;  2HMK B;  1BU4 A;  1ERV A;  5COH A;  3S9F A;  4CY6 A;  1ULI B;  4K61 A;  2K0M A;  4AKY A;  4FMC A;  4YKF A;  2B3S A;  3AHW A;  2R37 A;  2IMI A;  2P5R A;  3GAX A;  1GSF A;  1W4V A;  2K54 A;  2BIR A;  4YQM A;  1CYV A;  4GWR A;  1OC8 A;  3ROB A;  4TRX A;  2DJ1 A;  3K8N A;  3FLJ A;  2H71 A;  2R0P A;  3A5W A;  2LRT A;  2AV4 A;  1ERU A;  1XFL A;  2BU4 A;  1QAK A;  1TK0 B;  1HZ1 A;  2QGV A;  4IJ3 A;  2J8X B;  3NIV A;  2JZS A;  3EU3 A;  5CLK A;  5HFI A;  2P38 A;  1LOW A;  4J57 E;  4TXV A;  1YGW A;  4ZIJ A;  4KND A;  1UGH I;  4MMM A;  6GSS A;  1F3B A;  1WMP A;  1NJI 4;  3Q18 A;  1X9S B;  2D42 A;  1JB2 A;  2RGQ A;  2VOC A;  3KE7 A;  3QK9 A;  1YIJ 3;  1VF1 A;  2P09 A;  6GSY A;  1ZZY A;  1BSA A;  3QD9 A;  4EVM A;  1SKS B;  2GLR A;  4OFM A;  5BU4 A;  2KF3 A;  3PPU A;  2I3Y A;  5EPF A;  1YHQ 3;  2C4B A;  6GSV A;  1FUW A;  4MP4 A;  3WT2 A;  4G0I A;  4JRF A;  4LMV A;  3F7S A;  2FUG 2;  1BOX A;  2OTJ 3;  1JLV A;  3MHE A;  1Z7R A;  5F8B A;  2N5F A;  5STD A;  2W0Q A;  4EL1 A;  2P5Q A;  2GZZ A;  3OWY A;  4FMA A;  1C72 A;  1GD4 A;  4LL1 B;  3PGT A;  1W2B 2;  1M9A A;  2VIM A;  2CW9 A;  3DY5 A;  3P2A A;  2EIR A;  4EV2 A;  2H1D A;  1A0F A;  4Q5F A;  5J9B A;  22GS A;  4NPB A;  3CCU 3;  1TU7 A;  3F4R A;  1MTC A;  4ULX A;  1M99 A;  1EV9 A;  6GSW A;  3CBU A;  1SII A;  1YGE A;  1E2Y A;  2LYX A;  5BMU A;  1TTZ A;  1WRY A;  3MIX A;  1E97 A;  1HD2 A;  5AYR B;  4RNY A;  3CCR 3;  1FGO A;  5IEO A;  3EE2 A;  5HGR A;  2CG0 A;  1VQO 3;  3CTF A;  1XPV A;  5D8I A;  4ZB8 A;  2FLS A;  1OKT A;  1GRX A;  3FF0 A;  4XRD A;  3SXX A;  1B4P A;  1A67 A;  4BA7 A;  1TP6 A;  1ZCP A;  1BRN L;  2Y73 A;  2PN8 A;  2C8U A;  9RNT A;  1YKA A;  3TRP A;  1S72 3;  3P90 A;  3PR8 A;  11GS A;  1SJZ A;  3MSZ A;  5E59 A;  2LRN A;  3N54 B;  4PXO A;  2OWP A;  1UCI A;  3FF2 A;  1W5Z A;  2M80 A;  4OFT A;  5D93 A;  4E8H A;  3RGR A;  4XS1 A;  3FZ9 A;  3GST A;  4O2H A;  3R2Q A;  1Q7Y 4;  2KOK A;  3EYT A;  5FT3 A;  3DGO A;  5DAK A;  3HJO A;  2QA1 A;  1Z7P A;  4ECC A;  1WMJ A;  4AJ6 A;  3JVC A;  1PKZ A;  2JDI H;  2GDR A;  4HM8 B;  5ID2 B;  4WYK B;  1IT7 A;  5CP1 A;  3PGB A;  4IS0 A;  1UN2 A;  1VQM 3;  4ORL A;  2GSQ A;  4KF9 A;  1JB5 A;  2MBT A;  2ZNM A;  4LL4 B;  1OYJ A;  4OMV A;  3OWS A;  4NHF A;  1ROA A;  1GP1 A;  3O3T A;  2LST A;  3GNJ A;  2HSH A;  4X4J A;  1IQY A;  1JN5 A;  1F6M C;  4HM5 B;  4IT7 A;  1A2V A;  4PTS A;  2AAD A;  8RNT A;  5DRE A;  4CHS A;  3FY7 A;  1DE1 A;  1T1V A;  2YV7 A;  1EV4 A;  1MOL A;  4AEQ A;  4FCJ A;  2XFS A;  3DWV A;  1UVZ A;  3RDE A;  2GEX A;  1GUK A;  4HM2 B;  3LWA A;  2W9P A;  4XS4 A;  3P7X A;  3UAP A;  1FUS A;  1PN0 A;  3W6G A;  1I0V A;  2EC4 A;  4O5R A;  1VQ5 3;  1LNH A;  1STD A;  1T00 A;  1DET A;  3SVA A;  2RNT A;  4X0X A;  3KEB A;  4MLY A;  3UB1 A;  3MWH A;  2LNT A;  5M1A A;  1GY5 A;  3F9U A;  2R2J A;  4GLT A;  1YF1 A;  2RFR A;  1BRH A;  1U87 A;  4IIA A;  4IN0 A;  14GS A;  3TGZ A;  3PS8 A;  2FWH A;  5KOX A;  1LNI A;  4OFN A;  3RPP A;  4KSM A;  2MMA A;  1RN1 A;  3FGY A;  4HKV B;  5DDL A;  1FUT A;  3FG3 A;  2IY2 A;  3BNC A;  2YOI A;  5CXO A;  2FWG A;  1CQG A;  1M3I A;  16GS A;  2WOH A;  2HML B;  3DGQ A;  3KSP A;  1W2Z A;  5GST A;  2E2V A;  5ELG A;  1M2B A;  3SED A;  1A23 A;  2DKI A;  3SOY A;  4K8M A;  4Q53 A;  1XW5 A;  1Y4K A;  2HMN B;  2YJ7 A;  3WDG B;  2DIY A;  3US3 A;  3FKF A;  3JUP A;  2WGQ A;  2AB6 A;  3NM2 A;  3QDN A;  3TRQ A;  3WGX A;  5IQY A;  3GUR A;  3NXJ A;  5F0G A;  5IG4 A;  5D73 A;  4BPY A;  1N2A A;  4EBG A;  1ON4 A;  2K18 A;  4TR4 A;  5AIV A;  1IVV A;  5ECH B;  2XRX B;  1WTH A;  2PZV A;  2BO9 B;  1JBT A;  1PX7 A;  2XBQ A;  1I70 A;  3PH9 A;  1XCC A;  1G7E A;  2J9H A;  4NAX A;  2W56 B;  4MJD A;  3D4M A;  1PRX A;  4N0V A;  5IW9 A;  4GSP A;  2OJL A;  3HIG A;  3GX8 A;  1BRS A;  3T0U A;  2WJU A;  4X1U A;  2H30 A;  3FKA A;  4XBY A;  2HRK A;  4XS6 A;  2GBW B;  5IM9 A;  1FB6 A;  1RHL A;  1UC7 A;  3ERF A;  2GQM A;  4KH7 A;  2R4I A;  1BYE A;  6GSX A;  3CXC 2;  3AGN A;  4HQZ A;  3KTL A;  1MWT A;  1SK1 A;  2ZHX B;  4N11 A;  3E3E A;  1X5D A;  1VQ6 3;  3C1R A;  4I97 A;  4ZXG A;  3MYT A;  2OBK A;  2CK3 H;  4ZB6 A;  3HVX A;  1AAZ A;  3IV4 A;  1TU5 A;  1VQL 3;  1RQM A;  3EB8 A;  1V98 A;  4WXT A;  4I2U A;  4PNG A;  3AMO A;  1I5G A;  1FG4 A;  4TN8 A;  3D5G A;  3Q1C A;  1ZYP A;  4OO4 A;  3GV1 A;  3L9S A;  1O7W B;  2F5M A;  4KCA A;  2BMX A;  4EE0 