1V57A

Crystal structure of the disulfide bond isomerase dsbg
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v57A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v57A03
1BJXA 1O8XA 3WGEA 4DVCA 2JACA 2XBIA 2X8GA 2LRTA 4X1UA 4ISDA 5KN1A 3WYWA 1QUWA 4J56E 4GLTA 4DEJA 1VF3A 4J57E 4TR1A 3KD0A 5ECSA 1WIKA 2YJ7A 2H0IA 5C00A 2LJRA 4N10A 1PX7A 5ECHB 3EC3A 3UMAA 5G31A 2B1KA 1E2YA 3ME8A 5GSSA 3M8NA 4OCEA 3D22A 1X5DA 4EC0A 2CVKA 2P5QA 1UC7A 3F0IA 3BCIA 3HZ8A 4OFNA 4HUAA 3FKFA 2CX3A 2DJ3A 1USBA 2ZNMA 2YV9A 2E0QA 5EL8A 3MAKA 2JZRA 3GMFA 5IMAA 3QAGA 2HT9A 4NV2A 4EDYA 1IYHA 1NHOA 3FY7A 2FA4A 3GL3A 3ZL5A 2F9SA 1WWJA 2TRCP 3QAWA 3I9V2 1TTZA 1BQ7A 1XZOA 3DKSA 4WR4A 18GSA 3LEFA 2HXKA 2VIMA 1T4YA 22GSA 4TRXA 4N30A 3LYPA 4MLYA 2XPEA 3QOUA 3EURA 2IY2A 2KOKA 2VL2C 1B9XC 3O3TA 2VCTA 3BCKA 3UJ1A 3DVWA 5IMCA 2FD3A 3S9FA 3IK7A 4KA0A 2KUCA 1K0MA 2RUFA 4XIHA 4NPBA 1O85A 2PERA 4MZBA 4LL4B 3F63A 5B8BA 4IQAA 5IQYA 2OJLA 3KMNA 5DALB 1HNBA 2R4VA 3HHVA 4HQZA 1X9WB 3TKSC 3KP8A 3VWXA 2GQKA 2FNOA 1XVWA 3HVXA 3TKSE 3H1NA 4F0BA 10GSA 1JHBA 3C8EA 4V2MA 2LTKA 1PKZA 1R7HA 5JWQB 2C3TA 2I9HA 1B48A 4ZL8A 2I3YA 2PWJA 5D96A 3FK8A 4L8EA 3CSIA 4K2DA 1MDJA 4GSNA 2L5OA 3UAPA 1EEJA 2DJKA 3APQA 1TRSA 2V2GA 2NBSA 3LFLA 3L9VA 4O92A 3KZQA 5D73A 3UL3A 1PKWA 3FZ5A 3BD2A 5IMFA 2IFQB 5J9BA 3TJJA 1T4ZA 2YWNA 4RQRA 2PBJA 3BOAA 4F82A 4POBA 4DSSA 3GKMA 3WGDA 1IYIA 3Q74A 3C7MA 1SU9A 1V58A 5DBQA 1VGLA 4XHMA 3AY8A 3L78A 1K0CA 2XHFA 2EIRA 4GSSA 1N8JA 1EV9A 5FT3A 2YWOA 2H1AA 3W6GA 2AUVA 3MDKA 2WCIA 1XWBA 1YEXA 4WR5A 2OE3A 5GZZB 3GSSA 2BMXA 3CYNA 1R4WA 3QCPA 1TRUA 3FR9A 3PINA 2VLUA 4JBBA 4GCIA 2H75A 3EMXA 2MBTA 4XS6A 1KTEA 2F51A 4KCAA 1HD2A 3IXRA 1EOHA 4K0NA 2FWFA 2CX4A 2GQLA 3DYRA 1M2DA 1SL1B 3EE2A 4TR1B 3HCZA 5ECPB 4O5RA 1GNEA 2VD1A 2WJUA 1F6MC 1OAZA 5IIZA 3VK9A 5KN2A 2IMDA 4MA9A 5F8BA 4ZBAA 1ERUA 4XS4A 1TI1A 2F3MA 4BL7A 4E8HA 2ZCTA 3M9JA 4D73B 2YN1A 3O76A 4JEDA 5FHIA 3ZIJA 1X9SB 4MF5A 1B9YC 1EZKA 3I6AA 3QD9A 3KM6A 1CQGA 1BYEA 2WS2A 5HQPA 1K0DA 3P7XA 3GH9A 1X5EA 4JE1A 3D4MA 4H86A 1WMJA 5D9WA 4GF0A 2VCZA 3ZYWA 3GV1A 4KDXA 2OE0A 3VI7A 3EMPA 3DGQA 3HVVA 3VFIA 3HJPA 4Q5FA 1YJ6A 4XS1A 4TR4A 5J9CA 2VAFA 1JZRA 4MMMA 2JADA 4ID0A 2EC4A 5ECIB 3VI5A 4KB3A 5EVOA 1ERWA 4TXVA 6GSXA 2AB6A 4HOJA 3IAM2 3NZNA 2LRNA 2HZEB 3KP9A 1JFUA 2E2MA 2OACA 2CAQA 2G2QA 2AAWA 3ZMLA 4MJCA 1THXA 4TR3A 1WOUA 1AQWA 1ST9A 3DRNA 1UA5A 1QXHA 3Q18A 5AIXA 2QGVA 4YQMA 4IKHA 5AISA 4Z7XA 1K3OA 3APOA 3FZ9A 3IA1A 17GSA 8GSSA 4IBPA 1BG5A 3ISOA 2JSYA 5ELGA 5A4UA 2IYJA 4K7IA 2RM5A 3BBYA 4JU5A 1ZCPA 1SL2B 2MMAA 3IV4A 1K0BA 1BAYA 3C73A 4E8EA 4FH8A 5CNWA 2O7KA 2TIRA 4HS1A 2NVLA 1XOBA 3TJGA 5A4VA 1ERTA 2WGRA 1YKAA 4IGJA 3DMLA 3TJFA 1A24A 2PVQA 1FAAA 3GN3A 5ABRA 2PU9C 1GLQA 2OE1A 4PX1A 6GSYA 2DJ1A 2E7PA 1ABAA 3F3QA 4F2IA 1OKDA 1WPIA 2ZUPA 6GSSA 5HFIA 4QL7A 2B5EA 4DSSB 3KEBA 1OC3A 5JWOB 2AJQB 2X99A 3UVTA 2HZFA 4FYCA 4IP6A 1WP0A 1MDIA 2N5AA 1AXDA 1GSYA 1TU8A 2FWHA 1XCCA 5ECMB 2HE3A 3NOFA 2K8VA 1TXXA 1JZOA 1KEBA 2H6YA 4EVMA 5HR1A 1SL0B 3DVXA 3FRCA 2HNLA 5HFGA 2PPTA 2AV4A 2V41A 4EE0A 4TN8A 5J4UA 3TGZA 2RUEA 3GUSA 1U6TA 2R3XA 4MK3A 1K0AA 4HEA2 2OA7A 2CVDA 4ZB6A 4P3YB 1YQ1A 1O6JA 1FG4A 2I81A 3U5RE 2C3NA 3WT2A 4ECCA 1GUKA 3GL5A 5DVBA 1TK8B 3HY2A 1OKTA 1XWCA 2GQMA 4PNGA 1AW9A 3MWHA 2DSAA 2YOIA 4GTUA 3LXTA 2F8AA 3VWVA 3IPZA 1RK4A 2H6XA 2B3SA 4IP1A 1M7TA 2C0EA 2H19A 3ZFLA 1MDKA 3WGXA 4PUAA 1TU7A 3R2QA 4OFTA 4RQXA 5HR0A 4OO4A 4EL1A 6GSUA 1SKRB 2FGXA 4XS4B 2GSSA 2GZYA 3M3MA 2OBKA 1V98A 1AUCA 1EP7A 1MD3A 3TOUA 2GSTA 3C1RA 3HYPA 5F06A 4QL9A 1PX6A 4IS0A 1ACVA 5J3RA 5IOWA 4ZILA 2VCVA 2DMMA 1FHEA 3GX0A 5CAXA 2H30A 1TK5B 2H71A 1JZWA 2N5FA 5E59A 2MMNA 5G2ZA 19GSA 5JCGA 1GUMA 1GSQA 3CRTA 4WKWA 1J0FA 4CDOA 1EWXA 1S3DA 4V1Ag 4KSMA 4ECJA 2E2GA 5LNKe 4K7NA 4IHUA 3TRQA 1HYUA 5D93A 3HKRA 2DLXA 3FEUA 3LYKA 1E6BA 2DBCA 4WBRD 4BWSA 5ECRB 4N0VA 2DMLA 1XWGA 3TB2A 1J08A 2O85A 3IC4A 4FIWA 4ZL9A 2C0GA 4V1Ap 3F3RA 3U6VA 3C1SA 5EY6A 3G9BA 1S3AA 3H4KA 1ZGNA 2NTOA 2R37A 3M9KA 3LWAA 2LNTA 3US3A 1PMTA 4AGSA 3L9UA 1YZXA 3CBUA 2BTOT 1NHYA 5AGYA 2H01A 2LRCA 4X0XA 4K7OA 5CREA 1TK0B 1C72A 5LD0A 3VLNA 4HDEA 2H1DA 3G7JA 3O6TA 3UVHA 2FY6A 3TJKA 2V6KA 4NXIA 2WDUA 1WRYA 1QK8A 4GQCA 1U87A 3PGTA 4KAEA 1SKWB 4MZCA 4WXTA 3HJMA 16GSA 3F4RA 3W8SA 1FOVA 2IMIA 3KH9A 2DIYA 1A2LA 4KNDA 3D5JA 5DAKA 1XOAA 2VL2A 1OE7A 2C4JA 3MSZA 3CMIA 1M2BA 1GULA 2VL9A 1HNAA 2YZUA 3UBLA 4LA1A 5GAND 2QSIA 1AC1A 5KN0A 2N5BA 4F0CA 1GSSA 1XXUA 1LJRA 3I69A 4MH2A 1Z9HA 7GSSA 2MBSA 4HJMA 1XWKA 1GSFA 1FO5A 1GH2A 2PMTA 2A2SA 5G5FA 4NAXA 3TKSA 2QKEA 3GNJA 2CZ2A 2H70A 1GLPA 5CRGA 2LJAA 1M2AA 2ON5A 2K9FA 1ZZYA 2KHPA 2C80A 1TJDA 2VCQA 4WBJA 3CSJA 3FR6A 4V2NA 2K6VA 1DUGA 2V1MA 3IAS2 1K3YA 1UN2A 2P5RA 5CRHA 4POLA 4X43A 2GSRA 2X64A 1RQMA 4HI7A 1AQXA 1DSBA 2YNXA 4ML1A 3GIXA 4HU7A 1DBYA 4G9HA 2YPMA 1RW1A 3ZRDA 4MF6A 4L5OA 3GSTA 4I5QA 4ZB8A 2B1LA 5D9TA 3RPNA 1MD4A 3F6DA 3FR3A 5H5QA 4MJBA 3QAVA 5COHA 2HSHA 4MABA 3J7Yb 4Q5RA 1HQOA 1I9DA 4TW5A 3EVIA 1ZL9A 3KGKA 3CSHA 4G2EA 2CZ3A 2KP2A 5D9VA 2HI7A 3LGCA 4GSTA 1Q98A 1SENA 3GKXA 4FYBA 1TDIA 3ZZXA 2ON7A 1Z6MA 5B7CA 3HZ4A 4L0UA 4HU9A 5F05A 1HNCA 3ERGA 3VPQA 4MPGA 1SJZA 4G19A 2IJYA 3KCMA 1B4PA 3GYKA 4IJIA 2OBIA 1U88A 2GDRA 2GZPA 3TJBA 4DSRA 2TRXA 4AJ6A 1T1VA 1U3AA 4FO5A 1JLWA 1A2MA 3LQ7A 4I2TA 4K8MA 5ECQB 2BJXA 2I4AA 2LQOA 4PNFA 2VO4A 1V9WA 2KLXA 5DDLA 3F6FA 5G1KA 5IMDA 4K1FA 1GP1A 3H8QA 1GRXA 1G7OA 2H6ZA 2XPDA 2H8LA 4RUVA 1OC9A 3E0UA 1SD9A 2H72A 4EKZA 5H5RA 2PVOC 2HFDA 1F3BA 4RI6A 1ZOFA 1F9MA 2GSQA 1M9BA 2VCWA 3IRAA 3GA4A 1MTCA 1T3BA 1K0OA 5DCHA 1FW1A 4BVYA 4KDUA 2EIQA 1XVQA 3KH7A 3DWVA 6GSWA 1VRSD 13GSA 5DALA 2MMOA 3DIEA 1AQVA 2J9HA 1X9MB 4IJ3A 3VWUA 4F03A 4Q5NA 2R2JA 3D21A 3DXBA 3F4SA 4TVEA 3DEXA 4CW9A 2GVPA 4TXOA 3A3TA 1PN9A 3M1GA 3D4TA 1ZYEA 3K8NA 5IPGA 3RDWA 1DE2A 2FLSA 2IMKA 2FA8A 1EGRA 3A2WA 3E3EA 4BWQA 1YDKA 1G6YA 4J2FA 3UOMA 4KW6A 2XC2A 2JZTA 2OADA 4LL1B 5ID2A 4ML6A 3WT1A 4YAPA 4GQFA 1PA3A 1FB0A 3RAZA 1GTAA 2IL3A 1SYRA 4FYUA 5DAKB 4NHZA 4HQSA 3RHCA 2YWMA 2M72A 2EIOA 3TUEA 3ZTLA 4F9ZA 4NV5A 1SYXA 4BVXA 1R26A 3N9JA 5IO2A 4MZWA 2VM2A 1K3LA 4NHWA 3NIVA 20GSA 2L4QA 5CYYA 1TP9A 2L6CA 2WRTA 2VL3A 3SBCA 2A2RA 4KUNA 4XRAA 2K18A 1XW5A 3LSZA 4IW9A 1PL2A 2NDOA 3GFKA 4KGIA 2P31A 2IN3A 4HZ2A 5ECNB 4O7HA 1TOFA 2L4CA 1G7EA 1AAZA 2RM6A 5GAPD 2LEGA 1Y25A 4PURA 3Q19A 2DJ2A 1NW2A 3CTFA 3APSA 3GTUA 3ZIVA 2F8FA 3HVSA 1UVZA 3UIWA 3RHBA 2B6MA 3TKQA 5DQYA 3ME7A 3QPMA 3UEMA 4MJAA 2V32A 1SK2A 2GLRA 3GH6A 2HRNA 3E9JB 4KDYA 5C04A 2X8CA 1JLVA 5B8AA 4MH3A 3PH9A 3LJRA 1G6WA 2IPAA 4XRDA 4KCEA 5AN1A 1GSUA 3V1WA 1GSEA 2X8HA 1BX9A 4I6XA 5DCGA 2LKUA 2REMA 1B4QA 2H74A 1Y6EA 1TW9A 3ZMKA 1H75A 4PXOA 4TR0A 5J41A 2B7KA 1EGOA 6GSTA 3TKPA 4OCFA 2YANA 1FVKA 2B5XA 3FYGA 1GWCA 2PUKC 4POMA 4D73A 3A5WA 4AJ7A 4YQVA 4ZIJA 3LORA 5JCWA 4CHSA 2JSZA 1ML6A 4YH2A 3LXZA 3D0ZA 4NMUA 3ZLPA 4TOPA 4O32A 3ERFA 2V6OA 2H76A 4ECIA 2YP6A 3JCML 5L71A 2O87A 3W8JA 2DJJA 1XFLA 1O73A 3IOSA 2GS3A 3QR6A 5KEJA 1NM3A 3ZVJA 2JL4A 1PRXA 2VLVA 2M80A 3QDNA 1YF0A 3CXGA 2H0HA 1TKDB 1B8XA 1OC9B 1T7PB 5B6NA 4IN0A 3F8UA 5IM9A 1GSDA 2HZEA 1AIUA 4WEYA 1QFNA 6GSVA 4GRFA 5D8IA 2C1YA 12GSA 1A0FA 3G7IA 1PSQA 4ZBBA 1EOGA 3ZFBA 1J9BA 2WZ9A 2VM1A 2HYXA 1EP8A 4PQHA 4V2LA 1R5AA 4MF7A 2YCDA 5F07A 1XW6A 5IMVA 4EDZA 2CQ9A 4N0ZA 1XIYA 4YAVA 2LSTA 4EUYA 2WULA 3HXSA 4IVFA 1THOA 4TXOB 4NWYA 4N11A 4ECBA 5A4WA 1H4OA 4KX4A 1V57A 4POKA 1Z7RA 1XBSA 2OKAA 2DIZA 3KTBA 2H1BA 3H79A 4I2UA 3A2XA 2IMFA 2LQQA 5ID2B 4BPYA 5IPHA 2YWIA 5CP1A 3L0HA 4ZBDA 2B7JA 1ILOA 3ED3A 4HZ4A 1VF1A 4EXJA 2PGTA 3GX8A 2DC5A 3FZ4A 2AHEA 5DJMA 2M46A 2LNSA 2P0GA 2VOCA 3GKKA 5HR2A 4WETA 4IQ1A 2VUPA 1V2AA 3HA9A 2Z9SA 2CVBA 2CV4A 1GTBA 3IHQA 3GHAA 4OWYA 3IBHA 1QGVA 4XCSA 1Z3EA 3P8WA 3TCOA 1A2JA 3F9UA 2RLIA 1A23A 3PR8A 2CA8A 2CT6A 2H0GA 1Q4JA 1T8EB 2IMEA 1PD21 2QC7A 5EPFA 1TI3A 3VPTA 4GWRA 2L6DA 3KTLA 2FHEA 2C3QA 1I5GA 4EO3A 3TRPA 1M99A 3GTUB 4MJEA 4PQ1A 3Q6OA 1XWAA 2IIYA 2H66A 1U3IA 2H73A 4OD7A 3ZVJD 9GSSA 1CQHA 4YQUA 1T00A 3EU3A 2YZHA 5DJLA 3H93A 3TDGA 5H5SA 1A8YA 4MDCA 1O8WA 2H1GA 2C8UA 4XTSA 1Z5YE 1ERVA 5B6MA 5ENUA 3I43A 3ERWA 3M0FA 2LV3A 3HDCA 1FVJA 3HJOA 1X0RA 2G0FA 2LS5A 2FCHA 3CRUA 2FUG2 2DJ0A 4WF5A 3TOTA 3FZAA 1W89A 2JU5A 2LJKA 1ZMAA 1M0UA 1Z6NA 2HSYA 1YY7A 3P2AA 3EINA 2MMZA 1EV4A 3D6IA 3MNGA 3P90A 2VD0A 5IO0A 3TKRA 5A5KA 2YV7A 1SJIA 4DSQA 5LCZA 3KMOA 1JZDA 4AJ8A 3SWLA 1OC8A 3FW2A 1F3AA 4GXZA 1GL8A 2HRFA 1S3CA 2D2ZA 4LMWA 5IMZA 3UBKA 2AYTA 1GNWA 4Q5QA 5JCUA 1XPVA 1SK1A 3QFBC 3UARA 1PL1A 3ZREA 2ALBA 4G10A 2O8VB 3DD3A 4QQ7A 14GSA 1X5CA 2IWTA 3LG6A 4KSOA 5ELAA 2FWEA 1SKSB 3IDVA 1OVNA 11GSA 1PGTA 4K6XA 1YKCA 3L9SA 4ACSA 3N5OA 1QQ2A 2ES7A 5CO3A 1GTIA 4TKYA 3ZITA 1SD8A 2R6KA 2C0FA 1R5PA 2RIIA 1O7UA 1WE0A 3QFAC 4L5LA 3GRXA 4WF4A 1VF2A 1K0NA 1A0RP 2GZZA 3QMXA 3F4TA 3IE3A 2GT6A 1KBNA 2YJHA 1A8LA 1GUHA 1F37A 2MZCA 4JR4A 3VURA 2B5YA 2K8SA 5D9XA 1N2AA 1DE1A 3KXOA 3A2VA 4ULXA 1SK0A 3KJYA 4K9ZA 4ZB9A 2MYGA 3IK9A 3RBTA 5J5NA 5HFKA 1V40A 5HR3A 2CAIA 2J23A 2L57A 1M9AA 2NPBA 1WJKA 1KNGA 1VF4A 5G5EA 4RI7A 4JZQA 4IELA 5INYA 4AF2A 3KIJA 1OYJA 4MCUA 2FWGA 4MP4A 2L59A 5JWRB 4MPFA 2VLTA 1GTUA 5F0GA 3EWLA 5G1LA 2GT5A 5E4WA 2I1UA 4BA7A 3GKNA 4JRRA 1F2EA 3EU4A 2XBQA 2R5GA 1PQNA 2O89A 1YF1A 1BEDA 4L0WA 2IFQA 1LBKA 4HJ2A 1TRWA 5GSTA 1O81A 3RPPA 2KP1A 3WD6A 1URMA 2GGTA 3G7YA 4PQIA 5CRWA 3VWWA 3OR5A 4I97A 1TRVA 3J7Yk 4OMVA 3EYTA 1SJ6A 5DQSA 1NSWA 3FHKA 5KN3A 5AIVA 4LMVA 2HLSA 4K0GA 4I8BA 1QMVA 4KH7A 5ECOB 4ILFA 1FB6A 4JR6A 3CTGA 3HD5A 4EF0A 4OO5A 3L4NA 5IOXA 4PGTA 4KE3A 3IR4A 3C71A 2JZSA 4ZL7A 1XW9A 5CRDA 1MEKA 4LLRA 1LU4A 1ZYQB 5FWGA 5ECKB 2L5LA 2C0DA 4OFMA 4PUFC 2WFCA 3TRXA 2WB9A 5G30A 1OE8A 2LUSA 1ON4A 1YEPA 5ECLB 1G0TA 2PN8A 3BJ5A 2GTUA 1W4VA 4ZXGA 1Z7PA 2A4VA 2VCXA 3GURA 1EEMA
chains in the Genus database with same CATH superfamily
