1UCIA

Mutants of rnase sa
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
b'DTSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title The contribution of polar group burial to protein stability is strongly context-dependent
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 23
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1uciA00
3D5GA 1BRNL 3BU4A 1B3SA 3SYUA 1YVSA 1RDSA 1RLSA 1BNJA 5BIRA 1HYFA 1X1XA 3DH2A 1BGSA 1UCJA 3HOHA 1LOWA 1FYSA 1BSDA 2BIRA 1BRHA 1YGWA 2HOHA 3URPA 2GSPA 3Q3FA 1X1YA 4J5GA 1JBRA 2KF3A 3WHOA 2KAAA 1AQZA 1BRSA 3D5IA 1I0XA 1BOXA 4J5KA 4BIRA 1JBTA 1X1UA 1BU4A 2ZA4A 1BNRA 1BNGA 1IYYA 4GHOA 1C54A 5RNTA 1T2HA 1GOVA 1RCKA 1R4YA 1B2SA 6GSPA 2RNTA 3D4AA 5GSPA 3GSPA 2KF6A 1BUJA 3WR2A 1LRAA 1RGKA 1BNSA 1A2PA 1LOVA 1BIRA 1BNFA 1RCLA 3AGOA 2BU4A 1BANA 1I8VA 1RSNA 1RGHA 1PY3A 3AHSA 4HOHA 2AADA 1BSCA 1BRJA 1I2GA 1BSAA 1B2ZA 1TRPA 1SARA 2C4BA 1DE3A 1RNBA 1RGLA 4RNTA 1BRIA 1RGEA 5HOHA 1B2MA 2F4YA 1GOUA 1ZGXA 2F56A 1TRQA 1B21A 3DGYA 1I2FA 3KCHA 3BIRA 1RMSA 1YNVX 1RN1A 2F5MA 1T2IA 5BU4A 7RNTA 1RGFA 1G02A 1GSPA 1AY7A 4HAAA 1B2XA 1BSEA 1I3FA 1BSBA 1RHLA 1GOYA 1FW7A 1BAOA 1JBSA 1BNIA 1LNIA 1TTOA 4GSPA 1HZ1A 1BVIA 1BNEA 1DETA 1I2EA 1I70A 1Q9EA 1RGCA 1RN4A 2SARA 2KF4A 1FZUA 2RBIA 1I0VA 1RGGA 1UCKA 1B27A 1GMPA 1RTUA 6RNTA 1RNTA 1B20A 3RNTA 1BRKA 9RNTA 1B2UA 1LOYA 1MGWA 1RGAA 2KF5A 1FUSA 1X1WA 3AGNA 4BU4A 2AAEA 1PYLA 7GSPA 8RNTA 3A5EA 3AHWA 1CH0A 1UCIA 1UCLA 1MGRA 1I3IA 2F5WA 1BRGA 1FUTA 1GMRA 1GMQA
chains in the Genus database with same CATH superfamily
3CMA3 2P0XA 1OF5B 2XGNA 3BU4A 4H61A 2OTJ3 2P0MA 2W6JH 3FF0A 3X3YA 1VQO3 1BNJA 1VQP3 1WNHA 1S5AA 2OWPA 1YGEA 1HYFA 2UX0A 2YX9A 4O3VA 2UUGC 3ER7A 3KN4A 5JBSA 1BSDA 1G0TA 2F99A 3BNEA 1OH0A 4XM4A 3NV0A 5M1AA 5KP4A 3Q3FA 5IERA 2GEYA 2KF3A 3K5TA 1W2ZA 2D42A 3DXOA 3G713 1JBTA 3JUNA 3MPHA 1FGOA 4R1KA 5ELUA 1KC84 1OF5A 1T2HA 1TU5A 2XH9A 1GOVA 4K1VA 3KSED 4LGQA 2IMJA 3ZG0A 1V74A 1STDA 3DY5A 5FW5A 3GZRA 2QIYA 3D4AA 3X3ZA 2BMOB 3TDGA 1ASKA 3OV4A 1IQ8A 1DMNA 3WR2A 1IK3A 