A;  1Q9E A;  3TKS E;  3VFI A;  4NV2 A;  3G0K A;  1V2A A;  1N9E A;  2JSY A;  3FG1 A;  4WHA A;  1WJK A;  3L4N A;  2FHE A;  3FZ5 A;  3LTD A;  4G19 A;  1I2E A;  3VPT A;  3ZYW A;  4IGJ A;  1EG9 B;  2WRT A;  3HVS A;  4JF8 A;  1JZD A;  5J4U A;  3EWL A;  3UIW A;  3OV4 A;  4BL3 A;  1A0R P;  2B5X A;  3WR2 A;  3LML A;  1JBR A;  4RUV A;  2F8A A;  2MZC A;  4IP1 A;  2H1G A;  4L8P A;  1PA3 A;  2JU5 A;  3GZB A;  1PL1 A;  2X49 A;  1ZYQ B;  3E9J B;  3DXO A;  1THX A;  3HJM A;  2L57 A;  5FWG A;  3L9V A;  2C80 A;  4V1A g;  1ST9 A;  2M72 A;  3M0F A;  1RKY A;  1V9W A;  1QMA A;  1S3D A;  5G2Z A;  3FZ4 A;  5AN1 A;  5KOW A;  1OAZ A;  1GY6 A;  5JCU A;  4EV5 A;  5DQY A;  3CYN A;  2CVK A;  4HZB B;  4HEA 2;  2CZ3 A;  5HR0 A;  3HHV A;  1GSP A;  3EPT A;  4HU7 A;  1RGH A;  2B1K A;  2KCD A;  1K0O A;  3ZIJ A;  4TKY A;  3A5I A;  4N6T A;  1SYX A;  5TGN A;  4HM6 B;  1B2M A;  3KM6 A;  3LT8 A;  1J9B A;  3EBY A;  3CME 3;  2QGU A;  3ZIT A;  4O5U A;  1PD2 1;  2CWV A;  2CKF B;  2OE3 A;  1FAA A;  3GH9 A;  2ALB A;  3DMC A;  3ZIV A;  4F9Z A;  1W89 A;  3T8U A;  4RNZ A;  17GS A;  2WS2 A;  1AQX A;  3V98 A;  1ERT A;  1Y6E A;  1PN9 A;  1U3I A;  3ZRE A;  2FNQ A;  4KVH A;  5AIF A;  1PX6 A;  3D4T A;  2E0Q A;  4PX1 A;  3W8S A;  2MMN A;  1ZX2 A;  4U13 A;  2L6D A;  4WFO A;  1Q40 B;  4KE3 A;  4LEH A;  1I2G A;  1U5O A;  4L8E A;  3K63 A;  2VO4 A;  3IPZ A;  1N8R 4;  6RNT A;  2MMO A;  4EC0 A;  1WP0 A;  4YQU A;  4XDW A;  5D9W A;  5IG5 A;  3ZRD A;  1OVN A;  1VZZ A;  1EWX A;  1EOG A;  1GTI A;  4HZ2 A;  4KZ1 A;  5IO0 A;  3CXG A;  3V1W A;  3ERG A;  4XBX A;  3EC3 A;  1RCK A;  2LTK A;  4IBP A;  2LV3 A;  1IQX A;  1NHO A;  3Q6O A;  3IE3 A;  4GST A;  5M19 A;  1ZOF A;  2YN1 A;  1XBS A;  1S3C A;  2E7P A;  1EEM A;  2V1M A;  1SIH A;  3D4A A;  5CK6 A;  4J56 E;  3F9S A;  3IK9 A;  2DJJ A;  2CFD A;  5D9V A;  2GGT A;  1W02 A;  3IK7 A;  5DCG A;  1GUL A;  1U88 A;  5B6N A;  1WE0 A;  2XR8 B;  1AVL A;  2V41 A;  3IHG A;  4Z7X A;  1BRG A;  3KJY A;  2CX1 A;  1SKR B;  3BD2 A;  4Q5R A;  3LH4 A;  4IQA A;  1O85 A;  1GYB A;  1N5H A;  1HYF A;  5ELJ A;  2XH9 A;  1FGM A;  4X2H A;  2WUL A;  1BSE A;  5IOW A;  4BL7 B;  3F6F A;  1F9M A;  3GZR A;  2CC3 A;  3LGC A;  3BND A;  3ECF A;  1GSS A;  5CRD A;  2TRX A;  4EDY A;  2CFK A;  4EUY A;  5ECR B;  3LTA A;  5DRV A;  3C71 A;  4TX4 A;  3RNT A;  3VGN A;  3HZ8 A;  5AIS A;  5KN0 A;  4MJB A;  2NDO A;  1D6Z A;  1TJD A;  3LXZ A;  4HOJ A;  1G02 A;  2GSR A;  1A2L A;  1PMT A;  2R0C A;  1HNA A;  2K8V A;  1MNL A;  3KCH A;  4TR1 B;  2PGT A;  2XF3 A;  4NHZ A;  3GL5 A;  3RGA A;  2KAA A;  2A2R A;  1WOU A;  3VWX A;  4OD7 A;  1WQL B;  3I69 A;  3DD3 A;  2JZR A;  3UJM A;  4IP6 A;  4MF6 A;  3CQF A;  5GAP D;  1MDK A;  3HVN A;  4CDO A;  4KA0 A;  1WMO A;  4BVY B;  3ME8 A;  4G0K A;  3BU4 A;  2KXG A;  5CO3 A;  3VPQ A;  2I81 A;  3MSO A;  3D9R A;  1EOH A;  5ECI B;  3HXS A;  4BTX A;  4RQR A;  4WET A;  3QR6 A;  1SL2 B;  1T4Z A;  3GKN A;  4FCM A;  3B8L A;  3ZG5 A;  1K0B A;  2C0E A;  3GTU A;  4KDU A;  1QVF 2;  5HR3 A;  3RAZ A;  3TJK A;  5JBS A;  3LG6 A;  2M46 A;  3N9J A;  4EXR A;  1SK0 A;  2IFQ B;  2OCT A;  4WR4 A;  1ZO2 A;  3KKG A;  1BAY A;  1SYR A;  1JB4 A;  3DIE A;  2A15 A;  1LVN A;  4HBR A;  1FW7 A;  2CA8 A;  1A8L A;  4J5G A;  1TRV A;  1THO A;  1R4Y A;  2L5L A;  2MF7 A;  3LOY A;  5IPG A;  1D6Y A;  2DC5 A;  5KN1 A;  4BWS A;  3WOE B;  1YY7 A;  3DGL A;  2LEG A;  3HZP A;  4AF2 A;  2XPD A;  1GLP A;  4GSN A;  1HQO A;  1FW1 A;  3EX9 A;  3LOR A;  3GIX A;  19GS A;  3IXR A;  1H75 A;  1LQG C;  1QQ2 A;  4HI7 A;  3VWW A;  3JCM L;  2GBX B;  3G71 3;  3BB9 A;  1MGW A;  5HFG A;  3KN4 A;  2GST A;  1T3B A;  4Q5Q A;  3IMA B;  1BNS A;  1K9M 4;  2GXF A;  2A2S A;  4AGS A;  3HD5 A;  1LOX A;  1O8X A;  5ECP B;  1FOH A;  1HNC A;  1BED A;  4TVE A;  2VCT A;  2OKA A;  3HI7 A;  4JED A;  3GH6 A;  1XWC A;  3QMX A;  3FCS B;  1M90 4;  2RSX A;  3CCL 3;  2F9S A;  3C8E A;  4F03 A;  1GL8 A;  3M9K A;  3I0Y A;  4XCS A;  3DXB A;  3NV0 B;  2HRN A;  2A2P A;  5CRE A;  3MYD A;  1RGF A;  3MAK A;  1UCL A;  1CQH A;  3ER7 A;  4D73 A;  1M9G A;  1G96 A;  4JBB A;  4OCE A;  3TKQ A;  3DGM A;  5F07 A;  2G2Q A;  1R4W A;  3F4T A;  3IDV A;  4OWY A;  1MDJ A;  4MF5 A;  3FRC A;  2CH9 A;  3EMX A;  2H6X A;  2YCD A;  4K0N A;  4NXI A;  7GSP A;  3IC8 A;  3NZN A;  3HDC A;  5GSP A;  2FNO A;  4HM1 B;  3V92 A;  6GST A;  1YI2 3;  1GUH A;  5EVH A;  