3QK9A 2SARA 1BJXA 1UGHI 1O8XA 3WGEA 4DVCA 2JACA 2XBIA 2X8GA 2LRTA 4X1UA 4ISDA 2CFDA 5KN1A 3WYWA 1A67A 1FW7A 1QUWA 3G0KA 1ROVA 2XSHB 4GLTA 4J56E 4DEJA 1IQ8A 1VF3A 1N9JA 4J57E 2CG0A 5AI1A 4HZ9B 4TR1A 3KD0A 5ECSA 1WIKA 2YJ7A 2JQ5A 4HAAA 2V1LA 2H0IA 5C00A 2W9PA 2LJRA 4N10A 4K2XA 1EA2A 2IUJA 1PX7A 5ECHB 3EC3A 3UMAA 1M1XB 5G31A 2B1KA 1C7HA 3GAXA 5AYSC 1E2YA 2R0CA 3EPTA 3ME8A 5GSSA 3M8NA 2OTL3 1I2GA 4OCEA 1M1K4 2CFKA 3D22A 1X5DA 4EC0A 3CCU3 2CVKA 2P5QA 1UC7A 3F0IA 3BCIA 3HZ8A 2BO9B 4OFNA 4HUAA 1O7WB 4EV2A 3FKFA 2CX3A 2DJ3A 1USBA 2ZNMA 2P09A 1FA3A 2YV9A 3EF8A 2E0QA 5EL8A 4XB5A 1BRKA 4GL6A 2JZRA 3MAKA 1STDA 3GMFA 3K5TA 5IMAA 3QAGA 2HT9A 1STFI 1SIHA 4NV2A 1OF5A 4EDYA 1IYHA 1NHOA 3FY7A 2FA4A 3HIIA 1SPUA 3GL3A 3ZL5A 2F9SA 1Z1SA 1YIJ3 1WWJA 2TRCP 3QAWA 3I9V2 4YKFA 2BMRB 1TTZA 3A5EA 1BQ7A 1XZOA 4DKIA 3DKSA 4WR4A 18GSA 2I9WA 1LNHA 3LEFA 2HXKA 1BOXA 2VIMA 2W56A 4XBTA 2Z7AA 1T4YA 5TGNA 22GSA 4TRXA 1C54A 3FG1A 2QIYA 4N30A 3LYPA 1FGRA 4MLYA 2X4AA 5JBSA 1PU4A 3EB8A 2KAAA 3PYJA 2XPEA 3QOUA 3EURA 3CME3 2IY2A 4HYZA 4WHAA 2KOKA 2VL2C 1B9XC 3O3TA 3EHCA 2VCTA 3BCKA 3UJ1A 4BTXA 3DVWA 5IMCA 2FD3A 3WA3A 3S9FA 4XBXA 2OQEC 3IK7A 4KA0A 2KUCA 1K0MA 4LZIA 2RUFA 4XIHA 4NPBA 1O85A 2XRXB 2PERA 4MZBA 4IT7A 4LL4B 3F63A 5BU4A 1EQKA 5B8BA 4IQAA 5IQYA 2OJLA 1BNGA 1VZZA 3KMNA 5DALB 3DGLA 1HNBA 2R4VA 5BXQA 3HHVA 4HQZA 4O5QA 1O7PB 1X9WB 1OHOA 3TKSC 3KP8A 3VWXA 4EW5A 2GQKA 2FNOA 2FGTA 1XVWA 4OVMA 3HVXA 3TKSE 3H1NA 4F0BA 10GSA 3B4OA 3SXXA 1JHBA 3C8EA 4V2MA 2PNCA 2LTKA 1PKZA 4WYKB 3CD63 1S5AA 1R7HA 1TFKA 5JWQB 2C3TA 2I9HA 1B48A 4ZL8A 3LTDA 1EUIC 2I3YA 2PWJA 2KF4A 5HGRA 1JKGB 3SEDA 5D96A 3FK8A 4L8EA 3CSIA 2HMOB 4K2DA 3NV0A 1MDJA 7STDA 4GSNA 3CCR3 1YI23 2L5OA 3UAPA 1EEJA 2DJKA 3APQA 1TRPA 1TRSA 2V2GA 2NBSA 3LFLA 1ZX2A 3L9VA 2Y74A 1DVCA 3RNTA 2A15A 4O92A 3KZQA 5D73A 3NBJA 3MG2A 3UL3A 1PKWA 3FZ5A 3BD2A 5IMFA 2IFQB 1IVUA 5J9BA 3TJJA 4G1MB 1T4ZA 2YWNA 2M7OA 4RQRA 7GSPA 1G02A 3HI7A 2PBJA 1DYUA 3BOAA 4OUQA 4F82A 4POBA 4DSSA 4NREA 2WOHA 4GHOA 3B8LA 1K734 3GKMA 3CU3A 3WGDA 1IYIA 1D6ZA 3Q74A 2O3OA 4OK0A 3C7MA 1SU9A 1V58A 3T8NA 1E3VA 1I2EA 4HM4B 2XR8B 5DBQA 1VGLA 4XHMA 1RCKA 3AY8A 4N6OB 3L78A 1K0CA 2XHFA 2EIRA 3MHEA 4GSSA 1N8JA 1EV9A 3IC8A 5FT3A 3KSED 2YWOA 1YVSA 2H1AA 3W6GA 1B2UA 3KKGA 2AUVA 3MDKA 2WCIA 1XWBA 1DE3A 3G8ZA 1YEXA 4WR5A 2OE3A 1LOVA 5GZZB 2RSXA 3F7SA 4KFEA 3GSSA 2BMXA 5AYRB 3CYNA 3Q1CA 4HM3B 3S28A 4KT3B 1R4WA 3QCPA 1TRUA 3FR9A 1NWWA 1UGIA 2R0GA 3EN8A 1RGKA 1YGEA 3PINA 4O8SA 2VLUA 4JBBA 4GCIA 2H75A 3EMXA 2MBTA 4XS6A 1KTEA 2F51A 4KCAA 1HD2A 1OACA 3IXRA 2BMOB 3PS8A 5LC6A 3KE7A 1B2MA 2L4VA 1EOHA 4K0NA 1RGEA 2FWFA 3DZLA 2CX4A 1RN1A 1RKYA 4HM2B 4Z2UA 4HBRA 2GQLA 3DYRA 3KCHA 1M2DA 1TFOA 1SL1B 3MSOA 3EE2A 1FGOA 4TR1B 3HCZA 5ECPB 1LXEA 4O5RA 1JBSA 5FGOA 1GNEA 2VD1A 2WJUA 1F6MC 1OAZA 5IIZA 3VK9A 5KN2A 2IMDA 1VQM3 4MA9A 1R4CA 5F8BA 4N6MA 4ZBAA 1WMOA 1YJN3 4L8PA 1ERUA 4XS4A 1TIJA 1TI1A 2A4HA 1Q864 2F3MA 4BL7A 4E8HA 5AEUB 1TRQA 2ZCTA 3M9JA 4D73B 2YN1A 3O76A 4JEDA 5FHIA 3ZIJA 4MJDA 4MF5A 1B9YC 1X9SB 2YFIB 1EZKA 3I6AA 1Y4KA 2BHMA 2W2CA 3QD9A 1FGMA 3KM6A 3T8UA 1CQGA 1BYEA 1GMQA 2WS2A 5ELUA 5HQPA 1K0DA 3P7XA 3GH9A 1X5EA 1OF5B 2KF5A 4JE1A 3D4MA 3F8XA 1WMJA 4H86A 5D9WA 1RLSA 4GF0A 1VQ93 2VCZA 1B21A 1FYSA 3IPTA 3ZYWA 3GV1A 4KDXA 2OE0A 1VQO3 1BAOA 2OTJ3 3VI7A 3EMPA 3DGQA 3HVVA 3VFIA 1IDPA 3HJPA 2F56A 4Q5FA 3IJEB 1WMNA 4HVNA 3ALAA 3OX9A 1GD4A 3NX0A 1YJ6A 5M1AA 4XS1A 4TR4A 5J9CA 2W56B 5CF2A 1S3RA 4HM6B 2VAFA 3UB1A 4X2OA 8RNTA 1JZRA 4LYLB 1ZGXA 4J9AA 2RFRA 1LOXA 2JADA 4MMMA 4ID0A 2EC4A 5ECIB 3VI5A 5KP1A 4KB3A 4L7KA 5EVOA 3CCS3 1ERWA 4TXVA 6GSXA 1W5ZA 2AB6A 4HOJA 2LYXA 3CQFA 3IAM2 3NZNA 2LRNA 1BNJA 1T2IA 2HZEB 3KP9A 3NM2A 1MWSA 3UL5A 1JFUA 3CC43 2E2MA 3D4AA 2OACA 2CAQA 2G2QA 2AAWA 3ZMLA 4MJCA 1MWTA 1THXA 4TR3A 1WOUA 1AQWA 1ST9A 3DRNA 3CNXA 2GEYA 1UA5A 3IHGA 1QXHA 3Q18A 5AIXA 2QGVA 1QMAA 4YQMA 2C11A 3A76A 4IKHA 5AISA 4Z7XA 1K3OA 3APOA 3FZ9A 2W0QA 17GSA 3IA1A 8GSSA 4IBPA 3EBTA 1BG5A 3ISOA 4PEJA 3MYTA 4AKYA 2JSYA 5ELGA 1WTHA 5A4UA 4BL3A 2IYJA 4K7IA 2RM5A 1UCJA 2BIRA 1N8QA 1VQP3 3LT8A 2P38A 3BBYA 4JU5A 1ZCPA 1SL2B 4EC6A 2MMAA 3IV4A 1K0BA 1BAYA 3C73A 1I2FA 2W6JH 3I0YA 4E8EA 4FH8A 5CNWA 2O7KA 2TIRA 1IV9A 4HS1A 2NVLA 1XOBA 4FCZA 3TJGA 3FZWA 1BU4A 1N5PA 5A4VA 1SIIA 1ERTA 2WGRA 4N6NB 1YKAA 4IGJA 3DMLA 3TJFA 1A24A 2PVQA 1FAAA 3OWSA 4RNYA 1US1A 1K28A 3GN3A 5ABRA 2PU9C 1GLQA 2OE1A 4PX1A 6GSYA 2DJ1A 2E7PA 1ABAA 3F3QA 4F2IA 4KVHA 3BLZA 1OKDA 3DGYA 2WGOA 1T5YA 1WPIA 4FQUA 2ZUPA 2ML5A 2P0MA 5HFIA 6GSSA 4MMZB 4QL7A 1MOLA 2B5EA 4DSSB 3D3LA 3KEBA 1OC3A 5JWOB 2AJQB 2X99A 3UVTA 1RGAA 2HZFA 4FYCA 3WHOA 4IP6A 1WP0A 1MDIA 1UUVB 2N5AA 2KCDA 1AXDA 1GSYA 1TU8A 2XSOB 2FWHA 4K1VA 1XCCA 4FMBA 4AKZA 5ECMB 2CWVA 2HE3A 3NOFA 2K8VA 1TXXA 1VQ43 1JZOA 3WOEB 1A90A 1KEBA 5IEPA 2H6YA 4EVMA 5HR1A 1SL0B 3DVXA 3FRCA 2HNLA 5HFGA 2PPTA 2AV4A 2V41A 4Q53A 3LXUX 4EE0A 4TN8A 5J4UA 3TGZA 2C10A 2RUEA 3HZPA 4R80A 3GUSA 1U6TA 2R3XA 4MK3A 1CYVA 1K0AA 2CG1A 1YJ93 2PZVA 4HEA2 2OA7A 2CVDA 4ZB6A 1BRJA 4P3YB 1YQ1A 4KFFA 1O6JA 1FG4A 2I81A 3U5RE 2C3NA 3WT2A 3DY5A 4ECCA 5ELJA 2HRKA 1GUKA 3GL5A 2P05A 3FGYA 3V92A 5DVBA 3EQQB 1TK8B 4JRFA 4AEQA 1BSAA 4HM1B 1JNQA 3HY2A 3WODG 1OKTA 3FSDA 1XWCA 1LOWA 2GQMA 1RGGA 4PNGA 1AW9A 7RNTA 1D6YA 4BIKA 3MWHA 3D9RA 2DSAA 2YOIA 4FCMA 2LQVA 4GTUA 3LXTA 2F8AA 3DM8A 3K7CA 3VWVA 3IPZA 1RK4A 2H6XA 2B3SA 1K41A 4IP1A 1M7TA 2C0EA 2H19A 5A0OB 3ZFLA 2INXA 4HJLB 1RNBA 1MDKA 3WGXA 4PUAA 1WQLB 3DGOA 1TU7A 4RBNA 5AEWB 1BNEA 3JVCA 3R2QA 4OFTA 1GSPA 1Q9EA 4N6LA 3LOYA 4RQXA 5HR0A 5IG0A 3BIRA 4OO4A 4EL1A 6GSUA 2QA1A 3S67A 3CCJ3 1SKRB 2KF3A 2FGXA 2GSSA 4XS4B 2GZYA 4BL7B 3M3MA 1DETA 4YKGA 2OBKA 1V98A 1AUCA 1W2ZA 1EP7A 1MD3A 3TOUA 2GSTA 3C1RA 4GB5A 3HYPA 3LW9A 5F06A 1ROAA 1IV7A 3CCE3 4QL9A 4KFDA 3ECFA 3VGNA 1PX6A 4IS0A 1GYBA 3DUKA 3F14A 1ACVA 5J3RA 5IOWA 4ZILA 2VCVA 1YVBI 3EC9A 2DMMA 2HMJB 1FHEA 3AHWA 4HM0B 3GX0A 5CAXA 3BNBA 2H30A 1TK5B 2H71A 1JZWA 2N5FA 1SARA 2O9UX 3BB9A 5E59A 2MMNA 5G2ZA 19GSA 5JCGA 1GUMA 5AIHA 2QEX3 1GSQA 2YFJB 3CRTA 4WKWA 1UDII 1J0FA 4CDOA 1EWXA 1S3DA 4V1Ag 4KSMA 4CY6A 4ECJA 2E2GA 4KZ1A 1MGWA 1IT7A 5LNKe 4K7NA 4IHUA 4R4KA 3TRQA 1HYUA 5D93A 3WMDA 1HKXA 3HKRA 2DLXA 1RCLA 1TUHA 1DMNA 2FNQA 3FEUA 1E6BA 2DBCA 3LYKA 1ZYPA 4WBRD 2IMJA 4BWSA 5ECRB 1RMSA 2XGNA 1UCIA 4N0VA 1OHPA 5CXOA 2DMLA 1XWGA 1W6GA 3TB2A 1SQWA 1J08A 2O85A 3MPHA 3WOFB 4EV5A 3IC4A 4FIWA 4ZL9A 2F99A 1QJGA 2C0GA 4V1Ap 3F3RA 3AMOA 3U6VA 4TX4A 1I3IA 3C1SA 5EY6A 3G9BA 4FMCA 1S3AA 3H4KA 1QVF2 1M904 2RNTA 1ZGNA 2NTOA 1KC84 2R37A 3M9KA 4HSCX 3LWAA 2LNTA 3MIXA 2GEXA 3US3A 1PMTA 4AGSA 3L9UA 4WFOA 3X3ZA 1YZXA 3CBUA 2BTOT 1OPYA 5EQLA 2OOVC 2UUGC 1NHYA 1TP6A 4CPKA 5AGYA 2D42A 2H01A 2LRCA 4X0XA 4LEHA 5EVHA 4K7OA 5CREA 1TK0B 1C72A 5LD0A 3VLNA 4HDEA 2H1DA 3G7JA 3NHXA 3O6TA 3UVHA 1LVNA 2FY6A 1NNVA 3TJKA 1KSIA 3SOAA 2V6KA 4NXIA 2WDUA 1WRYA 1X1UA 1QK8A 1JN5A 4GQCA 3RDEA 1U87A 3PGTA 3GWRA 4KAEA 1YIT3 1SKWB 4MZCA 4WXTA 3HJMA 16GSA 3X42A 3F4RA 3W8SA 1FOVA 1I3FA 2IMIA 3KH9A 1VQL3 4Z2TA 2DIYA 5BRTA 3G16A 1A2LA 5G2GA 4KNDA 4L8OA 1XG8A 1G96A 3D5JA 1BIRA 2ML6A 5DAKA 4K61A 1XOAA 2VL2A 1I70A 1OE7A 2C4JA 3MSZA 2UGIA 3CMIA 2Z6BA 1M2BA 1Q40A 4XM4A 5D83A 1GULA 2VL9A 1HNAA 2R41A 5RNTA 1IQYA 4J8TA 5HOHA 2YZUA 2STDA 4G0IA 3MWZA 2AADA 3FKAA 3UBLA 4LA1A 5GAND 6STDA 4ZM8A 1KD14 2QSIA 2RGQA 1AC1A 5KN0A 1B27A 1HU9A 2N5BA 4F0CA 1GSSA 3JUPA 1XXUA 1LJRA 3I69A 2Y73A 4MH2A 1Z9HA 7GSSA 2MBSA 4HJMA 1UCKA 1XWKA 1GSFA 1FO5A 2E2VA 1GH2A 2PMTA 2A2SA 2QGUA 3BNDA 5G5FA 1QALA 4NAXA 3TKSA 2QKEA 3GNJA 4FCJA 3HVNA 3NQYA 1GOVA 1TU5A 2CZ2A 1GOYA 1M3JA 2H70A 1GLPA 5CRGA 1AV4A 2LJAA 2E2UA 3CPOA 1M2AA 3RGRA 4K5RA 2ON5A 2K9FA 1ZZYA 2KHPA 2C80A 1VQK3 1TJDA 2VCQA 4WBJA 3CSJA 4K5SA 1UUGB 3FR6A 3FG3A 4V2NA 4H61A 3G4S3 2K6VA 1DUGA 3N54B 2V1MA 3IAS2 1K3YA 1UN2A 3OWUA 2P5RA 5CRHA 4POLA 5JPPA 1W01A 3G6E3 4X43A 2GSRA 2X64A 3ZFZA 1RQMA 4HI7A 1AQXA 2XGLA 1DSBA 1JB4A 5DRVA 2YNXA 4ML1A 1Q7Y4 3GIXA 3IMAB 5CF1A 4BL2A 4HU7A 1DBYA 4G9HA 2YPMA 1RW1A 1Q814 3ZRDA 4MF6A 1O7GB 4L5OA 3GSTA 4I5QA 4ZB8A 4BIRA 2B1LA 5D9TA 3RPNA 2CWUA 2CKFB 1IVVA 1MD4A 3F6DA 3FR3A 5H5QA 4MJBA 1K8A4 1PFOA 1GOUA 3QAVA 5COHA 2HSHA 4MABA 5AIIA 4X4JA 3J7Yb 2Z77A 2K3DA 1W7CA 4BU4A 5DREA 4Q5RA 1BSCA 1HQOA 4EXRA 1I9DA 1A2KA 4TW5A 3EVIA 1ZL9A 3KGKA 3CSHA 2BU4A 4G2EA 2CZ3A 3GRDA 2KP2A 1FUSA 5D9VA 3DXOA 4EYCA 2CX0A 3OWYA 2HI7A 3LGCA 4GSTA 1Q98A 2HMLB 3E99A 1SENA 3GKXA 4FYBA 1CYUA 1TDIA 3ZZXA 5LC7A 4IPBA 2ON7A 1Z6MA 5B7CA 3X41A 3HZ4A 4L0UA 4HU9A 5F05A 1UI7A 1HNCA 3ERGA 3VPQA 4MPGA 1SJZA 4G19A 4G0KA 2IJYA 3KCMA 1B4PA 3FF2A 2XF3A 3LZAA 3GYKA 4IJIA 2OBIA 1U88A 2KXGA 2GDRA 2GZPA 1BANA 3TJBA 1ULJB 4DSRA 2TRXA 4AJ6A 1MWUA 1T1VA 1U3AA 4FO5A 1JLWA 1PN0A 1A2MA 3LQ7A 3R3EA 4I2TA 4K8MA 5ECQB 2BJXA 1X1XA 2I4AA 2B24B 2LQOA 4PNFA 2VO4A 3CPW2 1V9WA 2KLXA 4HZBB 5DDLA 3F6FA 1M9GA 1BRGA 5G1KA 5IMDA 1BGSA 1QAFA 1GP1A 4K1FA 5KOXA 3H8QA 1GRXA 1G7OA 2H6ZA 4FR9A 4X2HA 2XPDA 2H8LA 4RUVA 1R4YA 1VQ63 3NM7A 1OC9A 3E0UA 3H3HA 1SD9A 2H72A 3AMOB 4EKZA 5BIRA 2XH9A 5H5RA 3MG3A 2PVOC 5I97A 2HFDA 1F3BA 3OV4A 4RI6A 1ZOFA 3LH4A 8CHOA 1F9MA 2GSQA 1M9BA 2VCWA 3IRAA 3GA4A 1MTCA 2D1WA 1VQN3 1MGRA 4N6V0 1T3BA 1RHLA 1K0OA 5DCHA 1FW1A 2SBLA 4BVYA 3KZTA 4U13A 4KDUA 2EIQA 1XVQA 3KH7A 3DWVA 6GSWA 1GY7A 2C4BA 1VRSD 3Q2PA 13GSA 4XDVA 3FH1A 5DALA 2MMOA 3DIEA 1AQVA 1W6YA 1YNVX 2J9HA 1X9MB 3DGMA 4IJ3A 3NXJA 3VWUA 4F03A 1CQSA 4Q5NA 2R2JA 3J7Yd 3CXC2 3D21A 3NV0B 1GS3A 4EBGA 3DXBA 3F4SA 4TVEA 3DEXA 4CW9A 2GVPA 3A3TA 4TXOA 1PN9A 2QA2A 3M1GA 1ASKA 3D4TA 1ZYEA 3K8NA 5IF6A 1YGWA 5IPGA 3WR2A 3H51A 3RDWA 1DE2A 2FLSA 2IMKA 2FA8A 1JN5B 3A2WA 3E3EA 1EGRA 4BWQA 3N8BA 1YDKA 1G6YA 4J2FA 3UOMA 5M19A 4KW6A 2XC2A 4FMDA 2JZTA 2OADA 4CCVA 4LL1B 3VF1A 5ID2A 4I4KA 4ML6A 3WT1A 4YAPA 2F5WA 1PA3A 1GMRA 4GQFA 2K54A 1FB0A 2GBXB 3RAZA 1GTAA 3GZXB 1FGTA 2IL3A 1SYRA 1OGXA 1DVDA 4FYUA 2GXFA 5DAKB 1B3SA 4NHZA 1CH0A 3O8YA 4HQSA 3RHCA 2YWMA 1RJOA 1O7NB 3VSYA 2EIOA 2M72A 3TUEA 1UUWB 1OCVA 3ZTLA 2E2TA 4F9ZA 4NV5A 1SYXA 1Q40B 4BVXA 2F98A 3SYUA 1R26A 3N9JA 5IO2A 4MZWA 2VM2A 2CFGA 1JB5A 1K3LA 4NHWA 3NIVA 4HM7B 1K9M4 3PZWA 1EG9B 20GSA 1IK3A 1LQGC 2L4QA 5CYYA 4BTYA 1TP9A 1A2VA 2L6CA 2WRTA 4H3UA 2ZHXB 2VL3A 3BNEA 3SBCA 2A2RA 4KUNA 1VQ83 2K18A 4XRAA 1XW5A 3LSZA 4IW9A 1PL2A 2NDOA 3GFKA 2YFLB 4KGIA 4N6UA 2P31A 2IN3A 4HZ2A 1N8R4 2W04A 3K63A 5ECNB 4O7HA 2JDIH 1TOFA 2L4CA 2K0MA 1G7EA 1AAZA 2RM6A 2FXTA 2R0PA 5GAPD 2LEGA 1Y25A 2GU1A 4PURA 3Q19A 2DJ2A 1NW2A 1IU7A 3CTFA 3APSA 3GTUA 3LT9A 3ZIVA 2F8FA 3HVSA 5FW5A 3LTBA 1UVZA 3UIWA 5STDA 3SVAA 4WWUC 1RRLA 3RHBA 2B6MA 1V74A 3TKQA 5DQYA 3ME7A 3QPMA 4J5GA 3UEMA 4MJAA 1CEWI 2V32A 1SK2A 2GLRA 3PGBA 3GH6A 1X1YA 2HRNA 3E9JB 4KDYA 5C04A 2X8CA 2X49A 4HOHA 1JLVA 5B8AA 4MH3A 3PPUA 3PH9A 3EE1A 3LJRA 1W6CA 1G6WA 2IPAA 4RNZA 4XRDA 4K90B 4KCEA 2J8XB 3AGNA 5AN1A 1GSUA 9RNTA 4EIQA 1O7HB 3JUQA 3V1WA 1GSEA 2X8HA 1BX9A 4I6XA 3JUOA 1JV2B 5DCGA 1ULIB 4IIAA 4USSA 2LKUA 3L0RA 2REMA 1B4QA 1BSDA 2B1XB 2H74A 1NDOB 1Y6EA 1TW9A 3ZMKA 1H75A 4PXOA 4TR0A 5J41A 2W03A 2B7KA 1Q42A 6GSTA 1EGOA 3TKPA 5KP4A 4OCFA 3KIIA 2YANA 1I0VA 1FVKA 2B5XA 3FYGA 1OGZA 1N5HA 1FOHA 1M3IA 3U1WA 1GWCA 3F8HA 2PUKC 4POMA 1ZYNA 4D73A 5AIGA 3T0UA 3D5IA 3A5WA 4AJ7A 1O7MB 4KF9A 2DKIA 3I553 4YQVA 4ZIJA 3KSPA 3LORA 2GU3A 4R9KA 5JCWA 3HK4A 1NU3A 3FCSB 4CHSA 2JSZA 1ML6A 4YH2A 4EIPA 3G713 3JUNA 3LXZA 2RBIA 1U5OA 3D0ZA 4NMUA 3ZLPA 4TOPA 4O32A 3ERFA 2V6OA 1TTOA 2H76A 1PYLA 2UX0A 1JB2A 4ECIA 1OUNA 2YP6A 3JCML 2GBWB 5IENA 5L71A 2O87A 4G0LA 3W8JA 2DJJA 3PCSA 1XFLA 2BMQB 1O73A 3OW22 3LTCA 3IOSA 3EN1B 1UCLA 1RGCA 1DMQA 2WGQA 1RTUA 3CC23 2GS3A 1B2ZA 3QR6A 3BU4A 1NM3A 5KEJA 4LGQA 5AIFA 1KWIA 3ZVJA 2ZA4A 2JL4A 1PRXA 2VLVA 3UL6A 2M80A 3QDNA 2CH9A 1YF0A 3CXGA 2H0HA 2CC3A 6GSPA 3HX8A 3CCL3 1TKDB 5M18A 1RNTA 1B8XA 1OC9B 2UZ8A 1T7PB 4HKVB 3V99A 5B6NA 4IN0A 2XFTA 4O02B 3F8UA 1GSDA 2HZEA 5IM9A 3LTAA 1AIUA 4WEYA 1QFNA 6GSVA 4GRFA 5D8IA 3QRDA 2C1YA 12GSA 1A0FA 3G7IA 1S723 1PSQA 4ZBBA 4MNNA 4A5PA 1EOGA 3ZFBA 4WP5A 1J9BA 2Q07A 3S27A 4BVYB 2F86B 1VQ73 2WZ9A 2VM1A 2R4IA 2HYXA 2HMNB 1UI8A 1EP8A 1IT8A 4PQHA 1GY6A 4V2LA 1R5AA 4MF7A 4ICYA 3DMCA 4ORLA 1RN4A 2YCDA 5F07A 1XW6A 5IMVA 1N9EA 4XDWA 4EDZA 6RNTA 2CQ9A 4N0ZA 1JBRA 1XIYA 5IG5A 4YAVA 2LSTA 4EUYA 2WULA 2KF6A 3HXSA 4IVFA 1THOA 1I0XA 4TXOB 4NWYA 4N11A 1AQZA 5EEOA 4ECBA 4BTWA 5A4WA 1H4OA 4KX4A 1V57A 5KP3A 4POKA 1Z7RA 3DGNA 1XBSA 2OKAA 2DIZA 2MF7A 1BUQA 2H1BA 3H79A 3KTBA 4I2UA 3ZG5A 1B2SA 3A2XA 2IMFA 2LQQA 5ID2B 2A2PA 4BPYA 1JJ22 4K1UA 5IPHA 2YWIA 1E97A 4HM8B 5CP1A 3FF0A 3L0HA 3GSPA 2OWPA 4ZBDA 2B7JA 1ILOA 3ED3A 1LNIA 1W00A 4HZ4A 1VF1A 4EXJA 3UNLA 1NB3I 4RNTA 1MWRA 3X3XA 2PGTA 3GX8A 2DC5A 3FZ4A 2AHEA 5DJMA 2OQEA 2M46A 1SJWA 2F4YA 3SOYA 2LNSA 1RGHA 2P0GA 2VOCA 