2J8XB 3NM2A 3D3LA 1BIRA 1RCLA 2GBWB 3JUMA 2V1LA 3GZYB 3MWZA 3U97A 3KFQC 1BANA 2OOVA 1IVVA 1IV9A 3DGNA 1BUQA 2W56B 1KSIA 3AHSA 1IU7A 2AADA 1IDPA 1BSCA 2RCDA 1B2ZA 1STFI 1OHPA 4LYLB 3E99A 3GZBA 1DE3A 4EC6A 3V98A 3K63A 3X3XA 1QAKA 1RKYA 1UW1A 4K90B 4N6UA 4IIAA 4HBRA 4BL2A 2F56A 4L8PA 5EVHA 3BNBA 3BNCA 3O8YA 5CXOA 2Z77A 4KFFA 1LQGC 3EX9A 1EEJA 1Q814 4R9LA 3KCHA 3CPW2 2W56A 4L7KA 3IJEB 1YNVX 2GU1A 1NJI4 1Q7Y4 3L0RA 4I4KA 1RRHA 4RZMA 2OCTA 4J8TA 2O9UX 4GL6A 2CWVA 3U1WA 4RBNA 7RNTA 1WMPA 4BTYA 3KIIA 2WGQA 4O8SA 1AY7A 3K7CA 1B2XA 3NX0A 2Z6BA 3X42A 1R4CA 1BSBA 2P09A 5D82A 3UL6A 5DRVA 3T8NA 1NO3A 3FH1A 1TTOA 1JJ22 2FGTA 4HM1B 1BNEA 1Q9EA 1I2EA 3ALAA 1RGCA 2W03A 5LC6A 1IVXA 3LTBA 1W2B2 3JUPA 3NBRA 1UCKA 4QWTA 3HIIA 1F8NA 2HMOB 1YJ93 1NDOB 2CFLA 5A0OB 1GMPA 1RTUA 1ULJB 5LC7A 1QALA 2CX1A 1MWSA 3RNTA 1QJGA 1VQ93 3OXAA 4N6TA 1MGWA 3EQQB 1X1WA 2HMMB 1VQ83 3J7Yd 4BU4A 1PYLA 4STDA 3ROBA 4EV2A 2CC3A 1FGQA 1SPUA 3A5EA 1JB4A 2UGIA 1CH0A 5TGNA 1IT8A 1OHSA 3MYTA 3X41A 3AMOB 4HM6B 4HZ9B 2I9WA 1VQQA 1W00A 5IEPA 1FUTA 2XFTA 1BRKA 3WOEB 1GMQA 1JZOA 3D5GA 2FNQA 1B3SA 2MF7A 1RDSA 2IY2A 1Q42A 3BLZA 1M904 4JF8A 3CCS3 3DH2A 1BGSA 1W5ZA 1QVF2 3WDGB 5CF2A 3GRDA 1DYUA 1GY7A 1IV7A 3EN1B 4X2OA 4HJLB 2CFDA 2CW9A 1NB3I 2CK3H 3URPA 1X1YA 3ECFA 4J5GA 4R9KA 3F9SA 4ILFA 2KAAA 3EJVA 1AQZA 3D5IA 3IPTA 3SOYA 1X1UA 1W6GA 5M19A 1C54A 1FGRA 3B4OA 1Q40B 3LTCA 4MMZB 1RCKA 1DVCA 4G1MB 1R4YA 1B2SA 1TJDA 1NWWA 3CCL3 4HVNA 5AIIA 2XEPA 1O7PB 1JZDA 2CFKA 3D79A 4ORLA 1YJW3 2LYXA 1JB2A 3F14A 3VF1A 3PXMA 1VQK3 1TP6A 4HM0B 1ZX2A 4WYKB 3RDEA 1EG9B 3FLJA 2BU4A 4XB5A 3Q90A 1JB5A 4AKZA 4HOHA 4O2HA 1BRJA 1VQL3 1O7GB 1ULIB 1Q40A 1ROVA 1SARA 1OACA 1AR0A 1GY6A 1U5OA 3EBYA 4HM8B 5M18A 1D6ZA 2B24B 1MWUA 4WP5A 3KSPA 2P38A 2XF3A 1ZGXA 5STDA 5KP1A 1TRQA 4WYKA 1WQLB 2Z76A 3DGYA 1I2FA 2L4VA 3CCM3 1EKMA 2W9PA 4EV5A 3STDA 1IVWA 1VQN3 2BO9B 2CFGA 1HU9A 4LEHA 5IENA 3H3HA 3UNLA 1AVLA 3FCSB 5BU4A 1GSPA 2BNGA 2PZVA 2ZDJA 3FSDA 3T0UA 1BSEA 1TIJA 1YVBI 1I3FA 2A15A 1A67A 1OPYA 3DGOA 3F7XA 3PGBA 1FGTA 