1CQSA

Crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
124
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIEVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN : KETOSTEROID ISOMERASE
publication title Asp-99 donates a hydrogen bond not to Tyr-14 but to the steroid directly in the catalytic mechanism of Delta 5-3-ketosteroid isomerase from Pseudomonas putida biotype B
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 34
structure length 124
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cqsA00
2GBWB 5KP1A 1QMAA 1W01A 1U5OA 1GY7A 3MSOA 5G2GA 2GXFA 3F8XA 4R9KA 3OWYA 5JPUA 2PZVA 3KE7A 1OPYA 3HK4A 2YFIB 2BMOB 1Q42A 4LGQA 5CLKA 4WYKB 5CK6A 3JUOA 2F99A 4FCMA 3EC9A 3F8HA 1JKGA 2BNGA 3GZRA 2Z77A 4H3UA 1OGZA 3T8NA 1OGXA 5STDA 3DMCA 2UX0A 5IENA 1GS3A 1OH0A 3MYTA 4HM0B 5CF1A 4CDLA 3B4OA 1ULJB 5TGNA 1DMQA 4N3VA 3B8LA 3NUVA 4HM8B 1C7HA 3DUKA 5IG0A 4HM7B 4I4KA 2B1XB 3EBTA 3EBYA 2RGQA 1GY5A 3NV0B 2BMQB 4HKVB 1K41A 2XRXB 3A76A 5DRVA 1SJWA 2XSHB 2CKFB 1O7MB 2QGUA 3VSYA 1O7GB 4HM1B 3SEDA 3FZWA 3FF2A 4J9AA 3CNXA 3KZTA 2R4IA 1OF5A 4HZBB 2GEXA 5CF2A 4XBTA 3EJVA 1GYBA 4FCJA 3NXJA 3K0ZA 3RGRA 3LZAA 1CQSA 4L8OA 3JUQA 3E99A 4KVHA 1O7HB 3S5CA 2GBXB 3UNLA 1DMMA 3M8CA 5IG4A 7STDA 1NWWA 3OWUA 3OWSA 5IEPA 1TP6A 2W2CA 4HVNA 5BXQA 3B4PA 1OF5B 1ISKA 1E97A 1Q40A 5AEWB 3T8UA 1IDPA 1W02A 4IIAA 1STDA 3STDA 1HKXA 4X2HA 3RGAA 3EN1B 4GB5A 4OUQA 4X2OA 3DZLA 1A2KA 3MKIA 4R1KA 3EN8A 3UJMA 6STDA 3KSPA 5AIHA 1VZZA 3OV4A 3MG1A 5IF6A 3H51A 1OUNA 2IMJA 3FGYA 3HX8A 4WP5A 1AR0A 1E3RA 3SOAA 1JKGB 5JPPA 4MJDA 2BMRB 3EHCA 2YFLB 3D9RA 2F98A 2HMMB 2B24B 1O7WB 1EG9B 4L7KA 5D83A 3F14A 3FSDA 5AIFA 1S5AA 4RZMA 1W00A 2STDA 2RCDA 1JN5A 1GY6A 2HMNB 5KP4A 3Q90A 5FW5A 4L8PA 2RFRA 3NBRA 4LMIA 3JUMA 4J8TA 3SOYA 5D82A 1ASKA 2HMJB 3G16A 3BB9A 5DREA 3F40A 2Z7AA 1O7NB 2GEYA 1W6YA 3GZXB 3GZBA 3FLJA 1QJGA 2YFJB 1JN5B 3VGNA 3ECFA 3ER7A 4HM2B 5AI1A 1JB4A 4HJLB 2XR8B 3GZYB 4HM3B 5AEUB 4WYKA 3CNMA 4Q53A 4XM4A 5IEOA 1WQLB 3WMDA 3F7XA 5BVBA 3DM8A 3MG3A 4XDVA 1NDOB 3EX9A 1UUVB 3EQQB 3OX9A 4K1VA 1ULIB 2HMLB 3FKAA 3FF0A 5IERA 4LEHA 3ROBA 1OCVA 3F9SA 4XDWA 3NM2A 3IPTA 1Z1SA 3HZPA 3BLZA 1Q40B 2CHCA 1JB5A 2Z76A 3NV0A 5KP3A 3JUPA 1DMNA 2A15A 4STDA 5IG3A 1ZO2A 4U13A 3KKGA 5D81A 1ZX2A 4R9LA 4XBYA 2HMKB 2K54A 1TUHA 4XBXA 3GRDA 2XSOB 4HM4B 1E3VA 3CPOA 1NU3A 1JB2A 3LYGA 1OHPA 2I9WA 5EVHA 1UUWB 3EF8A 5HGRA 3I0YA 4WWUC 5CXOA 4ORLA 4PEJA 3K7CA 1OHOA 8CHOA 2JQ5A 2F86B 2OWPA 4OVMA 5AIIA 3G8ZA 2INXA 3MG2A 4HM5B 3DXOA 1OHSA 3F7SA 4XB5A 1EA2A 4K1UA 3GWRA 3MHEA 4HZ9B 5IG5A 4HM6B 2HMOB 3FH1A 3B7CA 1O7PB 3H3HA 2QIYA 3G0KA 5AIGA 3OXAA 3JUNA 1BUQA 3CU3A 3NHXA
chains in the Genus database with same CATH superfamily
2GBWB 1GOUA 5KP1A 1BSBA 2GSPA 1IVUA 1M9GA 1S723 1QMAA 1W01A 1U5OA 1MWRA 1ZGXA 1GY7A 3GSPA 4N6V0 2M7OA 1BSCA 5FGOA 3N54B 2OCTA 1JZOA 2KAAA 1WMPA 2K3DA 2R41A 3MSOA 2KXGA 5G2GA 4N6NB 2F4YA 2GXFA 2OQEC 3AHWA 3F8XA 4R9KA 1B2XA 1G0TA 1LQGC 1QAKA 3OWYA 4K90B 4N6OB 5JPUA 3HIIA 4N6TA 2K0MA 2XF3A 2PZVA 3KE7A 1OPYA 3HK4A 3LOYA 1VQ83 1JZDA 1YI23 2YFIB 2BMOB 3K63A 1IK3A 1Q42A 4LGQA 5CLKA 4WYKB 5CK6A 4BTYA 3JUOA 2QEX3 2F99A 1SIIA 4FCMA 2OTL3 5LC6A 1BNRA 3EC9A 3F8HA 3NX0A 1JBSA 1SARA 1JKGA 2BNGA 3FCSB 3GZRA 2IUKA 2Z77A 4AKYA 1FGTA 1UDII 4H3UA 2L1SA 3N8BA 1W6CA 1FGOA 4DKIA 1OGZA 1RJOA 7RNTA 1K28A 3T8NA 1OGXA 2FXTA 4FMBA 5STDA 1JRQA 1R4YA 2ML6A 2SBLA 3KN4A 1DVCA 1A67A 3NBJA 4CCVA 2C11A 3DMCA 3WA2X 2UX0A 3DGYA 5IENA 1GS3A 3BNDA 1OH0A 3LMLA 3MYTA 1B2MA 4HM0B 2WOHA 5CF1A 3FG1A 3SXXA 3PCSA 1W2B2 1FZUA 4CDLA 3B4OA 1RGAA 4EV2A 3CCL3 1Q7Y4 3DGLA 1ULJB 5TGNA 1DMQA 1V57A 4N3VA 1OACA 3B8LA 3NUVA 1TRQA 1BIRA 4HM8B 1C7HA 3DUKA 3WR2A 1RGCA 2E2TA 3ZG5A 3CMA3 1UGIA 1HZ1A 5IG0A 4AEQA 4HM7B 3I553 4I4KA 1IV9A 2B1XB 3EBTA 3EBYA 1D6UA 3D79A 2RGQA 3BNBA 3UL6A 1GY5A 4CPKA 2Z6BA 3NV0B 1W2ZA 2CG0A 3CCJ3 1VQM3 3AHSA 2BMQB 1TFKA 4HKVB 4MMYB 1IQXA 2D1WA 2Y74A 3J7Yd 3RNTA 1EQKA 1IQYA 1K41A 5JBSA 2XRXB 2ZHXB 1BRHA 3A76A 5DRVA 3TDGA 2H0HA 1SJWA 4J5GA 2XSHB 2CKFB 1K8A4 1T2HA 1O7MB 1FGMA 1HYFA 2UUGC 1N5HA 1VQN3 2KCDA 1RKYA 1I3IA 2W03A 4QWTA 3GAXA 1RGHA 2QGUA 2ZDJA 3VSYA 1I0VA 1BRJA 3U97A 1IQ8A 2ZL8A 1O7GB 4HM1B 3SEDA 2W56A 1MWSA 1UCIA 3S27A 1QVF2 3FZWA 4LSOA 3LXUX 1X1WA 1LVNA 1ZS7A 3FF2A 8RNTA 1BUJA 2RBIA 4J9AA 3CNXA 3CPW2 