1CQSA

Crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
124
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIEVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN : KETOSTEROID ISOMERASE
publication title Asp-99 donates a hydrogen bond not to Tyr-14 but to the steroid directly in the catalytic mechanism of Delta 5-3-ketosteroid isomerase from Pseudomonas putida biotype B
pubmed doi rcsb
source organism Pseudomonas putida
total genus 34
structure length 124
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cqsA00
1UUVB 4XBTA 1IDPA 3BB9A 4HM5B 3DZLA 2CHCA 1OF5A 4R1KA 2GEXA 1W02A 4WYKA 5G2GA 5AIHA 1STDA 1DMNA 3OV4A 2BMQB 1JB5A 4HKVB 4I4KA 2Z77A 1Q40A 1OHOA 5AEUB 3EN8A 6STDA 2IMJA 3NV0A 3M8CA 4STDA 5IENA 1E3VA 4N3VA 1OH0A 4L7KA 1O7GB 4HVNA 8CHOA 4L8PA 1K41A 3OWYA 5D83A 5D82A 3EHCA 3GZRA 3MHEA 5AIIA 5KP1A 4R9LA 3UJMA 2YFJB 1W6YA 4OUQA 4OVMA 5KP3A 3DM8A 1JB2A 3CPOA 1OHPA 3EBYA 2PZVA 3F7XA 2JQ5A 3MSOA 3F40A 5CK6A 3JUNA 2A15A 1NU3A 2UX0A 3KZTA 2YFIB 3GZBA 4HM3B 5DREA 3EN1B 2STDA 1BUQA 3B8LA 4XBXA 4HZ9B 3ROBA 3GZXB 2BMRB 4GB5A 1O7NB 4J9AA 1C7HA 1JKGB 5CF2A 1HKXA 2GXFA 1EG9B 1DMMA 1NDOB 3BLZA 3FZWA 3RGRA 4HZBB 3K7CA 2HMJB 2B24B 1JB4A 4Q53A 3EX9A 3F8HA 4CDLA 4U13A 5IERA 3DMCA 1CQSA 3ER7A 1QMAA 3EBTA 3K0ZA 5AEWB 1ULJB 5TGNA 1ASKA 3EQQB 5DRVA 3KKGA 1O7MB 5IG4A 2K54A 3FSDA 4PEJA 3T8NA 3SOYA 5CF1A 2Z7AA 4K1VA 5IEOA 1U5OA 4HM8B 3F7SA 1E3RA 1ISKA 2HMLB 2INXA 2B1XB 1GYBA 3NHXA 2GBWB 3JUMA 1OCVA 3KE7A 3A76A 1Z1SA 5HGRA 1OHSA 4HM0B 1NWWA 3MG2A 1S5AA 2CKFB 1W01A 3FH1A 3B4PA 3HZPA 4XDWA 5CLKA 2QIYA 1AR0A 4X2OA 4K1UA 2RCDA 1OPYA 3T8UA 5D81A 3S5CA 1QJGA 3MYTA 5IG3A 2BNGA 4R9KA 4J8TA 5STDA 4L8OA 1TP6A 3G0KA 3NUVA 3B4OA 1W00A 3VGNA 2BMOB 5IG5A 3SOAA 3OWSA 3UNLA 3B7CA 4HM4B 1SJWA 3F9SA 4XM4A 2F86B 1GY5A 4H3UA 1OGXA 3RGAA 3HK4A 1Q42A 2RGQA 3GZYB 1E97A 1DMQA 3NV0B 3F14A 4XDVA 1O7WB 1UUWB 3CU3A 3NBRA 3WMDA 3G8ZA 2F99A 3FF0A 5KP4A 5AIFA 1TUHA 3VSYA 3DXOA 3EF8A 4HM1B 5AIGA 3H3HA 4RZMA 5CXOA 2YFLB 2W2CA 3GRDA 3JUQA 1ZX2A 1WQLB 3EC9A 4X2HA 1ULIB 5IG0A 2HMKB 3FLJA 4IIAA 3JUPA 3MG1A 4XBYA 1JKGA 2RFRA 3E99A 3STDA 5IF6A 4HM7B 2XSHB 3FGYA 4FCJA 3IPTA 4XB5A 2F98A 2XR8B 1GS3A 1JN5B 3MKIA 3HX8A 3ECFA 4ORLA 3G16A 3FKAA 4WP5A 3GWRA 1OGZA 5BVBA 4MJDA 1O7HB 2GBXB 2QGUA 2HMOB 1ZO2A 3D9RA 4HM2B 4LGQA 5BXQA 1EA2A 2XRXB 3CNXA 1GY7A 3FF2A 4HM6B 1OUNA 3JUOA 3MG3A 3KSPA 3H51A 3DUKA 5AI1A 2OWPA 2GEYA 5IEPA 1GY6A 4HJLB 1VZZA 1JN5A 4KVHA 3CNMA 1OF5B 5FW5A 1O7PB 3SEDA 2R4IA 4WYKB 2Z76A 5JPPA 4LMIA 3OWUA 4LEHA 1Q40B 2HMNB 3F8XA 3Q90A 7STDA 3NM2A 3LYGA 4FCMA 3LZAA 3I0YA 1A2KA 5EVHA 2I9WA 4WWUC 3EJVA 3OX9A 5JPUA 3OXAA 2HMMB 2XSOB 3NXJA
chains in the Genus database with same CATH superfamily
1BSDA 3PYJA 4H61A 1UUVB 1BSCA 2CG1A 4XBTA 5A0OB 1IDPA 3BB9A 3N8BA 4HM5B 3DZLA 2GSPA 2CHCA 1OF5A 3LTDA 1W5ZA 1Q824 4R1KA 2GEXA 2W0QA 3DGYA 1N9EA 3LTAA 5ELUA 1A90A 1W02A 1BNSA 5ELJA 4WYKA 4WHAA 5G2GA 2F5WA 1FUWA 5AIHA 3LOYA 1T2IA 1STDA 1YVSA 1DMNA 4MMZB 1NB5I 3OV4A 1KSIA 1ZS7A 2BMQB 1JB5A 3K63A 4HKVB 1YGWA 3N9HA 1QAFA 1RGAA 1RNTA 3UL6A 2C10A 2OTL3 4I4KA 2PNCA 1BNRA 2Z77A 1Q40A 1OHOA 5AEUB 3EN8A 1UCKA 6STDA 1AV4A 3CCJ3 2P0MA 2XF3A 1BNFA 2IMJA 1FA3A 1CEWI 1BOXA 3NV0A 3M8CA 4STDA 1YIT3 4FR9A 5IENA 2ZDJA 1E3VA 4N3VA 4EYCA 1OH0A 3S27A 3SVAA 4N6TA 2KF5A 1UI8A 2KF6A 4L7KA 3TDGA 2GU1A 1O7GB 4HVNA 8CHOA 3LTCA 4L8PA 2IYJA 1HU9A 1GOUA 3BNBA 1K41A 1JJ22 3X42A 2LYXA 2XGNA 3OWYA 2CIUA 4EW5A 5D83A 3D79A 3EHCA 3GZRA 5D82A 9RNTA 1DETA 3CC73 1NJI4 3MHEA 2H0IA 1BIRA 2SARA 1N8R4 1UI7A 2RBIA 6RNTA 1PU4A 4CPKA 5AIIA 1VQP3 1BRIA 5JBSA 5AYRB 3AGNA 3D3LA 3V99A 1BRSA 5KP1A 5GSPA 4R9LA 4GL6A 2YFJB 3UJMA 1W6YA 2BT3A 3AGOA 4OUQA 4EBGA 1QALA 1KQS2 4OVMA 5KP3A 2F5MA 3DM8A 3S67A 5G1LA 1JBRA 1FGOA 1JB2A 1X1XA 2Y74A 3CPOA 1OHPA 1UCJA 3EBYA 1EUIC 4NPBA 2PZVA 3F7XA 2JQ5A 3KSED 3MSOA 3LXUX 1RN7A 1UUGB 3FG1A 1A2VA 1W2ZA 2Q07A 4FMDA 1MGRA 3CCL3 3F40A 1GOVA 2CX1A 3MWZA 2KF4A 5CK6A 5EQLA 3T0UA 4EC6A 1NO3A 1T3BA 2YX9A 3EB8A 3JUNA 4O8SA 4BL2A 2A15A 1NU3A 2UX0A 2GU3A 1T2HA 1MWTA 4LYLB 1MWRA 2CFKA 5EEOA 3LTBA 3WOFB 2WOFA 3KZTA 1HYFA 1RNBA 1QAKA 2YFIB 1WTHA 3GZBA 3NM7A 4RBNA 1M904 1JZOA 1YHQ3 4AKYA 2W56A 1US1A 4HM3B 3I563 1YJW3 2XH9A 1W7CA 4N6MA 5DREA 1L5GB 1A67A 3EN1B 3O8YA 3PCRA 1MWUA 2STDA 1BUQA 1QVG2 3B8LA 