4BVXB 3GKKA 5HR2A 1GD3A 4WETA 4O2HA 4IQ1A 2VUPA 5IG3A 1V2AA 3HA9A 2Z9SA 2CVBA 2CV4A 1GTBA 3IHQA 1D6UA 3GHAA 4OWYA 3MKIA 3D5GA 1F8NA 1QGVA 1Z3EA 3IBHA 4XCSA 3P8WA 1RDSA 3TCOA 1A2JA 4FMAA 3F9UA 5BMUA 2RLIA 1A23A 4MEIA 3DH2A 1WMPA 3PR8A 2CA8A 2CT6A 2H0GA 1Q4JA 1RGLA 1T8EB 2IMEA 1PD21 2QC7A 5EPFA 1RRHA 1IQXA 2OCTA 5KOWA 2ZL8A 2OOVA 1TI3A 3VPTA 3GZBA 4GWRA 1ZO2A 2L6DA 1BUJA 4JF8A 2XFSA 3KTLA 2FHEA 2C3QA 1VQ53 5BVBA 1I5GA 4EO3A 3TRPA 1M99A 3GTUB 1W02A 2CFLA 2CHCA 3FMWA 4MJEA 4PQ1A 1BNRA 3MYDA 1NB5I 1A2PA 3Q6OA 1XWAA 2MC8A 2IIYA 1PY3A 3PXMA 3URPA 2H66A 1U3IA 2H73A 3LYGA 1U8CB 4OD7A 4R9LA 1YJW3 1BVIA 3ZVJD 3S5CA 3K9MC 9GSSA 2BNGA 1BNIA 1CQHA 4YQUA 3HIGA 3K0ZA 4N3VA 1T00A 3EU3A 2ZDJA 2YZHA 5DJLA 3H93A 3FG4A 3TDGA 1AY7A 2XEPA 4R1KA 1A8YA 5H5SA 4MDCA 1O8WA 2H1GA 2C8UA 1B20A 3RGAA 4XTSA 1Z5YE 3WA2X 1ERVA 5B6MA 5ENUA 3HOHA 3KFQC 3D79A 1BRSA 2CFWA 4N6TA 3I43A 3ERWA 3M0FA 3OXAA 2LV3A 2KRTA 1FUTA 2DKHA 3HDCA 1FVJA 3HJOA 3CCV3 1X0RA 2G0FA 2LS5A 4STDA 2FCHA 3MG1A 3CRUA 2FUG2 2CW9A 2HMMB 2DJ0A 4WF5A 2P0XA 3TOTA 2W9QA 3FLJA 3FZAA 1BSBA 1W89A 2JU5A 1JRQA 2LJKA 1ZMAA 1M0UA 1Z6NA 2HSYA 1YY7A 3P2AA 3EINA 5IEOA 2MMZA 3CCM3 1EV4A 3D6IA 3MNGA 3P90A 3B7CA 3GZRA 3JUMA 1Q824 1BSEA 2VD0A 5IO0A 2WOFA 3TKRA 5A5KA 2YV7A 1SJIA 4DSQA 4MMYB 5LCZA 3CNMA 3KMOA 1BNSA 1JZDA 4AJ8A 3SWLA 1OC8A 3FW2A 1F3AA 4GXZA 1GL8A 3UJMA 1QAKA 2HRFA 1EKMA 2F5MA 2RCDA 1DMMA 1S3CA 2D2ZA 4LMWA 5IMZA 3UBKA 2AYTA 1GNWA 4Q5QA 2IA7A 1W4NA 3N9HA 5JCUA 1XPVA 1SK1A 3QFBC 5D81A 2HSMA 3UARA 3B4PA 1PL1A 1WNHA 3F7XA 2ALBA 3ZREA 1OH0A 4G10A 1LOYA 4LMIA 2O8VB 3DD3A 4QQ7A 4LSOA 5IG4A 14GSA 1X5CA 2IWTA 3LG6A 4KSOA 1NO3A 5ELAA 2FWEA 1SKSB 3IDVA 1OVNA 11GSA 5IERA 2AAEA 1PGTA 4K6XA 1YKCA 3F40A 3L9SA 4ACSA 3F9SA 1KQS2 3N5OA 1FGQA 1QQ2A 1GMPA 3LMLA 2ES7A 5CO3A 2WO0A 3ZG0A 1GTIA 4TKYA 3ZITA 1SD8A 3STDA 2R6KA 2C0FA 1R5PA 2RIIA 1O7UA 1WE0A 3QFAC 3AGOA 1GY5A 4L5LA 3GRXA 4WF4A 1VF2A 5GSPA 1ISKA 1T2HA 1K0NA 1A0RP 2GZZA 3QMXA 3I563 1E3RA 5IW9A 3F4TA 3IE3A 2GT6A 1KBNA 2YJHA 1A8LA 1GUHA 1AVKA 1IYYA 1F37A 2MZCA 4JR4A 3VURA 1PFPA 2B5YA 2K8SA 5D9XA 1N2AA 1DE1A 1W2B2 3KXOA 3A2VA 4ULXA 1SK0A 3KJYA 4K9ZA 4ZB9A 2MYGA 1UW1A 3IK9A 3A5IA 3RBTA 3X3YA 5J5NA 4HM5B 5HFKA 1V40A 5HR3A 4Z2RA 3BNCA 2Z76A 2CAIA 2J23A 2L57A 1M9AA 2NPBA 1MNLA 1WJKA 1KNGA 4MMXB 1VF4A 2QA43 5G5EA 4RI7A 4RZMA 1BRIA 1RSNA 4IELA 4JZQA 5INYA 4WYKA 2HRAA 4AF2A 3KIJA 1BNFA 1OYJA 4QWTA 3KN4A 3ROBA 4MCUA 2FWGA 4MP4A 1JBTA 1JKGA 4O5UA 1IVWA 2L59A 5JWRB 4J5KA 4MPFA 1NJI4 2VLTA 1GTUA 5F0GA 3EWLA 5G1LA 2GT5A 3M8CA 3S29A 5E4WA 2I1UA 2CWTA 5CLKA 4BA7A 3NUVA 4NHFA 1BRNL 3ER7A 1ZS7A 3GKNA 4JRRA 1AVLA 1YHQ3 1F2EA 3EU4A 2XBQA 2R5GA 1PQNA 3EJVA 1YF1A 2O89A 1B2XA 1BEDA 5D82A 4L0WA 1BRHA 3GZYB 3EX9A 2IFQA 2HOHA 2CX1A 1L5GB 1RGFA 1LBKA 4HJ2A 1TRWA 5GSTA 4O3VA 1O81A 3RPPA 5JPUA 2KP1A 3SX1A 3CMA3 1IVXA 3WD6A 1URMA 2GGTA 3G7YA 4PQIA 3NQZA 5CRWA 3VWWA 3OR5A 4I97A 1TRVA 3PCRA 3J7Yk 4XBYA 4OMVA 3EYTA 2HMKB 1SJ6A 5DQSA 1RN7A 1NSWA 3FHKA 1FZUA 3U97A 4CDLA 2GSPA 5KN3A 5AIVA 3NBRA 4LMVA 2L1SA 2HLSA 3Q90A 1I8VA 4K0GA 4I8BA 1X1WA 1QMVA 3WDGB 1HZ1A 4KH7A 5ECOB 4ILFA 1FB6A 4JR6A 3CTGA 3HD5A 1VQQA 3X40A 4EF0A 4OO5A 1LQMB 3L4NA 5IOXA 4PGTA 4KE3A 3IR4A 3C71A 1Q7HA 3NBBA 2JZSA 4PTSA 1OHSA 4ZL7A 1XW9A 5CRDA 5CK6A 1J2BA 3V98A 1MEKA 3SLUA 4CJNA 4LLRA 2CIUA 1LU4A 4CY8A 1ZYQB 5FWGA 5ECKB 1AR0A 2L5LA 2C0DA 1FUWA 2IUKA 1LRAA 3AHSA 3EBYA 4OFMA 4GSPA 4PUFC 1QVG2 3CC73 2WFCA 3TRXA 2WB9A 5G30A 1OE8A 2LUSA 1ON4A 1YEPA 3Q3FA 5ECLB 1G0TA 2PN8A 3BJ5A 2YX9A 2GTUA 1W4VA 4ZXGA 1Z7PA 2CK3H 2A4VA 3CCQ3 2VCXA 1HYFA 3GURA 2BT3A 1EEMA
chains in the Genus database with same CATH topology
1BJXA 1O8XA 3WGEA 4DVCA 2JACA 2XBIA 2X8GA 2LRTA 4X1UA 4ISDA 5KN1A 3WYWA 1QUWA 4J56E 4GLTA 4DEJA 1VF3A 4J57E 4TR1A 3KD0A 5ECSA 1WIKA 2YJ7A 2H0IA 5C00A 2LJRA 4N10A 4K2XA 1PX7A 5ECHB 3EC3A 3UMAA 5G31A 2B1KA 1E2YA 2R0CA 3EPTA 3ME8A 5GSSA 3M8NA 4OCEA 3D22A 1X5DA 4EC0A 2CVKA 2P5QA 1UC7A 3F0IA 3BCIA 3HZ8A 4OFNA 4HUAA 3FKFA 2CX3A 2DJ3A 1USBA 2ZNMA 2YV9A 2E0QA 5EL8A 3MAKA 2JZRA 3GMFA 5IMAA 3QAGA 2HT9A 4NV2A 4EDYA 1IYHA 1NHOA 3FY7A 2FA4A 3GL3A 3ZL5A 2F9SA 1WWJA 2TRCP 3QAWA 3I9V2 4YKFA 1TTZA 1BQ7A 1XZOA 3DKSA 4WR4A 18GSA 3LEFA 2HXKA 2VIMA 1T4YA 22GSA 4TRXA 4N30A 3LYPA 4MLYA 2X4AA 2XPEA 3QOUA 3EURA 2IY2A 2KOKA 2VL2C 1B9XC 3O3TA 2VCTA 3BCKA 3UJ1A 3DVWA 5IMCA 2FD3A 3S9FA 3IK7A 4KA0A 2KUCA 1K0MA 2RUFA 4XIHA 4NPBA 1O85A 2PERA 4MZBA 4LL4B 3F63A 5B8BA 4IQAA 5IQYA 2OJLA 3KMNA 5DALB 1HNBA 2R4VA 3HHVA 4HQZA 4O5QA 1X9WB 3TKSC 3KP8A 3VWXA 2GQKA 2FNOA 1XVWA 3HVXA 3TKSE 3H1NA 4F0BA 10GSA 1JHBA 3C8EA 4V2MA 2LTKA 1PKZA 1R7HA 5JWQB 2C3TA 2I9HA 1B48A 4ZL8A 2I3YA 2PWJA 5D96A 3FK8A 4L8EA 3CSIA 4K2DA 1MDJA 4GSNA 2L5OA 3UAPA 1EEJA 2DJKA 3APQA 1TRSA 2V2GA 2NBSA 3LFLA 3L9VA 4O92A 3KZQA 5D73A 3UL3A 1PKWA 3FZ5A 3BD2A 5IMFA 2IFQB 5J9BA 3TJJA 1T4ZA 2YWNA 4RQRA 2PBJA 3BOAA 4F82A 4POBA 4DSSA 3GKMA 3WGDA 1IYIA 3Q74A 3C7MA 1SU9A 1V58A 5DBQA 1VGLA 4XHMA 3AY8A 3L78A 1K0CA 2XHFA 2EIRA 4GSSA 1N8JA 1EV9A 3IC8A 5FT3A 2YWOA 2H1AA 3W6GA 2AUVA 3MDKA 2WCIA 1XWBA 1YEXA 4WR5A 2OE3A 5GZZB 3GSSA 2BMXA 3CYNA 1R4WA 3QCPA 1TRUA 3FR9A 2R0GA 3PINA 2VLUA 4JBBA 4GCIA 2H75A 3EMXA 2MBTA 4XS6A 1KTEA 2F51A 4KCAA 1HD2A 3IXRA 1EOHA 4K0NA 2FWFA 2CX4A 4Z2UA 2GQLA 3DYRA 1M2DA 1SL1B 3EE2A 4TR1B 3HCZA 5ECPB 4O5RA 1GNEA 2VD1A 2WJUA 1F6MC 1OAZA 5IIZA 3VK9A 5KN2A 2IMDA 4MA9A 5F8BA 4ZBAA 1ERUA 4XS4A 1TI1A 2A4HA 2F3MA 4BL7A 4E8HA 2ZCTA 3M9JA 4D73B 2YN1A 3O76A 4JEDA 5FHIA 3ZIJA 1X9SB 4MF5A 1B9YC 1EZKA 3I6AA 3QD9A 3KM6A 1CQGA 1BYEA 2WS2A 5HQPA 1K0DA 3P7XA 3GH9A 1X5EA 4JE1A 3D4MA 4H86A 1WMJA 5D9WA 4GF0A 2VCZA 3ZYWA 3GV1A 4KDXA 2OE0A 3VI7A 3EMPA 3DGQA 3HVVA 3VFIA 3HJPA 4Q5FA 1YJ6A 4XS1A 4TR4A 5J9CA 2VAFA 1JZRA 4MMMA 2JADA 4ID0A 2EC4A 5ECIB 3VI5A 4KB3A 5EVOA 1ERWA 4TXVA 6GSXA 2AB6A 4HOJA 3IAM2 3NZNA 2LRNA 2HZEB 3KP9A 1JFUA 2E2MA 2OACA 2CAQA 2G2QA 2AAWA 3ZMLA 4MJCA 1THXA 4TR3A 1WOUA 1AQWA 1ST9A 3DRNA 1UA5A 3IHGA 1QXHA 3Q18A 5AIXA 2QGVA 4YQMA 4IKHA 5AISA 4Z7XA 1K3OA 3APOA 3FZ9A 3IA1A 17GSA 8GSSA 4IBPA 1BG5A 3ISOA 2JSYA 5ELGA 5A4UA 2IYJA 4K7IA 2RM5A 3BBYA 4JU5A 1ZCPA 1SL2B 2MMAA 3IV4A 1K0BA 1BAYA 3C73A 4E8EA 4FH8A 5CNWA 2O7KA 2TIRA 4HS1A 2NVLA 1XOBA 3TJGA 5A4VA 1ERTA 2WGRA 1YKAA 4IGJA 3DMLA 3TJFA 1A24A 2PVQA 1FAAA 3GN3A 5ABRA 2PU9C 1GLQA 2OE1A 4PX1A 6GSYA 2DJ1A 2E7PA 1ABAA 3F3QA 4F2IA 1OKDA 1WPIA 4FQUA 2ZUPA 6GSSA 5HFIA 4QL7A 2B5EA 4DSSB 3KEBA 1OC3A 5JWOB 2AJQB 2X99A 3UVTA 2HZFA 4FYCA 4IP6A 1WP0A 1MDIA 2N5AA 1AXDA 1GSYA 1TU8A 2FWHA 1XCCA 5ECMB 2HE3A 3NOFA 2K8VA 1TXXA 1JZOA 1KEBA 2H6YA 4EVMA 5HR1A 1SL0B 3DVXA 3FRCA 2HNLA 5HFGA 2PPTA 2AV4A 2V41A 4EE0A 4TN8A 5J4UA 3TGZA 2RUEA 3GUSA 1U6TA 2R3XA 4MK3A 1K0AA 4HEA2 2OA7A 2CVDA 4ZB6A 4P3YB 1YQ1A 1O6JA 1FG4A 2I81A 3U5RE 2C3NA 3WT2A 4ECCA 2HRKA 1GUKA 3GL5A 5DVBA 1TK8B 3HY2A 1OKTA 1XWCA 2GQMA 4PNGA 1AW9A 3MWHA 2DSAA 2YOIA 4GTUA 3LXTA 2F8AA 3VWVA 3IPZA 1RK4A 2H6XA 2B3SA 4IP1A 1M7TA 2C0EA 2H19A 3ZFLA 1MDKA 3WGXA 4PUAA 1TU7A 3R2QA 4OFTA 4RQXA 5HR0A 4OO4A 4EL1A 6GSUA 2QA1A 1SKRB 2FGXA 4XS4B 2GSSA 2GZYA 4BL7B 3M3MA 4YKGA 2OBKA 1V98A 1AUCA 1EP7A 1MD3A 3TOUA 2GSTA 3C1RA 3HYPA 3LW9A 5F06A 4QL9A 1PX6A 4IS0A 1ACVA 5J3RA 5IOWA 4ZILA 2VCVA 2DMMA 1FHEA 3GX0A 5CAXA 2H30A 1TK5B 2H71A 1JZWA 2N5FA 5E59A 2MMNA 5G2ZA 19GSA 5JCGA 1GUMA 1GSQA 3CRTA 4WKWA 1J0FA 4CDOA 1EWXA 1S3DA 4V1Ag 4KSMA 4CY6A 4ECJA 2E2GA 5LNKe 4K7NA 4IHUA 3TRQA 1HYUA 5D93A 3HKRA 2DLXA 3FEUA 3LYKA 1E6BA 2DBCA 1ZYPA 4WBRD 4BWSA 5ECRB 4N0VA 2DMLA 1XWGA 3TB2A 1J08A 2O85A 3IC4A 4FIWA 4ZL9A 2C0GA 4V1Ap 3F3RA 3U6VA 3C1SA 5EY6A 3G9BA 1S3AA 3H4KA 1ZGNA 2NTOA 2R37A 3M9KA 3LWAA 2LNTA 3MIXA 3US3A 1PMTA 4AGSA 3L9UA 1YZXA 3CBUA 2BTOT 1NHYA 5AGYA 2H01A 2LRCA 4X0XA 4K7OA 5CREA 1TK0B 1C72A 5LD0A 3VLNA 4HDEA 2H1DA 3G7JA 3O6TA 3UVHA 2FY6A 3TJKA 2V6KA 4NXIA 2WDUA 1WRYA 1QK8A 4GQCA 1U87A 3PGTA 4KAEA 1SKWB 4MZCA 4WXTA 3HJMA 16GSA 3F4RA 3W8SA 1FOVA 2IMIA 3KH9A 4Z2TA 2DIYA 5BRTA 1A2LA 4KNDA 3D5JA 5DAKA 1XOAA 2VL2A 1OE7A 2C4JA 3MSZA 3CMIA 1M2BA 1GULA 2VL9A 1HNAA 2YZUA 4G0IA 3UBLA 4LA1A 5GAND 2QSIA 1AC1A 5KN0A 2N5BA 4F0CA 1GSSA 1XXUA 1LJRA 3I69A 4MH2A 1Z9HA 7GSSA 2MBSA 4HJMA 1XWKA 1GSFA 1FO5A 1GH2A 2PMTA 2A2SA 5G5FA 4NAXA 3TKSA 2QKEA 3GNJA 2CZ2A 2H70A 1GLPA 5CRGA 2LJAA 1M2AA 4K5RA 2ON5A 2K9FA 1ZZYA 2KHPA 2C80A 1TJDA 2VCQA 4WBJA 3CSJA 4K5SA 3FR6A 4V2NA 2K6VA 1DUGA 2V1MA 3IAS2 1K3YA 1UN2A 2P5RA 5CRHA 4POLA 4X43A 2GSRA 2X64A 1RQMA 4HI7A 1AQXA 1DSBA 2YNXA 4ML1A 3GIXA 4HU7A 1DBYA 4G9HA 2YPMA 1RW1A 3ZRDA 4MF6A 4L5OA 3GSTA 4I5QA 4ZB8A 2B1LA 5D9TA 3RPNA 1MD4A 3F6DA 3FR3A 5H5QA 4MJBA 3QAVA 5COHA 2HSHA 4MABA 4X4JA 3J7Yb 4Q5RA 1HQOA 1I9DA 4TW5A 3EVIA 1ZL9A 3KGKA 3CSHA 4G2EA 2CZ3A 2KP2A 5D9VA 2HI7A 3LGCA 4GSTA 1Q98A 1SENA 3GKXA 4FYBA 1TDIA 3ZZXA 2ON7A 1Z6MA 5B7CA 3HZ4A 4L0UA 4HU9A 5F05A 1HNCA 3ERGA 3VPQA 4MPGA 1SJZA 4G19A 4G0KA 2IJYA 3KCMA 1B4PA 3GYKA 4IJIA 2OBIA 1U88A 2GDRA 2GZPA 3TJBA 4DSRA 2TRXA 4AJ6A 1T1VA 1U3AA 4FO5A 1JLWA 1PN0A 1A2MA 3LQ7A 3R3EA 4K8MA 4I2TA 5ECQB 2BJXA 2I4AA 2LQOA 4PNFA 2VO4A 1V9WA 2KLXA 5DDLA 3F6FA 5G1KA 5IMDA 4K1FA 1GP1A 5KOXA 3H8QA 1GRXA 1G7OA 2H6ZA 2XPDA 2H8LA 4RUVA 1OC9A 3E0UA 1SD9A 2H72A 4EKZA 5H5RA 2PVOC 2HFDA 1F3BA 4RI6A 1ZOFA 1F9MA 2GSQA 1M9BA 2VCWA 3IRAA 3GA4A 1MTCA 1T3BA 1K0OA 5DCHA 1FW1A 4BVYA 4KDUA 2EIQA 1XVQA 3KH7A 3DWVA 6GSWA 1VRSD 13GSA 5DALA 2MMOA 3DIEA 1AQVA 2J9HA 1X9MB 4IJ3A 3VWUA 4F03A 4Q5NA 2R2JA 3D21A 3DXBA 3F4SA 4TVEA 3DEXA 4CW9A 2GVPA 4TXOA 3A3TA 1PN9A 2QA2A 3M1GA 3D4TA 1ZYEA 3K8NA 5IPGA 3RDWA 1DE2A 2FLSA 2IMKA 2FA8A 1EGRA 3A2WA 3E3EA 4BWQA 1YDKA 1G6YA 4J2FA 3UOMA 4KW6A 2XC2A 2JZTA 2OADA 4LL1B 5ID2A 4ML6A 3WT1A 4YAPA 4GQFA 1PA3A 1FB0A 3RAZA 1GTAA 2IL3A 1SYRA 4FYUA 5DAKB 4NHZA 4HQSA 3RHCA 2YWMA 2M72A 2EIOA 3TUEA 3ZTLA 4F9ZA 4NV5A 1SYXA 4BVXA 1R26A 3N9JA 5IO2A 4MZWA 2VM2A 1K3LA 4NHWA 3NIVA 20GSA 2L4QA 5CYYA 1TP9A 2L6CA 2WRTA 2VL3A 3SBCA 2A2RA 4KUNA 4XRAA 2K18A 1XW5A 3LSZA 4IW9A 1PL2A 2NDOA 3GFKA 4KGIA 2P31A 2IN3A 4HZ2A 5ECNB 4O7HA 1TOFA 2L4CA 1G7EA 1AAZA 2RM6A 2R0PA 5GAPD 2LEGA 1Y25A 4PURA 3Q19A 2DJ2A 1NW2A 3CTFA 3APSA 3GTUA 3ZIVA 2F8FA 3HVSA 1UVZA 3UIWA 3RHBA 2B6MA 3TKQA 5DQYA 3ME7A 3QPMA 3UEMA 4MJAA 2V32A 1SK2A 2GLRA 3GH6A 2HRNA 3E9JB 4KDYA 5C04A 2X8CA 2X49A 1JLVA 5B8AA 4MH3A 3PPUA 3PH9A 3LJRA 1G6WA 2IPAA 4XRDA 4KCEA 5AN1A 1GSUA 4EIQA 3V1WA 1GSEA 2X8HA 1BX9A 4I6XA 5DCGA 4USSA 2LKUA 2REMA 1B4QA 2H74A 1Y6EA 1TW9A 3ZMKA 1H75A 4PXOA 4TR0A 5J41A 2B7KA 1EGOA 6GSTA 3TKPA 4OCFA 2YANA 1FVKA 2B5XA 3FYGA 1FOHA 1GWCA 2PUKC 4POMA 1ZYNA 4D73A 3A5WA 4AJ7A 4KF9A 2DKIA 4YQVA 4ZIJA 3LORA 5JCWA 4CHSA 2JSZA 1ML6A 4YH2A 4EIPA 3LXZA 3D0ZA 4NMUA 3ZLPA 4TOPA 4O32A 3ERFA 2V6OA 2H76A 4ECIA 2YP6A 3JCML 5L71A 2O87A 4G0LA 3W8JA 2DJJA 1XFLA 1O73A 3IOSA 2GS3A 3QR6A 5KEJA 1NM3A 3ZVJA 2JL4A 1PRXA 2VLVA 2M80A 3QDNA 1YF0A 3CXGA 2H0HA 1TKDB 1B8XA 1OC9B 2UZ8A 1T7PB 5B6NA 4IN0A 3F8UA 5IM9A 1GSDA 2HZEA 1AIUA 4WEYA 1QFNA 6GSVA 4GRFA 5D8IA 2C1YA 12GSA 1A0FA 3G7IA 1PSQA 4ZBBA 4MNNA 4A5PA 1EOGA 3ZFBA 1J9BA 4BVYB 2WZ9A 2VM1A 2HYXA 1EP8A 4PQHA 4V2LA 1R5AA 4MF7A 4ICYA 2YCDA 5F07A 1XW6A 5IMVA 4EDZA 2CQ9A 4N0ZA 1XIYA 4YAVA 2LSTA 4EUYA 2WULA 3HXSA 4IVFA 1THOA 4TXOB 4NWYA 4N11A 4ECBA 5A4WA 1H4OA 4KX4A 1V57A 4POKA 1Z7RA 1XBSA 2OKAA 2DIZA 3KTBA 2H1BA 3H79A 4I2UA 3A2XA 2IMFA 2LQQA 5ID2B 2A2PA 4BPYA 5IPHA 2YWIA 