2R4IA 3KZTA 2L4VA 1OF5A 2KF3A 3SVAA 2F5WA 1YVBI 3D5IA 4HZBB 2GEXA 3QRDA 1UCLA 2J8XB 4XBTA 5CF2A 1RGEA 3EJVA 3O8YA 1K734 1TTOA 2F56A 1GYBA 4FCJA 5AYSC 3PYJA 3NXJA 1W4NA 3K0ZA 1QALA 3RGRA 2FNQA 1FA3A 3LZAA 1CQSA 2AAEA 2P0XA 4L8OA 4BIRA 1PYLA 3JUQA 1UW1A 3E99A 4KVHA 4JF8A 1RDSA 1O7HB 3S5CA 2GBXB 2XFSA 3LT9A 3UNLA 1DMMA 1RN1A 3M8CA 1BRGA 1UGHI 1Y4KA 1SPUA 1NB3I 5IG4A 7STDA 1NWWA 3OWUA 5M19A 9RNTA 7GSPA 1RGLA 4I5QA 2CX0A 1BSDA 1TFOA 1BSAA 3OWSA 1FGRA 1YJN3 2KF6A 5IEPA 2CW9A 3D3LA 3D5GA 1TP6A 1G96A 2W2CA 1LNHA 1BNSA 3S29A 4HVNA 1M1XB 1WMOA 3HOHA 4NREA 4LYLB 3K5TA 5BXQA 3B4PA 3DH2A 3VF1A 1OF5B 2OQEA 3CCR3 1ISKA 3BNEA 1D6YA 3LT8A 4LZIA 1VQK3 1E97A 1Q40A 5AEWB 2XGLA 3T8UA 1IDPA 1W02A 4IIAA 1IT8A 1STDA 4TX4A 6RNTA 2BU4A 4EW5A 1BRNL 3STDA 1HKXA 1TRPA 1YJW3 4X2HA 1PY3A 4FMAA 3CCV3 3RGAA 3EN1B 3HI7A 1SIHA 4GB5A 4R4KA 1ROVA 2CC3A 3MPHA 4OUQA 5HOHA 2CFKA 3DGOA 1I8VA 3AMOB 2MC8A 2GU3A 4X2OA 1UI8A 3DZLA 1BOXA 1A2KA 1IU7A 3JVCA 3SX1A 4BTWA 1T3BA 3MKIA 1RRLA 1AQZA 1YNVX 4AKZA 1IV7A 3IJEB 4R1KA 3EN8A 3UJMA 1UI7A 1I70A 3DY5A 3LTBA 4N6MA 3KSPA 6STDA 1YGEA 5AIHA 1RSNA 2CWVA 1UCKA 1IT7A 2PNCA 2IYJA 1VZZA 3T0UA 4WFOA 3OV4A 4FMCA 3EB8A 3UL5A 2XEPA 6GSPA 1FUWA 3MG1A 1L5GB 5IF6A 1RGGA 4ZM8A 1RNBA 5RNTA 3H51A 1OUNA 2OOVC 3DGNA 2IMJA 3FGYA 2UGIA 1B2SA 3HX8A 4KFEA 4CJNA 3NBBA 4WP5A 3D4AA 4OK0A 3RDEA 1VQ63 2AADA 1RCLA 3V92A 1AR0A 1MNLA 2CIUA 1E3RA 1MWTA 3CXC2 4RBNA 1M1K4 4GL6A 3CC23 1FW7A 3SOAA 1LQMB 1LRAA 2ZA4A 5M18A 2XH9A 2RNTA 2W9QA 4HOHA 1JKGB 1CYUA 2P05A 2P0MA 2LYXA 5JPPA 4MJDA 2BMRB 3EHCA 1Q814 1VQ53 2YFLB 3Q1CA 3ALAA 3D9RA 1JBTA 1MOLA 2F98A 2HMMB 2OTJ3 1JJ22 1N9EA 3I563 2B24B 1MGWA 1YIT3 1O7WB 1EG9B 1B21A 1BNEA 4L7KA 2P09A 5D83A 1DYUA 4N6UA 3F14A 1ROAA 3X3YA 1C54A 1B20A 1BVIA 3FSDA 5AIFA 1S5AA 1VQ73 4RZMA 1JBRA 2E2UA 1W00A 2CG1A 1GMRA 1U8CB 2STDA 1VQ43 2RCDA 3QK9A 5AYRB 1JN5A 1GY6A 2CFLA 2HMNB 3MWZA 3U1WA 4KFFA 1SQWA 5ELJA 5KP4A 4H61A 3Q90A 3S67A 1N8QA 1I2GA 3Q3FA 3X40A 5FW5A 4EBGA 1W7CA 2RFRA 4L8PA 1KC84 3NBRA 1US1A 3KSED 4LMIA 3JUMA 4J8TA 3SOYA 4GSPA 1NB5I 2C4BA 3FG4A 1PFPA 3L0RA 5D82A 1ASKA 1KSIA 1LOYA 1WMNA 2HMJB 4ILFA 2KF5A 3G16A 1FYSA 4BL3A 3BB9A 4IT7A 5DREA 4MEIA 2Y73A 3F40A 2BT3A 3PCRA 1QVG2 2Z7AA 1O7NB 1BAOA 2GEYA 1STFI 3CCQ3 1W6YA 3GZXB 4HBRA 3BIRA 3GZBA 2SARA 1VQP3 4EYCA 3FLJA 1QJGA 1X1UA 1YHQ3 5G1LA 1JV2B 1BANA 4BTXA 1CH0A 1G02A 1GMPA 1VQO3 1LOVA 1JN5B 2YFJB 3VGNA 1YIJ3 2O9UX 5EQLA 1B2UA 2W56B 2WGQA 3ECFA 3ER7A 1N5PA 1VQQA 4HM2B 5AI1A 1JB4A 4RNZA 1AVKA 1LNIA 4EV5A 4HJLB 1NO3A 2XR8B 3A5EA 1JNQA 3GZYB 4HM3B 4EC6A 3CME3 5AEUB 1F8NA 4O8SA 4WYKA 2MF7A 1BRKA 3CNMA 4NHFA 4Q53A 1RTUA 1LOWA 4GHOA 4O3VA 1I0XA 3V99A 4IPBA 1UCJA 1VQL3 4HAAA 4O02B 4XM4A 5IEOA 1WQLB 2WGOA 4RNYA 1FUSA 1EEJA 1N9JA 5A0OB 2WO0A 1HU9A 3WMDA 1RGFA 3F7XA 1WTHA 4J5KA 1YGWA 5BIRA 5BVBA 4FR9A 3CD63 5ELUA 1BRSA 3DM8A 3MG3A 3NQYA 1NDOB 2W6JH 4XDVA 3WODG 3EX9A 2CH9A 1UUVB 3EQQB 3WOFB 2XGNA 1W6GA 2C10A 3OX9A 1AVLA 4K1VA 1ULIB 2HMLB 4EXRA 3K9MC 3X41A 1GOVA 2O3OA 1DE3A 5IW9A 3FKAA 4WHAA 1RLSA 1A2VA 2CFDA 3FF0A 1V74A 5IERA 4LEHA 1BNFA 5LC7A 1MGRA 3ROBA 3N9HA 1I2FA 1LXEA 1B27A 1OCVA 1FGQA 1WNHA 1IVVA 1Q9EA 3F9SA 4XDWA 5M1AA 1GMQA 3CCE3 3NM2A 3IPTA 1YJ93 2OOVA 1Z1SA 1I2EA 3HZPA 2IY2A 1MWUA 1RCKA 3BLZA 1Q40B 1Q7HA 4MMZB 1BSEA 1D6ZA 2CHCA 1JB5A 2V1LA 3UB1A 3V98A 3WDGB 1A2PA 1T2IA 2Z76A 3NV0A 1IVXA 2IA7A 3URPA 3S28A 2CK3H 4KZ1A 3ZFZA 5KP3A 2CX1A 3JUPA 1BNJA 3KIIA 1DMNA 5I97A 1EKMA 1Q864 1GD3A 2A15A 3LTAA 4STDA 5IG3A 1PU4A 2P38A 5BU4A 1ZO2A 2Q07A 4U13A 3G713 4K61A 3KKGA 1RGKA 5D81A 1ZX2A 4R9LA 4XBYA 2HMKB 2H0IA 2K54A 1BNIA 1RN4A 3KFQC 3X3ZA 3BU4A 1K9M4 3IMAB 2XFTA 4O2HA 1A90A 1TUHA 1NNVA 4XBXA 3GRDA 2XSOB 3CC43 4HM4B 1CYVA 3HIGA 1NJI4 1BU4A 1DVDA 1E3VA 2F5MA 1LOXA 2D42A 3CPOA 2FGTA 2KF4A 1T5YA 2W0QA 4R80A 1NU3A 1R4CA 3G4S3 1JB2A 3LYGA 2CWUA 1OHPA 2I9WA 2HOHA 5EVHA 1UUWB 1EUIC 1DETA 3LTDA 3PXMA 3BNCA 3LTCA 2JDIH 3EF8A 3I0YA 5HGRA 4WWUC 2RSXA 4MMXB 1IVWA 2KRTA 3CCU3 3SLUA 3X42A 1V58A 1TIJA 1TJDA 5CXOA 1KD14 1J2BA 2ML5A 1UUGB 4ORLA 3ZG0A 4PEJA 5G1KA 2H0GA 2QA43 1QAFA 3K7CA 1OHOA 1W5ZA 1KQS2 1FUTA 8CHOA 3Q2PA 3WHOA 2JQ5A 2F86B 2OWPA 4BL2A 1GD4A 4OVMA 3CC73 1BNGA 2YX9A 3PZWA 3CCM3 2BIRA 1Q824 2CFWA 5AIIA 3G8ZA 1M904 4JRFA 2W04A 3EE1A 1TU5A 1CEWI 2W9PA 3DGMA 2INXA 3MG2A 4HM5B 1GOYA 3DXOA 1OHSA 3F7SA 4BU4A 4XB5A 1RRHA 1EA2A 3NM7A 1RMSA 4K1UA 3GWRA 1AY7A 3MHEA 1B2ZA 3PGBA 2BO9B 1RNTA 4FMDA 3PS8A 3G6E3 4FCZA 4HZ9B 2BHMA 3AGNA 5IG5A 2CWTA 4HM6B 2HMOB 2CFGA 3CCS3 3FH1A 4KT3B 2IUJA 4HYZA 1RN7A 3B7CA 1IYYA 1AV4A 4G1MB 1O7PB 4N6LA 4NPBA 3OW22 1I3FA 3H3HA 1RHLA 2QIYA 1GSPA 3FG3A 3G0KA 2WOFA 2GU1A 1YVSA 5AIGA 1KWIA 1BGSA 3OXAA 3WA3A 3JUNA 4RNTA 3SYUA 4KFDA 5EEOA 1BRIA 3AMOA 1N8R4 1X1XA 3KCHA 5GSPA 1BUQA 3CU3A 3NHXA 3WOEB 2LQVA 1B3SA 3LH4A 3X3XA 2E2VA 3NQZA 1VQ93 1X1YA 3AGOA