3G7Y A;  1GH2 A;  3GZY B;  3F8U A;  1GS3 A;  2OBI A;  3BNE A;  1RGA A;  2JSZ A;  2MBS A;  4EIP A;  4HVN A;  2FA4 A;  4G1M B;  2F99 A;  3EHC A;  4NWY A;  2JAD A;  1FGQ A;  2VL9 A;  2HZE B;  1FVJ A;  4F2I A;  4HDE A;  2CWT A;  1XVQ A;  2A4V A;  5LNK e;  3F14 A;  4J5K A;  4YKG A;  2Z76 A;  1XW6 A;  5D83 A;  3VSY A;  7RNT A;  4CDL A;  2H75 A;  3B4P A;  1TTO A;  3DKS A;  2BMO B;  3H93 A;  4MZW A;  2YZU A;  1J08 A;  4LA1 A;  5DAL A;  1E3V A;  2F3M A;  2O8V B;  1DSB A;  3KII A;  5AIG A;  1TRW A;  1G7O A;  1YIT 3;  3O76 A;  3F7X A;  5HQP A;  2HFD A;  2FA8 A;  2HMO B;  2BT3 A;  1GTA A;  3WD6 A;  4LMW A;  1TRS A;  3EQQ B;  1XXU A;  2FCH A;  1IV7 A;  4XTS A;  1VRS D;  1EA2 A;  2H70 A;  4YAP A;  4FMD A;  5DQS A;  3VWU A;  5CF1 A;  4DKI A;  1SEN A;  5ECS A;  1SAR A;  2P0X A;  3IOS A;  3CCS 3;  1RJO A;  4ISD A;  2C0D A;  2CQ9 A;  2WDU A;  4G0L A;  2GQK A;  4R80 A;  2GQL A;  2XSH B;  3I9V 2;  1BNF A;  1JBS A;  1CQS A;  1MD4 A;  2X4A A;  3ISO A;  3GKX A;  3LXU X;  3LEF A;  5IMF A;  5LCZ A;  4L8O A;  2P05 A;  3FSD A;  3FEU A;  1SKW B;  3M3M A;  2ML5 A;  1OHO A;  5INY A;  2XFT A;  1EUI C;  4PGT A;  5B7C A;  4ECJ A;  2HE3 A;  1TW9 A;  1GSU A;  3RBT A;  3ZMK A;  1JZO A;  2HRF A;  3K9M C;  3H8Q A;  3DGY A;  1T4Y A;  1SJI A;  4POB A;  3R3E A;  1UUW B;  4FQU A;  5ELU A;  1JZW A;  4XIH A;  2I9H A;  1K0A A;  2HMM B;  1T2H A;  1WWJ A;  1IQ8 A;  2YX9 A;  3C1S A;  4GL6 A;  4WWU C;  2EIQ A;  3CC7 3;  1OE7 A;  2N5A A;  2VCV A;  2O87 A;  3BBY A;  3FW2 A;  2C11 A;  1DMM A;  4HAA A;  4IVF A;  4ZBB A;  4EO3 A;  2CFG A;  1DVC A;  5IG3 A;  5CRH A;  2IL3 A;  3EN8 A;  3QCP A;  3QFA C;  5CAX A;  4XRA A;  1AY7 A;  1T5Y A;  5D81 A;  4MMY B;  3PXM A;  4ACS A;  1BAN A;  1YJ6 A;  1LQM B;  1MWU A;  2FGT A;  2LJA A;  1K3O A;  4K5S A;  1GY7 A;  1JKG A;  4MH3 A;  1BRJ A;  1UGI A;  3TOT A;  3VI5 A;  1K0N A;  1VQN 3;  2BTO T;  2IJY A;  3GX0 A;  4IJI A;  1TRQ A;  3W8J A;  1JRQ A;  1RGC A;  3Q3F A;  4RI7 A;  3CNX A;  5AEU B;  4MMX B;  3KTB A;  1W6Y A;  3ZML A;  1BSC A;  2DIZ A;  2KF6 A;  4K7O A;  1PFP A;  2OOV C;  2TRC P;  3ZZX A;  3IHQ A;  4G9H A;  2O9U X;  2RCD A;  4GTU A;  3WGD A;  4PQH A;  3UNL A;  2OE0 A;  1PFO A;  2X64 A;  2B1X B;  5DAK B;  1C54 A;  1GOV A;  5H5Q A;  3GUS A;  1A2M A;  1CYU A;  2YFL B;  4BTY A;  4RQX A;  3AHS A;  2IIY A;  2WO0 A;  3CMA 3;  2IUJ A;  4BVX A;  3X42 A;  2WCI A;  1TK8 B;  3FH1 A;  13GS A;  1WIK A;  4Q5N A;  1YF0 A;  1AUC A;  2DBC A;  1R5A A;  2DJ0 A;  2ML6 A;  3HVV A;  3QFB C;  4L0W A;  4GSS A;  1B20 A;  2V2G A;  4CW9 A;  1OHP A;  3IJE B;  3DZL A;  1Q7H A;  4IW9 A;  1LXE A;  2H6Z A;  1LU4 A;  2VD1 A;  3EN1 B;  1M0U A;  1RW1 A;  4DSQ A;  2HSY A;  1DMQ A;  1EZK A;  1J2B A;  1DBY A;  5ENU A;  3X3Y A;  1KD1 4;  3OR5 A;  2XC2 A;  1FYS A;  1BVI A;  1M2D A;  2ES7 A;  2VL3 A;  1A90 A;  4XS4 B;  3GSS A;  1STF I;  2DSA A;  1A24 A;  2L4C A;  1RN7 A;  1GNW A;  1LOY A;  5BIR A;  1RDS A;  1Q42 A;  2Z6B A;  3OX9 A;  1SL0 B;  3KP9 A;  4TXO A;  1KNG A;  3SYU A;  2ZL8 A;  1RNT A;  1ULJ B;  4G2E A;  1N8Q A;  3TOU A;  2V1L A;  2TIR A;  3DRN A;  4ZBD A;  9GSS A;  1F37 A;  2R41 A;  2K3D A;  3MG1 A;  2DMM A;  1AQV A;  3APQ A;  4L0U A;  3UVH A;  2OQE C;  1BJX A;  1HNB A;  1WMN A;  1MWS A;  1GLQ A;  2LQO A;  1JJ2 2;  2PVO C;  2BMR B;  4LMI A;  4HJ2 A;  2AUV A;  2CZ2 A;  1QJG A;  1N8J A;  1B4Q A;  4MMZ B;  1Q81 4;  1AR0 A;  1TK5 B;  4KW6 A;  3QAW A;  1BRI A;  5D9T A;  1Z3E A;  1AC1 A;  3B7C A;  2GEY A;  2STD A;  3IC4 A;  5ECO B;  1OGX A;  3FMW A;  2YWM A;  3TJB A;  3TKS C;  18GS A;  1ZGX A;  1I0X A;  3EIN A;  4Z2T A;  4BU4 A;  2JQ5 A;  3CTG A;  1IYY A;  4HOH A;  3LFL A;  1PL2 A;  3ERW A;  4KGI A;  5KEJ A;  4MH2 A;  5BVB A;  3UL3 A;  1UA5 A;  4GQF A;  4I2T A;  4WBR D;  1TP9 A;  4NMU A;  3UBK A;  1RMS A;  1S3R A;  5IF6 A;  4DSS A;  1QFN A;  3EJV A;  1N5P A;  1IDP A;  1O8W A;  1OC9 A;  1BNJ A;  3ED3 A;  4FCZ A;  4KFD A;  3NBR A;  1I2F A;  4OVM A;  2HXK A;  3C73 A;  1YJ9 3;  1KC8 4;  4WEY A;  3HY2 A;  1FGR A;  3LT9 A;  4CY8 A;  3A5E A;  1FGT A;  1RGK A;  4O5Q A;  1B21 A;  3N9H A;  1HU9 A;  2JZT A;  2CX4 A;  1WNH A;  1B2U A;  3BOA A;  3TJG A;  1V57 A;  2F56 A;  4O8S A;  1BSB A;  4V2N A;  2XPE A;  4USS A;  5GSS A;  1RCL A;  1F3A A;  1QGV A;  2GZP A;  2VM1 A;  1W7C A;  2R3X A;  4PUR A;  3WHO A;  1O73 A;  3K5T A;  2PPT A;  2ON5 A;  3RPN A;  1NDO