4WFOA 2OTJ3 3DGMA 1WNHA 4XBXA 1BNEA 4HZ9B 1Q864 3CC43 1D6ZA 1A2PA 1U8CB 3MPHA 3ROBA 3CCM3 2K3DA 3GZXB 1RRHA 2BMRB 4GB5A 1O7NB 4J9AA 2H0GA 3U97A 2LQVA 1JBSA 2FNQA 3Q1CA 2AAEA 3PZWA 1C7HA 1YIJ3 1LQMB 1I8VA 1JKGB 3BU4A 2QA43 1K734 5CF2A 1HKXA 1LQGC 3LT9A 1FGTA 2GXFA 1EG9B 1RKYA 1DMMA 1NDOB 2P09A 3BLZA 3FZWA 3RGRA 1IU7A 3G713 1VQO3 1YJ93 1W6GA 1DYUA 1LOXA 4HZBB 3J7Yd 2AADA 1HZ1A 3K7CA 2F56A 1B3SA 1EQKA 2HMJB 2E2UA 2B24B 1IK3A 1JB4A 2CFGA 2O3OA 2W03A 1FGMA 1N9JA 4I5QA 3BNEA 2K0MA 1BAOA 1TRQA 2XFSA 3EX9A 1K28A 2E2TA 4Q53A 3F8HA 3NQYA 1LRAA 4CDLA 4U13A 3VF1A 5IERA 1K9M4 1RGGA 1JZDA 3BNCA 1BRHA 1CQSA 2ZL8A 3DMCA 1GMQA 1C54A 2IUJA 3ER7A 3X41A 2CFDA 1PY3A 1B2UA 1QMAA 2WGOA 3EBTA 3K0ZA 4QWTA 5AEWB 1Q9EA 2WGQA 3JVCA 1EKMA 3QRDA 1B20A 1ULJB 1YGEA 5TGNA 1ASKA 3EQQB 5DRVA 1I2FA 1FYSA 1GSPA 2FGTA 2MC8A 1I0XA 2OQEC 3KKGA 3ZFZA 6GSPA 1W6CA 1O7MB 1X1WA 1BVIA 5IG4A 4O3VA 1G0TA 1K8A4 2K54A 3FSDA 1R4YA 3CME3 3FG3A 4PEJA 4CJNA 5BU4A 4BTYA 2ZHXB 4BTWA 1RCLA 2Y73A 3SOYA 3T8NA 3PCSA 1MGWA 1TJDA 1BRJA 4HAAA 5CF1A 1UGIA 1D6YA 2Z7AA 1CH0A 4K1VA 4FMAA 1V58A 3CMA3 4JF8A 4EXRA 5IEOA 1U5OA 2ZA4A 4HM8B 1AVLA 4K90B 3F7SA 4IPBA 1E3RA 4KZ1A 4HYZA 1RMSA 3WA2X 2CFWA 2W9QA 1BSAA 2IUKA 2HMLB 3CD63 2INXA 2B1XB 1GYBA 1RN1A 1ISKA 1JNQA 1IT8A 3NHXA 2GBWB 3LT8A 4J5GA 3JUMA 3HIGA 1OCVA 3KE7A 4O2HA 3V92A 3WHOA 3A76A 2Z6BA 1Z1SA 3PXMA 1T5YA 3WA3A 2KRTA 3KIIA 3DGOA 1B21A 5HGRA 1TFOA 2M7OA 3I553 1W2B2 1BNGA 1OHSA 4HM0B 1B2ZA 5G1KA 1YJN3 1WMPA 3IJEB 1NWWA 2L4VA 3FG4A 3MG2A 1GD4A 1S5AA 2CKFB 3N54B 1W01A 3UB1A 3LMLA 2C4BA 2WOHA 3EE1A 2O9UX 3FH1A 1QVF2 3B4PA 3HZPA 1PFPA 3AHWA 4XDWA 5CLKA 4OK0A 1BANA 1LNIA 1VQ73 2QIYA 1Q814 5I97A 1AR0A 3AHSA 4X2OA 2XEPA 8RNTA 4K1UA 2RCDA 5M18A 3CC23 1LOVA 1UCLA 1OPYA 1SIIA 3T8UA 5D81A 3S5CA 1BGSA 1QJGA 1MWSA 3MYTA 1V74A 5IG3A 2BNGA 2KF3A 4R9KA 1TRPA 4J8TA 5STDA 4L8OA 1SIHA 1TP6A 3G0KA 3KCHA 3RDEA 5AYSC 3G6E3 1RGCA 3NUVA 1BRKA 3B4OA 1W00A 4RNYA 3VGNA 3SX1A 7GSPA 4LZIA 2BMOB 3X3YA 3GAXA 5IG5A 1BNIA 1IVVA 5LC6A 3SOAA 1BSEA 1BU4A 3OWSA 3HOHA 1IVWA 1DE3A 3UNLA 2E2VA 1KC84 3B7CA 2CH9A 4HM4B 1TFKA 4JRFA 1SJWA 1X1YA 3F9SA 1Y4KA 4MEIA 1RRLA 4XM4A 1RGHA 4HBRA 4AKZA 1LNHA 1GD3A 2F86B 1CYUA 1ROAA 1GY5A 4H3UA 1YI23 2RSXA 1OGXA 3QK9A 1ZGXA 1GMRA 4KFEA 1IYYA 1LXEA 4NREA 3LH4A 1JBTA 2P0XA 3RGAA 4BTXA 3HK4A 4DKIA 4GSPA 1UW1A 3A5EA 1Q42A 2RGQA 1B2SA 1CYVA 1LVNA 2CG0A 2D1WA 3ALAA 3GZYB 1E97A 2OQEA 1DMQA 3SYUA 3UL5A 3IMAB 3NV0B 3F14A 4MMYB 4XDVA 4K61A 1O7WB 1F8NA 3OW22 1UUWB 2XGLA 3CU3A 4AEQA 3NBRA 3S28A 2F4YA 3WMDA 3G8ZA 1RTUA 2D42A 2W6JH 2F99A 3FF0A 5KP4A 1VQ43 1WMNA 1RHLA 1TUHA 3D5IA 5AIFA 1J2BA 3VSYA 3CCS3 3DXOA 3EF8A 4HM1B 5AIGA 3H3HA 4RZMA 1UDII 3HIIA 5CXOA 1VQM3 1N8QA 1R4CA 1X1UA 3DH2A 2YFLB 3DY5A 3K5TA 1FUSA 2W2CA 3GRDA 3JUQA 1SQWA 1AY7A 1EEJA 1VQ53 1ZX2A 1WQLB 3EC9A 4X2HA 1AVKA 1ULIB 3PS8A 5IG0A 1N5PA 2BO9B 1IQYA 2HMKB 3FLJA 4IIAA 1BUJA 2OOVA 1G02A 3JUPA 2CFLA 3MG1A 3CCU3 1VQ93 1FUTA 1LOWA 4EV5A 4J5KA 1VQQA 4XBYA 2P38A 1JKGA 3FCSB 5LC7A 2CW9A 1YNVX 2RFRA 3SLUA 3E99A 3D5GA 1RGFA 3STDA 4ILFA 1VQN3 1IQ8A 4BIRA 5IF6A 4HM7B 1LOYA 3S29A 1VQ63 2XSHB 1BNJA 4KT3B 3FGYA 4FCJA 3WODG 1I2GA 1RN4A 3IPTA 3URPA 1TTOA 4BU4A 2FXTA 3D4AA 4XB5A 3X3XA 3CCQ3 2QEX3 3G4S3 4FMCA 2F98A 3V98A 2XR8B 1TU5A 2OOVC 5BIRA 1GS3A 3Q2PA 2OCTA 2P05A 1JN5B 1TIJA 3CCE3 2MF7A 3MKIA 1Q7Y4 3HX8A 1RDSA 2R41A 1D6UA 3ECFA 3AMOB 4HOHA 4ORLA 2J8XB 3G16A 2RNTA 2W56B 4FCZA 1IT7A 2IA7A 1VQ83 2JDIH 1M1XB 3FKAA 3U1WA 4CCVA 4WP5A 5HOHA 1MNLA 2CWVA 3GWRA 2C11A 1OGZA 2HOHA 3HI7A 5BVBA 2W04A 1GOYA 1BSBA 3X3ZA 4MJDA 3Q3FA 1UGHI 4MMXB 1O7HB 3WR2A 4ZM8A 4R80A 2GBXB 2QGUA 1RGLA 4LSOA 4N6V0 4N6NB 2HMOB 5IW9A 1ZO2A 1I3FA 3D9RA 4HM2B 1B2MA 1BRGA 2UUGC 4LGQA 5BXQA 4N6UA 1KD14 1IV7A 1EA2A 2XRXB 1I2EA 3CNXA 1GY7A 3FF2A 2W9PA 4HM6B 4NHFA 1FGQA 1STFI 1I0VA 1OUNA 1GMPA 3JUOA 2BIRA 3MG3A 3GSPA 4R4KA 1VQK3 3DGNA 1VQL3 3KSPA 1RCKA 3H51A 3NBBA 1JRQA 1MOLA 3DUKA 1PYLA 5AI1A 2H0HA 2OWPA 4EV2A 1YVBI 2GEYA 3DGLA 1BRNL 1UCIA 4N6LA 1OACA 3NQZA 1W4NA 5IEPA 1FGRA 1GY6A 4HJLB 5FGOA 1SARA 2KCDA 4FMBA 1B2XA 1KWIA 1VZZA 2CC3A 2SBLA 1S723 2KXGA 1JN5A 4KVHA 3ZG0A 1M9GA 2CX0A 3RNTA 4TX4A 2ML5A 3CNMA 1OF5B 3CCV3 5FW5A 4RNZA 1M1K4 3AMOA 1Q7HA 1O7PB 2CWTA 3SEDA 4BL3A 2BU4A 1IVUA 1FZUA 2WO0A 1V57A 3NBJA 2R4IA 4WYKB 1N5HA 5RNTA 2Z76A 4G1MB 5JPPA 1B27A 4LMIA 1FW7A 1NNVA 3KFQC 1RJOA 3SXXA 4IT7A 2BHMA 2IY2A 2UGIA 1NB3I 3BIRA 7RNTA 4KFFA 1IVXA 3KN4A 3OWUA 2L1SA 4LEHA 1I3IA 1Q40B 1I70A 1ROVA 1AQZA 2HMNB 3F8XA 1DVCA 4KFDA 4RNTA 3Q90A 3NX0A 7STDA 3NM2A 4N6OB 3LYGA 1DVDA 4FCMA 1RLSA 3BNDA 3LZAA 3I0YA 2CK3H 1G96A 1RGEA 1A2KA 1WMOA 3WDGB 1JV2B 3PGBA 1RGKA 2V1LA 3K9MC 4O02B 1RSNA 1SPUA 5EVHA 2I9WA 3CPW2 4WWUC 3ZG5A 3CXC2 3CCR3 3WOEB 2XFTA 2ML6A 3EJVA 3OX9A 5JPUA 5M1AA 2CWUA 3OXAA 2KAAA 1IV9A 4GHOA 5M19A 2HMMB 3L0RA 2XSOB 3X40A 3NXJA 1IQXA