5CP1A 3L0HA 4ZBDA 2B7JA 1ILOA 3ED3A 4HZ4A 1VF1A 4EXJA 2PGTA 3GX8A 2DC5A 3FZ4A 2AHEA 5DJMA 2M46A 2LNSA 2P0GA 2VOCA 4BVXB 3GKKA 5HR2A 4WETA 4IQ1A 2VUPA 1V2AA 3HA9A 2Z9SA 2CVBA 2CV4A 1GTBA 3IHQA 3GHAA 4OWYA 3IBHA 1QGVA 4XCSA 1Z3EA 3P8WA 3TCOA 1A2JA 3F9UA 5BMUA 2RLIA 1A23A 3PR8A 2CA8A 2CT6A 2H0GA 1Q4JA 1T8EB 2IMEA 1PD21 2QC7A 5EPFA 5KOWA 1TI3A 3VPTA 4GWRA 2L6DA 3KTLA 2FHEA 2C3QA 1I5GA 4EO3A 3TRPA 1M99A 3GTUB 4MJEA 3FMWA 4PQ1A 3MYDA 3Q6OA 1XWAA 2IIYA 2H66A 1U3IA 2H73A 4OD7A 3ZVJD 9GSSA 1CQHA 4YQUA 1T00A 3EU3A 2YZHA 5DJLA 3H93A 3TDGA 5H5SA 1A8YA 4MDCA 1O8WA 2H1GA 2C8UA 4XTSA 1Z5YE 1ERVA 5B6MA 5ENUA 3I43A 3ERWA 3M0FA 2LV3A 2DKHA 3HDCA 1FVJA 3HJOA 1X0RA 2G0FA 2LS5A 2FCHA 3CRUA 2FUG2 2DJ0A 4WF5A 3TOTA 3FZAA 1W89A 2JU5A 2LJKA 1ZMAA 1M0UA 1Z6NA 2HSYA 1YY7A 3P2AA 3EINA 2MMZA 1EV4A 3D6IA 3MNGA 3P90A 2VD0A 5IO0A 3TKRA 5A5KA 2YV7A 1SJIA 4DSQA 5LCZA 3KMOA 1JZDA 4AJ8A 3SWLA 1OC8A 3FW2A 1F3AA 4GXZA 1GL8A 2HRFA 1S3CA 2D2ZA 4LMWA 5IMZA 3UBKA 2AYTA 1GNWA 4Q5QA 5JCUA 1XPVA 1SK1A 3QFBC 2HSMA 3UARA 1PL1A 3ZREA 2ALBA 4G10A 2O8VB 3DD3A 4QQ7A 14GSA 1X5CA 2IWTA 3LG6A 4KSOA 5ELAA 2FWEA 1SKSB 3IDVA 1OVNA 11GSA 1PGTA 4K6XA 1YKCA 3L9SA 4ACSA 3N5OA 1QQ2A 2ES7A 5CO3A 1GTIA 4TKYA 3ZITA 1SD8A 2R6KA 2C0FA 1R5PA 2RIIA 1O7UA 1WE0A 3QFAC 4L5LA 3GRXA 4WF4A 1VF2A 1K0NA 1A0RP 2GZZA 3QMXA 3F4TA 3IE3A 2GT6A 1KBNA 2YJHA 1A8LA 1GUHA 1F37A 2MZCA 4JR4A 3VURA 2B5YA 2K8SA 5D9XA 1N2AA 1DE1A 3KXOA 3A2VA 4ULXA 1SK0A 3KJYA 4K9ZA 4ZB9A 2MYGA 3IK9A 3A5IA 3RBTA 5J5NA 5HFKA 1V40A 5HR3A 4Z2RA 2CAIA 2J23A 2L57A 1M9AA 2NPBA 1WJKA 1KNGA 1VF4A 5G5EA 4RI7A 4JZQA 4IELA 5INYA 2HRAA 4AF2A 3KIJA 1OYJA 4MCUA 2FWGA 4MP4A 4O5UA 2L59A 5JWRB 4MPFA 2VLTA 1GTUA 5F0GA 3EWLA 5G1LA 2GT5A 5E4WA 2I1UA 4BA7A 3GKNA 4JRRA 1F2EA 3EU4A 2XBQA 2R5GA 1PQNA 2O89A 1YF1A 1BEDA 4L0WA 2IFQA 1LBKA 4HJ2A 1TRWA 5GSTA 1O81A 3RPPA 2KP1A 3WD6A 1URMA 2GGTA 3G7YA 4PQIA 5CRWA 3VWWA 3OR5A 4I97A 1TRVA 3J7Yk 4OMVA 3EYTA 1SJ6A 5DQSA 1NSWA 3FHKA 5KN3A 5AIVA 4LMVA 2HLSA 4K0GA 4I8BA 1QMVA 4KH7A 5ECOB 4ILFA 1FB6A 4JR6A 3CTGA 3HD5A 4EF0A 4OO5A 3L4NA 5IOXA 4PGTA 4KE3A 3IR4A 3C71A 2JZSA 4PTSA 4ZL7A 1XW9A 5CRDA 1MEKA 4LLRA 1LU4A 4CY8A 1ZYQB 5FWGA 5ECKB 2L5LA 2C0DA 4OFMA 4PUFC 2WFCA 3TRXA 2WB9A 5G30A 1OE8A 2LUSA 1ON4A 1YEPA 5ECLB 1G0TA 2PN8A 3BJ5A 2GTUA 1W4VA 4ZXGA 1Z7PA 2A4VA 2VCXA 3GURA 1EEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJX A;  1O8X A;  3WGE A;  4DVC A;  2JAC A;  2XBI A;  2X8G A;  2LRT A;  4X1U A;  4ISD A;  5KN1 A;  3WYW A;  1QUW A;  4J56 E;  4GLT A;  4DEJ A;  1VF3 A;  4J57 E;  4TR1 A;  3KD0 A;  5ECS A;  1WIK A;  2YJ7 A;  2H0I A;  5C00 A;  2LJR A;  4N10 A;  1PX7 A;  5ECH B;  3EC3 A;  3UMA A;  5G31 A;  2B1K A;  1E2Y A;  3ME8 A;  5GSS A;  3M8N A;  4OCE A;  3D22 A;  1X5D A;  4EC0 A;  2CVK A;  2P5Q A;  1UC7 A;  3F0I A;  3BCI A;  3HZ8 A;  4OFN A;  4HUA A;  3FKF A;  2CX3 A;  2DJ3 A;  1USB A;  2ZNM A;  2YV9 A;  2E0Q A;  5EL8 A;  3MAK A;  2JZR A;  3GMF A;  5IMA A;  3QAG A;  2HT9 A;  4NV2 A;  4EDY A;  1IYH A;  1NHO A;  3FY7 A;  2FA4 A;  3GL3 A;  3ZL5 A;  2F9S A;  1WWJ A;  2TRC P;  3QAW A;  3I9V 2;  1TTZ A;  1BQ7 A;  1XZO A;  3DKS A;  4WR4 A;  18GS A;  3LEF A;  2HXK A;  2VIM A;  1T4Y A;  22GS A;  4TRX A;  4N30 A;  3LYP A;  4MLY A;  2XPE A;  3QOU A;  3EUR A;  2IY2 A;  2KOK A;  2VL2 C;  1B9X C;  3O3T A;  2VCT A;  3BCK A;  3UJ1 A;  3DVW A;  5IMC A;  2FD3 A;  3S9F A;  3IK7 A;  4KA0 A;  2KUC A;  1K0M A;  2RUF A;  4XIH A;  4NPB A;  1O85 A;  2PER A;  4MZB A;  4LL4 B;  3F63 A;  5B8B A;  4IQA A;  5IQY A;  2OJL A;  3KMN A;  5DAL B;  1HNB A;  2R4V A;  3HHV A;  4HQZ A;  1X9W B;  3TKS C;  3KP8 A;  3VWX A;  2GQK A;  2FNO A;  1XVW A;  3HVX A;  3TKS E;  3H1N A;  4F0B A;  10GS A;  1JHB A;  3C8E A;  4V2M A;  2LTK A;  1PKZ A;  1R7H A;  5JWQ B;  2C3T A;  2I9H A;  1B48 A;  4ZL8 A;  2I3Y A;  2PWJ A;  5D96 A;  3FK8 A;  4L8E A;  3CSI A;  4K2D A;  1MDJ A;  4GSN A;  2L5O A;  3UAP A;  1EEJ A;  2DJK A;  3APQ A;  1TRS A;  2V2G A;  2NBS A;  3LFL A;  3L9V A;  4O92 A;  3KZQ A;  5D73 A;  3UL3 A;  1PKW A;  3FZ5 A;  3BD2 A;  5IMF A;  2IFQ B;  5J9B A;  3TJJ A;  1T4Z A;  2YWN A;  4RQR A;  2PBJ A;  3BOA A;  4F82 A;  4POB A;  4DSS A;  3GKM A;  3WGD A;  1IYI A;  3Q74 A;  3C7M A;  1SU9 A;  1V58 A;  5DBQ A;  1VGL A;  4XHM A;  3AY8 A;  3L78 A;  1K0C A;  2XHF A;  2EIR A;  4GSS A;  1N8J A;  1EV9 A;  5FT3 A;  2YWO A;  2H1A A;  3W6G A;  2AUV A;  3MDK A;  2WCI A;  1XWB A;  1YEX A;  4WR5 A;  2OE3 A;  5GZZ B;  3GSS A;  2BMX A;  3CYN A;  1R4W A;  3QCP A;  1TRU A;  3FR9 A;  3PIN A;  2VLU A;  4JBB A;  4GCI A;  2H75 A;  3EMX A;  2MBT A;  4XS6 A;  1KTE A;  2F51 A;  4KCA A;  1HD2 A;  3IXR A;  1EOH A;  4K0N A;  2FWF A;  2CX4 A;  2GQL A;  3DYR A;  1M2D A;  1SL1 B;  3EE2 A;  4TR1 B;  3HCZ A;  5ECP B;  4O5R A;  1GNE A;  2VD1 A;  2WJU A;  1F6M C;  1OAZ A;  5IIZ A;  3VK9 A;  5KN2 A;  2IMD A;  4MA9 A;  5F8B A;  4ZBA A;  1ERU A;  4XS4 A;  1TI1 A;  2F3M A;  4BL7 A;  4E8H A;  2ZCT A;  3M9J A;  4D73 B;  2YN1 A;  3O76 A;  4JED A;  5FHI A;  3ZIJ A;  1X9S B;  4MF5 A;  1B9Y C;  1EZK A;  3I6A A;  3QD9 A;  3KM6 A;  1CQG A;  1BYE A;  2WS2 A;  5HQP A;  1K0D A;  3P7X A;  3GH9 A;  1X5E A;  4JE1 A;  3D4M A;  4H86 A;  1WMJ A;  5D9W A;  4GF0 A;  2VCZ A;  3ZYW A;  3GV1 A;  4KDX A;  2OE0 A;  3VI7 A;  3EMP A;  3DGQ A;  3HVV A;  3VFI A;  3HJP A;  4Q5F A;  1YJ6 A;  4XS1 A;  4TR4 A;  5J9C A;  2VAF A;  1JZR A;  4MMM A;  2JAD A;  4ID0 A;  2EC4 A;  5ECI B;  3VI5 A;  4KB3 A;  5EVO A;  1ERW A;  4TXV A;  6GSX A;  2AB6 A;  4HOJ A;  3IAM 2;  3NZN A;  2LRN A;  2HZE B;  3KP9 A;  1JFU A;  2E2M A;  2OAC A;  2CAQ A;  2G2Q A;  2AAW A;  3ZML A;  4MJC A;  1THX A;  4TR3 A;  1WOU A;  1AQW A;  1ST9 A;  3DRN A;  1UA5 A;  1QXH A;  3Q18 A;  5AIX A;  2QGV A;  4YQM A;  4IKH A;  5AIS A;  4Z7X A;  1K3O A;  3APO A;  3FZ9 A;  3IA1 A;  17GS A;  8GSS A;  4IBP A;  1BG5 A;  3ISO A;  2JSY A;  5ELG A;  5A4U A;  2IYJ A;  4K7I A;  2RM5 A;  3BBY A;  4JU5 A;  1ZCP A;  1SL2 B;  2MMA A;  3IV4 A;  1K0B A;  1BAY A;  3C73 A;  4E8E A;  4FH8 A;  5CNW A;  2O7K A;  2TIR A;  4HS1 A;  2NVL A;  1XOB A;  3TJG A;  5A4V A;  1ERT A;  2WGR A;  1YKA A;  4IGJ A;  3DML A;  3TJF A;  1A24 A;  2PVQ A;  1FAA A;  3GN3 A;  5ABR A;  2PU9 C;  1GLQ A;  2OE1 A;  4PX1 A;  6GSY A;  2DJ1 A;  2E7P A;  1ABA A;  3F3Q A;  4F2I A;  1OKD A;  1WPI A;  2ZUP A;  6GSS A;  5HFI A;  4QL7 A;  2B5E A;  4DSS B;  3KEB A;  1OC3 A;  5JWO B;  2AJQ B;  2X99 A;  3UVT A;  2HZF A;  4FYC A;  4IP6 A;  1WP0 A;  1MDI A;  2N5A A;  1AXD A;  1GSY A;  1TU8 A;  2FWH A;  1XCC A;  5ECM B;  2HE3 A;  3NOF A;  2K8V A;  1TXX A;  1JZO A;  1KEB A;  2H6Y A;  4EVM A;  5HR1 A;  1SL0 B;  3DVX A;  3FRC A;  2HNL A;  5HFG A;  2PPT A;  2AV4 A;  2V41 A;  4EE0 A;  4TN8 A;  5J4U A;  3TGZ A;  2RUE A;  3GUS A;  1U6T A;  2R3X A;  4MK3 A;  1K0A A;  4HEA 2;  2OA7 A;  2CVD A;  4ZB6 A;  4P3Y B;  1YQ1 A;  1O6J A;  1FG4 A;  2I81 A;  3U5R E;  2C3N A;  3WT2 A;  4ECC A;  1GUK A;  3GL5 A;  5DVB A;  1TK8 B;  3HY2 A;  1OKT A;  1XWC A;  2GQM A;  4PNG A;  1AW9 A;  3MWH A;  2DSA A;  2YOI A;  4GTU A;  3LXT A;  2F8A A;  3VWV A;  3IPZ A;  1RK4 A;  2H6X A;  2B3S A;  4IP1 A;  1M7T A;  2C0E A;  2H19 A;  3ZFL A;  1MDK A;  3WGX A;  4PUA A;  1TU7 A;  3R2Q A;  4OFT A;  4RQX A;  5HR0 A;  4OO4 A;  4EL1 A;  6GSU A;  1SKR B;  2FGX A;  4XS4 B;  2GSS A;  2GZY A;  3M3M A;  2OBK A;  1V98 A;  1AUC A;  1EP7 A;  1MD3 A;  3TOU A;  2GST A;  3C1R A;  3HYP A;  5F06 A;  4QL9 A;  1PX6 A;  4IS0 A;  1ACV A;  5J3R A;  5IOW A;  4ZIL A;  2VCV A;  2DMM A;  1FHE A;  3GX0 A;  5CAX A;  2H30 A;  1TK5 B;  2H71 A;  1JZW A;  2N5F A;  5E59 A;  2MMN A;  5G2Z A;  19GS A;  5JCG A;  1GUM A;  1GSQ A;  3CRT A;  4WKW A;  1J0F A;  4CDO A;  1EWX A;  1S3D A;  4V1A g;  4KSM A;  4ECJ A;  2E2G A;  5LNK e;  4K7N A;  4IHU A;  3TRQ A;  1HYU A;  5D93 A;  3HKR A;  2DLX A;  3FEU A;  3LYK A;  1E6B A;  2DBC A;  4WBR D;  4BWS A;  5ECR B;  4N0V A;  2DML A;  1XWG A;  3TB2 A;  1J08 A;  2O85 A;  3IC4 A;  4FIW A;  4ZL9 A;  2C0G A;  4V1A p;  3F3R A;  3U6V A;  3C1S A;  5EY6 A;  3G9B A;  1S3A A;  3H4K A;  1ZGN A;  2NTO A;  2R37 A;  3M9K A;  3LWA A;  2LNT A;  3US3 A;  1PMT A;  4AGS A;  3L9U A;  1YZX A;  3CBU A;  2BTO T;  1NHY A;  5AGY A;  2H01 A;  2LRC A;  4X0X A;  4K7O A;  5CRE A;  1TK0 B;  1C72 A;  5LD0 A;  3VLN A;  4HDE A;  2H1D A;  3G7J A;  3O6T A;  3UVH A;  2FY6 A;  3TJK A;  2V6K A;  4NXI A;  2WDU A;  1WRY A;  1QK8 A;  4GQC A;  1U87 A;  3PGT A;  4KAE A;  1SKW B;  4MZC A;  4WXT A;  3HJM A;  16GS A;  3F4R A;  3W8S A;  1FOV A;  2IMI A;  3KH9 A;  2DIY A;  1A2L A;  4KND A;  3D5J A;  5DAK A;  1XOA A;  2VL2 A;  1OE7 A;  2C4J A;  3MSZ A;  3CMI A;  1M2B A;  1GUL A;  2VL9 A;  1HNA A;  2YZU A;  3UBL A;  4LA1 A;  5GAN D;  2QSI A;  1AC1 A;  5KN0 A;  2N5B A;  4F0C A;  1GSS A;  1XXU A;  1LJR A;  3I69 A;  4MH2 A;  1Z9H A;  7GSS A;  2MBS A;  4HJM A;  1XWK A;  1GSF A;  1FO5 A;  1GH2 A;  2PMT A;  2A2S A;  5G5F A;  4NAX A;  3TKS A;  2QKE A;  3GNJ A;  2CZ2 A;  2H70 A;  1GLP A;  5CRG A;  2LJA A;  1M2A A;  2ON5 A;  2K9F A;  1ZZY A;  2KHP A;  2C80 A;  1TJD A;  2VCQ A;  4WBJ A;  3CSJ A;  3FR6 A;  4V2N A;  2K6V A;  1DUG A;  2V1M A;  3IAS 2;  1K3Y A;  1UN2 A;  2P5R A;  5CRH A;  4POL A;  4X43 A;  2GSR A;  2X64 A;  1RQM A;  4HI7 A;  1AQX A;  1DSB A;  2YNX A;  4ML1 A;  3GIX A;  4HU7 A;  1DBY A;  4G9H A;  2YPM A;  1RW1 A;  3ZRD A;  4MF6 A;  4L5O A;  3GST A;  4I5Q A;  4ZB8 A;  2B1L A;  5D9T A;  3RPN A;  1MD4 A;  3F6D A;  3FR3 A;  5H5Q A;  4MJB A;  3QAV A;  5COH A;  2HSH A;  4MAB A;  3J7Y b;  4Q5R A;  1HQO A;  1I9D A;  4TW5 A;  3EVI A;  1ZL9 A;  3KGK A;  3CSH A;  4G2E A;  2CZ3 A;  2KP2 A;  5D9V A;  2HI7 A;  3LGC A;  4GST A;  1Q98 A;  1SEN A;  3GKX A;  4FYB A;  1TDI A;  3ZZX A;  2ON7 A;  1Z6M A;  5B7C A;  3HZ4 A;  4L0U A;  4HU9 A;  5F05 A;  1HNC A;  3ERG A;  3VPQ A;  4MPG A;  1SJZ A;  4G19 A;  2IJY A;  3KCM A;  1B4P A;  3GYK A;  4IJI A;  2OBI A;  1U88 A;  2GDR A;  2GZP A;  3TJB A;  4DSR A;  2TRX A;  4AJ6 A;  1T1V A;  1U3A A;  4FO5 A;  1JLW A;  1A2M A;  3LQ7 A;  4I2T A;  4K8M A;  5ECQ B;  2BJX A;  2I4A A;  2LQO A;  4PNF A;  2VO4 A;  1V9W A;  2KLX A;  5DDL A;  3F6F A;  5G1K A;  5IMD A;  4K1F A;  1GP1 A;  3H8Q A;  1GRX A;  1G7O A;  2H6Z A;  2XPD A;  2H8L A;  4RUV A;  1OC9 A;  3E0U A;  1SD9 A;  2H72 A;  4EKZ A;  5H5R A;  2PVO C;  2HFD A;  1F3B A;  4RI6 A;  1ZOF A;  1F9M A;  2GSQ A;  1M9B A;  2VCW A;  3IRA A;  3GA4 A;  1MTC A;  1T3B A;  1K0O A;  5DCH A;  1FW1 A;  4BVY A;  4KDU A;  2EIQ A;  1XVQ A;  3KH7 A;  3DWV A;  6GSW A;  1VRS D;  13GS A;  5DAL A;  2MMO A;  3DIE A;  1AQV A;  2J9H A;  1X9M B;  4IJ3 A;  3VWU A;  4F03 A;  4Q5N A;  2R2J A;  3D21 A;  3DXB A;  3F4S A;  4TVE A;  3DEX A;  4CW9 A;  2GVP A;  4TXO A;  3A3T A;  1PN9 A;  3M1G A;  3D4T A;  1ZYE A;  3K8N A;  5IPG A;  3RDW A;  1DE2 A;  2FLS A;  2IMK A;  2FA8 A;  1EGR A;  3A2W A;  3E3E A;  4BWQ A;  1YDK A;  1G6Y A;  4J2F A;  3UOM A;  4KW6 A;  2XC2 A;  2JZT A;  2OAD A;  4LL1 B;  5ID2 A;  4ML6 A;  3WT1 A;  4YAP A;  4GQF A;  1PA3 A;  1FB0 A;  3RAZ A;  1GTA A;  2IL3 A;  1SYR A;  4FYU A;  5DAK B;  4NHZ A;  4HQS A;  3RHC A;  2YWM A;  2M72 A;  2EIO A;  3TUE A;  3ZTL A;  4F9Z A;  4NV5 A;  1SYX A;  4BVX A;  1R26 A;  3N9J A;  5IO2 A;  4MZW