chains in the Genus database with same CATH topology
2GBWB 5KP1A 1IVUA 1M9GA 1S723 1QMAA 1W01A 1U5OA 1GY7A 4N6V0 2M7OA 5FGOA 3N54B 2OCTA 1WMPA 3MSOA 2KXGA 5G2GA 4N6NB 2GXFA 2OQEC 3F8XA 4R9KA 1QAKA 3OWYA 4K90B 4N6OB 5JPUA 3HIIA 4N6TA 2K0MA 2XF3A 2PZVA 3KE7A 1OPYA 3HK4A 3LOYA 1VQ83 1YI23 2YFIB 2BMOB 3K63A 1IK3A 1Q42A 4LGQA 5CLKA 4WYKB 5CK6A 4BTYA 3JUOA 2QEX3 2F99A 1SIIA 4FCMA 2OTL3 5LC6A 3EC9A 3F8HA 3NX0A 1JKGA 2BNGA 3FCSB 3GZRA 2IUKA 2Z77A 4AKYA 1FGTA 4H3UA 3N8BA 1W6CA 1FGOA 1OGZA 1RJOA 1K28A 3T8NA 1OGXA 2FXTA 4FMBA 5STDA 1JRQA 2ML6A 2SBLA 3KN4A 1DVCA 1A67A 3NBJA 4CCVA 2C11A 3DMCA 3WA2X 2UX0A 5IENA 1GS3A 3BNDA 1OH0A 3LMLA 3MYTA 4HM0B 2WOHA 5CF1A 3FG1A 3SXXA 3PCSA 1W2B2 4CDLA 3B4OA 4EV2A 3CCL3 1Q7Y4 3DGLA 1ULJB 5TGNA 1DMQA 4N3VA 1OACA 3B8LA 3NUVA 4HM8B 1C7HA 3DUKA 2E2TA 3CMA3 5IG0A 4AEQA 3I553 4HM7B 4I4KA 1IV9A 2B1XB 3EBTA 3EBYA 1D6UA 2RGQA 3BNBA 3UL6A 1GY5A 2Z6BA 3NV0B 1W2ZA 2CG0A 3CCJ3 1VQM3 2BMQB 1TFKA 4HKVB 4MMYB 1IQXA 2D1WA 2Y74A 3J7Yd 1EQKA 1IQYA 1K41A 5JBSA 2XRXB 3A76A 5DRVA 3TDGA 1SJWA 2XSHB 2CKFB 1K8A4 1O7MB 1FGMA 1N5HA 1VQN3 2KCDA 1RKYA 2W03A 4QWTA 3GAXA 2QGUA 2ZDJA 3VSYA 3U97A 1IQ8A 2ZL8A 1O7GB 4HM1B 3SEDA 2W56A 3S27A 1QVF2 3FZWA 4LSOA 3LXUX 1LVNA 3FF2A 4J9AA 3CNXA 3CPW2 2R4IA 3KZTA 2L4VA 1OF5A 3SVAA 1YVBI 4HZBB 2GEXA 3QRDA 5CF2A 4XBTA 3EJVA 3O8YA 1K734 1GYBA 4FCJA 5AYSC 3PYJA 3NXJA 1W4NA 3K0ZA 1QALA 3RGRA 2FNQA 1FA3A 3LZAA 1CQSA 2P0XA 4L8OA 3JUQA 1UW1A 3E99A 4KVHA 4JF8A 1O7HB 3S5CA 2GBXB 2XFSA 3LT9A 3UNLA 1DMMA 3M8CA 1Y4KA 1SPUA 1NB3I 5IG4A 7STDA 1NWWA 3OWUA 1TFOA 3OWSA 1FGRA 1YJN3 5IEPA 2CW9A 3D3LA 1TP6A 1G96A 2W2CA 1LNHA 3S29A 4HVNA 1M1XB 1WMOA 4NREA 3K5TA 5BXQA 3B4PA 3VF1A 1OF5B 2OQEA 3CCR3 1ISKA 3BNEA 1D6YA 3LT8A 4LZIA 1VQK3 1E97A 1Q40A 5AEWB 2XGLA 3T8UA 1IDPA 1W02A 4IIAA 1IT8A 1STDA 4TX4A 3STDA 1HKXA 1YJW3 4X2HA 4FMAA 3CCV3 3RGAA 3EN1B 3HI7A 1SIHA 4GB5A 4R4KA 1ROVA 2CC3A 3MPHA 4OUQA 2CFKA 3DGOA 3AMOB 2MC8A 2GU3A 4X2OA 1UI8A 3DZLA 3JVCA 1A2KA 1IU7A 3SX1A 4BTWA 3MKIA 1RRLA 4AKZA 1IV7A 3IJEB 4R1KA 3EN8A 3UJMA 1UI7A 3DY5A 3LTBA 4N6MA 3KSPA 6STDA 1YGEA 5AIHA 2CWVA 1IT7A 2PNCA 1VZZA 3T0UA 4WFOA 3OV4A 4FMCA 3EB8A 3UL5A 2XEPA 1FUWA 3MG1A 1L5GB 5IF6A 4ZM8A 3H51A 1OUNA 2OOVC 3DGNA 2IMJA 3FGYA 3HX8A 4KFEA 3NBBA 4WP5A 3RDEA 4OK0A 1VQ63 3V92A 1AR0A 1MNLA 2CIUA 1E3RA 3CXC2 4RBNA 1M1K4 4GL6A 3CC23 3SOAA 2XH9A 2W9QA 1CYUA 1JKGB 2P05A 2P0MA 2LYXA 5JPPA 4MJDA 2BMRB 3EHCA 1Q814 1VQ53 2YFLB 3Q1CA 3ALAA 3D9RA 1MOLA 2F98A 2HMMB 2OTJ3 1JJ22 1N9EA 3I563 2B24B 1YIT3 1O7WB 1EG9B 4L7KA 2P09A 5D83A 1DYUA 4N6UA 3F14A 1ROAA 3X3YA 3FSDA 5AIFA 1VQ73 1S5AA 4RZMA 2E2UA 1W00A 2CG1A 1U8CB 2STDA 1VQ43 2RCDA 3QK9A 5AYRB 1JN5A 1GY6A 2CFLA 2HMNB 3MWZA 3U1WA 4KFFA 1SQWA 5ELJA 5KP4A 4H61A 3Q90A 3S67A 1N8QA 3X40A 5FW5A 4EBGA 1W7CA 2RFRA 4L8PA 1KC84 3NBRA 1US1A 3KSED 4LMIA 3JUMA 4J8TA 3SOYA 1NB5I 5D82A 3FG4A 1PFPA 3L0RA 1ASKA 1KSIA 1WMNA 2HMJB 3G16A 3BB9A 4IT7A 5DREA 4MEIA 2Y73A 3F40A 2BT3A 3PCRA 1QVG2 2Z7AA 1O7NB 2GEYA 1STFI 3CCQ3 1W6YA 3GZXB 4HBRA 3GZBA 1VQP3 4EYCA 3FLJA 1QJGA 1YHQ3 1JV2B 4BTXA 1VQO3 2YFJB 1JN5B 3VGNA 1YIJ3 2O9UX 5EQLA 2W56B 2WGQA 3ECFA 3ER7A 1N5PA 4HM2B 5AI1A 1JB4A 4RNZA 1AVKA 4EV5A 4HJLB 1NO3A 2XR8B 1JNQA 3GZYB 4HM3B 4EC6A 3CME3 5AEUB 1F8NA 4O8SA 4WYKA 2MF7A 3CNMA 4NHFA 4Q53A 4O3VA 3V99A 4IPBA 1VQL3 4O02B 4XM4A 5IEOA 1WQLB 2WGOA 4RNYA 1N9JA 5A0OB 2WO0A 1HU9A 3WMDA 3F7XA 1WTHA 5BVBA 3CD63 4FR9A 5ELUA 3DM8A 3NQYA 3MG3A 4XDVA 1NDOB 2W6JH 3WODG 3EX9A 2CH9A 1UUVB 3EQQB 3WOFB 2XGNA 1W6GA 2C10A 3OX9A 1AVLA 4K1VA 1ULIB 2HMLB 4EXRA 3K9MC 3X41A 2O3OA 5IW9A 3FKAA 4WHAA 1A2VA 2CFDA 3FF0A 1V74A 5IERA 4LEHA 5LC7A 3ROBA 3N9HA 1LXEA 1OCVA 1FGQA 1WNHA 1IVVA 3F9SA 4XDWA 3CCE3 3NM2A 3IPTA 1YJ93 2OOVA 1Z1SA 3HZPA 4MMZB 3BLZA 1Q40B 2V1LA 1D6ZA 2CHCA 