chains in the Genus database with same CATH topology
3PYJA 4H61A 1UUVB 2CG1A 4XBTA 5A0OB 1IDPA 3BB9A 3N8BA 4HM5B 3DZLA 2CHCA 1OF5A 3LTDA 1W5ZA 1Q824 4R1KA 2GEXA 2W0QA 1N9EA 3LTAA 5ELUA 1A90A 1W02A 5ELJA 4WYKA 4WHAA 5G2GA 1FUWA 5AIHA 3LOYA 1STDA 4MMZB 1DMNA 1NB5I 3OV4A 1KSIA 2BMQB 1JB5A 3K63A 4HKVB 3N9HA 1QAFA 3UL6A 2C10A 2OTL3 4I4KA 2PNCA 2Z77A 1Q40A 1OHOA 5AEUB 3EN8A 6STDA 1AV4A 3CCJ3 2P0MA 2XF3A 2IMJA 1FA3A 1CEWI 3NV0A 1YIT3 3M8CA 4STDA 4FR9A 5IENA 2ZDJA 1E3VA 4N3VA 4EYCA 1OH0A 3S27A 3SVAA 4N6TA 1UI8A 4L7KA 3TDGA 2GU1A 1O7GB 4HVNA 8CHOA 3LTCA 4L8PA 1HU9A 3BNBA 1JJ22 1K41A 3X42A 2LYXA 2XGNA 3OWYA 2CIUA 5D83A 5D82A 3EHCA 3GZRA 3CC73 1NJI4 3MHEA 1N8R4 1UI7A 1PU4A 5AIIA 1VQP3 5JBSA 5AYRB 3D3LA 3V99A 5KP1A 4R9LA 4GL6A 2YFJB 3UJMA 1W6YA 2BT3A 4EBGA 4OUQA 1QALA 1KQS2 4OVMA 5KP3A 3DM8A 3S67A 1FGOA 1JB2A 2Y74A 3CPOA 1OHPA 3EBYA 2PZVA 3F7XA 2JQ5A 3KSED 3MSOA 3LXUX 1RN7A 3FG1A 1A2VA 1W2ZA 2Q07A 4FMDA 3CCL3 3F40A 3MWZA 5EQLA 3T0UA 5CK6A 4EC6A 1NO3A 2YX9A 3EB8A 3JUNA 4O8SA 2A15A 1NU3A 2UX0A 2GU3A 2CFKA 5EEOA 3LTBA 3WOFB 2WOFA 3KZTA 1QAKA 2YFIB 1WTHA 3GZBA 3NM7A 4RBNA 1M904 1YHQ3 4AKYA 2W56A 1US1A 4HM3B 3I563 1YJW3 2XH9A 1W7CA 4N6MA 5DREA 1L5GB 1A67A 3EN1B 3O8YA 3PCRA 2STDA 1BUQA 1QVG2 3B8LA 4WFOA 2OTJ3 3DGMA 1WNHA 4XBXA 4HZ9B 1Q864 3CC43 1D6ZA 1U8CB 3MPHA 3ROBA 3CCM3 3GZXB 1RRHA 2BMRB 4GB5A 1O7NB 4J9AA 3U97A 2LQVA 2FNQA 3Q1CA 3PZWA 1C7HA 1YIJ3 1JKGB 2QA43 1K734 5CF2A 1HKXA 3LT9A 1FGTA 2GXFA 1EG9B 1RKYA 1DMMA 1NDOB 2P09A 3BLZA 3FZWA 3RGRA 1IU7A 3G713 1VQO3 1YJ93 1W6GA 1DYUA 1LOXA 4HZBB 3J7Yd 3K7CA 1EQKA 2HMJB 2E2UA 2B24B 1IK3A 1JB4A 2CFGA 2O3OA 2W03A 1FGMA 1N9JA 3BNEA 2K0MA 2XFSA 3EX9A 1K28A 2E2TA 4Q53A 3F8HA 3NQYA 4CDLA 4U13A 3VF1A 5IERA 1K9M4 3BNCA 3DMCA 1CQSA 2ZL8A 2IUJA 3ER7A 3X41A 2CFDA 1QMAA 2WGOA 3EBTA 3K0ZA 4QWTA 5AEWB 3JVCA 2WGQA 1EKMA 3QRDA 1ULJB 5TGNA 1YGEA 1ASKA 3EQQB 5DRVA 2FGTA 2MC8A 3KKGA 2OQEC 1W6CA 1O7MB 5IG4A 4O3VA 1K8A4 2K54A 3FSDA 3CME3 3FG3A 4PEJA 4BTYA 4BTWA 2Y73A 3SOYA 3T8NA 3PCSA 5CF1A 2Z7AA 1D6YA 4K1VA 4FMAA 3CMA3 4JF8A 4EXRA 5IEOA 1U5OA 4HM8B 1AVLA 4K90B 3F7SA 4IPBA 1E3RA 4KZ1A 4HYZA 3WA2X 2CFWA 2W9QA 2IUKA 2HMLB 3CD63 2INXA 2B1XB 1GYBA 1ISKA 1JNQA 1IT8A 3NHXA 2GBWB 3LT8A 3JUMA 3HIGA 1OCVA 3KE7A 4O2HA 3V92A 3A76A 2Z6BA 1Z1SA 3PXMA 1T5YA 3WA3A 2KRTA 3KIIA 3DGOA 5HGRA 1TFOA 2M7OA 3I553 1W2B2 1OHSA 4HM0B 1YJN3 1WMPA 3IJEB 1NWWA 2L4VA 3FG4A 3MG2A 1GD4A 1S5AA 2CKFB 3N54B 1W01A 3UB1A 3LMLA 2WOHA 3EE1A 2O9UX 3FH1A 1QVF2 3B4PA 3HZPA 1PFPA 4XDWA 5CLKA 4OK0A 1VQ73 2QIYA 1Q814 5I97A 1AR0A 4X2OA 2XEPA 4K1UA 2RCDA 3CC23 1OPYA 1SIIA 3T8UA 5D81A 3S5CA 1QJGA 3MYTA 1V74A 5IG3A 2BNGA 4R9KA 4J8TA 5STDA 4L8OA 1SIHA 1TP6A 3G0KA 3RDEA 5AYSC 3G6E3 3NUVA 3B4OA 1W00A 4RNYA 3VGNA 3SX1A 4LZIA 2BMOB 3X3YA 3GAXA 5IG5A 1IVVA 5LC6A 3SOAA 3OWSA 1IVWA 3UNLA 2E2VA 1KC84 3B7CA 2CH9A 4HM4B 1TFKA 4JRFA 1SJWA 4MEIA 3F9SA 1Y4KA 1RRLA 4XM4A 4HBRA 4AKZA 1LNHA 1GD3A 2F86B 1CYUA 1ROAA 1GY5A 4H3UA 1YI23 2RSXA 1OGXA 3QK9A 4KFEA 1LXEA 4NREA 3LH4A 2P0XA 3RGAA 4BTXA 3HK4A 1UW1A 1Q42A 2RGQA 1LVNA 1CYVA 2CG0A 2D1WA 3ALAA 3GZYB 1E97A 2OQEA 1DMQA 3UL5A 3IMAB 3NV0B 3F14A 4MMYB 4XDVA 4K61A 1O7WB 1F8NA 3OW22 1UUWB 2XGLA 3CU3A 4AEQA 3NBRA 3S28A 3WMDA 3G8ZA 2D42A 2W6JH 2F99A 3FF0A 5KP4A 1VQ43 1WMNA 1TUHA 5AIFA 1J2BA 3VSYA 3CCS3 3DXOA 3EF8A 4HM1B 5AIGA 3H3HA 4RZMA 3HIIA 5CXOA 1VQM3 1N8QA 1R4CA 3DY5A 2YFLB 3K5TA 2W2CA 3GRDA 3JUQA 1SQWA 1VQ53 1ZX2A 1WQLB 3EC9A 4X2HA 1AVKA 1ULIB 3PS8A 5IG0A 1N5PA 2BO9B 1IQYA 2HMKB 3FLJA 4IIAA 2OOVA 3JUPA 2CFLA 3MG1A 3CCU3 1VQ93 4EV5A 4XBYA 2P38A 1JKGA 3FCSB 5LC7A 2CW9A 2RFRA 3SLUA 3E99A 3STDA 1VQN3 1IQ8A 1VQ63 5IF6A 4HM7B 3S29A 2XSHB 3FGYA 4FCJA 3WODG 3IPTA 2FXTA 4XB5A 3X3XA 3CCQ3 2QEX3 3G4S3 4FMCA 2F98A 3V98A 2XR8B 1TU5A 2OOVC 