A;  2VM2 A;  1K3L A;  4NHW A;  3NIV A;  20GS A;  2L4Q A;  5CYY A;  1TP9 A;  2L6C A;  2WRT A;  2VL3 A;  3SBC A;  2A2R A;  4KUN A;  4XRA A;  2K18 A;  1XW5 A;  3LSZ A;  4IW9 A;  1PL2 A;  2NDO A;  3GFK A;  4KGI A;  2P31 A;  2IN3 A;  4HZ2 A;  5ECN B;  4O7H A;  1TOF A;  2L4C A;  1G7E A;  1AAZ A;  2RM6 A;  5GAP D;  2LEG A;  1Y25 A;  4PUR A;  3Q19 A;  2DJ2 A;  1NW2 A;  3CTF A;  3APS A;  3GTU A;  3ZIV A;  2F8F A;  3HVS A;  1UVZ A;  3UIW A;  3RHB A;  2B6M A;  3TKQ A;  5DQY A;  3ME7 A;  3QPM A;  3UEM A;  4MJA A;  2V32 A;  1SK2 A;  2GLR A;  3GH6 A;  2HRN A;  3E9J B;  4KDY A;  5C04 A;  2X8C A;  1JLV A;  5B8A A;  4MH3 A;  3PH9 A;  3LJR A;  1G6W A;  2IPA A;  4XRD A;  4KCE A;  5AN1 A;  1GSU A;  3V1W A;  1GSE A;  2X8H A;  1BX9 A;  4I6X A;  5DCG A;  2LKU A;  2REM A;  1B4Q A;  2H74 A;  1Y6E A;  1TW9 A;  3ZMK A;  1H75 A;  4PXO A;  4TR0 A;  5J41 A;  2B7K A;  1EGO A;  6GST A;  3TKP A;  4OCF A;  2YAN A;  1FVK A;  2B5X A;  3FYG A;  1GWC A;  2PUK C;  4POM A;  4D73 A;  3A5W A;  4AJ7 A;  4YQV A;  4ZIJ A;  3LOR A;  5JCW A;  4CHS A;  2JSZ A;  1ML6 A;  4YH2 A;  3LXZ A;  3D0Z A;  4NMU A;  3ZLP A;  4TOP A;  4O32 A;  3ERF A;  2V6O A;  2H76 A;  4ECI A;  2YP6 A;  3JCM L;  5L71 A;  2O87 A;  3W8J A;  2DJJ A;  1XFL A;  1O73 A;  3IOS A;  2GS3 A;  3QR6 A;  5KEJ A;  1NM3 A;  3ZVJ A;  2JL4 A;  1PRX A;  2VLV A;  2M80 A;  3QDN A;  1YF0 A;  3CXG A;  2H0H A;  1TKD B;  1B8X A;  1OC9 B;  1T7P B;  5B6N A;  4IN0 A;  3F8U A;  5IM9 A;  1GSD A;  2HZE A;  1AIU A;  4WEY A;  1QFN A;  6GSV A;  4GRF A;  5D8I A;  2C1Y A;  12GS A;  1A0F A;  3G7I A;  1PSQ A;  4ZBB A;  1EOG A;  3ZFB A;  1J9B A;  2WZ9 A;  2VM1 A;  2HYX A;  1EP8 A;  4PQH A;  4V2L A;  1R5A A;  4MF7 A;  2YCD A;  5F07 A;  1XW6 A;  5IMV A;  4EDZ A;  2CQ9 A;  4N0Z A;  1XIY A;  4YAV A;  2LST A;  4EUY A;  2WUL A;  3HXS A;  4IVF A;  1THO A;  4TXO B;  4NWY A;  4N11 A;  4ECB A;  5A4W A;  1H4O A;  4KX4 A;  1V57 A;  4POK A;  1Z7R A;  1XBS A;  2OKA A;  2DIZ A;  3KTB A;  2H1B A;  3H79 A;  4I2U A;  3A2X A;  2IMF A;  2LQQ A;  5ID2 B;  4BPY A;  5IPH A;  2YWI A;  5CP1 A;  3L0H A;  4ZBD A;  2B7J A;  1ILO A;  3ED3 A;  4HZ4 A;  1VF1 A;  4EXJ A;  2PGT A;  3GX8 A;  2DC5 A;  3FZ4 A;  2AHE A;  5DJM A;  2M46 A;  2LNS A;  2P0G A;  2VOC A;  3GKK A;  5HR2 A;  4WET A;  4IQ1 A;  2VUP A;  1V2A A;  3HA9 A;  2Z9S A;  2CVB A;  2CV4 A;  1GTB A;  3IHQ A;  3GHA A;  4OWY A;  3IBH A;  1QGV A;  4XCS A;  1Z3E A;  3P8W A;  3TCO A;  1A2J A;  3F9U A;  2RLI A;  1A23 A;  3PR8 A;  2CA8 A;  2CT6 A;  2H0G A;  1Q4J A;  1T8E B;  2IME A;  1PD2 1;  2QC7 A;  5EPF A;  1TI3 A;  3VPT A;  4GWR A;  2L6D A;  3KTL A;  2FHE A;  2C3Q A;  1I5G A;  4EO3 A;  3TRP A;  1M99 A;  3GTU B;  4MJE A;  4PQ1 A;  3Q6O A;  1XWA A;  2IIY A;  2H66 A;  1U3I A;  2H73 A;  4OD7 A;  3ZVJ D;  9GSS A;  1CQH A;  4YQU A;  1T00 A;  3EU3 A;  2YZH A;  5DJL A;  3H93 A;  3TDG A;  5H5S A;  1A8Y A;  4MDC A;  1O8W A;  2H1G A;  2C8U A;  4XTS A;  1Z5Y E;  1ERV A;  5B6M A;  5ENU A;  3I43 A;  3ERW A;  3M0F A;  2LV3 A;  3HDC A;  1FVJ A;  3HJO A;  1X0R A;  2G0F A;  2LS5 A;  2FCH A;  3CRU A;  2FUG 2;  2DJ0 A;  4WF5 A;  3TOT A;  3FZA A;  1W89 A;  2JU5 A;  2LJK A;  1ZMA A;  1M0U A;  1Z6N A;  2HSY A;  1YY7 A;  3P2A A;  3EIN A;  2MMZ A;  1EV4 A;  3D6I A;  3MNG A;  3P90 A;  2VD0 A;  5IO0 A;  3TKR A;  5A5K A;  2YV7 A;  1SJI A;  4DSQ A;  5LCZ A;  3KMO A;  1JZD A;  4AJ8 A;  3SWL A;  1OC8 A;  3FW2 A;  1F3A A;  4GXZ A;  1GL8 A;  2HRF A;  1S3C A;  2D2Z A;  4LMW A;  5IMZ A;  3UBK A;  2AYT A;  1GNW A;  4Q5Q A;  5JCU A;  1XPV A;  1SK1 A;  3QFB C;  3UAR A;  1PL1 A;  3ZRE A;  2ALB A;  4G10 A;  2O8V B;  3DD3 A;  4QQ7 A;  14GS A;  1X5C A;  2IWT A;  3LG6 A;  4KSO A;  5ELA A;  2FWE A;  1SKS B;  3IDV A;  1OVN A;  11GS A;  1PGT A;  4K6X A;  1YKC A;  3L9S A;  4ACS A;  3N5O A;  1QQ2 A;  2ES7 A;  5CO3 A;  1GTI A;  4TKY A;  3ZIT A;  1SD8 A;  2R6K A;  2C0F A;  1R5P A;  2RII A;  1O7U A;  1WE0 A;  3QFA C;  4L5L A;  3GRX A;  4WF4 A;  1VF2 A;  1K0N A;  1A0R P;  2GZZ A;  3QMX A;  3F4T A;  3IE3 A;  2GT6 A;  1KBN A;  2YJH A;  1A8L A;  1GUH A;  1F37 A;  2MZC A;  4JR4 A;  3VUR A;  2B5Y A;  2K8S A;  5D9X A;  1N2A A;  1DE1 A;  3KXO A;  3A2V A;  4ULX A;  1SK0 A;  3KJY A;  4K9Z A;  4ZB9 A;  2MYG A;  3IK9 A;  3RBT A;  5J5N A;  5HFK A;  1V40 A;  5HR3 A;  2CAI A;  2J23 A;  2L57 A;  1M9A A;  2NPB A;  1WJK A;  1KNG A;  1VF4 A;  5G5E A;  4RI7 A;  4JZQ A;  4IEL A;  5INY A;  4AF2 A;  3KIJ A;  1OYJ A;  4MCU A;  2FWG A;  4MP4 A;  2L59 A;  5JWR B;  4MPF A;  2VLT A;  1GTU A;  5F0G A;  3EWL A;  5G1L A;  2GT5 A;  5E4W A;  2I1U A;  4BA7 A;  3GKN A;  4JRR A;  1F2E A;  3EU4 A;  2XBQ A;  2R5G A;  1PQN A;  2O89 A;  1YF1 A;  1BED A;  4L0W A;  2IFQ A;  1LBK A;  4HJ2 A;  1TRW A;  5GST A;  1O81 A;  3RPP A;  2KP1 A;  3WD6 A;  1URM A;  2GGT A;  3G7Y A;  4PQI A;  5CRW A;  3VWW A;  3OR5 A;  4I97 A;  1TRV A;  3J7Y k;  4OMV A;  3EYT A;  1SJ6 A;  5DQS A;  1NSW A;  3FHK A;  5KN3 A;  5AIV A;  4LMV A;  2HLS A;  4K0G A;  4I8B A;  1QMV A;  4KH7 A;  5ECO B;  4ILF A;  1FB6 A;  4JR6 A;  3CTG A;  3HD5 A;  4EF0 A;  4OO5 A;  3L4N A;  5IOX A;  4PGT A;  4KE3 A;  3IR4 A;  3C71 A;  2JZS A;  4ZL7 A;  1XW9 A;  5CRD A;  1MEK A;  4LLR A;  1LU4 A;  1ZYQ B;  5FWG A;  5ECK B;  2L5L A;  2C0D A;  4OFM A;  4PUF C;  2WFC A;  3TRX A;  2WB9 A;  5G30 A;  1OE8 A;  2LUS A;  1ON4 A;  1YEP A;  5ECL B;  1G0T A;  2PN8 A;  3BJ5 A;  2GTU A;  1W4V A;  4ZXG A;  1Z7P A;  2A4V A;  2VCX A;  3GUR A;  1EEM A; 
#chains in the Genus database with same CATH topology
 3QK9 A;  2SAR A;  1BJX A;  1UGH I;  1O8X A;  3WGE A;  4DVC A;  2JAC A;  2XBI A;  2X8G A;  2LRT A;  4X1U A;  4ISD A;  2CFD A;  5KN1 A;  3WYW A;  1A67 A;  1FW7 A;  1QUW A;  3G0K A;  1ROV A;  2XSH B;  4GLT A;  4J56 E;  4DEJ A;  1IQ8 A;  1VF3 A;  1N9J A;  4J57 E;  2CG0 A;  5AI1 A;  4HZ9 B;  4TR1 A;  3KD0 A;  5ECS A;  1WIK A;  2YJ7 A;  2JQ5 A;  4HAA A;  2V1L A;  2H0I A;  5C00 A;  2W9P A;  2LJR A;  4N10 A;  4K2X A;  1EA2 A;  2IUJ A;  1PX7 A;  5ECH B;  3EC3 A;  3UMA A;  1M1X B;  5G31 A;  2B1K A;  1C7H A;  3GAX A;  5AYS C;  1E2Y A;  2R0C A;  3EPT A;  3ME8 A;  5GSS A;  3M8N A;  2OTL 3;  1I2G A;  4OCE A;  1M1K 4;  2CFK A;  3D22 A;  1X5D A;  4EC0 A;  3CCU 3;  2CVK A;  2P5Q A;  1UC7 A;  3F0I A;  3BCI A;  3HZ8 A;  2BO9 B;  4OFN A;  4HUA A;  1O7W B;  4EV2 A;  3FKF A;  2CX3 A;  2DJ3 A;  1USB A;  2ZNM A;  2P09 A;  1FA3 A;  2YV9 A;  3EF8 A;  2E0Q A;  5EL8 A;  4XB5 A;  1BRK A;  4GL6 A;  2JZR A;  3MAK A;  1STD A;  3GMF A;  3K5T A;  5IMA A;  3QAG A;  2HT9 A;  1STF I;  1SIH A;  4NV2 A;  1OF5 A;  4EDY A;  1IYH A;  1NHO A;  3FY7 A;  2FA4 A;  3HII A;  1SPU A;  3GL3 A;  3ZL5 A;  2F9S A;  1Z1S A;  1YIJ 3;  1WWJ A;  2TRC P;  3QAW A;  3I9V 2;  4YKF A;  2BMR B;  1TTZ A;  3A5E A;  1BQ7 A;  1XZO A;  4DKI A;  3DKS A;  4WR4 A;  18GS A;  2I9W A;  1LNH A;  3LEF A;  2HXK A;  1BOX A;  2VIM A;  2W56 A;  4XBT A;  2Z7A A;  1T4Y A;  5TGN A;  22GS A;  4TRX A;  1C54 A;  3FG1 A;  2QIY A;  4N30 A;  3LYP A;  1FGR A;  4MLY A;  2X4A A;  5JBS A;  1PU4 A;  3EB8 A;  2KAA A;  3PYJ A;  2XPE A;  3QOU A;  3EUR A;  3CME 3;  2IY2 A;  4HYZ A;  4WHA A;  2KOK A;  2VL2 C;  1B9X C;  3O3T A;  3EHC A;  2VCT A;  3BCK A;  3UJ1 A;  4BTX A;  3DVW A;  5IMC A;  2FD3 A;  3WA3 A;  3S9F A;  4XBX A;  2OQE C;  3IK7 A;  4KA0 A;  2KUC A;  1K0M A;  4LZI A;  2RUF A;  4XIH A;  4NPB A;  1O85 A;  2XRX B;  2PER A;  4MZB A;  4IT7 A;  4LL4 B;  3F63 A;  5BU4 A;  1EQK A;  5B8B A;  4IQA A;  5IQY A;  2OJL A;  1BNG A;  1VZZ A;  3KMN A;  5DAL B;  3DGL A;  1HNB A;  2R4V A;  5BXQ A;  3HHV A;  4HQZ A;  4O5Q A;  1O7P B;  1X9W B;  1OHO A;  3TKS C;  3KP8 A;  3VWX A;  4EW5 A;  2GQK A;  2FNO A;  2FGT A;  1XVW A;  4OVM A;  3HVX A;  3TKS E;  3H1N A;  4F0B A;  10GS A;  3B4O A;  3SXX A;  1JHB A;  3C8E A;  4V2M A;  2PNC A;  2LTK A;  1PKZ A;  4WYK B;  3CD6 3;  1S5A A;  1R7H A;  1TFK A;  5JWQ B;  2C3T A;  2I9H A;  1B48 A;  4ZL8 A;  3LTD A;  1EUI C;  2I3Y A;  2PWJ A;  2KF4 A;  5HGR A;  1JKG B;  3SED A;  5D96 A;  3FK8 A;  4L8E A;  3CSI A;  2HMO B;  4K2D A;  3NV0 A;  1MDJ A;  7STD A;  4GSN A;  3CCR 3;  1YI2 3;  2L5O A;  3UAP A;  1EEJ A;  2DJK A;  3APQ A;  1TRP A;  1TRS A;  2V2G A;  2NBS A;  3LFL A;  1ZX2 A;  3L9V A;  2Y74 A;  1DVC A;  3RNT A;  2A15 A;  4O92 A;  3KZQ A;  5D73 A;  3NBJ A;  3MG2 A;  3UL3 A;  1PKW A;  3FZ5 A;  3BD2 A;  5IMF A;  2IFQ B;  1IVU A;  5J9B A;  3TJJ A;  4G1M B;  1T4Z A;  2YWN A;  2M7O A;  4RQR A;  7GSP A;  1G02 A;  3HI7 A;  2PBJ A;  1DYU A;  3BOA A;  4OUQ A;  4F82 A;  4POB A;  4DSS A;  4NRE A;  2WOH A;  4GHO A;  3B8L A;  1K73 4;  3GKM A;  3CU3 A;  3WGD A;  1IYI A;  1D6Z A;  3Q74 A;  2O3O A;  4OK0 A;  3C7M A;  1SU9 A;  1V58 A;  3T8N A;  1E3V A;  1I2E A;  4HM4 B;  2XR8 B;  5DBQ A;  1VGL A;  4XHM A;  1RCK A;  3AY8 A;  4N6O B;  3L78 A;  1K0C A;  2XHF A;  2EIR A;  3MHE A;  4GSS A;  1N8J A;  1EV9 A;  3IC8 A;  5FT3 A;  3KSE D;  2YWO A;  1YVS A;  2H1A A;  3W6G A;  1B2U A;  3KKG A;  2AUV A;  3MDK A;  2WCI A;  1XWB A;  1DE3 A;  3G8Z A;  1YEX A;  4WR5 A;  2OE3 A;  1LOV A;  5GZZ B;  2RSX A;  3F7S A;  4KFE A;  3GSS A;  2BMX A;  5AYR B;  3CYN A;  3Q1C A;  4HM3 B;  3S28 A;  4KT3 B;  1R4W A;  3QCP A;  1TRU A;  3FR9 A;  1NWW A;  1UGI A;  2R0G A;  3EN8 A;  1RGK A;  1YGE A;  3PIN A;  4O8S A;  2VLU A;  4JBB A;  4GCI A;  2H75 A;  3EMX A;  2MBT A;  4XS6 A;  1KTE A;  2F51 A;  4KCA A;  1HD2 A;  1OAC A;  3IXR A;  2BMO B;  3PS8 A;  5LC6 A;  3KE7 A;  1B2M A;  2L4V A;  1EOH A;  4K0N A;  1RGE A;  2FWF A;  3DZL A;  2CX4 A;  1RN1 A;  1RKY A;  4HM2 B;  4Z2U A;  4HBR A;  2GQL A;  3DYR A;  3KCH A;  1M2D A;  1TFO A;  1SL1 B;  3MSO A;  3EE2 A;  1FGO A;  4TR1 B;  3HCZ A;  5ECP B;  1LXE A;  4O5R A;  1JBS A;  5FGO A;  1GNE A;  2VD1 A;  2WJU A;  1F6M C;  1OAZ A;  5IIZ A;  3VK9 A;  5KN2 A;  2IMD A;  1VQM 3;  4MA9 A;  1R4C A;  5F8B A;  4N6M A;  4ZBA A;  1WMO A;  1YJN 3;  4L8P A;  1ERU A;  4XS4 A;  1TIJ A;  1TI1 A;  2A4H A;  1Q86 4;  2F3M A;  4BL7 A;  4E8H A;  5AEU B;  1TRQ A;  2ZCT A;  3M9J A;  4D73 B;  2YN1 A;  3O76 A;  4JED A;  5FHI A;  3ZIJ A;  4MJD A;  4MF5 A;  1B9Y C;  1X9S B;  2YFI B;  1EZK A;  3I6A A;  1Y4K A;  2BHM A;  2W2C A;  3QD9 A;  1FGM A;  3KM6 A;  3T8U A;  1CQG A;  1BYE A;  1GMQ A;  2WS2 A;  5ELU A;  5HQP A;  1K0D A;  3P7X A;  3GH9 A;  1X5E A;  1OF5 B;  2KF5 A;  4JE1 A;  3D4M A;  3F8X A;  1WMJ A;  4H86 A;  5D9W A;  1RLS A;  4GF0 A;  1VQ9 3;  2VCZ A;  1B21 A;  1FYS A;  3IPT A;  3ZYW A;  3GV1 A;  4KDX A;  2OE0 A;  1VQO 3;  1BAO A;  2OTJ 3;  3VI7 A;  3EMP A;  3DGQ A;  3HVV A;  3VFI A;  1IDP A;  3HJP A;  2F56 A;  4Q5F A;  3IJE B;  1WMN A;  4HVN A;  3ALA A;  3OX9 A;  1GD4 A;  3NX0 A;  1YJ6 A;  5M1A A;  4XS1 A;  4TR4 A;  5J9C A;  2W56 B;  5CF2 A;  1S3R A;  4HM6 B;  2VAF A;  3UB1 A;  4X2O A;  8RNT A;  1JZR A;  4LYL B;  1ZGX A;  4J9A A;  2RFR A;  1LOX A;  2JAD A;  4MMM A;  4ID0 A;  2EC4 A;  5ECI B;  3VI5 A;  5KP1 A;  4KB3 A;  4L7K A;  5EVO A;  3CCS 3;  1ERW A;  4TXV A;  6GSX A;  1W5Z A;  2AB6 A;  4HOJ A;  2LYX A;  3CQF A;  3IAM 2;  3NZN A;  2LRN A;  1BNJ A;  1T2I A;  2HZE B;  3KP9 A;  3NM2 A;  1MWS A;  3UL5 A;  1JFU A;  3CC4 3;  2E2M A;  3D4A A;  2OAC A;  2CAQ A;  2G2Q A;  2AAW A;  3ZML A;  4MJC A;  1MWT A;  1THX A;  4TR3 A;  1WOU