1JB5A 3UB1A 3V98A 3WDGB 2Z76A 3NV0A 1IVXA 2IA7A 3S28A 2CK3H 4KZ1A 5KP3A 3JUPA 5I97A 3KIIA 1Q864 1DMNA 1EKMA 1GD3A 2A15A 3LTAA 4STDA 5IG3A 1PU4A 2P38A 1ZO2A 2Q07A 4U13A 3G713 4K61A 3KKGA 5D81A 1ZX2A 4R9LA 4XBYA 2HMKB 2K54A 3KFQC 3X3ZA 1K9M4 3IMAB 2XFTA 4O2HA 1A90A 1TUHA 4XBXA 3GRDA 2XSOB 3CC43 4HM4B 1CYVA 3HIGA 1NJI4 1DVDA 1E3VA 1LOXA 2D42A 3CPOA 2FGTA 1T5YA 2W0QA 4R80A 1NU3A 1R4CA 3G4S3 1JB2A 3LYGA 2CWUA 1OHPA 2I9WA 5EVHA 1UUWB 3LTDA 3PXMA 3BNCA 3LTCA 2JDIH 3EF8A 3I0YA 5HGRA 4WWUC 2RSXA 4MMXB 1IVWA 2KRTA 3CCU3 3SLUA 3X42A 1TIJA 5CXOA 1KD14 1J2BA 2ML5A 4ORLA 4PEJA 2QA43 1QAFA 3K7CA 1OHOA 1W5ZA 1KQS2 8CHOA 3Q2PA 2JQ5A 2F86B 2OWPA 1GD4A 4OVMA 3CC73 3PZWA 2YX9A 3CCM3 1Q824 2CFWA 5AIIA 3G8ZA 1M904 4JRFA 2W04A 3EE1A 1TU5A 1CEWI 2W9PA 3DGMA 2INXA 3MG2A 4HM5B 3DXOA 1OHSA 3F7SA 4XB5A 1RRHA 1EA2A 3NM7A 4K1UA 3GWRA 3MHEA 3PGBA 2BO9B 4FMDA 3PS8A 3G6E3 4FCZA 4HZ9B 2BHMA 5IG5A 2CWTA 4HM6B 2HMOB 2CFGA 3CCS3 3FH1A 2IUJA 4HYZA 1RN7A 3B7CA 1AV4A 4G1MB 1O7PB 4N6LA 3OW22 3H3HA 2QIYA 3FG3A 3G0KA 2WOFA 2GU1A 5AIGA 1KWIA 3OXAA 3WA3A 3JUNA 4KFDA 5EEOA 3AMOA 1N8R4 1BUQA 3CU3A 3NHXA 3WOEB 2LQVA 3LH4A 3X3XA 2E2VA 3NQZA 1VQ93
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBW B;  5KP1 A;  1QMA A;  1W01 A;  1U5O A;  1GY7 A;  3MSO A;  5G2G A;  2GXF A;  3F8X A;  4R9K A;  3OWY A;  5JPU A;  2PZV A;  3KE7 A;  1OPY A;  3HK4 A;  2YFI B;  2BMO B;  1Q42 A;  4LGQ A;  5CLK A;  4WYK B;  5CK6 A;  3JUO A;  2F99 A;  4FCM A;  3EC9 A;  3F8H A;  1JKG A;  2BNG A;  3GZR A;  2Z77 A;  4H3U A;  1OGZ A;  3T8N A;  1OGX A;  5STD A;  3DMC A;  2UX0 A;  5IEN A;  1GS3 A;  1OH0 A;  3MYT A;  4HM0 B;  5CF1 A;  4CDL A;  3B4O A;  1ULJ B;  5TGN A;  1DMQ A;  4N3V A;  3B8L A;  3NUV A;  4HM8 B;  1C7H A;  3DUK A;  5IG0 A;  4HM7 B;  4I4K A;  2B1X B;  3EBT A;  3EBY A;  2RGQ A;  1GY5 A;  3NV0 B;  2BMQ B;  4HKV B;  1K41 A;  2XRX B;  3A76 A;  5DRV A;  1SJW A;  2XSH B;  2CKF B;  1O7M B;  2QGU A;  3VSY A;  1O7G B;  4HM1 B;  3SED A;  3FZW A;  3FF2 A;  4J9A A;  3CNX A;  3KZT A;  2R4I A;  1OF5 A;  4HZB B;  2GEX A;  5CF2 A;  4XBT A;  3EJV A;  1GYB A;  4FCJ A;  3NXJ A;  3K0Z A;  3RGR A;  3LZA A;  1CQS A;  4L8O A;  3JUQ A;  3E99 A;  4KVH A;  1O7H B;  3S5C A;  2GBX B;  3UNL A;  1DMM A;  3M8C A;  5IG4 A;  7STD A;  1NWW A;  3OWU A;  3OWS A;  5IEP A;  1TP6 A;  2W2C A;  4HVN A;  5BXQ A;  3B4P A;  1OF5 B;  1ISK A;  1E97 A;  1Q40 A;  5AEW B;  3T8U A;  1IDP A;  1W02 A;  4IIA A;  1STD A;  3STD A;  1HKX A;  4X2H A;  3RGA A;  3EN1 B;  4GB5 A;  4OUQ A;  4X2O A;  3DZL A;  1A2K A;  3MKI A;  4R1K A;  3EN8 A;  3UJM A;  6STD A;  3KSP A;  5AIH A;  1VZZ A;  3OV4 A;  3MG1 A;  5IF6 A;  3H51 A;  1OUN A;  2IMJ A;  3FGY A;  3HX8 A;  4WP5 A;  1AR0 A;  1E3R A;  3SOA A;  1JKG B;  5JPP A;  4MJD A;  2BMR B;  3EHC A;  2YFL B;  3D9R A;  2F98 A;  2HMM B;  2B24 B;  1O7W B;  1EG9 B;  4L7K A;  5D83 A;  3F14 A;  3FSD A;  5AIF A;  1S5A A;  4RZM A;  1W00 A;  2STD A;  2RCD A;  1JN5 A;  1GY6 A;  2HMN B;  5KP4 A;  3Q90 A;  5FW5 A;  4L8P A;  2RFR A;  3NBR A;  4LMI A;  3JUM A;  4J8T A;  3SOY A;  5D82 A;  1ASK A;  2HMJ B;  3G16 A;  3BB9 A;  5DRE A;  3F40 A;  2Z7A A;  1O7N B;  2GEY A;  1W6Y A;  3GZX B;  3GZB A;  3FLJ A;  1QJG A;  2YFJ B;  1JN5 B;  3VGN A;  3ECF A;  3ER7 A;  4HM2 B;  5AI1 A;  1JB4 A;  4HJL B;  2XR8 B;  3GZY B;  4HM3 B;  5AEU B;  4WYK A;  3CNM A;  4Q53 A;  4XM4 A;  5IEO A;  1WQL B;  3WMD A;  3F7X A;  5BVB A;  3DM8 A;  3MG3 A;  4XDV A;  1NDO B;  3EX9 A;  1UUV B;  3EQQ B;  3OX9 A;  4K1V A;  1ULI B;  2HML B;  3FKA A;  3FF0 A;  5IER A;  4LEH A;  3ROB A;  1OCV A;  3F9S A;  4XDW A;  3NM2 A;  3IPT A;  1Z1S A;  3HZP A;  3BLZ A;  1Q40 B;  2CHC A;  1JB5 A;  2Z76 A;  3NV0 A;  5KP3 A;  3JUP A;  1DMN A;  2A15 A;  4STD A;  5IG3 A;  1ZO2 A;  4U13 A;  3KKG A;  5D81 A;  1ZX2 A;  4R9L A;  4XBY A;  2HMK B;  2K54 A;  1TUH A;  4XBX A;  3GRD A;  2XSO B;  4HM4 B;  1E3V A;  3CPO A;  1NU3 A;  1JB2 A;  3LYG A;  1OHP A;  2I9W A;  5EVH A;  1UUW B;  3EF8 A;  5HGR A;  3I0Y A;  4WWU C;  5CXO A;  4ORL A;  4PEJ A;  3K7C A;  1OHO A;  8CHO A;  2JQ5 A;  2F86 B;  2OWP A;  4OVM A;  5AII A;  3G8Z A;  2INX A;  3MG2 A;  4HM5 B;  3DXO A;  1OHS A;  3F7S A;  4XB5 A;  1EA2 A;  4K1U A;  3GWR A;  3MHE A;  4HZ9 B;  5IG5 A;  4HM6 B;  2HMO B;  3FH1 A;  3B7C A;  1O7P B;  3H3H A;  2QIY A;  3G0K A;  5AIG A;  3OXA A;  3JUN A;  1BUQ A;  3CU3 A;  3NHX A; 