1GS3A 3Q2PA 2OCTA 2P05A 1JN5B 1TIJA 3CCE3 2MF7A 3MKIA 1Q7Y4 3HX8A 1D6UA 3ECFA 3AMOB 4ORLA 3G16A 2W56B 1VQ83 4FCZA 1IT7A 2IA7A 2JDIH 1M1XB 3FKAA 3U1WA 4CCVA 4WP5A 1MNLA 2CWVA 3GWRA 2C11A 1OGZA 3HI7A 5BVBA 2W04A 3X3ZA 4MJDA 4MMXB 1O7HB 4ZM8A 4R80A 2GBXB 2QGUA 4LSOA 4N6V0 4N6NB 2HMOB 5IW9A 1ZO2A 3D9RA 4HM2B 4LGQA 5BXQA 4N6UA 1KD14 1IV7A 1EA2A 2XRXB 3CNXA 1GY7A 3FF2A 2W9PA 4HM6B 4NHFA 1FGQA 1STFI 1OUNA 3JUOA 3MG3A 4R4KA 1VQK3 3DGNA 1VQL3 3KSPA 3H51A 3NBBA 1JRQA 1MOLA 3DUKA 5AI1A 2OWPA 4EV2A 1YVBI 2GEYA 3DGLA 4N6LA 1OACA 3NQZA 1W4NA 5IEPA 1FGRA 1GY6A 4HJLB 5FGOA 2KCDA 4FMBA 1KWIA 1VZZA 2CC3A 2SBLA 1S723 2KXGA 1JN5A 4KVHA 1M9GA 4TX4A 2ML5A 3CNMA 1OF5B 3CCV3 5FW5A 4RNZA 1M1K4 3AMOA 1O7PB 2CWTA 3SEDA 1IVUA 2WO0A 3NBJA 2R4IA 4WYKB 1N5HA 2Z76A 4G1MB 5JPPA 4LMIA 3KFQC 1RJOA 3SXXA 4IT7A 2BHMA 1NB3I 4KFFA 1IVXA 3KN4A 3OWUA 4LEHA 1Q40B 1ROVA 2HMNB 4KFDA 3F8XA 1DVCA 3Q90A 3NX0A 7STDA 3NM2A 4N6OB 3LYGA 1DVDA 4FCMA 3BNDA 3LZAA 3I0YA 2CK3H 1G96A 1A2KA 1WMOA 3WDGB 1JV2B 3PGBA 2V1LA 3K9MC 4O02B 1SPUA 5EVHA 2I9WA 3CPW2 4WWUC 3CCR3 3CXC2 3WOEB 2XFTA 2ML6A 3EJVA 3OX9A 5JPUA 2CWUA 3OXAA 1IV9A 2HMMB 3L0RA 2XSOB 3X40A 3NXJA 1IQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUV B;  4XBT A;  1IDP A;  3BB9 A;  4HM5 B;  3DZL A;  2CHC A;  1OF5 A;  4R1K A;  2GEX A;  1W02 A;  4WYK A;  5G2G A;  5AIH A;  1STD A;  1DMN A;  3OV4 A;  2BMQ B;  1JB5 A;  4HKV B;  4I4K A;  2Z77 A;  1Q40 A;  1OHO A;  5AEU B;  3EN8 A;  6STD A;  2IMJ A;  3NV0 A;  3M8C A;  4STD A;  5IEN A;  1E3V A;  4N3V A;  1OH0 A;  4L7K A;  1O7G B;  4HVN A;  8CHO A;  4L8P A;  1K41 A;  3OWY A;  5D83 A;  5D82 A;  3EHC A;  3GZR A;  3MHE A;  5AII A;  5KP1 A;  4R9L A;  3UJM A;  2YFJ B;  1W6Y A;  4OUQ A;  4OVM A;  5KP3 A;  3DM8 A;  1JB2 A;  3CPO A;  1OHP A;  3EBY A;  2PZV A;  3F7X A;  2JQ5 A;  3MSO A;  3F40 A;  5CK6 A;  3JUN A;  2A15 A;  1NU3 A;  2UX0 A;  3KZT A;  2YFI B;  3GZB A;  4HM3 B;  5DRE A;  3EN1 B;  2STD A;  1BUQ A;  3B8L A;  4XBX A;  4HZ9 B;  3ROB A;  3GZX B;  2BMR B;  4GB5 A;  1O7N B;  4J9A A;  1C7H A;  1JKG B;  5CF2 A;  1HKX A;  2GXF A;  1EG9 B;  1DMM A;  1NDO B;  3BLZ A;  3FZW A;  3RGR A;  4HZB B;  3K7C A;  2HMJ B;  2B24 B;  1JB4 A;  4Q53 A;  3EX9 A;  3F8H A;  4CDL A;  4U13 A;  5IER A;  3DMC A;  1CQS A;  3ER7 A;  1QMA A;  3EBT A;  3K0Z A;  5AEW B;  1ULJ B;  5TGN A;  1ASK A;  3EQQ B;  5DRV A;  3KKG A;  1O7M B;  5IG4 A;  2K54 A;  3FSD A;  4PEJ A;  3T8N A;  3SOY A;  5CF1 A;  2Z7A A;  4K1V A;  5IEO A;  1U5O A;  4HM8 B;  3F7S A;  1E3R A;  1ISK A;  2HML B;  2INX A;  2B1X B;  1GYB A;  3NHX A;  2GBW B;  3JUM A;  1OCV A;  3KE7 A;  3A76 A;  1Z1S A;  5HGR A;  1OHS A;  4HM0 B;  1NWW A;  3MG2 A;  1S5A A;  2CKF B;  1W01 A;  3FH1 A;  3B4P A;  3HZP A;  4XDW A;  5CLK A;  2QIY A;  1AR0 A;  4X2O A;  4K1U A;  2RCD A;  1OPY A;  3T8U A;  5D81 A;  3S5C A;  1QJG A;  3MYT A;  5IG3 A;  2BNG A;  4R9K A;  4J8T A;  5STD A;  4L8O A;  1TP6 A;  3G0K A;  3NUV A;  3B4O A;  1W00 A;  3VGN A;  2BMO B;  5IG5 A;  3SOA A;  3OWS A;  3UNL A;  3B7C A;  4HM4 B;  1SJW A;  3F9S A;  4XM4 A;  2F86 B;  1GY5 A;  4H3U A;  1OGX A;  3RGA A;  3HK4 A;  1Q42 A;  2RGQ A;  3GZY B;  1E97 A;  1DMQ A;  3NV0 B;  3F14 A;  4XDV A;  1O7W B;  1UUW B;  3CU3 A;  3NBR A;  3WMD A;  3G8Z A;  2F99 A;  3FF0 A;  5KP4 A;  5AIF A;  1TUH A;  3VSY A;  3DXO A;  3EF8 A;  4HM1 B;  5AIG A;  3H3H A;  4RZM A;  5CXO A;  2YFL B;  2W2C A;  3GRD A;  3JUQ A;  1ZX2 A;  1WQL B;  3EC9 A;  4X2H A;  1ULI B;  5IG0 A;  2HMK B;  3FLJ A;  4IIA A;  3JUP A;  3MG1 A;  4XBY A;  1JKG A;  2RFR A;  3E99 A;  3STD A;  5IF6 A;  4HM7 B;  2XSH B;  3FGY A;  4FCJ A;  3IPT A;  4XB5 A;  2F98 A;  2XR8 B;  1GS3 A;  1JN5 B;  3MKI A;  3HX8 A;  3ECF A;  4ORL A;  3G16 A;  3FKA A;  4WP5 A;  3GWR A;  1OGZ A;  5BVB A;  4MJD A;  1O7H B;  2GBX B;  2QGU A;  2HMO B;  1ZO2 A;  3D9R A;  4HM2 B;  4LGQ A;  5BXQ A;  1EA2 A;  2XRX B;  3CNX A;  1GY7 A;  3FF2 A;  4HM6 B;  1OUN A;  3JUO A;  3MG3 A;  3KSP A;  3H51 A;  3DUK A;  5AI1 A;  2OWP A;  2GEY A;  5IEP A;  1GY6 A;  4HJL B;  1VZZ A;  1JN5 A;  4KVH A;  3CNM A;  1OF5 B;  5FW5 A;  1O7P B;  3SED A;  2R4I A;  4WYK B;  2Z76 A;  5JPP A;  4LMI A;  3OWU A;  4LEH A;  1Q40 B;  2HMN B;  3F8X A;  3Q90 A;  7STD A;  3NM2 A;  3LYG A;  4FCM A;  3LZA A;  3I0Y A;  1A2K A;  5EVH A;  2I9W A;  4WWU C;  3EJV A;  3OX9 A;  5JPU A;  3OXA A;  2HMM B;  2XSO B;  3NXJ A; 