4KFDA 1FW7A 1AVKA 1BAOA 1OUNA 3CCV3 1Y4KA 1CQSA 3F8HA 4HM7B 3FZWA 1HZ1A 5G1LA 3HZPA 1DETA 3CCR3 4N3VA 1N9EA 1RN4A 3N8BA 1SIHA 4FR9A 4GB5A 2BHMA 4WHAA 1FZUA 2INXA 2PNCA 1RGGA 3LT9A 1PFPA 1D6UA 1CYVA 1B27A 2E2UA 1LXEA 2XGLA 1OHOA 1U8CB 3NM7A 3PCSA 4CCVA 3VSYA 2BMQB 2W2CA 2H0IA 1MWRA 3LT8A 2CHCA 1LOYA 5IG5A 2QGUA 3NXJA 2WOFA 2XSOB 1IVUA 1TFKA 2AAEA 3AGNA 4HM5B 2GBXB 5IEOA 1VQM3 1Q824 4BTXA 7GSPA 2K0MA 3AHWA 1JKGB 1FUWA 5IF6A 3B8LA 1MGRA 1QMAA 1YIT3 3FG1A 1I3IA 2M7OA 1BRGA 4L8OA 3DUKA 4XBYA 1O7NB 4HYZA 4EW5A 2XR8B 3EN8A 4X2HA 4FCJA 1YVSA 4XBXA 1RLSA 4H3UA 5CF1A 2FXTA 4AEQA 5BIRA 1T5YA 5AI1A 3N9HA 5IW9A 1LOWA 1FYSA 2D1WA 2E2TA 1V58A 2BIRA 2KXGA 4WFOA 5I97A 2Y73A 3LXUX 1BRHA 2HOHA 3NHXA 4DKIA 1VQ53 2GSPA 3LTAA 1JBRA 3WHOA 1RJOA 1BRSA 1JRQA 2IYJA 2WGOA 1I0XA 3HIGA 1BOXA 3LZAA 5CLKA 3FG3A 3DMCA 1BNGA 2IA7A 3A76A 4FMCA 5D83A 1IT7A 5RNTA 2QA43 1Q864 1IYYA 4JRFA 1M9GA 1WMOA 2ML6A 3GZXB 1W7CA 3PS8A 1N9JA 5DREA 6GSPA 4NREA 1RRLA 3CCQ3 3K0ZA 2STDA 3CU3A 4IPBA 4J9AA 1RGKA 2IUJA 1K41A 1OGZA 1BNSA 4KZ1A 4LMIA 1LOVA 1NU3A 4XDVA 2JDIH 1UUVB 5G2GA 1T3BA 1KWIA 3LTDA 3WOFB 1K9M4 2XFSA 3G0KA 1I8VA 4HM4B 5EQLA 3GAXA 1PY3A 3PCRA 2GXFA 3MG1A 1VQ43 1A90A 4MJDA 5IG0A 1I2GA 3EE1A 1TRPA 3MG3A 3HK4A 3G4S3 1O7WB 2CFWA 3ZFZA 3AMOA 3CD63 3G8ZA 1HKXA 2HMNB 1V57A 1VQ63 4IT7A 1RGLA 1O7HB 4K61A 3T8UA 3WA2X 1RGEA 3Q1CA 3CCU3 1KQS2 1C7HA 1OCVA 2O3OA 2F4YA 2XRXB 1GS3A 4RNZA 3SOAA 1GY5A 3MG2A 1GOUA 2H0HA 4PEJA 3PYJA 4K1UA 1MOLA 2Q07A 3F8XA 1W01A 1VZZA 3FG4A 3NQZA 2CIUA 1RMSA 5AIGA 4RNYA 3SVAA 1W6CA 1N8QA 4KT3B 1LVNA 2B1XB 2F5MA 1T2IA 3LYGA 3VGNA 3KKGA 3FGYA 2LQVA 3CCE3 3CCJ3 1WTHA 3N54B 1RGFA 1L5GB 5AYSC 1YJN3 1M1K4 1QVG2 1JNQA 3SX1A 5KP3A 1RHLA 1GOYA 2HMKB 3NV0B 4N6MA 3Q2PA 2OOVC 4NHFA 1BNIA 1LNIA 3OWUA 4GSPA 4OUQA 2CH9A 3V92A 3G16A 4N6LA 2ZL8A 4EBGA 4HM2B 2L1SA 1GD3A 1UUGB 2HMJB 1UGHI 2SARA 3I0YA 4R80A 2WO0A 5AIFA 4BL3A 2C11A 2C10A 1I0VA 3EB8A 1DMMA 2OQEC 3NBBA 4N6V0 1E3VA 4FMBA 3RGAA 1WMNA 2KRTA 5G1KA 5BVBA 1AV4A 1GD4A 1M1XB 2F86B 1RNTA 2YFLB 1A2KA 2CX0A 1B2UA 