#chains in the Genus database with same CATH topology
 2GBW B;  1GOU A;  5KP1 A;  1BSB A;  2GSP A;  1IVU A;  1M9G A;  1S72 3;  1QMA A;  1W01 A;  1U5O A;  1MWR A;  1ZGX A;  1GY7 A;  3GSP A;  4N6V 0;  2M7O A;  1BSC A;  5FGO A;  3N54 B;  2OCT A;  1JZO A;  2KAA A;  1WMP A;  2K3D A;  2R41 A;  3MSO A;  2KXG A;  5G2G A;  4N6N B;  2F4Y A;  2GXF A;  2OQE C;  3AHW A;  3F8X A;  4R9K A;  1B2X A;  1G0T A;  1LQG C;  1QAK A;  3OWY A;  4K90 B;  4N6O B;  5JPU A;  3HII A;  4N6T A;  2K0M A;  2XF3 A;  2PZV A;  3KE7 A;  1OPY A;  3HK4 A;  3LOY A;  1VQ8 3;  1JZD A;  1YI2 3;  2YFI B;  2BMO B;  3K63 A;  1IK3 A;  1Q42 A;  4LGQ A;  5CLK A;  4WYK B;  5CK6 A;  4BTY A;  3JUO A;  2QEX 3;  2F99 A;  1SII A;  4FCM A;  2OTL 3;  5LC6 A;  1BNR A;  3EC9 A;  3F8H A;  3NX0 A;  1JBS A;  1SAR A;  1JKG A;  2BNG A;  3FCS B;  3GZR A;  2IUK A;  2Z77 A;  4AKY A;  1FGT A;  1UDI I;  4H3U A;  2L1S A;  3N8B A;  1W6C A;  1FGO A;  4DKI A;  1OGZ A;  1RJO A;  7RNT A;  1K28 A;  3T8N A;  1OGX A;  2FXT A;  4FMB A;  5STD A;  1JRQ A;  1R4Y A;  2ML6 A;  2SBL A;  3KN4 A;  1DVC A;  1A67 A;  3NBJ A;  4CCV A;  2C11 A;  3DMC A;  3WA2 X;  2UX0 A;  3DGY A;  5IEN A;  1GS3 A;  3BND A;  1OH0 A;  3LML A;  3MYT A;  1B2M A;  4HM0 B;  2WOH A;  5CF1 A;  3FG1 A;  3SXX A;  3PCS A;  1W2B 2;  1FZU A;  4CDL A;  3B4O A;  1RGA A;  4EV2 A;  3CCL 3;  1Q7Y 4;  3DGL A;  1ULJ B;  5TGN A;  1DMQ A;  1V57 A;  4N3V A;  1OAC A;  3B8L A;  3NUV A;  1TRQ A;  1BIR A;  4HM8 B;  1C7H A;  3DUK A;  3WR2 A;  1RGC A;  2E2T A;  3ZG5 A;  3CMA 3;  1UGI A;  1HZ1 A;  5IG0 A;  4AEQ A;  4HM7 B;  3I55 3;  4I4K A;  1IV9 A;  2B1X B;  3EBT A;  3EBY A;  1D6U A;  3D79 A;  2RGQ A;  3BNB A;  3UL6 A;  1GY5 A;  4CPK A;  2Z6B A;  3NV0 B;  1W2Z A;  2CG0 A;  3CCJ 3;  1VQM 3;  3AHS A;  2BMQ B;  1TFK A;  4HKV B;  4MMY B;  1IQX A;  2D1W A;  2Y74 A;  3J7Y d;  3RNT A;  1EQK A;  1IQY A;  1K41 A;  5JBS A;  2XRX B;  2ZHX B;  1BRH A;  3A76 A;  5DRV A;  3TDG A;  2H0H A;  1SJW A;  4J5G A;  2XSH B;  2CKF B;  1K8A 4;  1T2H A;  1O7M B;  1FGM A;  1HYF A;  2UUG C;  1N5H A;  1VQN 3;  2KCD A;  1RKY A;  1I3I A;  2W03 A;  4QWT A;  3GAX A;  1RGH A;  2QGU A;  2ZDJ A;  3VSY A;  1I0V A;  1BRJ A;  3U97 A;  1IQ8 A;  2ZL8 A;  1O7G B;  4HM1 B;  3SED A;  2W56 A;  1MWS A;  1UCI A;  3S27 A;  1QVF 2;  3FZW A;  4LSO A;  3LXU X;  1X1W A;  1LVN A;  1ZS7 A;  3FF2 A;  8RNT A;  1BUJ A;  2RBI A;  4J9A A;  3CNX A;  3CPW 2;  2R4I A;  3KZT A;  2L4V A;  1OF5 A;  2KF3 A;  3SVA A;  2F5W A;  1YVB I;  3D5I A;  4HZB B;  2GEX A;  3QRD A;  1UCL A;  2J8X B;  4XBT A;  5CF2 A;  1RGE A;  3EJV A;  3O8Y A;  1K73 4;  1TTO A;  2F56 A;  1GYB A;  4FCJ A;  5AYS C;  3PYJ A;  3NXJ A;  1W4N A;  3K0Z A;  1QAL A;  3RGR A;  2FNQ A;  1FA3 A;  3LZA A;  1CQS A;  2AAE A;  2P0X A;  4L8O A;  4BIR A;  1PYL A;  3JUQ A;  1UW1 A;  3E99 A;  4KVH A;  4JF8 A;  1RDS A;  1O7H B;  3S5C A;  2GBX B;  2XFS A;  3LT9 A;  3UNL A;  1DMM A;  1RN1 A;  3M8C A;  1BRG A;  1UGH I;  1Y4K A;  1SPU A;  1NB3 I;  5IG4 A;  7STD A;  1NWW A;  3OWU A;  5M19 A;  9RNT A;  7GSP A;  1RGL A;  4I5Q A;  2CX0 A;  1BSD A;  1TFO A;  1BSA A;  3OWS A;  1FGR A;  1YJN 3;  2KF6 A;  5IEP A;  2CW9 A;  3D3L A;  3D5G A;  1TP6 A;  1G96 A;  2W2C A;  1LNH A;  1BNS A;  3S29 A;  4HVN A;  1M1X B;  1WMO A;  3HOH A;  4NRE A;  4LYL B;  3K5T A;  5BXQ A;  3B4P A;  3DH2 A;  3VF1 A;  1OF5 B;  2OQE A;  3CCR 3;  1ISK A;  3BNE A;  1D6Y A;  3LT8 A;  4LZI A;  1VQK 3;  1E97 A;  1Q40 A;  5AEW B;  2XGL A;  3T8U A;  1IDP A;  1W02 A;  4IIA A;  1IT8 A;  1STD A;  4TX4 A;  6RNT A;  2BU4 A;  4EW5 A;  1BRN L;  3STD A;  1HKX A;  1TRP A;  1YJW 3;  4X2H A;  1PY3 A;  4FMA A;  3CCV 3;  3RGA A;  3EN1 B;  3HI7 A;  1SIH A;  4GB5 A;  4R4K A;  1ROV A;  2CC3 A;  3MPH A;  4OUQ A;  5HOH A;  2CFK A;  3DGO A;  1I8V A;  3AMO B;  2MC8 A;  2GU3 A;  4X2O A;  1UI8 A;  3DZL A;  1BOX A;  1A2K A;  1IU7 A;  3JVC A;  3SX1 A;  4BTW A;  1T3B A;  3MKI A;  1RRL A;  1AQZ A;  1YNV X;  4AKZ A;  1IV7 A;  3IJE B;  4R1K A;  3EN8 A;  3UJM A;  1UI7 A;  1I70 A;  3DY5 A;  3LTB A;  4N6M A;  3KSP A;  6STD A;  1YGE A;  5AIH A;  1RSN A;  2CWV A;  1UCK A;  1IT7 A;  2PNC A;  2IYJ A;  1VZZ A;  3T0U A;  4WFO A;  3OV4 A;  4FMC A;  3EB8 A;  