#chains in the Genus database with same CATH topology
 1BSD A;  3PYJ A;  4H61 A;  1UUV B;  1BSC A;  2CG1 A;  4XBT A;  5A0O B;  1IDP A;  3BB9 A;  3N8B A;  4HM5 B;  3DZL A;  2GSP A;  2CHC A;  1OF5 A;  3LTD A;  1W5Z A;  1Q82 4;  4R1K A;  2GEX A;  2W0Q A;  3DGY A;  1N9E A;  3LTA A;  5ELU A;  1A90 A;  1W02 A;  1BNS A;  5ELJ A;  4WYK A;  4WHA A;  5G2G A;  2F5W A;  1FUW A;  5AIH A;  3LOY A;  1T2I A;  1STD A;  1YVS A;  1DMN A;  4MMZ B;  1NB5 I;  3OV4 A;  1KSI A;  1ZS7 A;  2BMQ B;  1JB5 A;  3K63 A;  4HKV B;  1YGW A;  3N9H A;  1QAF A;  1RGA A;  1RNT A;  3UL6 A;  2C10 A;  2OTL 3;  4I4K A;  2PNC A;  1BNR A;  2Z77 A;  1Q40 A;  1OHO A;  5AEU B;  3EN8 A;  1UCK A;  6STD A;  1AV4 A;  3CCJ 3;  2P0M A;  2XF3 A;  1BNF A;  2IMJ A;  1FA3 A;  1CEW I;  1BOX A;  3NV0 A;  3M8C A;  4STD A;  1YIT 3;  4FR9 A;  5IEN A;  2ZDJ A;  1E3V A;  4N3V A;  4EYC A;  1OH0 A;  3S27 A;  3SVA A;  4N6T A;  2KF5 A;  1UI8 A;  2KF6 A;  4L7K A;  3TDG A;  2GU1 A;  1O7G B;  4HVN A;  8CHO A;  3LTC A;  4L8P A;  2IYJ A;  1HU9 A;  1GOU A;  3BNB A;  1K41 A;  1JJ2 2;  3X42 A;  2LYX A;  2XGN A;  3OWY A;  2CIU A;  4EW5 A;  5D83 A;  3D79 A;  3EHC A;  3GZR A;  5D82 A;  9RNT A;  1DET A;  3CC7 3;  1NJI 4;  3MHE A;  2H0I A;  1BIR A;  2SAR A;  1N8R 4;  1UI7 A;  2RBI A;  6RNT A;  1PU4 A;  4CPK A;  5AII A;  1VQP 3;  1BRI A;  5JBS A;  5AYR B;  3AGN A;  3D3L A;  3V99 A;  1BRS A;  5KP1 A;  5GSP A;  4R9L A;  4GL6 A;  2YFJ B;  3UJM A;  1W6Y A;  2BT3 A;  3AGO A;  4OUQ A;  4EBG A;  1QAL A;  1KQS 2;  4OVM A;  5KP3 A;  2F5M A;  3DM8 A;  3S67 A;  5G1L A;  1JBR A;  1FGO A;  1JB2 A;  1X1X A;  2Y74 A;  3CPO A;  1OHP A;  1UCJ A;  3EBY A;  1EUI C;  4NPB A;  2PZV A;  3F7X A;  2JQ5 A;  3KSE D;  3MSO A;  3LXU X;  1RN7 A;  1UUG B;  3FG1 A;  1A2V A;  1W2Z A;  2Q07 A;  4FMD A;  1MGR A;  3CCL 3;  3F40 A;  1GOV A;  2CX1 A;  3MWZ A;  2KF4 A;  5CK6 A;  5EQL A;  3T0U A;  4EC6 A;  1NO3 A;  1T3B A;  2YX9 A;  3EB8 A;  3JUN A;  4O8S A;  4BL2 A;  2A15 A;  1NU3 A;  2UX0 A;  2GU3 A;  1T2H A;  1MWT A;  4LYL B;  1MWR A;  2CFK A;  5EEO A;  3LTB A;  3WOF B;  2WOF A;  3KZT A;  1HYF A;  1RNB A;  1QAK A;  2YFI B;  1WTH A;  3GZB A;  3NM7 A;  4RBN A;  1M90 4;  1JZO A;  1YHQ 3;  4AKY A;  2W56 A;  1US1 A;  4HM3 B;  3I56 3;  1YJW 3;  2XH9 A;  1W7C A;  4N6M A;  5DRE A;  1L5G B;  1A67 A;  3EN1 B;  3O8Y A;  3PCR A;  1MWU A;  2STD A;  1BUQ A;  1QVG 2;  3B8L A;  4WFO A;  2OTJ 3;  3DGM A;  1WNH A;  4XBX A;  1BNE A;  4HZ9 B;  1Q86 4;  3CC4 3;  1D6Z A;  1A2P A;  1U8C B;  3MPH A;  3ROB A;  3CCM 3;  2K3D A;  3GZX B;  1RRH A;  2BMR B;  4GB5 A;  1O7N B;  4J9A A;  2H0G A;  3U97 A;  2LQV A;  1JBS A;  2FNQ A;  3Q1C A;  2AAE A;  3PZW A;  1C7H A;  1YIJ 3;  1LQM B;  1I8V A;  1JKG B;  3BU4 A;  2QA4 3;  1K73 4;  5CF2 A;  1HKX A;  1LQG C;  3LT9 A;  1FGT A;  2GXF A;  1EG9 B;  1RKY A;  1DMM A;  1NDO B;  2P09 A;  3BLZ A;  3FZW A;  3RGR A;  1IU7 A;  3G71 3;  1VQO 3;  1YJ9 3;  1W6G A;  1DYU A;  1LOX A;  4HZB B;  3J7Y d;  2AAD A;  1HZ1 A;  3K7C A;  2F56 A;  1B3S A;  1EQK A;  2HMJ B;  2E2U A;  2B24 B;  1IK3 A;  1JB4 A;  2CFG A;  2O3O A;  2W03 A;  1FGM A;  1N9J A;  4I5Q A;  3BNE A;  2K0M A;  1BAO A;  1TRQ A;  2XFS A;  3EX9 A;  1K28 A;  2E2T A;  4Q53 A;  3F8H A;  3NQY A;  1LRA A;  4CDL A;  4U13 A;  3VF1 A;  5IER A;  1K9M 4;  1RGG A;  1JZD A;  3BNC A;  1BRH A;  1CQS A;  2ZL8 A;  3DMC A;  1GMQ A;  1C54 A;  2IUJ A;  3ER7 A;  3X41 A;  2CFD A;  1PY3 A;  1B2U A;  1QMA A;  2WGO A;  3EBT A;  3K0Z A;  4QWT A;  5AEW B;  1Q9E A;  2WGQ A;  3JVC A;  1EKM A;  3QRD A;  1B20 A;  1ULJ B;  1YGE A;  5TGN A;  1ASK A;  3EQQ B;  5DRV A;  1I2F A;  1FYS A;  1GSP A;  2FGT A;  2MC8 A;  1I0X A;  2OQE C;  3KKG A;  3ZFZ A;  6GSP A;  1W6C A;  1O7M B;  1X1W A;  1BVI A;  5IG4 A;  4O3V A;  1G0T A;  1K8A 4;  2K54 A;  3FSD A;  1R4Y A;  3CME 3;  3FG3 A;  4PEJ A;  4CJN A;  5BU4 A;  4BTY A;  2ZHX B;  4BTW A;  1RCL A;  2Y73 A;  3SOY A;  3T8N A;  3PCS A;  1MGW A;  1TJD A;  1BRJ A;  4HAA A;  5CF1 A;  1UGI A;  1D6Y A;  2Z7A A;  1CH0 A;  4K1V A;  4FMA A;  1V58 A;  3CMA 3;  4JF8 A;  4EXR A;  5IEO A;  1U5O A;  2ZA4 A;  4HM8 B;  1AVL A;  4K90 B;  3F7S A;  4IPB A;  1E3R A;  4KZ1 A;  4HYZ A;  1RMS A;  3WA2 X;  