A;  1AQW A;  1ST9 A;  3DRN A;  3CNX A;  2GEY A;  1UA5 A;  3IHG A;  1QXH A;  3Q18 A;  5AIX A;  2QGV A;  1QMA A;  4YQM A;  2C11 A;  3A76 A;  4IKH A;  5AIS A;  4Z7X A;  1K3O A;  3APO A;  3FZ9 A;  2W0Q A;  17GS A;  3IA1 A;  8GSS A;  4IBP A;  3EBT A;  1BG5 A;  3ISO A;  4PEJ A;  3MYT A;  4AKY A;  2JSY A;  5ELG A;  1WTH A;  5A4U A;  4BL3 A;  2IYJ A;  4K7I A;  2RM5 A;  1UCJ A;  2BIR A;  1N8Q A;  1VQP 3;  3LT8 A;  2P38 A;  3BBY A;  4JU5 A;  1ZCP A;  1SL2 B;  4EC6 A;  2MMA A;  3IV4 A;  1K0B A;  1BAY A;  3C73 A;  1I2F A;  2W6J H;  3I0Y A;  4E8E A;  4FH8 A;  5CNW A;  2O7K A;  2TIR A;  1IV9 A;  4HS1 A;  2NVL A;  1XOB A;  4FCZ A;  3TJG A;  3FZW A;  1BU4 A;  1N5P A;  5A4V A;  1SII A;  1ERT A;  2WGR A;  4N6N B;  1YKA A;  4IGJ A;  3DML A;  3TJF A;  1A24 A;  2PVQ A;  1FAA A;  3OWS A;  4RNY A;  1US1 A;  1K28 A;  3GN3 A;  5ABR A;  2PU9 C;  1GLQ A;  2OE1 A;  4PX1 A;  6GSY A;  2DJ1 A;  2E7P A;  1ABA A;  3F3Q A;  4F2I A;  4KVH A;  3BLZ A;  1OKD A;  3DGY A;  2WGO A;  1T5Y A;  1WPI A;  4FQU A;  2ZUP A;  2ML5 A;  2P0M A;  5HFI A;  6GSS A;  4MMZ B;  4QL7 A;  1MOL A;  2B5E A;  4DSS B;  3D3L A;  3KEB A;  1OC3 A;  5JWO B;  2AJQ B;  2X99 A;  3UVT A;  1RGA A;  2HZF A;  4FYC A;  3WHO A;  4IP6 A;  1WP0 A;  1MDI A;  1UUV B;  2N5A A;  2KCD A;  1AXD A;  1GSY A;  1TU8 A;  2XSO B;  2FWH A;  4K1V A;  1XCC A;  4FMB A;  4AKZ A;  5ECM B;  2CWV A;  2HE3 A;  3NOF A;  2K8V A;  1TXX A;  1VQ4 3;  1JZO A;  3WOE B;  1A90 A;  1KEB A;  5IEP A;  2H6Y A;  4EVM A;  5HR1 A;  1SL0 B;  3DVX A;  3FRC A;  2HNL A;  5HFG A;  2PPT A;  2AV4 A;  2V41 A;  4Q53 A;  3LXU X;  4EE0 A;  4TN8 A;  5J4U A;  3TGZ A;  2C10 A;  2RUE A;  3HZP A;  4R80 A;  3GUS A;  1U6T A;  2R3X A;  4MK3 A;  1CYV A;  1K0A A;  2CG1 A;  1YJ9 3;  2PZV A;  4HEA 2;  2OA7 A;  2CVD A;  4ZB6 A;  1BRJ A;  4P3Y B;  1YQ1 A;  4KFF A;  1O6J A;  1FG4 A;  2I81 A;  3U5R E;  2C3N A;  3WT2 A;  3DY5 A;  4ECC A;  5ELJ A;  2HRK A;  1GUK A;  3GL5 A;  2P05 A;  3FGY A;  3V92 A;  5DVB A;  3EQQ B;  1TK8 B;  4JRF A;  4AEQ A;  1BSA A;  4HM1 B;  1JNQ A;  3HY2 A;  3WOD G;  1OKT A;  3FSD A;  1XWC A;  1LOW A;  2GQM A;  1RGG A;  4PNG A;  1AW9 A;  7RNT A;  1D6Y A;  4BIK A;  3MWH A;  3D9R A;  2DSA A;  2YOI A;  4FCM A;  2LQV A;  4GTU A;  3LXT A;  2F8A A;  3DM8 A;  3K7C A;  3VWV A;  3IPZ A;  1RK4 A;  2H6X A;  2B3S A;  1K41 A;  4IP1 A;  1M7T A;  2C0E A;  2H19 A;  5A0O B;  3ZFL A;  2INX A;  4HJL B;  1RNB A;  1MDK A;  3WGX A;  4PUA A;  1WQL B;  3DGO A;  1TU7 A;  4RBN A;  5AEW B;  1BNE A;  3JVC A;  3R2Q A;  4OFT A;  1GSP A;  1Q9E A;  4N6L A;  3LOY A;  4RQX A;  5HR0 A;  5IG0 A;  3BIR A;  4OO4 A;  4EL1 A;  6GSU A;  2QA1 A;  3S67 A;  3CCJ 3;  1SKR B;  2KF3 A;  2FGX A;  2GSS A;  4XS4 B;  2GZY A;  4BL7 B;  3M3M A;  1DET A;  4YKG A;  2OBK A;  1V98 A;  1AUC A;  1W2Z A;  1EP7 A;  1MD3 A;  3TOU A;  2GST A;  3C1R A;  4GB5 A;  3HYP A;  3LW9 A;  5F06 A;  1ROA A;  1IV7 A;  3CCE 3;  4QL9 A;  4KFD A;  3ECF A;  3VGN A;  1PX6 A;  4IS0 A;  1GYB A;  3DUK A;  3F14 A;  1ACV A;  5J3R A;  5IOW A;  4ZIL A;  2VCV A;  1YVB I;  3EC9 A;  2DMM A;  2HMJ B;  1FHE A;  3AHW A;  4HM0 B;  3GX0 A;  5CAX A;  3BNB A;  2H30 A;  1TK5 B;  2H71 A;  1JZW A;  2N5F A;  1SAR A;  2O9U X;  3BB9 A;  5E59 A;  2MMN A;  5G2Z A;  19GS A;  5JCG A;  1GUM A;  5AIH A;  2QEX 3;  1GSQ A;  2YFJ B;  3CRT A;  4WKW A;  1UDI I;  1J0F A;  4CDO A;  1EWX A;  1S3D A;  4V1A g;  4KSM A;  4CY6 A;  4ECJ A;  2E2G A;  4KZ1 A;  1MGW A;  1IT7 A;  5LNK e;  4K7N A;  4IHU A;  4R4K A;  3TRQ A;  1HYU A;  5D93 A;  3WMD A;  1HKX A;  3HKR A;  2DLX A;  1RCL A;  1TUH A;  1DMN A;  2FNQ A;  3FEU A;  1E6B A;  2DBC A;  3LYK A;  1ZYP A;  4WBR D;  2IMJ A;  4BWS A;  5ECR B;  1RMS A;  2XGN A;  1UCI A;  4N0V A;  1OHP A;  5CXO A;  2DML A;  1XWG A;  1W6G A;  3TB2 A;  1SQW A;  1J08 A;  2O85 A;  3MPH A;  3WOF B;  4EV5 A;  3IC4 A;  4FIW A;  4ZL9 A;  2F99 A;  1QJG A;  2C0G A;  4V1A p;  3F3R A;  3AMO A;  3U6V A;  4TX4 A;  1I3I A;  3C1S A;  5EY6 A;  3G9B A;  4FMC A;  1S3A A;  3H4K A;  1QVF 2;  1M90 4;  2RNT A;  1ZGN A;  2NTO A;  1KC8 4;  2R37 A;  3M9K A;  4HSC X;  3LWA A;  2LNT A;  3MIX A;  2GEX A;  3US3 A;  1PMT A;  4AGS A;  3L9U A;  4WFO A;  3X3Z A;  1YZX A;  3CBU A;  2BTO T;  1OPY A;  5EQL A;  2OOV C;  2UUG C;  1NHY A;  1TP6 A;  4CPK A;  5AGY A;  2D42 A;  2H01 A;  2LRC A;  4X0X A;  4LEH A;  5EVH A;  4K7O A;  5CRE A;  1TK0 B;  1C72 A;  5LD0 A;  3VLN A;  4HDE A;  2H1D A;  3G7J A;  3NHX A;  3O6T A;  3UVH A;  1LVN A;  2FY6 A;  1NNV A;  3TJK A;  1KSI A;  3SOA A;  2V6K A;  4NXI A;  2WDU A;  1WRY A;  1X1U A;  1QK8 A;  1JN5 A;  4GQC A;  3RDE A;  1U87 A;  3PGT A;  3GWR A;  4KAE A;  1YIT 3;  1SKW B;  4MZC A;  4WXT A;  3HJM A;  16GS A;  3X42 A;  3F4R A;  3W8S A;  1FOV A;  1I3F A;  2IMI A;  3KH9 A;  1VQL 3;  4Z2T A;  2DIY A;  5BRT A;  3G16 A;  1A2L A;  5G2G A;  4KND A;  4L8O A;  1XG8 A;  1G96 A;  3D5J A;  1BIR A;  2ML6 A;  5DAK A;  4K61 A;  1XOA A;  2VL2 A;  1I70 A;  1OE7 A;  2C4J A;  3MSZ A;  2UGI A;  3CMI A;  2Z6B A;  1M2B A;  1Q40 A;  4XM4 A;  5D83 A;  1GUL A;  2VL9 A;  1HNA A;  2R41 A;  5RNT A;  1IQY A;  4J8T A;  5HOH A;  2YZU A;  2STD A;  4G0I A;  3MWZ A;  2AAD A;  3FKA A;  3UBL A;  4LA1 A;  5GAN D;  6STD A;  4ZM8 A;  1KD1 4;  2QSI A;  2RGQ A;  1AC1 A;  5KN0 A;  1B27 A;  1HU9 A;  2N5B A;  4F0C A;  1GSS A;  3JUP A;  1XXU A;  1LJR A;  3I69 A;  2Y73 A;  4MH2 A;  1Z9H A;  7GSS A;  2MBS A;  4HJM A;  1UCK A;  1XWK A;  1GSF A;  1FO5 A;  2E2V A;  1GH2 A;  2PMT A;  2A2S A;  2QGU A;  3BND A;  5G5F A;  1QAL A;  4NAX A;  3TKS A;  2QKE A;  3GNJ A;  4FCJ A;  3HVN A;  3NQY A;  1GOV A;  1TU5 A;  2CZ2 A;  1GOY A;  1M3J A;  2H70 A;  1GLP A;  5CRG A;  1AV4 A;  2LJA A;  2E2U A;  3CPO A;  1M2A A;  3RGR A;  4K5R A;  2ON5 A;  2K9F A;  1ZZY A;  2KHP A;  2C80 A;  1VQK 3;  1TJD A;  2VCQ A;  4WBJ A;  3CSJ A;  4K5S A;  1UUG B;  3FR6 A;  3FG3 A;  4V2N A;  4H61 A;  3G4S 3;  2K6V A;  1DUG A;  3N54 B;  2V1M A;  3IAS 2;  1K3Y A;  1UN2 A;  3OWU A;  2P5R A;  5CRH A;  4POL A;  5JPP A;  1W01 A;  3G6E 3;  4X43 A;  2GSR A;  2X64 A;  3ZFZ A;  1RQM A;  4HI7 A;  1AQX A;  2XGL A;  1DSB A;  1JB4 A;  5DRV A;  2YNX A;  4ML1 A;  1Q7Y 4;  3GIX A;  3IMA B;  5CF1 A;  4BL2 A;  4HU7 A;  1DBY A;  4G9H A;  2YPM A;  1RW1 A;  1Q81 4;  3ZRD A;  4MF6 A;  1O7G B;  4L5O A;  3GST A;  4I5Q A;  4ZB8 A;  4BIR A;  2B1L A;  5D9T A;  3RPN A;  2CWU A;  2CKF B;  1IVV A;  1MD4 A;  3F6D A;  3FR3 A;  5H5Q A;  4MJB A;  1K8A 4;  1PFO A;  1GOU A;  3QAV A;  5COH A;  2HSH A;  4MAB A;  5AII A;  4X4J A;  3J7Y b;  2Z77 A;  2K3D A;  1W7C A;  4BU4 A;  5DRE A;  4Q5R A;  1BSC A;  1HQO A;  4EXR A;  1I9D A;  1A2K A;  4TW5 A;  3EVI A;  1ZL9 A;  3KGK A;  3CSH A;  2BU4 A;  4G2E A;  2CZ3 A;  3GRD A;  2KP2 A;  1FUS A;  5D9V A;  3DXO A;  4EYC A;  2CX0 A;  3OWY A;  2HI7 A;  3LGC A;  4GST A;  1Q98 A;  2HML B;  3E99 A;  1SEN A;  3GKX A;  4FYB A;  1CYU A;  1TDI A;  3ZZX A;  5LC7 A;  4IPB A;  2ON7 A;  1Z6M A;  5B7C A;  3X41 A;  3HZ4 A;  4L0U A;  4HU9 A;  5F05 A;  1UI7 A;  1HNC A;  3ERG A;  3VPQ A;  4MPG A;  1SJZ A;  4G19 A;  4G0K A;  2IJY A;  3KCM A;  1B4P A;  3FF2 A;  2XF3 A;  3LZA A;  3GYK A;  4IJI A;  2OBI A;  1U88 A;  2KXG A;  2GDR A;  2GZP A;  1BAN A;  3TJB A;  1ULJ B;  4DSR A;  2TRX A;  4AJ6 A;  1MWU A;  1T1V A;  1U3A A;  4FO5 A;  1JLW A;  1PN0 A;  1A2M A;  3LQ7 A;  3R3E A;  4I2T A;  4K8M A;  5ECQ B;  2BJX A;  1X1X A;  2I4A A;  2B24 B;  2LQO A;  4PNF A;  2VO4 A;  3CPW 2;  1V9W A;  2KLX A;  4HZB B;  5DDL A;  3F6F A;  1M9G A;  1BRG A;  5G1K A;  5IMD A;  1BGS A;  1QAF A;  1GP1 A;  4K1F A;  5KOX A;  3H8Q A;  1GRX A;  1G7O A;  2H6Z A;  4FR9 A;  4X2H A;  2XPD A;  2H8L A;  4RUV A;  1R4Y A;  1VQ6 3;  3NM7 A;  1OC9 A;  3E0U A;  3H3H A;  1SD9 A;  2H72 A;  3AMO B;  4EKZ A;  5BIR A;  2XH9 A;  5H5R A;  3MG3 A;  2PVO C;  5I97 A;  2HFD A;  1F3B A;  3OV4 A;  4RI6 A;  1ZOF A;  3LH4 A;  8CHO A;  1F9M A;  2GSQ A;  1M9B A;  2VCW A;  3IRA A;  3GA4 A;  1MTC A;  2D1W A;  1VQN 3;  1MGR A;  4N6V 0;  1T3B A;  1RHL A;  1K0O A;  5DCH A;  1FW1 A;  2SBL A;  4BVY A;  3KZT A;  4U13 A;  4KDU A;  2EIQ A;  1XVQ A;  3KH7 A;  3DWV A;  6GSW A;  1GY7 A;  2C4B A;  1VRS D;  3Q2P A;  13GS A;  4XDV A;  3FH1 A;  5DAL A;  2MMO A;  3DIE A;  1AQV A;  1W6Y A;  1YNV X;  2J9H A;  1X9M B;  3DGM A;  4IJ3 A;  3NXJ A;  3VWU A;  4F03 A;  1CQS A;  4Q5N A;  2R2J A;  3J7Y d;  3CXC 2;  3D21 A;  3NV0 B;  1GS3 A;  4EBG A;  3DXB A;  3F4S A;  4TVE A;  3DEX A;  4CW9 A;  2GVP A;  3A3T A;  4TXO A;  1PN9 A;  2QA2 A;  3M1G A;  1ASK A;  3D4T A;  1ZYE A;  3K8N A;  5IF6 A;  1YGW A;  5IPG A;  3WR2 A;  3H51 A;  3RDW A;  1DE2 A;  2FLS A;  2IMK A;  2FA8 A;  1JN5 B;  3A2W A;  3E3E A;  1EGR A;  4BWQ A;  3N8B A;  1YDK A;  1G6Y A;  4J2F A;  3UOM A;  5M19 A;  4KW6 A;  2XC2 A;  4FMD A;  2JZT A;  2OAD A;  4CCV A;  4LL1 B;  3VF1 A;  5ID2 A;  4I4K A;  4ML6 A;  3WT1 A;  4YAP A;  2F5W A;  1PA3 A;  1GMR A;  4GQF A;  2K54 A;  1FB0 A;  2GBX B;  3RAZ A;  1GTA A;  3GZX B;  1FGT A;  2IL3 A;  1SYR A;  1OGX A;  1DVD A;  4FYU A;  2GXF A;  5DAK B;  1B3S A;  4NHZ A;  1CH0 A;  3O8Y A;  4HQS A;  3RHC A;  2YWM A;  1RJO A;  1O7N B;  3VSY A;  2EIO A;  2M72 A;  3TUE A;  1UUW B;  1OCV A;  3ZTL A;  2E2T A;  4F9Z A;  4NV5 A;  1SYX A;  1Q40 B;  4BVX A;  2F98 A;  3SYU A;  1R26 A;  3N9J A;  5IO2 A;  4MZW A;  2VM2 A;  2CFG A;  1JB5 A;  1K3L A;  4NHW A;  3NIV A;  4HM7 B;  1K9M 4;  3PZW A;  1EG9 B;  20GS A;  1IK3 A;  1LQG C;  2L4Q A;  5CYY A;  4BTY A;  1TP9 A;  1A2V A;  2L6C A;  2WRT A;  4H3U A;  2ZHX B;  2VL3 A;  3BNE A;  3SBC A;  2A2R A;  4KUN A;  1VQ8 3;  2K18 A;  4XRA A;  1XW5 A;  3LSZ A;  4IW9 A;  1PL2 A;  2NDO A;  3GFK A;  2YFL B;  4KGI A;  4N6U A;  2P31 A;  2IN3 A;  4HZ2 A;  1N8R 4;  2W04 A;  3K63 A;  5ECN B;  4O7H A;  2JDI H;  1TOF A;  2L4C A;  2K0M A;  1G7E A;  1AAZ A;  2RM6 A;  2FXT A;  2R0P A;  5GAP D;  2LEG A;  1Y25 A;  2GU1 A;  4PUR A;  3Q19 A;  2DJ2 A;  1NW2 A;  1IU7 A;  3CTF A;  3APS A;  3GTU A;  3LT9 A;  3ZIV A;  2F8F A;  3HVS A;  5FW5 A;  3LTB A;  1UVZ A;  3UIW A;  5STD A;  3SVA A;  4WWU C;  1RRL A;  3RHB A;  2B6M A;  1V74 A;  3TKQ A;  5DQY A;  3ME7 A;  3QPM A;  4J5G A;  3UEM A;  4MJA A;  1CEW I;  2V32 A;  1SK2 A;  2GLR A;  3PGB A;  3GH6 A;  1X1Y A;  2HRN A;  3E9J B;  4KDY A;  5C04 A;  2X8C A;  2X49 A;  4HOH A;  1JLV A;  5B8A A;  4MH3 A;  3PPU A;  3PH9 A;  3EE1 A;  3LJR A;  1W6C A;  1G6W A;  2IPA A;  4RNZ A;  4XRD A;  4K90 B;  4KCE A;  2J8X B;  3AGN A;  5AN1 A;  1GSU A;  9RNT A;  4EIQ A;  1O7H B;  3JUQ A;  3V1W A;  1GSE A;  2X8H A;  1BX9 A;  4I6X A;  3JUO A;  1JV2 B;  5DCG A;  1ULI B;  4IIA A;  4USS A;  2LKU A;  3L0R A;  2REM A;  1B4Q A;  1BSD A;  2B1X B;  2H74 A;  1NDO B;  1Y6E A;  1TW9 A;  3ZMK A;  1H75 A;  4PXO A;  4TR0 A;  5J41 A;  2W03 A;  2B7K A;  1Q42 A;  6GST A;  1EGO A;  3TKP A;  5KP4 A;  4OCF A;  3KII A;  2YAN A;  1I0V A;  1FVK A;  2B5X A;  3FYG A;  1OGZ A;  1N5H A;  1FOH A;  1M3I A;  3U1W A;  1GWC A;  3F8H A;  2PUK C;  4POM A;  1ZYN A;  4D73 A;  5AIG A;  3T0U A;  3D5I A;  3A5W A;  4AJ7 A;  1O7M B;  4KF9 A;  2DKI A;  3I55 3;  4YQV A;  4ZIJ A;  3KSP A;  3LOR A;  2GU3 A;  4R9K A;  5JCW A;  3HK4 A;  1NU3 A;  3FCS B;  4CHS A;  2JSZ A;  1ML6 A;  4YH2 A;  4EIP A;  3G71 3;  3JUN