3UL5 A;  2XEP A;  6GSP A;  1FUW A;  3MG1 A;  1L5G B;  5IF6 A;  1RGG A;  4ZM8 A;  1RNB A;  5RNT A;  3H51 A;  1OUN A;  2OOV C;  3DGN A;  2IMJ A;  3FGY A;  2UGI A;  1B2S A;  3HX8 A;  4KFE A;  4CJN A;  3NBB A;  4WP5 A;  3D4A A;  4OK0 A;  3RDE A;  1VQ6 3;  2AAD A;  1RCL A;  3V92 A;  1AR0 A;  1MNL A;  2CIU A;  1E3R A;  1MWT A;  3CXC 2;  4RBN A;  1M1K 4;  4GL6 A;  3CC2 3;  1FW7 A;  3SOA A;  1LQM B;  1LRA A;  2ZA4 A;  5M18 A;  2XH9 A;  2RNT A;  2W9Q A;  4HOH A;  1JKG B;  1CYU A;  2P05 A;  2P0M A;  2LYX A;  5JPP A;  4MJD A;  2BMR B;  3EHC A;  1Q81 4;  1VQ5 3;  2YFL B;  3Q1C A;  3ALA A;  3D9R A;  1JBT A;  1MOL A;  2F98 A;  2HMM B;  2OTJ 3;  1JJ2 2;  1N9E A;  3I56 3;  2B24 B;  1MGW A;  1YIT 3;  1O7W B;  1EG9 B;  1B21 A;  1BNE A;  4L7K A;  2P09 A;  5D83 A;  1DYU A;  4N6U A;  3F14 A;  1ROA A;  3X3Y A;  1C54 A;  1B20 A;  1BVI A;  3FSD A;  5AIF A;  1S5A A;  1VQ7 3;  4RZM A;  1JBR A;  2E2U A;  1W00 A;  2CG1 A;  1GMR A;  1U8C B;  2STD A;  1VQ4 3;  2RCD A;  3QK9 A;  5AYR B;  1JN5 A;  1GY6 A;  2CFL A;  2HMN B;  3MWZ A;  3U1W A;  4KFF A;  1SQW A;  5ELJ A;  5KP4 A;  4H61 A;  3Q90 A;  3S67 A;  1N8Q A;  1I2G A;  3Q3F A;  3X40 A;  5FW5 A;  4EBG A;  1W7C A;  2RFR A;  4L8P A;  1KC8 4;  3NBR A;  1US1 A;  3KSE D;  4LMI A;  3JUM A;  4J8T A;  3SOY A;  4GSP A;  1NB5 I;  2C4B A;  3FG4 A;  1PFP A;  3L0R A;  5D82 A;  1ASK A;  1KSI A;  1LOY A;  1WMN A;  2HMJ B;  4ILF A;  2KF5 A;  3G16 A;  1FYS A;  4BL3 A;  3BB9 A;  4IT7 A;  5DRE A;  4MEI A;  2Y73 A;  3F40 A;  2BT3 A;  3PCR A;  1QVG 2;  2Z7A A;  1O7N B;  1BAO A;  2GEY A;  1STF I;  3CCQ 3;  1W6Y A;  3GZX B;  4HBR A;  3BIR A;  3GZB A;  2SAR A;  1VQP 3;  4EYC A;  3FLJ A;  1QJG A;  1X1U A;  1YHQ 3;  5G1L A;  1JV2 B;  1BAN A;  4BTX A;  1CH0 A;  1G02 A;  1GMP A;  1VQO 3;  1LOV A;  1JN5 B;  2YFJ B;  3VGN A;  1YIJ 3;  2O9U X;  5EQL A;  1B2U A;  2W56 B;  2WGQ A;  3ECF A;  3ER7 A;  1N5P A;  1VQQ A;  4HM2 B;  5AI1 A;  1JB4 A;  4RNZ A;  1AVK A;  1LNI A;  4EV5 A;  4HJL B;  1NO3 A;  2XR8 B;  3A5E A;  1JNQ A;  3GZY B;  4HM3 B;  4EC6 A;  3CME 3;  5AEU B;  1F8N A;  4O8S A;  4WYK A;  2MF7 A;  1BRK A;  3CNM A;  4NHF A;  4Q53 A;  1RTU A;  1LOW A;  4GHO A;  4O3V A;  1I0X A;  3V99 A;  4IPB A;  1UCJ A;  1VQL 3;  4HAA A;  4O02 B;  4XM4 A;  5IEO A;  1WQL B;  2WGO A;  4RNY A;  1FUS A;  1EEJ A;  1N9J A;  5A0O B;  2WO0 A;  1HU9 A;  3WMD A;  1RGF A;  3F7X A;  1WTH A;  4J5K A;  1YGW A;  5BIR A;  5BVB A;  4FR9 A;  3CD6 3;  5ELU A;  1BRS A;  3DM8 A;  3MG3 A;  3NQY A;  1NDO B;  2W6J H;  4XDV A;  3WOD G;  3EX9 A;  2CH9 A;  1UUV B;  3EQQ B;  3WOF B;  2XGN A;  1W6G A;  2C10 A;  3OX9 A;  1AVL A;  4K1V A;  1ULI B;  2HML B;  4EXR A;  3K9M C;  3X41 A;  1GOV A;  2O3O A;  1DE3 A;  5IW9 A;  3FKA A;  4WHA A;  1RLS A;  1A2V A;  2CFD A;  3FF0 A;  1V74 A;  5IER A;  4LEH A;  1BNF A;  5LC7 A;  1MGR A;  3ROB A;  3N9H A;  1I2F A;  1LXE A;  1B27 A;  1OCV A;  1FGQ A;  1WNH A;  1IVV A;  1Q9E A;  3F9S A;  4XDW A;  5M1A A;  1GMQ A;  3CCE 3;  3NM2 A;  3IPT A;  1YJ9 3;  2OOV A;  1Z1S A;  1I2E A;  3HZP A;  2IY2 A;  1MWU A;  1RCK A;  3BLZ A;  1Q40 B;  1Q7H A;  4MMZ B;  1BSE A;  1D6Z A;  2CHC A;  1JB5 A;  2V1L A;  3UB1 A;  3V98 A;  3WDG B;  1A2P A;  1T2I A;  2Z76 A;  3NV0 A;  1IVX A;  2IA7 A;  3URP A;  3S28 A;  2CK3 H;  4KZ1 A;  3ZFZ A;  5KP3 A;  2CX1 A;  3JUP A;  1BNJ A;  3KII A;  1DMN A;  5I97 A;  1EKM A;  1Q86 4;  1GD3 A;  2A15 A;  3LTA A;  4STD A;  5IG3 A;  1PU4 A;  2P38 A;  5BU4 A;  1ZO2 A;  2Q07 A;  4U13 A;  3G71 3;  4K61 A;  3KKG A;  1RGK A;  5D81 A;  1ZX2 A;  4R9L A;  4XBY A;  2HMK B;  2H0I A;  2K54 A;  1BNI A;  1RN4 A;  3KFQ C;  3X3Z A;  3BU4 A;  1K9M 4;  3IMA B;  2XFT A;  4O2H A;  1A90 A;  1TUH A;  1NNV A;  4XBX A;  3GRD A;  2XSO B;  3CC4 3;  4HM4 B;  1CYV A;  3HIG A;  1NJI 4;  1BU4 A;  1DVD A;  1E3V A;  2F5M A;  1LOX A;  2D42 A;  3CPO A;  2FGT A;  2KF4 A;  1T5Y A;  2W0Q A;  4R80 A;  1NU3 A;  1R4C A;  3G4S 3;  1JB2 A;  3LYG A;  2CWU A;  1OHP A;  2I9W A;  2HOH A;  5EVH A;  1UUW B;  1EUI C;  1DET A;  3LTD A;  3PXM A;  3BNC A;  3LTC A;  2JDI H;  3EF8 A;  3I0Y A;  5HGR A;  4WWU C;  2RSX A;  4MMX B;  1IVW A;  2KRT A;  3CCU 3;  3SLU A;  3X42 A;  1V58 A;  1TIJ A;  1TJD A;  5CXO A;  1KD1 4;  1J2B A;  2ML5 A;  1UUG B;  4ORL A;  3ZG0 A;  4PEJ A;  5G1K A;  2H0G A;  2QA4 3;  1QAF A;  3K7C A;  1OHO A;  1W5Z A;  1KQS 2;  1FUT A;  8CHO A;  3Q2P A;  3WHO A;  2JQ5 A;  2F86 B;  2OWP A;  4BL2 A;  1GD4 A;  4OVM A;  3CC7 3;  1BNG A;  2YX9 A;  3PZW A;  3CCM 3;  2BIR A;  1Q82 4;  2CFW A;  5AII A;  3G8Z A;  1M90 4;  4JRF A;  2W04 A;  3EE1 A;  1TU5 A;  1CEW I;  2W9P A;  3DGM A;  2INX A;  3MG2 A;  4HM5 B;  1GOY A;  3DXO A;  1OHS A;  3F7S A;  4BU4 A;  4XB5 A;  1RRH A;  1EA2 A;  3NM7 A;  1RMS A;  4K1U A;  3GWR A;  1AY7 A;  3MHE A;  1B2Z A;  3PGB A;  2BO9 B;  1RNT A;  4FMD A;  3PS8 A;  3G6E 3;  4FCZ A;  4HZ9 B;  2BHM A;  3AGN A;  5IG5 A;  2CWT A;  4HM6 B;  2HMO B;  2CFG A;  3CCS 3;  3FH1 A;  4KT3 B;  2IUJ A;  4HYZ A;  1RN7 A;  3B7C A;  1IYY A;  1AV4 A;  4G1M B;  1O7P B;  4N6L A;  4NPB A;  3OW2 2;  1I3F A;  3H3H A;  1RHL A;  2QIY A;  1GSP A;  3FG3 A;  3G0K A;  2WOF A;  2GU1 A;  1YVS A;  5AIG A;  1KWI A;  1BGS A;  3OXA A;  3WA3 A;  3JUN A;  4RNT A;  3SYU A;  4KFD A;  5EEO A;  1BRI A;  3AMO A;  1N8R 4;  1X1X A;  3KCH A;  5GSP A;  1BUQ A;  3CU3 A;  3NHX A;  3WOE B;  2LQV A;  1B3S A;  3LH4 A;  3X3X A;  2E2V A;  3NQZ A;  1VQ9 3;  1X1Y A;  3AGO A; 
#chains in the Genus database with same CATH homology
 2GBW B;  5KP1 A;  1IVU A;  1M9G A;  1S72 3;  1QMA A;  1W01 A;  1U5O A;  1GY7 A;  4N6V 0;  2M7O A;  5FGO A;  3N54 B;  2OCT A;  1WMP A;  3MSO A;  2KXG A;  5G2G A;  4N6N B;  2GXF A;  2OQE C;  3F8X A;  4R9K A;  1QAK A;  3OWY A;  4K90 B;  4N6O B;  5JPU A;  3HII A;  4N6T A;  2K0M A;  2XF3 A;  2PZV A;  3KE7 A;  1OPY A;  3HK4 A;  3LOY A;  1VQ8 3;  1YI2 3;  2YFI B;  2BMO B;  3K63 A;  1IK3 A;  1Q42 A;  4LGQ A;  5CLK A;  4WYK B;  5CK6 A;  4BTY A;  3JUO A;  2QEX 3;  2F99 A;  1SII A;  4FCM A;  2OTL 3;  5LC6 A;  3EC9 A;  3F8H A;  3NX0 A;  1JKG A;  2BNG A;  3FCS B;  3GZR A;  2IUK A;  2Z77 A;  4AKY A;  1FGT A;  4H3U A;  3N8B A;  1W6C A;  1FGO A;  1OGZ A;  1RJO A;  1K28 A;  3T8N A;  1OGX A;  2FXT A;  4FMB A;  5STD A;  1JRQ A;  2ML6 A;  2SBL A;  3KN4 A;  1DVC A;  1A67 A;  3NBJ A;  4CCV A;  2C11 A;  3DMC A;  3WA2 X;  2UX0 A;  5IEN A;  1GS3 A;  3BND A;  1OH0 A;  3LML A;  3MYT A;  4HM0 B;  2WOH A;  5CF1 A;  3FG1 A;  3SXX A;  3PCS A;  1W2B 2;  4CDL A;  3B4O A;  4EV2 A;  3CCL 3;  1Q7Y 4;  3DGL A;  1ULJ B;  5TGN A;  1DMQ A;  4N3V A;  1OAC A;  3B8L A;  3NUV A;  4HM8 B;  1C7H A;  3DUK A;  2E2T A;  3CMA 3;  5IG0 A;  4AEQ A;  3I55 3;  4HM7 B;  4I4K A;  1IV9 A;  2B1X B;  3EBT A;  3EBY A;  1D6U A;  2RGQ A;  3BNB A;  3UL6 A;  1GY5 A;  2Z6B A;  3NV0 B;  1W2Z A;  2CG0 A;  3CCJ 3;  1VQM 3;  2BMQ B;  1TFK A;  4HKV B;  4MMY B;  1IQX A;  2D1W A;  2Y74 A;  3J7Y d;  1EQK A;  1IQY A;  1K41 A;  5JBS A;  2XRX B;  3A76 A;  5DRV A;  3TDG A;  1SJW A;  2XSH B;  2CKF B;  1K8A 4;  1O7M B;  1FGM A;  1N5H A;  1VQN 3;  2KCD A;  1RKY A;  2W03 A;  4QWT A;  3GAX A;  2QGU A;  2ZDJ A;  3VSY A;  3U97 A;  1IQ8 A;  2ZL8 A;  1O7G B;  4HM1 B;  3SED A;  2W56 A;  3S27 A;  1QVF 2;  3FZW A;  4LSO A;  3LXU X;  1LVN A;  3FF2 A;  4J9A A;  3CNX A;  3CPW 2;  2R4I A;  3KZT A;  2L4V A;  1OF5 A;  3SVA A;  1YVB I;  4HZB B;  2GEX A;  3QRD A;  5CF2 A;  4XBT A;  3EJV A;  3O8Y A;  1K73 4;  1GYB A;  4FCJ A;  5AYS C;  3PYJ A;  3NXJ A;  1W4N A;  3K0Z A;  1QAL A;  3RGR A;  2FNQ A;  1FA3 A;  3LZA A;  1CQS A;  2P0X A;  4L8O A;  3JUQ A;  1UW1 A;  3E99 A;  4KVH A;  4JF8 A;  1O7H B;  3S5C A;  2GBX B;  2XFS A;  3LT9 A;  3UNL A;  1DMM A;  3M8C A;  1Y4K A;  1SPU A;  1NB3 I;  5IG4 A;  7STD A;  1NWW A;  3OWU A;  1TFO A;  3OWS A;  1FGR A;  1YJN 3;  5IEP A;  2CW9 A;  3D3L A;  1TP6 A;  1G96 A;  2W2C A;  1LNH A;  3S29 A;  4HVN A;  1M1X B;  1WMO A;  4NRE A;  3K5T A;  5BXQ A;  3B4P A;  3VF1 A;  1OF5 B;  2OQE A;  3CCR 3;  1ISK A;  3BNE A;  1D6Y A;  3LT8 A;  4LZI A;  1VQK 3;  1E97 A;  1Q40 A;  5AEW B;  2XGL A;  3T8U A;  1IDP A;  1W02 A;  4IIA A;  1IT8 A;  1STD A;  4TX4 A;  3STD A;  1HKX A;  1YJW 3;  4X2H A;  4FMA A;  3CCV 3;  3RGA A;  3EN1 B;  3HI7 A;  1SIH A;  4GB5 A;  4R4K A;  1ROV A;  2CC3 A;  3MPH A;  4OUQ A;  2CFK A;  3DGO A;  3AMO B;  2MC8 A;  2GU3 A;  4X2O A;  1UI8 A;  3DZL A;  3JVC A;  1A2K A;  1IU7 A;  3SX1 A;  4BTW A;  3MKI A;  1RRL A;  4AKZ A;  1IV7 A;  3IJE B;  4R1K A;  3EN8 A;  3UJM A;  1UI7 A;  3DY5 A;  3LTB A;  4N6M A;  3KSP A;  6STD A;  1YGE A;  5AIH A;  2CWV A;  1IT7 A;  