2CFW A;  2W9Q A;  1BSA A;  2IUK A;  2HML B;  3CD6 3;  2INX A;  2B1X B;  1GYB A;  1RN1 A;  1ISK A;  1JNQ A;  1IT8 A;  3NHX A;  2GBW B;  3LT8 A;  4J5G A;  3JUM A;  3HIG A;  1OCV A;  3KE7 A;  4O2H A;  3V92 A;  3WHO A;  3A76 A;  2Z6B A;  1Z1S A;  3PXM A;  1T5Y A;  3WA3 A;  2KRT A;  3KII A;  3DGO A;  1B21 A;  5HGR A;  1TFO A;  2M7O A;  3I55 3;  1W2B 2;  1BNG A;  1OHS A;  4HM0 B;  1B2Z A;  5G1K A;  1YJN 3;  1WMP A;  3IJE B;  1NWW A;  2L4V A;  3FG4 A;  3MG2 A;  1GD4 A;  1S5A A;  2CKF B;  3N54 B;  1W01 A;  3UB1 A;  3LML A;  2C4B A;  2WOH A;  3EE1 A;  2O9U X;  3FH1 A;  1QVF 2;  3B4P A;  3HZP A;  1PFP A;  3AHW A;  4XDW A;  5CLK A;  4OK0 A;  1BAN A;  1LNI A;  1VQ7 3;  2QIY A;  1Q81 4;  5I97 A;  1AR0 A;  3AHS A;  4X2O A;  2XEP A;  8RNT A;  4K1U A;  2RCD A;  5M18 A;  3CC2 3;  1LOV A;  1UCL A;  1OPY A;  1SII A;  3T8U A;  5D81 A;  3S5C A;  1BGS A;  1QJG A;  1MWS A;  3MYT A;  1V74 A;  5IG3 A;  2BNG A;  2KF3 A;  4R9K A;  1TRP A;  4J8T A;  5STD A;  4L8O A;  1SIH A;  1TP6 A;  3G0K A;  3KCH A;  3RDE A;  5AYS C;  3G6E 3;  1RGC A;  3NUV A;  1BRK A;  3B4O A;  1W00 A;  4RNY A;  3VGN A;  3SX1 A;  7GSP A;  4LZI A;  2BMO B;  3X3Y A;  3GAX A;  5IG5 A;  1BNI A;  1IVV A;  5LC6 A;  3SOA A;  1BSE A;  1BU4 A;  3OWS A;  3HOH A;  1IVW A;  1DE3 A;  3UNL A;  2E2V A;  1KC8 4;  3B7C A;  2CH9 A;  4HM4 B;  1TFK A;  4JRF A;  1SJW A;  1X1Y A;  3F9S A;  1Y4K A;  4MEI A;  1RRL A;  4XM4 A;  1RGH A;  4HBR A;  4AKZ A;  1LNH A;  1GD3 A;  2F86 B;  1CYU A;  1ROA A;  1GY5 A;  4H3U A;  1YI2 3;  2RSX A;  1OGX A;  3QK9 A;  1ZGX A;  1GMR A;  4KFE A;  1IYY A;  1LXE A;  4NRE A;  3LH4 A;  1JBT A;  2P0X A;  3RGA A;  4BTX A;  3HK4 A;  4DKI A;  4GSP A;  1UW1 A;  3A5E A;  1Q42 A;  2RGQ A;  1B2S A;  1CYV A;  1LVN A;  2CG0 A;  2D1W A;  3ALA A;  3GZY B;  1E97 A;  2OQE A;  1DMQ A;  3SYU A;  3UL5 A;  3IMA B;  3NV0 B;  3F14 A;  4MMY B;  4XDV A;  4K61 A;  1O7W B;  1F8N A;  3OW2 2;  1UUW B;  2XGL A;  3CU3 A;  4AEQ A;  3NBR A;  3S28 A;  2F4Y A;  3WMD A;  3G8Z A;  1RTU A;  2D42 A;  2W6J H;  2F99 A;  3FF0 A;  5KP4 A;  1VQ4 3;  1WMN A;  1RHL A;  1TUH A;  3D5I A;  5AIF A;  1J2B A;  3VSY A;  3CCS 3;  3DXO A;  3EF8 A;  4HM1 B;  5AIG A;  3H3H A;  4RZM A;  1UDI I;  3HII A;  5CXO A;  1VQM 3;  1N8Q A;  1R4C A;  1X1U A;  3DH2 A;  2YFL B;  3DY5 A;  3K5T A;  1FUS A;  2W2C A;  3GRD A;  3JUQ A;  1SQW A;  1AY7 A;  1EEJ A;  1VQ5 3;  1ZX2 A;  1WQL B;  3EC9 A;  4X2H A;  1AVK A;  1ULI B;  3PS8 A;  5IG0 A;  1N5P A;  2BO9 B;  1IQY A;  2HMK B;  3FLJ A;  4IIA A;  1BUJ A;  2OOV A;  1G02 A;  3JUP A;  2CFL A;  3MG1 A;  3CCU 3;  1VQ9 3;  1FUT A;  1LOW A;  4EV5 A;  4J5K A;  1VQQ A;  4XBY A;  2P38 A;  1JKG A;  3FCS B;  5LC7 A;  2CW9 A;  1YNV X;  2RFR A;  3SLU A;  3E99 A;  3D5G A;  1RGF A;  3STD A;  4ILF A;  1VQN 3;  1IQ8 A;  4BIR A;  5IF6 A;  4HM7 B;  1LOY A;  3S29 A;  1VQ6 3;  2XSH B;  1BNJ A;  4KT3 B;  3FGY A;  4FCJ A;  3WOD G;  1I2G A;  1RN4 A;  3IPT A;  3URP A;  1TTO A;  4BU4 A;  2FXT A;  3D4A A;  4XB5 A;  3X3X A;  3CCQ 3;  2QEX 3;  3G4S 3;  4FMC A;  2F98 A;  3V98 A;  2XR8 B;  1TU5 A;  2OOV C;  5BIR A;  1GS3 A;  3Q2P A;  2OCT A;  2P05 A;  1JN5 B;  1TIJ A;  3CCE 3;  2MF7 A;  3MKI A;  1Q7Y 4;  3HX8 A;  1RDS A;  2R41 A;  1D6U A;  3ECF A;  3AMO B;  4HOH A;  4ORL A;  2J8X B;  3G16 A;  2RNT A;  2W56 B;  4FCZ A;  1IT7 A;  2IA7 A;  1VQ8 3;  2JDI H;  1M1X B;  3FKA A;  3U1W A;  4CCV A;  4WP5 A;  5HOH A;  1MNL A;  2CWV A;  3GWR A;  2C11 A;  1OGZ A;  2HOH A;  3HI7 A;  5BVB A;  2W04 A;  1GOY A;  1BSB A;  3X3Z A;  4MJD A;  3Q3F A;  1UGH I;  4MMX B;  1O7H B;  3WR2 A;  4ZM8 A;  4R80 A;  2GBX B;  2QGU A;  1RGL A;  4LSO A;  4N6V 0;  4N6N B;  2HMO B;  5IW9 A;  1ZO2 A;  1I3F A;  3D9R A;  4HM2 B;  1B2M A;  1BRG A;  2UUG C;  4LGQ A;  5BXQ A;  4N6U A;  1KD1 4;  1IV7 A;  1EA2 A;  2XRX B;  1I2E A;  3CNX A;  1GY7 A;  3FF2 A;  2W9P A;  4HM6 B;  4NHF A;  1FGQ A;  1STF I;  1I0V A;  1OUN A;  1GMP A;  3JUO A;  2BIR A;  3MG3 A;  3GSP A;  4R4K A;  1VQK 3;  3DGN A;  1VQL 3;  3KSP A;  1RCK A;  3H51 A;  3NBB A;  1JRQ A;  1MOL A;  3DUK A;  1PYL A;  5AI1 A;  2H0H A;  2OWP A;  4EV2 A;  1YVB I;  2GEY A;  3DGL A;  1BRN L;  1UCI A;  4N6L A;  1OAC A;  3NQZ A;  1W4N A;  5IEP A;  1FGR A;  1GY6 A;  4HJL B;  5FGO A;  1SAR A;  2KCD A;  4FMB A;  1B2X A;  