A;  3LXZ A;  2RBI A;  1U5O A;  3D0Z A;  4NMU A;  3ZLP A;  4TOP A;  4O32 A;  3ERF A;  2V6O A;  1TTO A;  2H76 A;  1PYL A;  2UX0 A;  1JB2 A;  4ECI A;  1OUN A;  2YP6 A;  3JCM L;  2GBW B;  5IEN A;  5L71 A;  2O87 A;  4G0L A;  3W8J A;  2DJJ A;  3PCS A;  1XFL A;  2BMQ B;  1O73 A;  3OW2 2;  3LTC A;  3IOS A;  3EN1 B;  1UCL A;  1RGC A;  1DMQ A;  2WGQ A;  1RTU A;  3CC2 3;  2GS3 A;  1B2Z A;  3QR6 A;  3BU4 A;  1NM3 A;  5KEJ A;  4LGQ A;  5AIF A;  1KWI A;  3ZVJ A;  2ZA4 A;  2JL4 A;  1PRX A;  2VLV A;  3UL6 A;  2M80 A;  3QDN A;  2CH9 A;  1YF0 A;  3CXG A;  2H0H A;  2CC3 A;  6GSP A;  3HX8 A;  3CCL 3;  1TKD B;  5M18 A;  1RNT A;  1B8X A;  1OC9 B;  2UZ8 A;  1T7P B;  4HKV B;  3V99 A;  5B6N A;  4IN0 A;  2XFT A;  4O02 B;  3F8U A;  1GSD A;  2HZE A;  5IM9 A;  3LTA A;  1AIU A;  4WEY A;  1QFN A;  6GSV A;  4GRF A;  5D8I A;  3QRD A;  2C1Y A;  12GS A;  1A0F A;  3G7I A;  1S72 3;  1PSQ A;  4ZBB A;  4MNN A;  4A5P A;  1EOG A;  3ZFB A;  4WP5 A;  1J9B A;  2Q07 A;  3S27 A;  4BVY B;  2F86 B;  1VQ7 3;  2WZ9 A;  2VM1 A;  2R4I A;  2HYX A;  2HMN B;  1UI8 A;  1EP8 A;  1IT8 A;  4PQH A;  1GY6 A;  4V2L A;  1R5A A;  4MF7 A;  4ICY A;  3DMC A;  4ORL A;  1RN4 A;  2YCD A;  5F07 A;  1XW6 A;  5IMV A;  1N9E A;  4XDW A;  4EDZ A;  6RNT A;  2CQ9 A;  4N0Z A;  1JBR A;  1XIY A;  5IG5 A;  4YAV A;  2LST A;  4EUY A;  2WUL A;  2KF6 A;  3HXS A;  4IVF A;  1THO A;  1I0X A;  4TXO B;  4NWY A;  4N11 A;  1AQZ A;  5EEO A;  4ECB A;  4BTW A;  5A4W A;  1H4O A;  4KX4 A;  1V57 A;  5KP3 A;  4POK A;  1Z7R A;  3DGN A;  1XBS A;  2OKA A;  2DIZ A;  2MF7 A;  1BUQ A;  2H1B A;  3H79 A;  3KTB A;  4I2U A;  3ZG5 A;  1B2S A;  3A2X A;  2IMF A;  2LQQ A;  5ID2 B;  2A2P A;  4BPY A;  1JJ2 2;  4K1U A;  5IPH A;  2YWI A;  1E97 A;  4HM8 B;  5CP1 A;  3FF0 A;  3L0H A;  3GSP A;  2OWP A;  4ZBD A;  2B7J A;  1ILO A;  3ED3 A;  1LNI A;  1W00 A;  4HZ4 A;  1VF1 A;  4EXJ A;  3UNL A;  1NB3 I;  4RNT A;  1MWR A;  3X3X A;  2PGT A;  3GX8 A;  2DC5 A;  3FZ4 A;  2AHE A;  5DJM A;  2OQE A;  2M46 A;  1SJW A;  2F4Y A;  3SOY A;  2LNS A;  1RGH A;  2P0G A;  2VOC A;  4BVX B;  3GKK A;  5HR2 A;  1GD3 A;  4WET A;  4O2H A;  4IQ1 A;  2VUP A;  5IG3 A;  1V2A A;  3HA9 A;  2Z9S A;  2CVB A;  2CV4 A;  1GTB A;  3IHQ A;  1D6U A;  3GHA A;  4OWY A;  3MKI A;  3D5G A;  1F8N A;  1QGV A;  1Z3E A;  3IBH A;  4XCS A;  3P8W A;  1RDS A;  3TCO A;  1A2J A;  4FMA A;  3F9U A;  5BMU A;  2RLI A;  1A23 A;  4MEI A;  3DH2 A;  1WMP A;  3PR8 A;  2CA8 A;  2CT6 A;  2H0G A;  1Q4J A;  1RGL A;  1T8E B;  2IME A;  1PD2 1;  2QC7 A;  5EPF A;  1RRH A;  1IQX A;  2OCT A;  5KOW A;  2ZL8 A;  2OOV A;  1TI3 A;  3VPT A;  3GZB A;  4GWR A;  1ZO2 A;  2L6D A;  1BUJ A;  4JF8 A;  2XFS A;  3KTL A;  2FHE A;  2C3Q A;  1VQ5 3;  5BVB A;  1I5G A;  4EO3 A;  3TRP A;  1M99 A;  3GTU B;  1W02 A;  2CFL A;  2CHC A;  3FMW A;  4MJE A;  4PQ1 A;  1BNR A;  3MYD A;  1NB5 I;  1A2P A;  3Q6O A;  1XWA A;  2MC8 A;  2IIY A;  1PY3 A;  3PXM A;  3URP A;  2H66 A;  1U3I A;  2H73 A;  3LYG A;  1U8C B;  4OD7 A;  4R9L A;  1YJW 3;  1BVI A;  3ZVJ D;  3S5C A;  3K9M C;  9GSS A;  2BNG A;  1BNI A;  1CQH A;  4YQU A;  3HIG A;  3K0Z A;  4N3V A;  1T00 A;  3EU3 A;  2ZDJ A;  2YZH A;  5DJL A;  3H93 A;  3FG4 A;  3TDG A;  1AY7 A;  2XEP A;  4R1K A;  1A8Y A;  5H5S A;  4MDC A;  1O8W A;  2H1G A;  2C8U A;  1B20 A;  3RGA A;  4XTS A;  1Z5Y E;  3WA2 X;  1ERV A;  5B6M A;  5ENU A;  3HOH A;  3KFQ C;  3D79 A;  1BRS A;  2CFW A;  4N6T A;  3I43 A;  3ERW A;  3M0F A;  3OXA A;  2LV3 A;  2KRT A;  1FUT A;  2DKH A;  3HDC A;  1FVJ A;  3HJO A;  3CCV 3;  1X0R A;  2G0F A;  2LS5 A;  4STD A;  2FCH A;  3MG1 A;  3CRU A;  2FUG 2;  2CW9 A;  2HMM B;  2DJ0 A;  4WF5 A;  2P0X A;  3TOT A;  2W9Q A;  3FLJ A;  3FZA A;  1BSB A;  1W89 A;  2JU5 A;  1JRQ A;  2LJK A;  1ZMA A;  1M0U A;  1Z6N A;  2HSY A;  1YY7 A;  3P2A A;  3EIN A;  5IEO A;  2MMZ A;  3CCM 3;  1EV4 A;  3D6I A;  3MNG A;  3P90 A;  3B7C A;  3GZR A;  3JUM A;  1Q82 4;  1BSE A;  2VD0 A;  5IO0 A;  2WOF A;  3TKR A;  5A5K A;  2YV7 A;  1SJI A;  4DSQ A;  4MMY B;  5LCZ A;  3CNM A;  3KMO A;  1BNS A;  1JZD A;  4AJ8 A;  3SWL A;  1OC8 A;  3FW2 A;  1F3A A;  4GXZ A;  1GL8 A;  3UJM A;  1QAK A;  2HRF A;  1EKM A;  2F5M A;  2RCD A;  1DMM A;  1S3C A;  2D2Z A;  4LMW A;  5IMZ A;  3UBK A;  2AYT A;  1GNW A;  4Q5Q A;  2IA7 A;  1W4N A;  3N9H A;  5JCU A;  1XPV A;  1SK1 A;  3QFB C;  5D81 A;  2HSM A;  3UAR A;  3B4P A;  1PL1 A;  1WNH A;  3F7X A;  2ALB A;  3ZRE A;  1OH0 A;  4G10 A;  1LOY A;  4LMI A;  2O8V B;  3DD3 A;  4QQ7 A;  4LSO A;  5IG4 A;  14GS A;  1X5C A;  2IWT A;  3LG6 A;  4KSO A;  1NO3 A;  5ELA A;  2FWE A;  1SKS B;  3IDV A;  1OVN A;  11GS A;  5IER A;  2AAE A;  1PGT A;  4K6X A;  1YKC A;  3F40 A;  3L9S A;  4ACS A;  3F9S A;  1KQS 2;  3N5O A;  1FGQ A;  1QQ2 A;  1GMP A;  3LML A;  2ES7 A;  5CO3 A;  2WO0 A;  3ZG0 A;  1GTI A;  4TKY A;  3ZIT A;  1SD8 A;  3STD A;  2R6K A;  2C0F A;  1R5P A;  2RII A;  1O7U A;  1WE0 A;  3QFA C;  3AGO A;  1GY5 A;  4L5L A;  3GRX A;  4WF4 A;  1VF2 A;  5GSP A;  1ISK A;  1T2H A;  1K0N A;  1A0R P;  2GZZ A;  3QMX A;  3I56 3;  1E3R A;  5IW9 A;  3F4T A;  3IE3 A;  2GT6 A;  1KBN A;  2YJH A;  1A8L A;  1GUH A;  1AVK A;  1IYY A;  1F37 A;  2MZC A;  4JR4 A;  3VUR A;  1PFP A;  2B5Y A;  2K8S A;  5D9X A;  1N2A A;  1DE1 A;  1W2B 2;  3KXO A;  3A2V A;  4ULX A;  1SK0 A;  3KJY A;  4K9Z A;  4ZB9 A;  2MYG A;  1UW1 A;  3IK9 A;  3A5I A;  3RBT A;  3X3Y A;  5J5N A;  4HM5 B;  5HFK A;  1V40 A;  5HR3 A;  4Z2R A;  3BNC A;  2Z76 A;  2CAI A;  2J23 A;  2L57 A;  1M9A A;  2NPB A;  1MNL A;  1WJK A;  1KNG A;  4MMX B;  1VF4 A;  2QA4 3;  5G5E A;  4RI7 A;  4RZM A;  1BRI A;  1RSN A;  4IEL A;  4JZQ A;  5INY A;  4WYK A;  2HRA A;  4AF2 A;  3KIJ A;  1BNF A;  1OYJ A;  4QWT A;  3KN4 A;  3ROB A;  4MCU A;  2FWG A;  4MP4 A;  1JBT A;  1JKG A;  4O5U A;  1IVW A;  2L59 A;  5JWR B;  4J5K A;  4MPF A;  1NJI 4;  2VLT A;  1GTU A;  5F0G A;  3EWL A;  5G1L A;  2GT5 A;  3M8C A;  3S29 A;  5E4W A;  2I1U A;  2CWT A;  5CLK A;  4BA7 A;  3NUV A;  4NHF A;  1BRN L;  3ER7 A;  1ZS7 A;  3GKN A;  4JRR A;  1AVL A;  1YHQ 3;  1F2E A;  3EU4 A;  2XBQ A;  2R5G A;  1PQN A;  3EJV A;  1YF1 A;  2O89 A;  1B2X A;  1BED A;  5D82 A;  4L0W A;  1BRH A;  3GZY B;  3EX9 A;  2IFQ A;  2HOH A;  2CX1 A;  1L5G B;  1RGF A;  1LBK A;  4HJ2 A;  1TRW A;  5GST A;  4O3V A;  1O81 A;  3RPP A;  5JPU A;  2KP1 A;  3SX1 A;  3CMA 3;  1IVX A;  3WD6 A;  1URM A;  2GGT A;  3G7Y A;  4PQI A;  3NQZ A;  5CRW A;  3VWW A;  3OR5 A;  4I97 A;  1TRV A;  3PCR A;  3J7Y k;  4XBY A;  4OMV A;  3EYT A;  2HMK B;  1SJ6 A;  5DQS A;  1RN7 A;  1NSW A;  3FHK A;  1FZU A;  3U97 A;  4CDL A;  2GSP A;  5KN3 A;  5AIV A;  3NBR A;  4LMV A;  2L1S A;  2HLS A;  3Q90 A;  1I8V A;  4K0G A;  4I8B A;  1X1W A;  1QMV A;  3WDG B;  1HZ1 A;  4KH7 A;  5ECO B;  4ILF A;  1FB6 A;  4JR6 A;  3CTG A;  3HD5 A;  1VQQ A;  3X40 A;  4EF0 A;  4OO5 A;  1LQM B;  3L4N A;  5IOX A;  4PGT A;  4KE3 A;  3IR4 A;  3C71 A;  1Q7H A;  3NBB A;  2JZS A;  4PTS A;  1OHS A;  4ZL7 A;  1XW9 A;  5CRD A;  5CK6 A;  1J2B A;  3V98 A;  1MEK A;  3SLU A;  4CJN A;  4LLR A;  2CIU A;  1LU4 A;  4CY8 A;  1ZYQ B;  5FWG A;  5ECK B;  1AR0 A;  2L5L A;  2C0D A;  1FUW A;  2IUK A;  1LRA A;  3AHS A;  3EBY A;  4OFM A;  4GSP A;  4PUF C;  1QVG 2;  3CC7 3;  2WFC A;  3TRX A;  2WB9 A;  5G30 A;  1OE8 A;  2LUS A;  1ON4 A;  1YEP A;  3Q3F A;  5ECL B;  1G0T A;  2PN8 A;  3BJ5 A;  2YX9 A;  2GTU A;  1W4V A;  4ZXG A;  1Z7P A;  2CK3 H;  2A4V A;  3CCQ 3;  2VCX A;  1HYF A;  3GUR A;  2BT3 A;  1EEM A; 
#chains in the Genus database with same CATH homology
 1BJX A;  1O8X A;  3WGE A;  4DVC A;  2JAC A;  2XBI A;  2X8G A;  2LRT A;  4X1U A;  4ISD A;  5KN1 A;  3WYW A;  1QUW A;  4J56 E;  4GLT A;  4DEJ A;  1VF3 A;  4J57 E;  4TR1 A;  3KD0 A;  5ECS A;  1WIK A;  2YJ7 A;  2H0I A;  5C00 A;  2LJR A;  4N10 A;  4K2X A;  1PX7 A;  5ECH B;  3EC3 A;  3UMA A;  5G31 A;  2B1K A;  1E2Y A;  2R0C A;  3EPT A;  3ME8 A;  5GSS A;  3M8N A;  4OCE A;  3D22 A;  1X5D A;  4EC0 A;  2CVK A;  2P5Q A;  1UC7 A;  3F0I A;  3BCI A;  3HZ8 A;  4OFN A;  4HUA A;  3FKF A;  2CX3 A;  2DJ3 A;  1USB A;  2ZNM A;  2YV9 A;  2E0Q A;  5EL8 A;  3MAK A;  2JZR A;  3GMF A;  5IMA A;  3QAG A;  2HT9 A;  4NV2 A;  4EDY A;  1IYH A;  1NHO A;  3FY7 A;  2FA4 A;  3GL3 A;  3ZL5 A;  2F9S A;  1WWJ A;  2TRC P;  3QAW A;  3I9V 2;  4YKF A;  1TTZ A;  1BQ7 A;  1XZO A;  3DKS A;  4WR4 A;  18GS A;  3LEF A;  2HXK A;  2VIM A;  1T4Y A;  22GS A;  4TRX A;  4N30 A;  3LYP A;  4MLY A;  2X4A A;  2XPE A;  3QOU A;  3EUR A;  2IY2 A;  2KOK A;  2VL2 C;  1B9X C;  3O3T A;  2VCT A;  3BCK A;  3UJ1 A;  3DVW A;  5IMC A;  2FD3 A;  3S9F A;  3IK7 A;  4KA0 A;  2KUC A;  1K0M A;  2RUF A;  4XIH A;  4NPB A;  1O85 A;  2PER A;  4MZB A;  4LL4 B;  3F63 A;  5B8B A;  4IQA A;  5IQY A;  2OJL A;  3KMN A;  5DAL B;  1HNB A;  2R4V A;  3HHV A;  4HQZ A;  4O5Q A;  1X9W B;  3TKS C;  3KP8 A;  3VWX A;  2GQK A;  2FNO A;  1XVW A;  3HVX A;  3TKS E;  3H1N A;  4F0B A;  10GS A;  1JHB A;  3C8E A;  4V2M A;  2LTK A;  1PKZ A;  1R7H A;  5JWQ B;  2C3T A;  2I9H A;  1B48 A;  4ZL8 A;  2I3Y A;  2PWJ A;  5D96 A;  3FK8 A;  4L8E A;  3CSI A;  4K2D A;  1MDJ A;  4GSN A;  2L5O A;  3UAP A;  1EEJ A;  2DJK A;  3APQ A;  1TRS A;  2V2G A;  2NBS A;  3LFL A;  3L9V A;  4O92 A;  3KZQ A;  5D73 A;  3UL3 A;  1PKW A;  3FZ5 A;  3BD2 A;  5IMF A;  2IFQ B;  5J9B A;  3TJJ A;  1T4Z A;  2YWN A;  4RQR A;  2PBJ A;  3BOA A;  4F82 A;  4POB A;  4DSS A;  3GKM A;  3WGD A;  1IYI A;  3Q74 A;  3C7M A;  1SU9 A;  1V58 A;  5DBQ A;  1VGL A;  4XHM A;  3AY8 A;  3L78 A;  1K0C A;  2XHF A;  2EIR A;  4GSS A;  1N8J A;  1EV9 A;  3IC8 A;  5FT3 A;  2YWO A;  2H1A A;  3W6G A;  2AUV A;  3MDK A;  2WCI A;  1XWB A;  1YEX A;  4WR5 A;  2OE3 A;  5GZZ B;  3GSS A;  2BMX A;  3CYN A;  1R4W A;  3QCP A;  1TRU A;  3FR9 A;  2R0G A;  3PIN A;  2VLU A;  4JBB A;  4GCI A;  2H75 A;  3EMX A;  2MBT A;  4XS6 A;  1KTE A;  2F51 A;  4KCA A;  1HD2 A;  3IXR A;  1EOH A;  4K0N A;  2FWF A;  2CX4 A;  4Z2U A;  2GQL A;  3DYR A;  1M2D A;  1SL1 B;  3EE2 A;  4TR1 B;  3HCZ A;  5ECP B;  4O5R A;  1GNE A;  2VD1 A;  2WJU A;  1F6M C;  1OAZ A;  5IIZ A;  3VK9 A;  5KN2 A;  2IMD A;  4MA9 A;  5F8B A;  4ZBA A;  1ERU A;  4XS4 A;  1TI1 A;  2A4H A;  2F3M A;  4BL7 A;  4E8H A;  2ZCT A;  3M9J A;  4D73 B;  2YN1 A;  3O76 A;  4JED A;  5FHI A;  3ZIJ A;  1X9S B;  4MF5 A;  1B9Y C;  1EZK A;  3I6A A;  3QD9 A;  3KM6 A;  1CQG A;  1BYE A;  2WS2 A;  5HQP A;  1K0D A;  3P7X A;  3GH9 A;  1X5E A;  4JE1 A;  3D4M A;  4H86 A;  1WMJ A;  5D9W A;  4GF0 A;  2VCZ A;  3ZYW A;  3GV1 A;  4KDX A;  2OE0 A;  3VI7 A;  3EMP A;  3DGQ A;  3HVV A;  3VFI A;  3HJP A;  4Q5F A;  1YJ6 A;  4XS1 A;  4TR4 A;  5J9C A;  2VAF A;  1JZR A;  4MMM A;  2JAD A;  4ID0 A;  2EC4 A;  5ECI B;  3VI5 A;  4KB3 A;  5EVO A;  1ERW A;  4TXV A;  6GSX A;  2AB6 A;  4HOJ A;  3IAM 2;  3NZN A;  2LRN A;  2HZE B;  3KP9 A;  1JFU A;  2E2M A;  2OAC A;  2CAQ A;  2G2Q A;  2AAW A;  3ZML A;  4MJC A;  1THX A;  4TR3 A;  1WOU A;  1AQW A;  1ST9 A;  3DRN A;  1UA5 A;  3IHG A;  1QXH A;  3Q18 A;  5AIX A;  2QGV A;  4YQM A;  4IKH A;  5AIS A;  4Z7X A;  1K3O A;  3APO A;  3FZ9 A;  3IA1 A;  17GS A;  8GSS A;  4IBP A;  1BG5 A;  3ISO A;  2JSY A;  5ELG A;  5A4U A;  2IYJ A;  4K7I A;  2RM5 A;  3BBY A;  4JU5 A;  1ZCP A;  1SL2 B;  2MMA A;  3IV4 A;  1K0B A;  1BAY