2PNC A;  1VZZ A;  3T0U A;  4WFO A;  3OV4 A;  4FMC A;  3EB8 A;  3UL5 A;  2XEP A;  1FUW A;  3MG1 A;  1L5G B;  5IF6 A;  4ZM8 A;  3H51 A;  1OUN A;  2OOV C;  3DGN A;  2IMJ A;  3FGY A;  3HX8 A;  4KFE A;  3NBB A;  4WP5 A;  3RDE A;  4OK0 A;  1VQ6 3;  3V92 A;  1AR0 A;  1MNL A;  2CIU A;  1E3R A;  3CXC 2;  4RBN A;  1M1K 4;  4GL6 A;  3CC2 3;  3SOA A;  2XH9 A;  2W9Q A;  1CYU A;  1JKG B;  2P05 A;  2P0M A;  2LYX A;  5JPP A;  4MJD A;  2BMR B;  3EHC A;  1Q81 4;  1VQ5 3;  2YFL B;  3Q1C A;  3ALA A;  3D9R A;  1MOL A;  2F98 A;  2HMM B;  2OTJ 3;  1JJ2 2;  1N9E A;  3I56 3;  2B24 B;  1YIT 3;  1O7W B;  1EG9 B;  4L7K A;  2P09 A;  5D83 A;  1DYU A;  4N6U A;  3F14 A;  1ROA A;  3X3Y A;  3FSD A;  5AIF A;  1VQ7 3;  1S5A A;  4RZM A;  2E2U A;  1W00 A;  2CG1 A;  1U8C B;  2STD A;  1VQ4 3;  2RCD A;  3QK9 A;  5AYR B;  1JN5 A;  1GY6 A;  2CFL A;  2HMN B;  3MWZ A;  3U1W A;  4KFF A;  1SQW A;  5ELJ A;  5KP4 A;  4H61 A;  3Q90 A;  3S67 A;  1N8Q A;  3X40 A;  5FW5 A;  4EBG A;  1W7C A;  2RFR A;  4L8P A;  1KC8 4;  3NBR A;  1US1 A;  3KSE D;  4LMI A;  3JUM A;  4J8T A;  3SOY A;  1NB5 I;  5D82 A;  3FG4 A;  1PFP A;  3L0R A;  1ASK A;  1KSI A;  1WMN A;  2HMJ B;  3G16 A;  3BB9 A;  4IT7 A;  5DRE A;  4MEI A;  2Y73 A;  3F40 A;  2BT3 A;  3PCR A;  1QVG 2;  2Z7A A;  1O7N B;  2GEY A;  1STF I;  3CCQ 3;  1W6Y A;  3GZX B;  4HBR A;  3GZB A;  1VQP 3;  4EYC A;  3FLJ A;  1QJG A;  1YHQ 3;  1JV2 B;  4BTX A;  1VQO 3;  2YFJ B;  1JN5 B;  3VGN A;  1YIJ 3;  2O9U X;  5EQL A;  2W56 B;  2WGQ A;  3ECF A;  3ER7 A;  1N5P A;  4HM2 B;  5AI1 A;  1JB4 A;  4RNZ A;  1AVK A;  4EV5 A;  4HJL B;  1NO3 A;  2XR8 B;  1JNQ A;  3GZY B;  4HM3 B;  4EC6 A;  3CME 3;  5AEU B;  1F8N A;  4O8S A;  4WYK A;  2MF7 A;  3CNM A;  4NHF A;  4Q53 A;  4O3V A;  3V99 A;  4IPB A;  1VQL 3;  4O02 B;  4XM4 A;  5IEO A;  1WQL B;  2WGO A;  4RNY A;  1N9J A;  5A0O B;  2WO0 A;  1HU9 A;  3WMD A;  3F7X A;  1WTH A;  5BVB A;  3CD6 3;  4FR9 A;  5ELU A;  3DM8 A;  3NQY A;  3MG3 A;  4XDV A;  1NDO B;  2W6J H;  3WOD G;  3EX9 A;  2CH9 A;  1UUV B;  3EQQ B;  3WOF B;  2XGN A;  1W6G A;  2C10 A;  3OX9 A;  1AVL A;  4K1V A;  1ULI B;  2HML B;  4EXR A;  3K9M C;  3X41 A;  2O3O A;  5IW9 A;  3FKA A;  4WHA A;  1A2V A;  2CFD A;  3FF0 A;  1V74 A;  5IER A;  4LEH A;  5LC7 A;  3ROB A;  3N9H A;  1LXE A;  1OCV A;  1FGQ A;  1WNH A;  1IVV A;  3F9S A;  4XDW A;  3CCE 3;  3NM2 A;  3IPT A;  1YJ9 3;  2OOV A;  1Z1S A;  3HZP A;  4MMZ B;  3BLZ A;  1Q40 B;  2V1L A;  1D6Z A;  2CHC A;  1JB5 A;  3UB1 A;  3V98 A;  3WDG B;  2Z76 A;  3NV0 A;  1IVX A;  2IA7 A;  3S28 A;  2CK3 H;  4KZ1 A;  5KP3 A;  3JUP A;  5I97 A;  3KII A;  1Q86 4;  1DMN A;  1EKM A;  1GD3 A;  2A15 A;  3LTA A;  4STD A;  5IG3 A;  1PU4 A;  2P38 A;  1ZO2 A;  2Q07 A;  4U13 A;  3G71 3;  4K61 A;  3KKG A;  5D81 A;  1ZX2 A;  4R9L A;  4XBY A;  2HMK B;  2K54 A;  3KFQ C;  3X3Z A;  1K9M 4;  3IMA B;  2XFT A;  4O2H A;  1A90 A;  1TUH A;  4XBX A;  3GRD A;  2XSO B;  3CC4 3;  4HM4 B;  1CYV A;  3HIG A;  1NJI 4;  1DVD A;  1E3V A;  1LOX A;  2D42 A;  3CPO A;  2FGT A;  1T5Y A;  2W0Q A;  4R80 A;  1NU3 A;  1R4C A;  3G4S 3;  1JB2 A;  3LYG A;  2CWU A;  1OHP A;  2I9W A;  5EVH A;  1UUW B;  3LTD A;  3PXM A;  3BNC A;  3LTC A;  2JDI H;  3EF8 A;  3I0Y A;  5HGR A;  4WWU C;  2RSX A;  4MMX B;  1IVW A;  2KRT A;  3CCU 3;  3SLU A;  3X42 A;  1TIJ A;  5CXO A;  1KD1 4;  1J2B A;  2ML5 A;  4ORL A;  4PEJ A;  2QA4 3;  1QAF A;  3K7C A;  1OHO A;  1W5Z A;  1KQS 2;  8CHO A;  3Q2P A;  2JQ5 A;  2F86 B;  2OWP A;  1GD4 A;  4OVM A;  3CC7 3;  3PZW A;  2YX9 A;  3CCM 3;  1Q82 4;  2CFW A;  5AII A;  3G8Z A;  1M90 4;  4JRF A;  2W04 A;  3EE1 A;  1TU5 A;  1CEW I;  2W9P A;  3DGM A;  2INX A;  3MG2 A;  4HM5 B;  3DXO A;  1OHS A;  3F7S A;  4XB5 A;  1RRH A;  1EA2 A;  3NM7 A;  4K1U A;  3GWR A;  3MHE A;  3PGB A;  2BO9 B;  4FMD A;  3PS8 A;  3G6E 3;  4FCZ A;  4HZ9 B;  2BHM A;  5IG5 A;  2CWT A;  4HM6 B;  2HMO B;  2CFG A;  3CCS 3;  3FH1 A;  2IUJ A;  4HYZ A;  1RN7 A;  3B7C A;  1AV4 A;  4G1M B;  1O7P B;  4N6L A;  3OW2 2;  3H3H A;  2QIY A;  3FG3 A;  3G0K A;  2WOF A;  2GU1 A;  5AIG A;  1KWI A;  3OXA A;  3WA3 A;  3JUN A;  4KFD A;  5EEO A;  3AMO A;  1N8R 4;  1BUQ A;  3CU3 A;  3NHX A;  3WOE B;  2LQV A;  3LH4 A;  3X3X A;  2E2V A;  3NQZ A;  1VQ9 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...