B;  5CF2 A;  1SK2 A;  2VL2 C;  1GOY A;  1K73 4;  1OC3 A;  5A4U A;  3A76 A;  2Z7A A;  3UL5 A;  4POM A;  4ILF A;  4BL7 A;  3AMO B;  4N6M A;  1BAO A;  1IVW A;  2LQQ A;  4ZL8 A;  5IO2 A;  1X1W A;  5DCH A;  1YEP A;  3LXT A;  5G5E A;  2CX3 A;  2BJX A;  2GU3 A;  2R5G A;  2RLI A;  4V2M A;  4KDY A;  2VCQ A;  3MWZ A;  4GRF A;  2YWN A;  5CRW A;  5KP4 A;  5HFK A;  2PBJ A;  1OHS A;  3EMP A;  3G9B A;  2GSP A;  2FY6 A;  2R0G A;  5G2G A;  3G7I A;  5A5K A;  5AGY A;  3UL6 A;  3MG3 A;  3G4S 3;  3EUR A;  1M3J A;  4K5R A;  3QRD A;  1X9W B;  2E2M A;  2MMZ A;  1OGZ A;  4HZ4 A;  3CCV 3;  3TKR A;  3HZ4 A;  4FR9 A;  5AEW B;  4IHU A;  4EC6 A;  3GYK A;  3GWR A;  5BRT A;  3WOD G;  1R7H A;  1AQZ A;  4K7I A;  3NQZ A;  4K1V A;  2RM5 A;  1TRU A;  3J7Y k;  1BIR A;  2QEX 3;  3FK8 A;  1ZS7 A;  1XW9 A;  4OK0 A;  3UBL A;  4NHW A;  2YV9 A;  2B5E A;  1TFO A;  4XB5 A;  1T7P B;  3MNG A;  3BLZ A;  3F8X A;  2CT6 A;  3A3T A;  3P8W A;  1MWR A;  5ABR A;  4FMB A;  2XSO B;  2NVL A;  4LZI A;  12GS A;  2O7K A;  2VCZ A;  5IMV A;  4KB3 A;  2AJQ B;  2B1L A;  3HA9 A;  2LKU A;  1VF3 A;  4F82 A;  1IT8 A;  3G6E 3;  2C3T A;  4XHM A;  1BRK A;  3NQY A;  2UX0 A;  2VUP A;  1S5A A;  4F0B A;  1RRL A;  1PKW A;  1B9Y C;  3L0R A;  1GUM A;  3GL3 A;  3RHC A;  2K8S A;  3JUN A;  1DVD A;  1XWB A;  3M9J A;  5HR1 A;  4IKH A;  1RSN A;  4ZIL A;  4PUA A;  2KUC A;  3KD0 A;  1HKX A;  1V74 A;  1LRA A;  1JHB A;  1X1X A;  1BNI A;  4I4K A;  5HOH A;  2C0F A;  3KGK A;  2GS3 A;  2YFJ B;  1GTU A;  3CCQ 3;  5J9C A;  3RHB A;  1IYH A;  1B9X C;  3L0H A;  3X41 A;  4MJE A;  4RZM A;  5KP1 A;  3IA1 A;  3IAM 2;  1CH0 A;  2CHC A;  3WGE A;  1UCJ A;  3CC2 3;  1ZL9 A;  3SWL A;  1E6B A;  5ECM B;  1I3I A;  2XGN A;  1VQ9 3;  4J8T A;  4N6O B;  3KZQ A;  5I97 A;  2H72 A;  1UW1 A;  2LQV A;  1RK4 A;  4ECB A;  1SU9 A;  2H1B A;  5D96 A;  3FYG A;  2IA7 A;  4PUF C;  1B2X A;  1DE2 A;  1EGO A;  1EQK A;  3I6A A;  3D6I A;  3QOU A;  4DSR A;  1YEX A;  1X5C A;  1TI1 A;  2XHF A;  2HI7 A;  4FH8 A;  3L78 A;  2HMJ B;  3N5O A;  4TR0 A;  3UAR A;  3V99 A;  5C04 A;  3K0Z A;  1A8Y A;  3TJJ A;  2H76 A;  4NV5 A;  5ECQ B;  3O6T A;  2IWT A;  1VQK 3;  2REM A;  3A2W A;  2OAD A;  1NWW A;  3I56 3;  2LNS A;  4O32 A;  5JWO B;  2IPA A;  5FGO A;  3FHK A;  4PNF A;  1GNE A;  1QXH A;  5EQL A;  1Q4J A;  3C7M A;  2PVQ A;  2KP2 A;  1PGT A;  4GQC A;  2I4A A;  3LQ7 A;  3U6V A;  4FIW A;  2WFC A;  4HM7 B;  3RDW A;  2P0G A;  2Q07 A;  4QL7 A;  2W9Q A;  3TDG A;  1A2K A;  5EL8 A;  3IAS 2;  4YH2 A;  1T8E B;  4EYC A;  2GT5 A;  2DLX A;  4XDV A;  5IER A;  1Z5Y E;  3VK9 A;  1K8A 4;  4E8E A;  4KX4 A;  2CWU A;  1BG5 A;  1S3A A;  3GKM A;  1UUV B;  4IPB A;  3VI7 A;  2GVP A;  2F86 B;  2V6O A;  3BCK A;  3ZFL A;  3GMF A;  2HOH A;  2HT9 A;  3JUO A;  4DEJ A;  1YVS A;  5B8A A;  1USB A;  2RII A;  4FYC A;  2C3Q A;  2DKH A;  1K0D A;  3CU3 A;  3TKP A;  3GZX B;  1PQN A;  3S67 A;  1FHE A;  3LW9 A;  1EEJ A;  1QK8 A;  4MAB A;  1QAL A;  3LZA A;  1RGE A;  4KDX A;  2IME A;  3F6D A;  1YQ1 A;  1FOV A;  3CCJ 3;  4CJN A;  3WA2 X;  2IN3 A;  3M1G A;  1CEW I;  2ZDJ A;  4MPF A;  4KAE A;  1WPI A;  3NUV A;  3J7Y d;  3LYG A;  2VLV A;  5JPU A;  1K0C A;  3Q19 A;  5JWQ B;  2HLS A;  4K1F A;  5G31 A;  4WF5 A;  1RLS A;  2E2U A;  1QUW A;  3LYP A;  2PMT A;  4MJA A;  1OF5 B;  20GS A;  5CNW A;  2W03 A;  2QC7 A;  1QMV A;  2L59 A;  4K0G A;  1NHY A;  2FGX A;  3D5J A;  1BGS A;  3G16 A;  2H0I A;  3QAV A;  3U1W A;  1ROV A;  3CCE 3;  2AHE A;  3GTU B;  1YKC A;  3E99 A;  3CMI A;  5AYS C;  1SJ6 A;  2X8H A;  3H4K A;  4EW5 A;  5EVO A;  1V58 A;  2YWI A;  5ECN B;  1DYU A;  3TUE A;  2ZUP A;  5ECK B;  1OCV A;  2QKE A;  5ID2 A;  4ECI A;  4WYK A;  4GCI A;  2PUK C;  4ZM8 A;  4HM3 B;  1YJN 3;  2HYX A;  1M9B A;  1PY3 A;  1TRP A;  2WGO A;  1DUG A;  3GSP A;  3QPM A;  4GXZ A;  2N5B A;  4KUN A;  1B27 A;  3ZVJ D;  5FW5 A;  1E3R A;  3NHX A;  2PWJ A;  1PU4 A;  1NB5 I;  3AY8 A;  4MK3 A;  4ICY A;  1M2A A;  2L5O A;  3SLU A;  3A2V A;  4TW5 A;  4MNN A;  2XEP A;  2AAE A;  2FWF A;  4WBJ A;  3EC9 A;  2KF5 A;  5A0O B;  3O8Y A;  2CG1 A;  1ILO A;  2C0G A;  4WR5 A;  4RI6 A;  4AJ7 A;  3I43 A;  1TOF A;  2D1W A;  5H5R A;  5AIX A;  4LYL B;  2PNC A;  1Z6N A;  5J41 A;  1BNR A;  1Q98 A;  3JUQ A;  2VCW A;  4K7N A;  10GS A;  1KTE A;  1O7P B;  1K0M A;  3NOF A;  5IMD A;  2P31 A;  1BUQ A;  5IMC A;  2H6Y A;  4HM0 B;  4N0Z A;  3S28 A;  4I8B A;  