1UGIA 1PU4A 1SIIA 1FUSA 6STDA 1YI23 1SQWA 1JN5B 5CK6A 3LOYA 1D6YA 4OVMA 8RNTA 3G6E3 2W04A 3UB1A 3FF2A 3FKAA 2Z7AA 1UCIA 1LQMB 1OGXA 1UCLA 3BNDA 4N6OB 1RN7A 2F5WA 2MC8A 3MHEA 3X40A 3SLUA 1ISKA 3EF8A 3DZLA 1UDII 4EXRA 4MMYB 3GWRA 5AEUB 1Q7HA 5FGOA 2GEXA 1BRNL 3I563 4AKYA 1YHQ3 3CXC2 2SBLA 4EYCA 3SYUA 1QAFA 3OX9A 3B7CA 1X1XA 2RSXA 3D9RA 3HOHA 1UCJA 2HMLB 1TFOA 1JN5A 3MKIA 3UJMA 1FA3A 8CHOA 1NNVA 1YGWA 4R4KA 1EUIC 2YFJB 1ZO2A 5D81A 3WMDA 3EHCA 2OQEA 2YFIB 4J5KA 1CEWI 3WODG 4BIRA 1BU4A 2ZA4A 1BNRA 4FMDA 4GHOA 2R41A 3HX8A 1K28A 1W4NA 3JVCA 3LMLA 4HZBB 2RNTA 3EC9A 3CNMA 5GSPA 1N8R4 4LZIA 4I5QA 3GSPA 2KF6A 3SEDA 5IG3A 1BUJA 1LRAA 2JQ5A 1LOXA 3CME3 1Z1SA 3DM8A 1VQ73 4O02B 1NB5I 1CYUA 1A2PA 1JV2B 3EBTA 1DMQA 1BNFA 2RFRA 3S27A 3AGOA 1MNLA 4MMXB 1GYBA 5AYRB 3V99A 3H51A 4ZM8A 3CNXA 1RSNA 1RGHA 2CWTA 3ZG5A 2W9QA 1JKGA 3JUOA 1E97A 3KZTA 1BSAA 1N5HA 2CG0A 5HGRA 4BTWA 2OTL3 1YIJ3 3IMAB 4XDWA 4KVHA 2H0GA 3NBJA 2C4BA 2CKFB 2P05A 1RNBA 1E3RA 2W0QA 4RNTA 2CG1A 1BRIA 3BB9A 5HOHA 1K734 1B2MA 2K54A 4KFEA 1EQKA 5BXQA 4NPBA 1IQXA 4CDLA 5IG4A 3PZWA 1S723 2F98A 2K3DA 3S29A 1B21A 4CJNA 3BIRA 2ML5A 3CC23 4WWUC 1RN1A 3NUVA 4N6NB 2RGQA 3KE7A 1G96A 4OK0A 4TX4A 1J2BA 1A2VA 3MSOA 1G02A 1ZS7A 3M8CA 4Q53A 7STDA 4HAAA 3WA3A 4HKVB 1MWTA 1TUHA 1W6YA 1EA2A 3QRDA 4XBTA 4FCMA 2QEX3 3OW22 3F7SA 2CWUA 1JBSA 1UI8A 1ROAA 3OWSA 3QK9A 1UUWB 1BVIA 5JPPA 1I70A 3I553 1FGMA 2KF4A 2RBIA 4LSOA 1KD14 1N5PA 4MEIA 6RNTA 2BT3A 1B20A 4U13A 3RGRA 4CPKA 2R4IA 3CPOA 5ELJA 9RNTA 3CC43 3B4PA 3HI7A 2IUKA 2ZHXB 1RGAA 2KF5A 1IQYA 1UI7A 2KCDA 4FCZA 3UL5A 1LNHA 3F40A 5EEOA 1O7MB 3SXXA 5AEWB 1K8A4 3DGMA 3JUQA 1W02A 3DGLA 2XSHB 3LH4A 3CC73 1SJWA 1US1A 2E2VA 3S5CA 2WOHA 3NQYA 5JPUA 1DVDA 3S67A 5AIHA 2BMRB 3K9MC 2Y74A 4FMAA 3OWYA 1GMRA 2GU3A 4HM3B 3S28A
chains in the Genus database with same CATH topology