A;  3C73 A;  4E8E A;  4FH8 A;  5CNW A;  2O7K A;  2TIR A;  4HS1 A;  2NVL A;  1XOB A;  3TJG A;  5A4V A;  1ERT A;  2WGR A;  1YKA A;  4IGJ A;  3DML A;  3TJF A;  1A24 A;  2PVQ A;  1FAA A;  3GN3 A;  5ABR A;  2PU9 C;  1GLQ A;  2OE1 A;  4PX1 A;  6GSY A;  2DJ1 A;  2E7P A;  1ABA A;  3F3Q A;  4F2I A;  1OKD A;  1WPI A;  4FQU A;  2ZUP A;  6GSS A;  5HFI A;  4QL7 A;  2B5E A;  4DSS B;  3KEB A;  1OC3 A;  5JWO B;  2AJQ B;  2X99 A;  3UVT A;  2HZF A;  4FYC A;  4IP6 A;  1WP0 A;  1MDI A;  2N5A A;  1AXD A;  1GSY A;  1TU8 A;  2FWH A;  1XCC A;  5ECM B;  2HE3 A;  3NOF A;  2K8V A;  1TXX A;  1JZO A;  1KEB A;  2H6Y A;  4EVM A;  5HR1 A;  1SL0 B;  3DVX A;  3FRC A;  2HNL A;  5HFG A;  2PPT A;  2AV4 A;  2V41 A;  4EE0 A;  4TN8 A;  5J4U A;  3TGZ A;  2RUE A;  3GUS A;  1U6T A;  2R3X A;  4MK3 A;  1K0A A;  4HEA 2;  2OA7 A;  2CVD A;  4ZB6 A;  4P3Y B;  1YQ1 A;  1O6J A;  1FG4 A;  2I81 A;  3U5R E;  2C3N A;  3WT2 A;  4ECC A;  2HRK A;  1GUK A;  3GL5 A;  5DVB A;  1TK8 B;  3HY2 A;  1OKT A;  1XWC A;  2GQM A;  4PNG A;  1AW9 A;  3MWH A;  2DSA A;  2YOI A;  4GTU A;  3LXT A;  2F8A A;  3VWV A;  3IPZ A;  1RK4 A;  2H6X A;  2B3S A;  4IP1 A;  1M7T A;  2C0E A;  2H19 A;  3ZFL A;  1MDK A;  3WGX A;  4PUA A;  1TU7 A;  3R2Q A;  4OFT A;  4RQX A;  5HR0 A;  4OO4 A;  4EL1 A;  6GSU A;  2QA1 A;  1SKR B;  2FGX A;  4XS4 B;  2GSS A;  2GZY A;  4BL7 B;  3M3M A;  4YKG A;  2OBK A;  1V98 A;  1AUC A;  1EP7 A;  1MD3 A;  3TOU A;  2GST A;  3C1R A;  3HYP A;  3LW9 A;  5F06 A;  4QL9 A;  1PX6 A;  4IS0 A;  1ACV A;  5J3R A;  5IOW A;  4ZIL A;  2VCV A;  2DMM A;  1FHE A;  3GX0 A;  5CAX A;  2H30 A;  1TK5 B;  2H71 A;  1JZW A;  2N5F A;  5E59 A;  2MMN A;  5G2Z A;  19GS A;  5JCG A;  1GUM A;  1GSQ A;  3CRT A;  4WKW A;  1J0F A;  4CDO A;  1EWX A;  1S3D A;  4V1A g;  4KSM A;  4CY6 A;  4ECJ A;  2E2G A;  5LNK e;  4K7N A;  4IHU A;  3TRQ A;  1HYU A;  5D93 A;  3HKR A;  2DLX A;  3FEU A;  3LYK A;  1E6B A;  2DBC A;  1ZYP A;  4WBR D;  4BWS A;  5ECR B;  4N0V A;  2DML A;  1XWG A;  3TB2 A;  1J08 A;  2O85 A;  3IC4 A;  4FIW A;  4ZL9 A;  2C0G A;  4V1A p;  3F3R A;  3U6V A;  3C1S A;  5EY6 A;  3G9B A;  1S3A A;  3H4K A;  1ZGN A;  2NTO A;  2R37 A;  3M9K A;  3LWA A;  2LNT A;  3MIX A;  3US3 A;  1PMT A;  4AGS A;  3L9U A;  1YZX A;  3CBU A;  2BTO T;  1NHY A;  5AGY A;  2H01 A;  2LRC A;  4X0X A;  4K7O A;  5CRE A;  1TK0 B;  1C72 A;  5LD0 A;  3VLN A;  4HDE A;  2H1D A;  3G7J A;  3O6T A;  3UVH A;  2FY6 A;  3TJK A;  2V6K A;  4NXI A;  2WDU A;  1WRY A;  1QK8 A;  4GQC A;  1U87 A;  3PGT A;  4KAE A;  1SKW B;  4MZC A;  4WXT A;  3HJM A;  16GS A;  3F4R A;  3W8S A;  1FOV A;  2IMI A;  3KH9 A;  4Z2T A;  2DIY A;  5BRT A;  1A2L A;  4KND A;  3D5J A;  5DAK A;  1XOA A;  2VL2 A;  1OE7 A;  2C4J A;  3MSZ A;  3CMI A;  1M2B A;  1GUL A;  2VL9 A;  1HNA A;  2YZU A;  4G0I A;  3UBL A;  4LA1 A;  5GAN D;  2QSI A;  1AC1 A;  5KN0 A;  2N5B A;  4F0C A;  1GSS A;  1XXU A;  1LJR A;  3I69 A;  4MH2 A;  1Z9H A;  7GSS A;  2MBS A;  4HJM A;  1XWK A;  1GSF A;  1FO5 A;  1GH2 A;  2PMT A;  2A2S A;  5G5F A;  4NAX A;  3TKS A;  2QKE A;  3GNJ A;  2CZ2 A;  2H70 A;  1GLP A;  5CRG A;  2LJA A;  1M2A A;  4K5R A;  2ON5 A;  2K9F A;  1ZZY A;  2KHP A;  2C80 A;  1TJD A;  2VCQ A;  4WBJ A;  3CSJ A;  4K5S A;  3FR6 A;  4V2N A;  2K6V A;  1DUG A;  2V1M A;  3IAS 2;  1K3Y A;  1UN2 A;  2P5R A;  5CRH A;  4POL A;  4X43 A;  2GSR A;  2X64 A;  1RQM A;  4HI7 A;  1AQX A;  1DSB A;  2YNX A;  4ML1 A;  3GIX A;  4HU7 A;  1DBY A;  4G9H A;  2YPM A;  1RW1 A;  3ZRD A;  4MF6 A;  4L5O A;  3GST A;  4I5Q A;  4ZB8 A;  2B1L A;  5D9T A;  3RPN A;  1MD4 A;  3F6D A;  3FR3 A;  5H5Q A;  4MJB A;  3QAV A;  5COH A;  2HSH A;  4MAB A;  4X4J A;  3J7Y b;  4Q5R A;  1HQO A;  1I9D A;  4TW5 A;  3EVI A;  1ZL9 A;  3KGK A;  3CSH A;  4G2E A;  2CZ3 A;  2KP2 A;  5D9V A;  2HI7 A;  3LGC A;  4GST A;  1Q98 A;  1SEN A;  3GKX A;  4FYB A;  1TDI A;  3ZZX A;  2ON7 A;  1Z6M A;  5B7C A;  3HZ4 A;  4L0U A;  4HU9 A;  5F05 A;  1HNC A;  3ERG A;  3VPQ A;  4MPG A;  1SJZ A;  4G19 A;  4G0K A;  2IJY A;  3KCM A;  1B4P A;  3GYK A;  4IJI A;  2OBI A;  1U88 A;  2GDR A;  2GZP A;  3TJB A;  4DSR A;  2TRX A;  4AJ6 A;  1T1V A;  1U3A A;  4FO5 A;  1JLW A;  1PN0 A;  1A2M A;  3LQ7 A;  3R3E A;  4K8M A;  4I2T A;  5ECQ B;  2BJX A;  2I4A A;  2LQO A;  4PNF A;  2VO4 A;  1V9W A;  2KLX A;  5DDL A;  3F6F A;  5G1K A;  5IMD A;  4K1F A;  1GP1 A;  5KOX A;  3H8Q A;  1GRX A;  1G7O A;  2H6Z A;  2XPD A;  2H8L A;  4RUV A;  1OC9 A;  3E0U A;  1SD9 A;  2H72 A;  4EKZ A;  5H5R A;  2PVO C;  2HFD A;  1F3B A;  4RI6 A;  1ZOF A;  1F9M A;  2GSQ A;  1M9B A;  2VCW A;  3IRA A;  3GA4 A;  1MTC A;  1T3B A;  1K0O A;  5DCH A;  1FW1 A;  4BVY A;  4KDU A;  2EIQ A;  1XVQ A;  3KH7 A;  3DWV A;  6GSW A;  1VRS D;  13GS A;  5DAL A;  2MMO A;  3DIE A;  1AQV A;  2J9H A;  1X9M B;  4IJ3 A;  3VWU A;  4F03 A;  4Q5N A;  2R2J A;  3D21 A;  3DXB A;  3F4S A;  4TVE A;  3DEX A;  4CW9 A;  2GVP A;  4TXO A;  3A3T A;  1PN9 A;  2QA2 A;  3M1G A;  3D4T A;  1ZYE A;  3K8N A;  5IPG A;  3RDW A;  1DE2 A;  2FLS A;  2IMK A;  2FA8 A;  1EGR A;  3A2W A;  3E3E A;  4BWQ A;  1YDK A;  1G6Y A;  4J2F A;  3UOM A;  4KW6 A;  2XC2 A;  2JZT A;  2OAD A;  4LL1 B;  5ID2 A;  4ML6 A;  3WT1 A;  4YAP A;  4GQF A;  1PA3 A;  1FB0 A;  3RAZ A;  1GTA A;  2IL3 A;  1SYR A;  4FYU A;  5DAK B;  4NHZ A;  4HQS A;  3RHC A;  2YWM A;  2M72 A;  2EIO A;  3TUE A;  3ZTL A;  4F9Z A;  4NV5 A;  1SYX A;  4BVX A;  1R26 A;  3N9J A;  5IO2 A;  4MZW A;  2VM2 A;  1K3L A;  4NHW A;  3NIV A;  20GS A;  2L4Q A;  5CYY A;  1TP9 A;  2L6C A;  2WRT A;  2VL3 A;  3SBC A;  2A2R A;  4KUN A;  4XRA A;  2K18 A;  1XW5 A;  3LSZ A;  4IW9 A;  1PL2 A;  2NDO A;  3GFK A;  4KGI A;  2P31 A;  2IN3 A;  4HZ2 A;  5ECN B;  4O7H A;  1TOF A;  2L4C A;  1G7E A;  1AAZ A;  2RM6 A;  2R0P A;  5GAP D;  2LEG A;  1Y25 A;  4PUR A;  3Q19 A;  2DJ2 A;  1NW2 A;  3CTF A;  3APS A;  3GTU A;  3ZIV A;  2F8F A;  3HVS A;  1UVZ A;  3UIW A;  3RHB A;  2B6M A;  3TKQ A;  5DQY A;  3ME7 A;  3QPM A;  3UEM A;  4MJA A;  2V32 A;  1SK2 A;  2GLR A;  3GH6 A;  2HRN A;  3E9J B;  4KDY A;  5C04 A;  2X8C A;  2X49 A;  1JLV A;  5B8A A;  4MH3 A;  3PPU A;  3PH9 A;  3LJR A;  1G6W A;  2IPA A;  4XRD A;  4KCE A;  5AN1 A;  1GSU A;  4EIQ A;  3V1W A;  1GSE A;  2X8H A;  1BX9 A;  4I6X A;  5DCG A;  4USS A;  2LKU A;  2REM A;  1B4Q A;  2H74 A;  1Y6E A;  1TW9 A;  3ZMK A;  1H75 A;  4PXO A;  4TR0 A;  5J41 A;  2B7K A;  1EGO A;  6GST A;  3TKP A;  4OCF A;  2YAN A;  1FVK A;  2B5X A;  3FYG A;  1FOH A;  1GWC A;  2PUK C;  4POM A;  1ZYN A;  4D73 A;  3A5W A;  4AJ7 A;  4KF9 A;  2DKI A;  4YQV A;  4ZIJ A;  3LOR A;  5JCW A;  4CHS A;  2JSZ A;  1ML6 A;  4YH2 A;  4EIP A;  3LXZ A;  3D0Z A;  4NMU A;  3ZLP A;  4TOP A;  4O32 A;  3ERF A;  2V6O A;  2H76 A;  4ECI A;  2YP6 A;  3JCM L;  5L71 A;  2O87 A;  4G0L A;  3W8J A;  2DJJ A;  1XFL A;  1O73 A;  3IOS A;  2GS3 A;  3QR6 A;  5KEJ A;  1NM3 A;  3ZVJ A;  2JL4 A;  1PRX A;  2VLV A;  2M80 A;  3QDN A;  1YF0 A;  3CXG A;  2H0H A;  1TKD B;  1B8X A;  1OC9 B;  2UZ8 A;  1T7P B;  5B6N A;  4IN0 A;  3F8U A;  5IM9 A;  1GSD A;  2HZE A;  1AIU A;  4WEY A;  1QFN A;  6GSV A;  4GRF A;  5D8I A;  2C1Y A;  12GS A;  1A0F A;  3G7I A;  1PSQ A;  4ZBB A;  4MNN A;  4A5P A;  1EOG A;  3ZFB A;  1J9B A;  4BVY B;  2WZ9 A;  2VM1 A;  2HYX A;  1EP8 A;  4PQH A;  4V2L A;  1R5A A;  4MF7 A;  4ICY A;  2YCD A;  5F07 A;  1XW6 A;  5IMV A;  4EDZ A;  2CQ9 A;  4N0Z A;  1XIY A;  4YAV A;  2LST A;  4EUY A;  2WUL A;  3HXS A;  4IVF A;  1THO A;  4TXO B;  4NWY A;  4N11 A;  4ECB A;  5A4W A;  1H4O A;  4KX4 A;  1V57 A;  4POK A;  1Z7R A;  1XBS A;  2OKA A;  2DIZ A;  3KTB A;  2H1B A;  3H79 A;  4I2U A;  3A2X A;  2IMF A;  2LQQ A;  5ID2 B;  2A2P A;  4BPY A;  5IPH A;  2YWI A;  5CP1 A;  3L0H A;  4ZBD A;  2B7J A;  1ILO A;  3ED3 A;  4HZ4 A;  1VF1 A;  4EXJ A;  2PGT A;  3GX8 A;  2DC5 A;  3FZ4 A;  2AHE A;  5DJM A;  2M46 A;  2LNS A;  2P0G A;  2VOC A;  4BVX B;  3GKK A;  5HR2 A;  4WET A;  4IQ1 A;  2VUP A;  1V2A A;  3HA9 A;  2Z9S A;  2CVB A;  2CV4 A;  1GTB A;  3IHQ A;  3GHA A;  4OWY A;  3IBH A;  1QGV A;  4XCS A;  1Z3E A;  3P8W A;  3TCO A;  1A2J A;  3F9U A;  5BMU A;  2RLI A;  1A23 A;  3PR8 A;  2CA8 A;  2CT6 A;  2H0G A;  1Q4J A;  1T8E B;  2IME A;  1PD2 1;  2QC7 A;  5EPF A;  5KOW A;  1TI3 A;  3VPT A;  4GWR A;  2L6D A;  3KTL A;  2FHE A;  2C3Q A;  1I5G A;  4EO3 A;  3TRP A;  1M99 A;  3GTU B;  4MJE A;  3FMW A;  4PQ1 A;  3MYD A;  3Q6O A;  1XWA A;  2IIY A;  2H66 A;  1U3I A;  2H73 A;  4OD7 A;  3ZVJ D;  9GSS A;  1CQH A;  4YQU A;  1T00 A;  3EU3 A;  2YZH A;  5DJL A;  3H93 A;  3TDG A;  5H5S A;  1A8Y A;  4MDC A;  1O8W A;  2H1G A;  2C8U A;  4XTS A;  1Z5Y E;  1ERV A;  5B6M A;  5ENU A;  3I43 A;  3ERW A;  3M0F A;  2LV3 A;  2DKH A;  3HDC A;  1FVJ A;  3HJO A;  1X0R A;  2G0F A;  2LS5 A;  2FCH A;  3CRU A;  2FUG 2;  2DJ0 A;  4WF5 A;  3TOT A;  3FZA A;  1W89 A;  2JU5 A;  2LJK A;  1ZMA A;  1M0U A;  1Z6N A;  2HSY A;  1YY7 A;  3P2A A;  3EIN A;  2MMZ A;  1EV4 A;  3D6I A;  3MNG A;  3P90 A;  2VD0 A;  5IO0 A;  3TKR A;  5A5K A;  2YV7 A;  1SJI A;  4DSQ A;  5LCZ A;  3KMO A;  1JZD A;  4AJ8 A;  3SWL A;  1OC8 A;  3FW2 A;  1F3A A;  4GXZ A;  1GL8 A;  2HRF A;  1S3C A;  2D2Z A;  4LMW A;  5IMZ A;  3UBK A;  2AYT A;  1GNW A;  4Q5Q A;  5JCU A;  1XPV A;  1SK1 A;  3QFB C;  2HSM A;  3UAR A;  1PL1 A;  3ZRE A;  2ALB A;  4G10 A;  2O8V B;  3DD3 A;  4QQ7 A;  14GS A;  1X5C A;  2IWT A;  3LG6 A;  4KSO A;  5ELA A;  2FWE A;  1SKS B;  3IDV A;  1OVN A;  11GS A;  1PGT A;  4K6X A;  1YKC A;  3L9S A;  4ACS A;  3N5O A;  1QQ2 A;  2ES7 A;  5CO3 A;  1GTI A;  4TKY A;  3ZIT A;  1SD8 A;  2R6K A;  2C0F A;  1R5P A;  2RII A;  1O7U A;  1WE0 A;  3QFA C;  4L5L A;  3GRX A;  4WF4 A;  1VF2 A;  1K0N A;  1A0R P;  2GZZ A;  3QMX A;  3F4T A;  3IE3 A;  2GT6 A;  1KBN A;  2YJH A;  1A8L A;  1GUH A;  1F37 A;  2MZC A;  4JR4 A;  3VUR A;  2B5Y A;  2K8S A;  5D9X A;  1N2A A;  1DE1 A;  3KXO A;  3A2V A;  4ULX A;  1SK0 A;  3KJY A;  4K9Z A;  4ZB9 A;  2MYG A;  3IK9 A;  3A5I A;  3RBT A;  5J5N A;  5HFK A;  1V40 A;  5HR3 A;  4Z2R A;  2CAI A;  2J23 A;  2L57 A;  1M9A A;  2NPB A;  1WJK A;  1KNG A;  1VF4 A;  5G5E A;  4RI7 A;  4JZQ A;  4IEL A;  5INY A;  2HRA A;  4AF2 A;  3KIJ A;  1OYJ A;  4MCU A;  2FWG A;  4MP4 A;  4O5U A;  2L59 A;  5JWR B;  4MPF A;  2VLT A;  1GTU A;  5F0G A;  3EWL A;  5G1L A;  2GT5 A;  5E4W A;  2I1U A;  4BA7 A;  3GKN A;  4JRR A;  1F2E A;  3EU4 A;  2XBQ A;  2R5G A;  1PQN A;  2O89 A;  1YF1 A;  1BED A;  4L0W A;  2IFQ A;  1LBK A;  4HJ2 A;  1TRW A;  5GST A;  1O81 A;  3RPP A;  2KP1 A;  3WD6 A;  1URM A;  2GGT A;  3G7Y A;  4PQI A;  5CRW A;  3VWW A;  3OR5 A;  4I97 A;  1TRV A;  3J7Y k;  4OMV A;  3EYT A;  1SJ6 A;  5DQS A;  1NSW A;  3FHK A;  5KN3 A;  5AIV A;  4LMV A;  2HLS A;  4K0G A;  4I8B A;  1QMV A;  4KH7 A;  5ECO B;  4ILF A;  1FB6 A;  4JR6 A;  3CTG A;  3HD5 A;  4EF0 A;  4OO5 A;  3L4N A;  5IOX A;  4PGT A;  4KE3 A;  3IR4 A;  3C71 A;  2JZS A;  4PTS A;  4ZL7 A;  1XW9 A;  5CRD A;  1MEK A;  4LLR A;  1LU4 A;  4CY8 A;  1ZYQ B;  5FWG A;  5ECK B;  2L5L A;  2C0D A;  4OFM A;  4PUF C;  2WFC A;  3TRX A;  2WB9 A;  5G30 A;  1OE8 A;  2LUS A;  1ON4 A;  1YEP A;  5ECL B;  1G0T A;  2PN8 A;  3BJ5 A;  2GTU A;  1W4V A;  4ZXG A;  1Z7P A;  2A4V A;  2VCX A;  3GUR A;  1EEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...