1KWI A;  1VZZ A;  2CC3 A;  2SBL A;  1S72 3;  2KXG A;  1JN5 A;  4KVH A;  3ZG0 A;  1M9G A;  2CX0 A;  3RNT A;  4TX4 A;  2ML5 A;  3CNM A;  1OF5 B;  3CCV 3;  5FW5 A;  4RNZ A;  1M1K 4;  3AMO A;  1Q7H A;  1O7P B;  2CWT A;  3SED A;  4BL3 A;  2BU4 A;  1IVU A;  1FZU A;  2WO0 A;  1V57 A;  3NBJ A;  2R4I A;  4WYK B;  1N5H A;  5RNT A;  2Z76 A;  4G1M B;  5JPP A;  1B27 A;  4LMI A;  1FW7 A;  1NNV A;  3KFQ C;  1RJO A;  3SXX A;  4IT7 A;  2BHM A;  2IY2 A;  2UGI A;  1NB3 I;  3BIR A;  7RNT A;  4KFF A;  1IVX A;  3KN4 A;  3OWU A;  2L1S A;  4LEH A;  1I3I A;  1Q40 B;  1I70 A;  1ROV A;  1AQZ A;  2HMN B;  3F8X A;  1DVC A;  4KFD A;  4RNT A;  3Q90 A;  3NX0 A;  7STD A;  3NM2 A;  4N6O B;  3LYG A;  1DVD A;  4FCM A;  1RLS A;  3BND A;  3LZA A;  3I0Y A;  2CK3 H;  1G96 A;  1RGE A;  1A2K A;  1WMO A;  3WDG B;  1JV2 B;  3PGB A;  1RGK A;  2V1L A;  3K9M C;  4O02 B;  1RSN A;  1SPU A;  5EVH A;  2I9W A;  3CPW 2;  4WWU C;  3ZG5 A;  3CXC 2;  3CCR 3;  3WOE B;  2XFT A;  2ML6 A;  3EJV A;  3OX9 A;  5JPU A;  5M1A A;  2CWU A;  3OXA A;  2KAA A;  1IV9 A;  4GHO A;  5M19 A;  2HMM B;  3L0R A;  2XSO B;  3X40 A;  3NXJ A;  1IQX A; 
#chains in the Genus database with same CATH homology
 3PYJ A;  4H61 A;  1UUV B;  2CG1 A;  4XBT A;  5A0O B;  1IDP A;  3BB9 A;  3N8B A;  4HM5 B;  3DZL A;  2CHC A;  1OF5 A;  3LTD A;  1W5Z A;  1Q82 4;  4R1K A;  2GEX A;  2W0Q A;  1N9E A;  3LTA A;  5ELU A;  1A90 A;  1W02 A;  5ELJ A;  4WYK A;  4WHA A;  5G2G A;  1FUW A;  5AIH A;  3LOY A;  1STD A;  4MMZ B;  1DMN A;  1NB5 I;  3OV4 A;  1KSI A;  2BMQ B;  1JB5 A;  3K63 A;  4HKV B;  3N9H A;  1QAF A;  3UL6 A;  2C10 A;  2OTL 3;  4I4K A;  2PNC A;  2Z77 A;  1Q40 A;  1OHO A;  5AEU B;  3EN8 A;  6STD A;  1AV4 A;  3CCJ 3;  2P0M A;  2XF3 A;  2IMJ A;  1FA3 A;  1CEW I;  3NV0 A;  1YIT 3;  3M8C A;  4STD A;  4FR9 A;  5IEN A;  2ZDJ A;  1E3V A;  4N3V A;  4EYC A;  1OH0 A;  3S27 A;  3SVA A;  4N6T A;  1UI8 A;  4L7K A;  3TDG A;  2GU1 A;  1O7G B;  4HVN A;  8CHO A;  3LTC A;  4L8P A;  1HU9 A;  3BNB A;  1JJ2 2;  1K41 A;  3X42 A;  2LYX A;  2XGN A;  3OWY A;  2CIU A;  5D83 A;  5D82 A;  3EHC A;  3GZR A;  3CC7 3;  1NJI 4;  3MHE A;  1N8R 4;  1UI7 A;  1PU4 A;  5AII A;  1VQP 3;  5JBS A;  5AYR B;  3D3L A;  3V99 A;  5KP1 A;  4R9L A;  4GL6 A;  2YFJ B;  3UJM A;  1W6Y A;  2BT3 A;  4EBG A;  4OUQ A;  1QAL A;  1KQS 2;  4OVM A;  5KP3 A;  3DM8 A;  3S67 A;  1FGO A;  1JB2 A;  2Y74 A;  3CPO A;  1OHP A;  3EBY A;  2PZV A;  3F7X A;  2JQ5 A;  3KSE D;  3MSO A;  3LXU X;  1RN7 A;  3FG1 A;  1A2V A;  1W2Z A;  2Q07 A;  4FMD A;  3CCL 3;  3F40 A;  3MWZ A;  5EQL A;  3T0U A;  5CK6 A;  4EC6 A;  1NO3 A;  2YX9 A;  3EB8 A;  3JUN A;  4O8S A;  2A15 A;  1NU3 A;  2UX0 A;  2GU3 A;  2CFK A;  5EEO A;  3LTB A;  3WOF B;  2WOF A;  3KZT A;  1QAK A;  2YFI B;  1WTH A;  3GZB A;  3NM7 A;  4RBN A;  1M90 4;  1YHQ 3;  4AKY A;  2W56 A;  1US1 A;  4HM3 B;  3I56 3;  1YJW 3;  2XH9 A;  1W7C A;  4N6M A;  5DRE A;  1L5G B;  1A67 A;  3EN1 B;  3O8Y A;  3PCR A;  2STD A;  1BUQ A;  1QVG 2;  3B8L A;  4WFO A;  2OTJ 3;  3DGM A;  1WNH A;  4XBX A;  4HZ9 B;  1Q86 4;  3CC4 3;  1D6Z A;  1U8C B;  3MPH A;  3ROB A;  3CCM 3;  3GZX B;  1RRH A;  2BMR B;  4GB5 A;  1O7N B;  4J9A A;  3U97 A;  2LQV A;  2FNQ A;  3Q1C A;  3PZW A;  1C7H A;  1YIJ 3;  1JKG B;  2QA4 3;  1K73 4;  5CF2 A;  1HKX A;  3LT9 A;  1FGT A;  2GXF A;  1EG9 B;  1RKY A;  1DMM A;  1NDO B;  2P09 A;  3BLZ A;  3FZW A;  3RGR A;  1IU7 A;  3G71 3;  1VQO 3;  1YJ9 3;  1W6G A;  1DYU A;  1LOX A;  4HZB B;  3J7Y d;  3K7C A;  1EQK A;  2HMJ B;  2E2U A;  2B24 B;  1IK3 A;  1JB4 A;  2CFG A;  2O3O A;  2W03 A;  1FGM A;  1N9J A;  3BNE A;  2K0M A;  2XFS A;  3EX9 A;  1K28 A;  2E2T A;  4Q53 A;  3F8H A;  3NQY A;  4CDL A;  4U13 A;  3VF1 A;  5IER A;  1K9M 4;  3BNC A;  3DMC A;  1CQS A;  2ZL8 A;  2IUJ A;  3ER7 A;  3X41 A;  2CFD A;  1QMA A;  2WGO A;  3EBT A;  3K0Z A;  4QWT A;  5AEW B;  3JVC A;  2WGQ A;  1EKM A;  3QRD A;  1ULJ B;  5TGN A;  1YGE A;  1ASK A;  3EQQ B;  5DRV A;  2FGT A;  2MC8 A;  3KKG A;  2OQE C;  1W6C A;  1O7M B;  5IG4 A;  4O3V A;  1K8A 4;  2K54 A;  3FSD A;  3CME 3;  3FG3 A;  4PEJ A;  4BTY A;  4BTW A;  2Y73 A;  3SOY A;  3T8N A;  3PCS A;  5CF1 A;  2Z7A A;  1D6Y A;  4K1V A;  4FMA A;  3CMA 3;  4JF8 A;  4EXR A;  5IEO A;  1U5O A;  4HM8 B;  1AVL A;  4K90 B;  3F7S A;  4IPB