1RGG A;  4MZC A;  1RGL A;  4FYU A;  4FYB A;  1UDI I;  1KSI A;  1JLW A;  1W00 A;  2FXT A;  2CV4 A;  5E4W A;  3UJ1 A;  4D73 B;  4Z2R A;  1A2J A;  1AW9 A;  2GZY A;  3DML A;  4XM4 A;  1VQQ A;  2E2T A;  4HJM A;  3ZFZ A;  1SD9 A;  2VLT A;  4JR6 A;  1JV2 B;  5F05 A;  2OTL 3;  4L5O A;  3CSI A;  6STD A;  2WOF A;  1IK3 A;  2WZ9 A;  5IPH A;  1VQ8 3;  3HX8 A;  1F2E A;  8GSS A;  4I6X A;  4CCV A;  3ZTL A;  2KLX A;  3D5I A;  3VF1 A;  4WP5 A;  3HJP A;  1ISK A;  3UOM A;  1UI7 A;  2K9F A;  5CYY A;  2H73 A;  2M7O A;  8CHO A;  1O7G B;  2H66 A;  2CFW A;  1GSQ A;  1BX9 A;  3PIN A;  1ML6 A;  3DH2 A;  1YDK A;  2L1S A;  2O3O A;  1R5P A;  5IEN A;  2OE1 A;  1K28 A;  2HRA A;  2B5Y A;  3BIR A;  5KP3 A;  1URM A;  3APO A;  2W56 A;  1ACV A;  3UMA A;  3WOF B;  4R9L A;  1XVW A;  2X8C A;  1GD3 A;  4N6N B;  1EKM A;  1O6J A;  3SX1 A;  3IPT A;  3CNM A;  2O85 A;  2Z77 A;  4MZB A;  1U6T A;  3F3Q A;  2KRT A;  4LGQ A;  1JNQ A;  3VLN A;  1Q86 4;  1O7M B;  1F8N A;  2F4Y A;  7GSS A;  3EBT A;  1RN4 A;  3KP8 A;  3Q2P A;  4N6V 0;  5DAL B;  3UEM A;  3HYP A;  1FZU A;  2P0M A;  3HK4 A;  4H3U A;  1BSD A;  2VAF A;  2CIU A;  3GHA A;  1PYL A;  2QSI A;  2SAR A;  4P3Y B;  1QVG 2;  1B8X A;  4XBT A;  2QA4 3;  2YNX A;  5ELA A;  4K6X A;  1FB0 A;  2H8L A;  2DJK A;  1D6U A;  1VF2 A;  2EIO A;  2NPB A;  4WF4 A;  6GSP A;  4BL2 A;  5A4W A;  4MJC A;  3HCZ A;  2UUG C;  1LBK A;  3FR3 A;  1M1X B;  5CRG A;  4N6L A;  2RBI A;  3OW2 2;  3CSH A;  3GRD A;  4MEI A;  3D79 A;  1IYI A;  2F8F A;  3KZT A;  2INX A;  2G0F A;  2MC8 A;  3FR6 A;  4K9Z A;  3KH9 A;  3H51 A;  2IMJ A;  2Z9S A;  2OA7 A;  3EU4 A;  3PZW A;  4HQS A;  3J7Y b;  4HUA A;  1PSQ A;  1AV4 A;  1YJW 3;  2LUS A;  2H01 A;  4WKW A;  2H19 A;  4A5P A;  2ON7 A;  1TFK A;  5G5F A;  2B24 B;  1X1U A;  1XWK A;  1UI8 A;  2DJ2 A;  2VD0 A;  3DVW A;  1QAF A;  4POL A;  4AJ8 A;  1EP7 A;  1L5G B;  1KBN A;  5AIH A;  5D82 A;  1NW2 A;  1UCK A;  3LSZ A;  3E0U A;  1JN5 B;  1C7H A;  2L6C A;  1GWC A;  1J0F A;  1O7H B;  2IMD A;  4TOP A;  5KN3 A;  1W01 A;  2FWE A;  5G1K A;  2CVD A;  3DEX A;  3S27 A;  1YVB I;  1NU3 A;  2CX0 A;  2OOV A;  1YZX A;  2IMK A;  4ZL9 A;  1OKD A;  1RTU A;  3PCR A;  2I1U A;  1K3L A;  2VM2 A;  3WA3 A;  3UVT A;  3ZG0 A;  1X9M B;  4ML1 A;  2BNG A;  2A4H A;  3OWU A;  2YP6 A;  4PQ1 A;  4L7K A;  1GTB A;  4KCE A;  4LSO A;  2DJ3 A;  1K3Y A;  3T8N A;  3CD6 3;  1GSY A;  1SL1 B;  3GRX A;  3KSE D;  2IUK A;  5B6M A;  2XGL A;  3S5C A;  3FG4 A;  4K1U A;  4N30 A;  1OAC A;  2NBS A;  2HNL A;  3GFK A;  4PEJ A;  1JZR A;  1JKG B;  2H74 A;  3SOA A; 
#chains in the Genus database with same CATH homology
 1XOB A;  4YQV A;  1XIY A;  4G10 A;  2GSS A;  1B48 A;  4JU5 A;  4QL9 A;  1ERW A;  4QQ7 A;  4HS1 A;  2GT6 A;  4EF0 A;  2H1A A;  4MPG A;  1HYU A;  2ZCT A;  3VWV A;  3H79 A;  3TRX A;  4V1A p;  2K6V A;  5LD0 A;  1XWA A;  4MF7 A;  4V2L A;  3EVI A;  5H5S A;  4BVX B;  3VUR A;  6GSU A;  1G0T A;  3KH7 A;  2PU9 C;  4MCU A;  5JWR B;  5IMZ A;  4IEL A;  3F4S A;  2D2Z A;  2V32 A;  4MA9 A;  2VLU A;  1XWG A;  3KIJ A;  3SBC A;  1BQ7 A;  1I9D A;  3D22 A;  3LJR A;  2H0H A;  2IYJ A;  4L5L A;  2YAN A;  2LJK A;  2UZ8 A;  2KHP A;  3F63 A;  2L4Q A;  2FD3 A;  4FO5 A;  2H0G A;  4DVC A;  1X0R A;  3DVX A;  4H86 A;  4N10 A;  3U5R E;  3TKS A;  3ME7 A;  1VF4 A;  2LJR A;  3LYK A;  1O81 A;  2RM6 A;  4K2X A;  3A2X A;  4F0C A;  5L71 A;  1ZYN A;  2YPM A;  3D21 A;  4IQ1 A;  4PQI A;  3APS A;  4Z2U A;  4EIQ A;  4MDC A;  3Q74 A;  4TXO B;  4EKZ A;  5D9X A;  3TB2 A;  2AAW A;  1TU8 A;  2JL4 A;  1ABA A;  2C1Y A;  2PER A;  4OCF A;  2C4J A;  4I5Q A;  2E2G A;  3CRU A;  3KXO A;  3QAG A;  5JCW A;  1M7T A;  3BJ5 A;  2O89 A;  4JE1 A;  2VCX A;  5A4V A;  2B7K A;  1ZMA A;  1ZYE A;  2B7J A;  1TI3 A;  4GF0 A;  4TR3 A;  1LJR A;  4TR1 A;  3L9U A;  4LLR A;  4JZQ A;  3ZFB A;  5IOX A;  4O92 A;  5IMA A;  3IBH A;  2R4V A;  3GKK A;  1TKD B;  3ZLP A;  2MYG A;  2VL2 A;  4DSS B;  1ZGN A;  2YWO A;  4BVY A;  3FR9 A;  1OC9 B;  3F3R A;  1EP8 A;  1AQW A;  5ECL B;  5GAN D;  3IR4 A;  5JCG A;  1H4O A;  4KSO A;  3CRT A;  4EDZ A;  3DYR A;  2R6K A;  4OO5 A;  1G6W A;  2DML A;  3F0I A;  5IIZ A;  2X99 A;  5G30 A;  5EY6 A;  1G6Y A;  2IFQ A;  2JAC A;  4K2D A;  2YJH A;  5FHI A;  3TCO A;  1VGL A;  1GSD A;  5J3R A;  2CVB A;  3CSJ A;  3IRA A;  1R26 A;  4ZBA A;  5C00 A;  1Z9H A;  3HKR A;  5HR2 A;  2WB9 A;  5DJL A;  4YAV A;  3ZVJ A;  5GZZ B;  1XZO A;  3KCM A;  3WYW A;  3FZA A;  3D0Z A;  3GA4 A;  1JFU A;  2CAI A;  1AIU A;  4X43 A;  2C3N A;  1KEB A;  3M8N A;  1V40 A;  3BCI A;  5G1L A;  2F51 A;  5DJM A;  2HSM A;  1TXX A;  4ZB9 A;  3KMO A;  1AXD A;  1U3A A;  3TJF A;  1Y25 A;  4ZL7 A;  2RUE A;  2XBI A;  3G7J A;  2IMF A;  1GSE A;  1SD8 A;  2LS5 A;  3ZL5 A;  1MD3 A;  2KP1 A;  5J5N A;  1O7U A;  2YZH A;  1XOA A;  1NM3 A;  1TDI A;  1Z6M A;  2J23 A;  1MEK A;  5KN2 A;  2X8G A;  2V6K A;  4O7H A;  1MDI A;  1OE8 A;  1NSW A;  4JR4 A;  2AYT A;  5F06 A;  2HZF A;  2WGR A;  2NTO A;  4JRR A;  5DBQ A;  3H1N A;  2B6M A;  3MDK A;  4EXJ A;  2RUF A;  4POK A;  4ML6 A;  4ID0 A;  3WT1 A;  1FO5 A;  5B8B A;  1FVK A;  2HZE A;  1X5E A;  2OAC A;  2CAQ A;  4HU9 A;  4J2F A;  3KMN A;  2GTU A;  2QA2 A;  4BWQ A;  2LRC A;  1EGR A;  3GN3 A;  5DVB A;  3S9F A;  1ERV A;  5COH A;  4CY6 A;  4YKF A;  2B3S A;  2R37 A;  2IMI A;  2P5R A;  1GSF A;  1W4V A;  4YQM A;  4GWR A;  1OC8 A;  4TRX A;  2DJ1 A;  3K8N A;  2H71 A;  2R0P A;  3A5W A;  2LRT A;  2AV4 A;  1ERU A;  1XFL A;  1TK0 B;  2QGV A;  4IJ3 A;  3NIV A;  2JZS A;  3EU3 A;  5HFI A;  4J57 E;  4TXV A;  4ZIJ A;  4KND A;  4MMM A;  6GSS A;  1F3B A;  3Q18 A;  1X9S B;  2VOC A;  1VF1 A;  6GSY A;  1ZZY A;  3QD9 A;  4EVM A;  1SKS B;  2GLR A;  4OFM A;  3PPU A;  5EPF A;  2I3Y A;  6GSV A;  4MP4 A;  3WT2 A;  4G0I A;  4LMV A;  2FUG 2;  1JLV A;  1Z7R A;  5F8B A;  2N5F A;  4EL1 A;  2P5Q A;  2GZZ A;  1C72 A;  4LL1 B;  3PGT A;  1M9A A;  2VIM A;  3P2A A;  2EIR A;  2H1D A;  4Q5F A;  1A0F A;  5J9B A;  22GS A;  4NPB A;  1TU7 A;  3F4R A;  1MTC A;  4ULX A;  1M99 A;  1EV9 A;  6GSW A;  3CBU A;  1E2Y A;  5BMU A;  1TTZ A;  1WRY A;  3MIX A;  1HD2 A;  3EE2 A;  3CTF A;  1XPV A;  5D8I A;  4ZB8 A;  2FLS A;  1OKT A;  1GRX A;  4XRD A;  1B4P A;  4BA7 A;  1ZCP A;  2PN8 A;  2C8U A;  1YKA A;  3TRP A;  3P90 A;  3PR8 A;  11GS A;  1SJZ A;  3MSZ A;  5E59 A;  2LRN A;  4PXO A;  2M80 A;  4OFT A;  5D93 A;  4E8H A;  4XS1 A;  3FZ9 A;  3GST A;  3R2Q A;  2KOK A;  3EYT A;  5FT3 A;  5DAK A;  3HJO A;  2QA1 A;  1Z7P A;  4ECC A;  1WMJ A;  4AJ6 A;  1PKZ A;  2GDR A;  5ID2 B;  5CP1 A;  4IS0 A;  1UN2 A;  2GSQ A;  4KF9 A;  2MBT A;  2ZNM A;  4LL4 B;  1OYJ A;  4OMV A;  1GP1 A;  3O3T A;  2LST A;  3GNJ A;  2HSH A;  4X4J A;  1F6M C;  4PTS A;  4CHS A;  3FY7 A;  1DE1 A;  1T1V A;  2YV7 A;  1EV4 A;  3DWV A;  1UVZ A;  1GUK A;  3LWA A;  4XS4 A;  3P7X A;  3UAP A;  1PN0 A;  3W6G A;  2EC4 A;  4O5R A;  1T00 A;  4X0X A;  3KEB A;  4MLY A;  3MWH A;  2LNT A;  3F9U A;  2R2J A;  4GLT A;  1YF1 A;  1U87 A;  4IN0 A;  14GS A;  3TGZ A;  2FWH A;  5KOX A;  4OFN A;  3RPP A;  4KSM A;  2MMA A;  5DDL A;  2YOI A;  2IY2 A;  2FWG A;  1CQG A;  16GS A;  3DGQ A;  5GST A;  5ELG A;  1M2B A;  1A23 A;  2DKI A;  4K8M A;  1XW5 A;  2YJ7 A;  2DIY A;  3US3 A;  3FKF A;  2AB6 A;  3QDN A;  3TRQ A;  3WGX A;  5IQY A;  3GUR A;  5F0G A;  5D73 A;  4BPY A;  1N2A A;  2K18 A;  1ON4 A;  4TR4 A;  5AIV A;  5ECH B;  1PX7 A;  2XBQ A;  3PH9 A;  1XCC A;  1G7E A;  2J9H A;  4NAX A;  3D4M A;  1PRX A;  4N0V A;  2OJL A;  3GX8 A;  2WJU A;  4X1U A;  2H30 A;  2HRK A;  4XS6 A;  5IM9 A;  1FB6 A;  1UC7 A;  3ERF A;  2GQM A;  4KH7 A;  1BYE A;  6GSX A;  4HQZ A;  3KTL A;  1SK1 A;  4N11 A;  3E3E A;  1X5D A;  3C1R A;  4I97 A;  4ZXG A;  2OBK A;  4ZB6 A;  3HVX A;  1AAZ A;  3IV4 A;  1RQM A;  4WXT A;  1V98 A;  4I2U A;  4PNG A;  1I5G A;  4TN8 A;  1FG4 A;  1ZYP A;  4OO4 A;  3GV1 A;  3L9S A;  4KCA A;  2BMX A;  4EE0 A;  3TKS E;  3VFI A;  4NV2 A;  1V2A A;  2JSY A;  1WJK A;  3L4N A;  2FHE A;  3FZ5 A;  4G19 A;  3VPT A;  3ZYW A;  4IGJ A;  2WRT A;  3HVS A;  1JZD A;  5J4U A;  3EWL A;  3UIW A;  1A0R P;  2B5X A;  4RUV A;  2F8A A;  2MZC A;  4IP1 A;  2H1G A;  1PA3 A;  2JU5 A;  1PL1 A;  2X49 A;  1ZYQ B;  3E9J B;  1THX A;  3HJM A;  2L57 A;  5FWG A;  3L9V A;  2C80 A;  4V1A g;  1ST9 A;  2M72 A;  3M0F A;  1V9W A;  1S3D A;  5G2Z A;  3FZ4 A;  5AN1 A;  5KOW A;  1OAZ A;  5JCU A;  5DQY A;  3CYN A;  2CVK A;  4HEA 2;  2CZ3 A;  5HR0 A;  3HHV A;  3EPT A;  4HU7 A;  2B1K A;  1K0O A;  3ZIJ A;  4TKY A;  3A5I A;  1SYX A;  3KM6 A;  1J9B A;  3ZIT A;  4O5U A;  1PD2 1;  2OE3 A;  1FAA A;  3GH9 A;  2ALB A;  3ZIV A;  4F9Z A;  1W89 A;  17GS A;  2WS2 A;  1AQX A;  1ERT A;  1Y6E A;  1PN9 A;  1U3I A;  3ZRE A;  1PX6 A;  3D4T A;  2E0Q A;  4PX1 A;  3W8S A;  2MMN A;  2L6D A;  4KE3 A;  4L8E A;  2VO4 A;  3IPZ A;  2MMO