3D5GA 1BRNL 3BU4A 1B3SA 3SYUA 1YVSA 1RDSA 1RLSA 1BNJA 5BIRA 1HYFA 1X1XA 3DH2A 1BGSA 1UCJA 3HOHA 1LOWA 1FYSA 1BSDA 2BIRA 1BRHA 1YGWA 2HOHA 3URPA 2GSPA 3Q3FA 1X1YA 4J5GA 1JBRA 2KF3A 3WHOA 2KAAA 1AQZA 1BRSA 3D5IA 1I0XA 1BOXA 4J5KA 4BIRA 1JBTA 1X1UA 1BU4A 2ZA4A 1BNRA 1BNGA 1IYYA 4GHOA 1C54A 5RNTA 1T2HA 1GOVA 1RCKA 1R4YA 1B2SA 6GSPA 2RNTA 3D4AA 5GSPA 3GSPA 2KF6A 1BUJA 3WR2A 1LRAA 1RGKA 1BNSA 1A2PA 1LOVA 1BIRA 1BNFA 1RCLA 3AGOA 2BU4A 1BANA 1I8VA 1RSNA 1RGHA 1PY3A 3AHSA 4HOHA 2AADA 1BSCA 1BRJA 1I2GA 1BSAA 1B2ZA 1TRPA 1SARA 2C4BA 1DE3A 1RNBA 1RGLA 4RNTA 1BRIA 1RGEA 5HOHA 1B2MA 2F4YA 1GOUA 1ZGXA 2F56A 1TRQA 1B21A 3DGYA 1I2FA 3KCHA 3BIRA 1RMSA 1YNVX 1RN1A 2F5MA 1T2IA 5BU4A 7RNTA 1RGFA 1G02A 1GSPA 1AY7A 4HAAA 1B2XA 1BSEA 1I3FA 1BSBA 1RHLA 1GOYA 1FW7A 1BAOA 1JBSA 1BNIA 1LNIA 1TTOA 4GSPA 1HZ1A 1BVIA 1BNEA 1DETA 1I2EA 1I70A 1Q9EA 1RGCA 1RN4A 2SARA 2KF4A 1FZUA 2RBIA 1I0VA 1RGGA 1UCKA 1B27A 1GMPA 1RTUA 6RNTA 1RNTA 1B20A 3RNTA 1BRKA 9RNTA 1B2UA 1LOYA 1MGWA 1RGAA 2KF5A 1FUSA 1X1WA 3AGNA 4BU4A 2AAEA 1PYLA 7GSPA 8RNTA 3A5EA 3AHWA 1CH0A 1UCIA 1UCLA 1MGRA 1I3IA 2F5WA 1BRGA 1FUTA 1GMRA 1GMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5G A;  1BRN L;  3BU4 A;  1B3S A;  3SYU A;  1YVS A;  1RDS A;  1RLS A;  1BNJ A;  5BIR A;  1HYF A;  1X1X A;  3DH2 A;  1BGS A;  1UCJ A;  3HOH A;  1LOW A;  1FYS A;  1BSD A;  2BIR A;  1BRH A;  1YGW A;  2HOH A;  3URP A;  2GSP A;  3Q3F A;  1X1Y A;  4J5G A;  1JBR A;  2KF3 A;  3WHO A;  2KAA A;  1AQZ A;  1BRS A;  3D5I A;  1I0X A;  1BOX A;  4J5K A;  4BIR A;  1JBT A;  1X1U A;  1BU4 A;  2ZA4 A;  1BNR A;  1BNG A;  1IYY A;  4GHO A;  1C54 A;  5RNT A;  1T2H A;  1GOV A;  1RCK A;  1R4Y A;  1B2S A;  6GSP A;  2RNT A;  3D4A A;  5GSP A;  3GSP A;  2KF6 A;  1BUJ A;  3WR2 A;  1LRA A;  1RGK A;  1BNS A;  1A2P A;  1LOV A;  1BIR A;  1BNF A;  1RCL A;  3AGO A;  2BU4 A;  1BAN A;  1I8V A;  1RSN A;  1RGH A;  1PY3 A;  3AHS A;  4HOH A;  2AAD A;  1BSC A;  1BRJ A;  1I2G A;  1BSA A;  1B2Z A;  1TRP A;  1SAR A;  2C4B A;  1DE3 A;  1RNB A;  1RGL A;  4RNT A;  1BRI A;  1RGE A;  5HOH A;  1B2M A;  2F4Y A;  1GOU A;  1ZGX A;  2F56 A;  1TRQ A;  1B21 A;  3DGY A;  1I2F A;  3KCH A;  3BIR A;  1RMS A;  1YNV X;  1RN1 A;  2F5M A;  1T2I A;  5BU4 A;  7RNT