A;  1E3R A;  4KZ1 A;  4HYZ A;  3WA2 X;  2CFW A;  2W9Q A;  2IUK A;  2HML B;  3CD6 3;  2INX A;  2B1X B;  1GYB A;  1ISK A;  1JNQ A;  1IT8 A;  3NHX A;  2GBW B;  3LT8 A;  3JUM A;  3HIG A;  1OCV A;  3KE7 A;  4O2H A;  3V92 A;  3A76 A;  2Z6B A;  1Z1S A;  3PXM A;  1T5Y A;  3WA3 A;  2KRT A;  3KII A;  3DGO A;  5HGR A;  1TFO A;  2M7O A;  3I55 3;  1W2B 2;  1OHS A;  4HM0 B;  1YJN 3;  1WMP A;  3IJE B;  1NWW A;  2L4V A;  3FG4 A;  3MG2 A;  1GD4 A;  1S5A A;  2CKF B;  3N54 B;  1W01 A;  3UB1 A;  3LML A;  2WOH A;  3EE1 A;  2O9U X;  3FH1 A;  1QVF 2;  3B4P A;  3HZP A;  1PFP A;  4XDW A;  5CLK A;  4OK0 A;  1VQ7 3;  2QIY A;  1Q81 4;  5I97 A;  1AR0 A;  4X2O A;  2XEP A;  4K1U A;  2RCD A;  3CC2 3;  1OPY A;  1SII A;  3T8U A;  5D81 A;  3S5C A;  1QJG A;  3MYT A;  1V74 A;  5IG3 A;  2BNG A;  4R9K A;  4J8T A;  5STD A;  4L8O A;  1SIH A;  1TP6 A;  3G0K A;  3RDE A;  5AYS C;  3G6E 3;  3NUV A;  3B4O A;  1W00 A;  4RNY A;  3VGN A;  3SX1 A;  4LZI A;  2BMO B;  3X3Y A;  3GAX A;  5IG5 A;  1IVV A;  5LC6 A;  3SOA A;  3OWS A;  1IVW A;  3UNL A;  2E2V A;  1KC8 4;  3B7C A;  2CH9 A;  4HM4 B;  1TFK A;  4JRF A;  1SJW A;  4MEI A;  3F9S A;  1Y4K A;  1RRL A;  4XM4 A;  4HBR A;  4AKZ A;  1LNH A;  1GD3 A;  2F86 B;  1CYU A;  1ROA A;  1GY5 A;  4H3U A;  1YI2 3;  2RSX A;  1OGX A;  3QK9 A;  4KFE A;  1LXE A;  4NRE A;  3LH4 A;  2P0X A;  3RGA A;  4BTX A;  3HK4 A;  1UW1 A;  1Q42 A;  2RGQ A;  1LVN A;  1CYV A;  2CG0 A;  2D1W A;  3ALA A;  3GZY B;  1E97 A;  2OQE A;  1DMQ A;  3UL5 A;  3IMA B;  3NV0 B;  3F14 A;  4MMY B;  4XDV A;  4K61 A;  1O7W B;  1F8N A;  3OW2 2;  1UUW B;  2XGL A;  3CU3 A;  4AEQ A;  3NBR A;  3S28 A;  3WMD A;  3G8Z A;  2D42 A;  2W6J H;  2F99 A;  3FF0 A;  5KP4 A;  1VQ4 3;  1WMN A;  1TUH A;  5AIF A;  1J2B A;  3VSY A;  3CCS 3;  3DXO A;  3EF8 A;  4HM1 B;  5AIG A;  3H3H A;  4RZM A;  3HII A;  5CXO A;  1VQM 3;  1N8Q A;  1R4C A;  3DY5 A;  2YFL B;  3K5T A;  2W2C A;  3GRD A;  3JUQ A;  1SQW A;  1VQ5 3;  1ZX2 A;  1WQL B;  3EC9 A;  4X2H A;  1AVK A;  1ULI B;  3PS8 A;  5IG0 A;  1N5P A;  2BO9 B;  1IQY A;  2HMK B;  3FLJ A;  4IIA A;  2OOV A;  3JUP A;  2CFL A;  3MG1 A;  3CCU 3;  1VQ9 3;  4EV5 A;  4XBY A;  2P38 A;  1JKG A;  3FCS B;  5LC7 A;  2CW9 A;  2RFR A;  3SLU A;  3E99 A;  3STD A;  1VQN 3;  1IQ8 A;  1VQ6 3;  5IF6 A;  4HM7 B;  3S29 A;  2XSH B;  3FGY A;  4FCJ A;  3WOD G;  3IPT A;  2FXT A;  4XB5 A;  3X3X A;  3CCQ 3;  2QEX 3;  3G4S 3;  4FMC A;  2F98 A;  3V98 A;  2XR8 B;  1TU5 A;  2OOV C;  1GS3 A;  3Q2P A;  2OCT A;  2P05 A;  1JN5 B;  1TIJ A;  3CCE 3;  2MF7 A;  3MKI A;  1Q7Y 4;  3HX8 A;  1D6U A;  3ECF A;  3AMO B;  4ORL A;  3G16 A;  2W56 B;  1VQ8 3;  4FCZ A;  1IT7 A;  2IA7 A;  2JDI H;  1M1X B;  3FKA A;  3U1W A;  4CCV A;  4WP5 A;  1MNL A;  2CWV A;  3GWR A;  2C11 A;  1OGZ A;  3HI7 A;  5BVB A;  2W04 A;  3X3Z A;  4MJD A;  4MMX B;  1O7H B;  4ZM8 A;  4R80 A;  2GBX B;  2QGU A;  4LSO A;  4N6V 0;  4N6N B;  2HMO B;  5IW9 A;  1ZO2 A;  3D9R A;  4HM2 B;  4LGQ A;  5BXQ A;  4N6U A;  1KD1 4;  1IV7 A;  1EA2 A;  2XRX B;  3CNX A;  1GY7 A;  3FF2 A;  2W9P A;  4HM6 B;  4NHF A;  1FGQ A;  1STF I;  1OUN A;  3JUO A;  3MG3 A;  4R4K A;  1VQK 3;  3DGN A;  1VQL 3;  3KSP A;  3H51 A;  3NBB A;  1JRQ A;  1MOL A;  3DUK A;  5AI1 A;  2OWP A;  4EV2 A;  1YVB I;  2GEY A;  3DGL A;  4N6L A;  1OAC A;  3NQZ A;  1W4N A;  5IEP A;  1FGR A;  1GY6 A;  4HJL B;  5FGO A;  2KCD A;  4FMB A;  1KWI A;  1VZZ A;  2CC3 A;  2SBL A;  1S72 3;  2KXG A;  1JN5 A;  4KVH A;  1M9G A;  4TX4 A;  2ML5 A;  3CNM A;  1OF5 B;  3CCV 3;  5FW5 A;  4RNZ A;  1M1K 4;  3AMO A;  1O7P B;  2CWT A;  3SED A;  1IVU A;  2WO0 A;  3NBJ A;  2R4I A;  4WYK B;  1N5H A;  2Z76 A;  4G1M B;  5JPP A;  4LMI A;  3KFQ C;  1RJO A;  3SXX A;  4IT7 A;  2BHM A;  1NB3 I;  4KFF A;  1IVX A;  3KN4 A;  3OWU A;  4LEH A;  1Q40 B;  1ROV A;  2HMN B;  4KFD A;  3F8X A;  1DVC A;  3Q90 A;  3NX0 A;  7STD A;  3NM2 A;  4N6O B;  3LYG A;  1DVD A;  4FCM A;  3BND A;  3LZA A;  3I0Y A;  2CK3 H;  1G96 A;  1A2K A;  1WMO A;  3WDG B;  1JV2 B;  3PGB A;  2V1L A;  3K9M C;  4O02 B;  1SPU A;  5EVH A;  2I9W A;  3CPW 2;  4WWU C;  3CCR 3;  3CXC 2;  3WOE B;  2XFT A;  2ML6 A;  3EJV A;  3OX9 A;  5JPU A;  2CWU A;  3OXA A;  1IV9 A;  2HMM B;  3L0R A;  2XSO B;  3X40 A;  3NXJ A;  1IQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...