A;  4EC0 A;  1WP0 A;  4YQU A;  5D9W A;  3ZRD A;  1OVN A;  1EWX A;  1EOG A;  1GTI A;  4HZ2 A;  5IO0 A;  3CXG A;  3V1W A;  3ERG A;  3EC3 A;  2LTK A;  4IBP A;  2LV3 A;  1NHO A;  3Q6O A;  3IE3 A;  4GST A;  1ZOF A;  2YN1 A;  1XBS A;  1S3C A;  2E7P A;  1EEM A;  2V1M A;  4J56 E;  3IK9 A;  2DJJ A;  5D9V A;  2GGT A;  3IK7 A;  5DCG A;  1GUL A;  1U88 A;  5B6N A;  1WE0 A;  2V41 A;  3IHG A;  4Z7X A;  3KJY A;  1SKR B;  3BD2 A;  4Q5R A;  4IQA A;  1O85 A;  2WUL A;  5IOW A;  4BL7 B;  3F6F A;  1F9M A;  3LGC A;  5CRD A;  1GSS A;  2TRX A;  4EDY A;  4EUY A;  5ECR B;  3C71 A;  3HZ8 A;  5AIS A;  5KN0 A;  4MJB A;  2NDO A;  1TJD A;  3LXZ A;  4HOJ A;  2GSR A;  1A2L A;  1PMT A;  2R0C A;  1HNA A;  2K8V A;  4TR1 B;  2PGT A;  4NHZ A;  3GL5 A;  2A2R A;  1WOU A;  3VWX A;  4OD7 A;  3I69 A;  3DD3 A;  2JZR A;  4IP6 A;  4MF6 A;  5GAP D;  1MDK A;  4CDO A;  4KA0 A;  4BVY B;  3ME8 A;  4G0K A;  5CO3 A;  3VPQ A;  2I81 A;  1EOH A;  5ECI B;  3HXS A;  4RQR A;  4WET A;  3QR6 A;  1SL2 B;  1T4Z A;  3GKN A;  1K0B A;  2C0E A;  3GTU A;  4KDU A;  5HR3 A;  3RAZ A;  3TJK A;  3LG6 A;  2M46 A;  3N9J A;  1SK0 A;  2IFQ B;  4WR4 A;  1BAY A;  1SYR A;  3DIE A;  2CA8 A;  1A8L A;  1TRV A;  1THO A;  2L5L A;  5IPG A;  2DC5 A;  5KN1 A;  4BWS A;  1YY7 A;  2LEG A;  4AF2 A;  2XPD A;  1GLP A;  4GSN A;  1HQO A;  1FW1 A;  3LOR A;  3GIX A;  19GS A;  3IXR A;  1H75 A;  1QQ2 A;  4HI7 A;  3VWW A;  3JCM L;  5HFG A;  2GST A;  1T3B A;  4Q5Q A;  2A2S A;  4AGS A;  3HD5 A;  1O8X A;  5ECP B;  1FOH A;  1HNC A;  1BED A;  4TVE A;  2VCT A;  2OKA A;  4JED A;  3GH6 A;  1XWC A;  3QMX A;  2F9S A;  3C8E A;  4F03 A;  1GL8 A;  3M9K A;  4XCS A;  3DXB A;  2HRN A;  2A2P A;  5CRE A;  3MYD A;  3MAK A;  1CQH A;  4D73 A;  4JBB A;  4OCE A;  3TKQ A;  5F07 A;  2G2Q A;  1R4W A;  3F4T A;  3IDV A;  4OWY A;  1MDJ A;  4MF5 A;  3FRC A;  3EMX A;  2H6X A;  2YCD A;  4K0N A;  4NXI A;  3IC8 A;  3NZN A;  3HDC A;  2FNO A;  6GST A;  1GUH A;  3G7Y A;  1GH2 A;  3F8U A;  2OBI A;  2JSZ A;  2MBS A;  4EIP A;  2FA4 A;  4NWY A;  2JAD A;  2VL9 A;  2HZE B;  1FVJ A;  4F2I A;  4HDE A;  1XVQ A;  2A4V A;  5LNK e;  4YKG A;  1XW6 A;  2H75 A;  3DKS A;  3H93 A;  4MZW A;  2YZU A;  1J08 A;  4LA1 A;  5DAL A;  2F3M A;  2O8V B;  1DSB A;  1TRW A;  1G7O A;  3O76 A;  5HQP A;  2HFD A;  2FA8 A;  1GTA A;  3WD6 A;  4LMW A;  1TRS A;  1XXU A;  2FCH A;  4XTS A;  1VRS D;  2H70 A;  4YAP A;  5DQS A;  3VWU A;  1SEN A;  5ECS A;  3IOS A;  4ISD A;  2C0D A;  2CQ9 A;  2WDU A;  4G0L A;  2GQK A;  2GQL A;  3I9V 2;  1MD4 A;  2X4A A;  3ISO A;  3GKX A;  3LEF A;  5IMF A;  5LCZ A;  3FEU A;  1SKW B;  3M3M A;  5INY A;  4PGT A;  5B7C A;  4ECJ A;  2HE3 A;  1TW9 A;  1GSU A;  3RBT A;  3ZMK A;  1JZO A;  2HRF A;  3H8Q A;  1T4Y A;  1SJI A;  4POB A;  3R3E A;  4FQU A;  1JZW A;  4XIH A;  2I9H A;  1K0A A;  1WWJ A;  3C1S A;  2EIQ A;  2N5A A;  1OE7 A;  2VCV A;  2O87 A;  3BBY A;  3FW2 A;  4IVF A;  4ZBB A;  4EO3 A;  5CRH A;  2IL3 A;  3QCP A;  3QFA C;  5CAX A;  4XRA A;  4ACS A;  1YJ6 A;  2LJA A;  1K3O A;  4K5S A;  4MH3 A;  3TOT A;  3VI5 A;  1K0N A;  2BTO T;  2IJY A;  3GX0 A;  4IJI A;  3W8J A;  4RI7 A;  3ZML A;  3KTB A;  2DIZ A;  4K7O A;  2TRC P;  3ZZX A;  3IHQ A;  4G9H A;  4GTU A;  3WGD A;  4PQH A;  2OE0 A;  2X64 A;  5DAK B;  5H5Q A;  3GUS A;  1A2M A;  4RQX A;  2IIY A;  4BVX A;  2WCI A;  1TK8 B;  13GS A;  1WIK A;  4Q5N A;  1YF0 A;  1AUC A;  2DBC A;  1R5A A;  2DJ0 A;  3HVV A;  3QFB C;  4L0W A;  4GSS A;  2V2G A;  4CW9 A;  4IW9 A;  2H6Z A;  1LU4 A;  2VD1 A;  1M0U A;  1RW1 A;  4DSQ A;  2HSY A;  1EZK A;  1DBY A;  5ENU A;  3OR5 A;  2XC2 A;  1M2D A;  2ES7 A;  2VL3 A;  4XS4 B;  3GSS A;  2DSA A;  1A24 A;  2L4C A;  1GNW A;  1SL0 B;  3KP9 A;  4TXO A;  1KNG A;  4G2E A;  3TOU A;  2TIR A;  3DRN A;  4ZBD A;  9GSS A;  1F37 A;  2DMM A;  1AQV A;  3APQ A;  4L0U A;  3UVH A;  1BJX A;  1HNB A;  1GLQ A;  2LQO A;  2PVO C;  4HJ2 A;  2AUV A;  2CZ2 A;  1N8J A;  1B4Q A;  1TK5 B;  4KW6 A;  3QAW A;  5D9T A;  1Z3E A;  1AC1 A;  3IC4 A;  5ECO B;  3FMW A;  2YWM A;  3TJB A;  3TKS C;  18GS A;  3EIN A;  4Z2T A;  3CTG A;  3LFL A;  1PL2 A;  3ERW A;  4KGI A;  5KEJ A;  4MH2 A;  3UL3 A;  1UA5 A;  4GQF A;  4I2T A;  4WBR D;  1TP9 A;  4NMU A;  3UBK A;  4DSS A;  1QFN A;  1O8W A;  1OC9 A;  3ED3 A;  2HXK A;  3C73 A;  4WEY A;  3HY2 A;  4CY8 A;  4O5Q A;  2JZT A;  2CX4 A;  3TJG A;  3BOA A;  1V57 A;  4V2N A;  2XPE A;  4USS A;  