A;  1RGF A;  1G02 A;  1GSP A;  1AY7 A;  4HAA A;  1B2X A;  1BSE A;  1I3F A;  1BSB A;  1RHL A;  1GOY A;  1FW7 A;  1BAO A;  1JBS A;  1BNI A;  1LNI A;  1TTO A;  4GSP A;  1HZ1 A;  1BVI A;  1BNE A;  1DET A;  1I2E A;  1I70 A;  1Q9E A;  1RGC A;  1RN4 A;  2SAR A;  2KF4 A;  1FZU A;  2RBI A;  1I0V A;  1RGG A;  1UCK A;  1B27 A;  1GMP A;  1RTU A;  6RNT A;  1RNT A;  1B20 A;  3RNT A;  1BRK A;  9RNT A;  1B2U A;  1LOY A;  1MGW A;  1RGA A;  2KF5 A;  1FUS A;  1X1W A;  3AGN A;  4BU4 A;  2AAE A;  1PYL A;  7GSP A;  8RNT A;  3A5E A;  3AHW A;  1CH0 A;  1UCI A;  1UCL A;  1MGR A;  1I3I A;  2F5W A;  1BRG A;  1FUT A;  1GMR A;  1GMQ A; 
#chains in the Genus database with same CATH topology
 3CMA 3;  2P0X A;  1OF5 B;  2XGN A;  3BU4 A;  4H61 A;  2OTJ 3;  2P0M A;  2W6J H;  3FF0 A;  3X3Y A;  1VQO 3;  1BNJ A;  1VQP 3;  1WNH A;  1S5A A;  2OWP A;  1YGE A;  1HYF A;  2UX0 A;  2YX9 A;  4O3V A;  2UUG C;  3ER7 A;  3KN4 A;  5JBS A;  1BSD A;  1G0T A;  2F99 A;  3BNE A;  1OH0 A;  4XM4 A;  3NV0 A;  5M1A A;  5KP4 A;  3Q3F A;  5IER A;  2GEY A;  2KF3 A;  3K5T A;  1W2Z A;  2D42 A;  3DXO A;  3G71 3;  1JBT A;  3JUN A;  3MPH A;  1FGO A;  4R1K A;  5ELU A;  1KC8 4;  1OF5 A;  1T2H A;  1TU5 A;  2XH9 A;  1GOV A;  4K1V A;  3KSE D;  4LGQ A;  2IMJ A;  3ZG0 A;  1V74 A;  1STD A;  3DY5 A;  5FW5 A;  3GZR A;  2QIY A;  3D4A A;  3X3Z A;  2BMO B;  3TDG A;  1ASK A;  3OV4 A;  1IQ8 A;  1DMN A;  3WR2 A;  1IK3 A;  2J8X B;  3NM2 A;  3D3L A;  1BIR A;  1RCL A;  2GBW B;  3JUM A;  2V1L A;  3GZY B;  3MWZ A;  3U97 A;  3KFQ C;  1BAN A;  2OOV A;  1IVV A;  1IV9 A;  3DGN A;  1BUQ A;  2W56 B;  1KSI A;  3AHS A;  1IU7 A;  2AAD A;  1IDP A;  1BSC A;  2RCD A;  1B2Z A;  1STF I;  1OHP A;  4LYL B;  3E99 A;  3GZB A;  1DE3 A;  4EC6 A;  3V98 A;  3K63 A;  3X3X A;  1QAK A;  1RKY A;  1UW1 A;  4K90 B;  4N6U A;  4IIA A;  4HBR A;  4BL2 A;  2F56 A;  4L8P A;  5EVH A;  3BNB A;  3BNC A;  3O8Y A;  5CXO A;  2Z77 A;  4KFF A;  1LQG C;  3EX9 A;  1EEJ A;  1Q81 4;  4R9L A;  3KCH A;  3CPW 2;  2W56 A;  4L7K A;  3IJE B;  1YNV X;  2GU1 A;  1NJI 4;  1Q7Y 4;  3L0R A;  4I4K A;  1RRH A;  4RZM A;  2OCT A;  4J8T A;  2O9U X;  4GL6 A;  2CWV A;  3U1W A;  4RBN A;  7RNT A;  1WMP A;  4BTY A;  3KII A;  2WGQ A;  4O8S A;  1AY7 A;  3K7C A;  1B2X A;  3NX0 A;  2Z6B A;  3X42 A;  1R4C A;  1BSB A;  2P09 A;  5D82 A;  3UL6 A;  5DRV A;  3T8N A;  1NO3 A;  3FH1 A;  1TTO A;  1JJ2 2;  2FGT A;  4HM1 B;  1BNE A;  1Q9E A;  1I2E A;  3ALA A;  1RGC A;  2W03 A;  5LC6 A;  1IVX A;  3LTB A;  1W2B 2;  3JUP A;  3NBR A;  1UCK A;  4QWT A;  3HII A;  1F8N A;  2HMO B;  1YJ9 3;  1NDO B;  2CFL A;  5A0O B;  1GMP A;  1RTU A;  1ULJ B;  5LC7 A;  1QAL A;  2CX1 A;  1MWS A;  3RNT A;  1QJG A;  1VQ9 3;  3OXA A;  4N6T A;  1MGW A;  3EQQ B;  1X1W A;  2HMM B;  1VQ8 3;  3J7Y d;  4BU4 A;  1PYL A;  4STD A;  3ROB A;  4EV2 A;  2CC3 A;  1FGQ A;  1SPU A;  3A5E A;  1JB4 A;  2UGI A;  1CH0 A;  5TGN A;  1IT8 A;  1OHS A;  3MYT A;  3X41 A;  3AMO B;  4HM6 B;  4HZ9 B;  2I9W A;  1VQQ A;  1W00 A;  5IEP A;  1FUT A;  2XFT A;  1BRK A;  3WOE B;  1GMQ A;  1JZO A;  3D5G A;  2FNQ A;  1B3S A;  2MF7 A;  1RDS A;  2IY2 A;  1Q42 A;  3BLZ A;  1M90 4;  4JF8 A;  3CCS 3;  3DH2 A;  1BGS A;  1W5Z A;  1QVF 2;  3WDG B;  5CF2 A;  3GRD A;  1DYU A;  1GY7 A;  1IV7 A;  3EN1 B;  4X2O A;  4HJL B;  2CFD A;  2CW9 A;  1NB3 I;  2CK3 H;  3URP A;  1X1Y A;  3ECF A;  4J5G A;  4R9K A;  3F9S A;  4ILF A;  2KAA A;  3EJV A;  1AQZ A;  3D5I A;  3IPT A;  3SOY A;  1X1U A;  1W6G A;  5M19 A;  1C54 A;  1FGR A;  3B4O A;  1Q40 B;  3LTC A;  4MMZ B;  1RCK A;  1DVC A;  4G1M B;  1R4Y A;  1B2S A;  1TJD A;  1NWW A;  3CCL 3;  4HVN A;  5AII A;  2XEP A;  1O7P B;  1JZD A;  2CFK A;  3D79 A;  4ORL A;  1YJW 3;  2LYX A;  1JB2 A;  3F14 A;  3VF1 A;  3PXM A;  1VQK 3;  1TP6 A;  4HM0 B;  1ZX2 A;  4WYK B;  3RDE A;  1EG9 B;  3FLJ A;  2BU4 A;  4XB5 A;  3Q90 A;  1JB5 A;  4AKZ A;  4HOH A;  4O2H A;  1BRJ A;  1VQL 3;  1O7G B;  1ULI B;  1Q40 A;  1ROV A;  1SAR A;  1OAC A;  1AR0 A;  1GY6 A;  1U5O A;  3EBY A;  4HM8 B;  5M18 A;  1D6Z A;  2B24 B;  1MWU A;  4WP5 A;  3KSP A;  2P38 A;  2XF3 A;  1ZGX A;  5STD A;  