5GSS A;  1QGV A;  1F3A A;  2GZP A;  2VM1 A;  2R3X A;  4PUR A;  1O73 A;  2PPT A;  2ON5 A;  3RPN A;  1SK2 A;  2VL2 C;  1OC3 A;  5A4U A;  4POM A;  4ILF A;  4BL7 A;  5IO2 A;  2LQQ A;  4ZL8 A;  5DCH A;  1YEP A;  3LXT A;  5G5E A;  2CX3 A;  2BJX A;  2R5G A;  2RLI A;  4V2M A;  4KDY A;  2VCQ A;  4GRF A;  5CRW A;  2YWN A;  5HFK A;  2PBJ A;  3EMP A;  3G9B A;  2FY6 A;  2R0G A;  3G7I A;  5A5K A;  5AGY A;  3EUR A;  4K5R A;  1X9W B;  2E2M A;  2MMZ A;  4HZ4 A;  3TKR A;  3HZ4 A;  4IHU A;  3GYK A;  5BRT A;  1R7H A;  4K7I A;  2RM5 A;  1TRU A;  3J7Y k;  3FK8 A;  1XW9 A;  3UBL A;  4NHW A;  2YV9 A;  2B5E A;  1T7P B;  3MNG A;  2CT6 A;  3A3T A;  3P8W A;  5ABR A;  2NVL A;  12GS A;  2O7K A;  2VCZ A;  5IMV A;  4KB3 A;  2AJQ B;  2B1L A;  3HA9 A;  2LKU A;  1VF3 A;  4F82 A;  2C3T A;  4XHM A;  2VUP A;  4F0B A;  1PKW A;  1B9Y C;  1GUM A;  3GL3 A;  3RHC A;  2K8S A;  1XWB A;  3M9J A;  5HR1 A;  4IKH A;  4ZIL A;  4PUA A;  2KUC A;  3KD0 A;  1JHB A;  2C0F A;  3KGK A;  2GS3 A;  1GTU A;  5J9C A;  3RHB A;  1IYH A;  1B9X C;  3L0H A;  4MJE A;  3IA1 A;  3IAM 2;  3WGE A;  1ZL9 A;  3SWL A;  1E6B A;  5ECM B;  3KZQ A;  2H72 A;  1RK4 A;  4ECB A;  1SU9 A;  2H1B A;  5D96 A;  3FYG A;  4PUF C;  1DE2 A;  1EGO A;  3I6A A;  3D6I A;  3QOU A;  4DSR A;  1YEX A;  1X5C A;  1TI1 A;  2XHF A;  2HI7 A;  4FH8 A;  3L78 A;  3N5O A;  4TR0 A;  3UAR A;  5C04 A;  3TJJ A;  1A8Y A;  2H76 A;  4NV5 A;  5ECQ B;  3O6T A;  2IWT A;  2REM A;  3A2W A;  2OAD A;  5JWO B;  2LNS A;  4O32 A;  2IPA A;  3FHK A;  4PNF A;  1QXH A;  1GNE A;  1Q4J A;  3C7M A;  2PVQ A;  2KP2 A;  1PGT A;  4GQC A;  2I4A A;  3LQ7 A;  3U6V A;  4FIW A;  2WFC A;  3RDW A;  2P0G A;  4QL7 A;  3TDG A;  5EL8 A;  3IAS 2;  4YH2 A;  1T8E B;  2GT5 A;  2DLX A;  1Z5Y E;  3VK9 A;  4E8E A;  4KX4 A;  1BG5 A;  1S3A A;  3GKM A;  3VI7 A;  2GVP A;  2V6O A;  3ZFL A;  3BCK A;  3GMF A;  2HT9 A;  4DEJ A;  5B8A A;  1USB A;  2RII A;  4FYC A;  2C3Q A;  2DKH A;  1K0D A;  3TKP A;  1PQN A;  1FHE A;  3LW9 A;  1EEJ A;  1QK8 A;  4MAB A;  4KDX A;  2IME A;  3F6D A;  1YQ1 A;  1FOV A;  2IN3 A;  3M1G A;  4MPF A;  4KAE A;  1WPI A;  2VLV A;  1K0C A;  3Q19 A;  5JWQ B;  2HLS A;  4K1F A;  5G31 A;  4WF5 A;  1QUW A;  3LYP A;  2PMT A;  4MJA A;  20GS A;  5CNW A;  2QC7 A;  1QMV A;  2L59 A;  4K0G A;  1NHY A;  2FGX A;  3D5J A;  2H0I A;  3QAV A;  2AHE A;  3GTU B;  1YKC A;  3CMI A;  1SJ6 A;  2X8H A;  3H4K A;  5EVO A;  1V58 A;  2YWI A;  5ECN B;  3TUE A;  2ZUP A;  5ECK B;  2QKE A;  5ID2 A;  4ECI A;  4GCI A;  2PUK C;  2HYX A;  1M9B A;  1DUG A;  3QPM A;  4GXZ A;  2N5B A;  4KUN A;  3ZVJ D;  2PWJ A;  3AY8 A;  4MK3 A;  4ICY A;  1M2A A;  2L5O A;  3A2V A;  4TW5 A;  4MNN A;  2FWF A;  4WBJ A;  1ILO A;  2C0G A;  4WR5 A;  4RI6 A;  4AJ7 A;  3I43 A;  1TOF A;  5H5R A;  5AIX A;  1Z6N A;  5J41 A;  1Q98 A;  2VCW A;  4K7N A;  10GS A;  1KTE A;  1K0M A;  3NOF A;  5IMD A;  2P31 A;  5IMC A;  2H6Y A;  4N0Z A;  4I8B A;  4MZC A;  4FYU A;  4FYB A;  1JLW A;  2CV4 A;  5E4W A;  3UJ1 A;  4D73 B;  4Z2R A;  1A2J A;  1AW9 A;  2GZY A;  3DML A;  4HJM A;  1SD9 A;  2VLT A;  4JR6 A;  5F05 A;  4L5O A;  3CSI A;  2WZ9 A;  5IPH A;  1F2E A;  8GSS A;  4I6X A;  3ZTL A;  2KLX A;  3HJP A;  3UOM A;  2K9F A;  5CYY A;  2H73 A;  2H66 A;  1GSQ A;  1BX9 A;  3PIN A;  1ML6 A;  1YDK A;  1R5P A;  2OE1 A;  2HRA A;  2B5Y A;  3UMA A;  1URM A;  3APO A;  1ACV A;  1XVW A;  2X8C A;  1O6J A;  2O85 A;  4MZB A;  1U6T A;  3F3Q A;  3VLN A;  7GSS A;  3KP8 A;  5DAL B;  3UEM A;  3HYP A;  2VAF A;  3GHA A;  2QSI A;  4P3Y B;  1B8X A;  2YNX A;  5ELA A;  4K6X A;  1FB0 A;  2H8L A;  2DJK A;  1VF2 A;  2EIO A;  2NPB A;  4WF4 A;  5A4W A;  4MJC A;  3HCZ A;  1LBK A;  3FR3 A;  5CRG A;  3CSH A;  1IYI A;  2F8F A;  2G0F A;  3FR6 A;  4K9Z A;  3KH9 A;  4HQS A;  2Z9S A;  2OA7 A;  3EU4 A;  3J7Y b;  4HUA A;  1PSQ A;  2LUS A;  2H01 A;  4WKW A;  2H19 A;  4A5P A;  2ON7 A;  5G5F A;  1XWK A;  2DJ2 A;  2VD0 A;  3DVW A;  4POL A;  4AJ8 A;  1EP7 A;  1KBN A;  1NW2 A;  3LSZ A;  3E0U A;  2L6C A;  1GWC A;  1J0F A;  2IMD A;  4TOP A;  5KN3 A;  2FWE A;  5G1K A;  2CVD A;  3DEX A;  1YZX A;  2IMK A;  4ZL9 A;  1OKD A;  2I1U A;  2VM2 A;  1K3L A;  3UVT A;  1X9M B;  4ML1 A;  2A4H A;  2YP6 A;  4PQ1 A;  1GTB A;  4KCE A;  2DJ3 A;  1K3Y A;  1GSY A;  1SL1 B;  3GRX A;  5B6M A;  4N30 A;  2NBS A;  2HNL A;  3GFK A;  1JZR A;  2H74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...