5KP1 A;  1TRQ A;  4WYK A;  1WQL B;  2Z76 A;  3DGY A;  1I2F A;  2L4V A;  3CCM 3;  1EKM A;  2W9P A;  4EV5 A;  3STD A;  1IVW A;  1VQN 3;  2BO9 B;  2CFG A;  1HU9 A;  4LEH A;  5IEN A;  3H3H A;  3UNL A;  1AVL A;  3FCS B;  5BU4 A;  1GSP A;  2BNG A;  2PZV A;  2ZDJ A;  3FSD A;  3T0U A;  1BSE A;  1TIJ A;  1YVB I;  1I3F A;  2A15 A;  1A67 A;  1OPY A;  3DGO A;  3F7X A;  3PGB A;  1FGT A;  4KFD A;  1FW7 A;  1AVK A;  1BAO A;  1OUN A;  3CCV 3;  1Y4K A;  1CQS A;  3F8H A;  4HM7 B;  3FZW A;  1HZ1 A;  5G1L A;  3HZP A;  1DET A;  3CCR 3;  4N3V A;  1N9E A;  1RN4 A;  3N8B A;  1SIH A;  4FR9 A;  4GB5 A;  2BHM A;  4WHA A;  1FZU A;  2INX A;  2PNC A;  1RGG A;  3LT9 A;  1PFP A;  1D6U A;  1CYV A;  1B27 A;  2E2U A;  1LXE A;  2XGL A;  1OHO A;  1U8C B;  3NM7 A;  3PCS A;  4CCV A;  3VSY A;  2BMQ B;  2W2C A;  2H0I A;  1MWR A;  3LT8 A;  2CHC A;  1LOY A;  5IG5 A;  2QGU A;  3NXJ A;  2WOF A;  2XSO B;  1IVU A;  1TFK A;  2AAE A;  3AGN A;  4HM5 B;  2GBX B;  5IEO A;  1VQM 3;  1Q82 4;  4BTX A;  7GSP A;  2K0M A;  3AHW A;  1JKG B;  1FUW A;  5IF6 A;  3B8L A;  1MGR A;  1QMA A;  1YIT 3;  3FG1 A;  1I3I A;  2M7O A;  1BRG A;  4L8O A;  3DUK A;  4XBY A;  1O7N B;  4HYZ A;  4EW5 A;  2XR8 B;  3EN8 A;  4X2H A;  4FCJ A;  1YVS A;  4XBX A;  1RLS A;  4H3U A;  5CF1 A;  2FXT A;  4AEQ A;  5BIR A;  1T5Y A;  5AI1 A;  3N9H A;  5IW9 A;  1LOW A;  1FYS A;  2D1W A;  2E2T A;  1V58 A;  2BIR A;  2KXG A;  4WFO A;  5I97 A;  2Y73 A;  3LXU X;  1BRH A;  2HOH A;  3NHX A;  4DKI A;  1VQ5 3;  2GSP A;  3LTA A;  1JBR A;  3WHO A;  1RJO A;  1BRS A;  1JRQ A;  2IYJ A;  2WGO A;  1I0X A;  3HIG A;  1BOX A;  3LZA A;  5CLK A;  3FG3 A;  3DMC A;  1BNG A;  2IA7 A;  3A76 A;  4FMC A;  5D83 A;  1IT7 A;  5RNT A;  2QA4 3;  1Q86 4;  1IYY A;  4JRF A;  1M9G A;  1WMO A;  2ML6 A;  3GZX B;  1W7C A;  3PS8 A;  1N9J A;  5DRE A;  6GSP A;  4NRE A;  1RRL A;  3CCQ 3;  3K0Z A;  2STD A;  3CU3 A;  4IPB A;  4J9A A;  1RGK A;  2IUJ A;  1K41 A;  1OGZ A;  1BNS A;  4KZ1 A;  4LMI A;  1LOV A;  1NU3 A;  4XDV A;  2JDI H;  1UUV B;  5G2G A;  1T3B A;  1KWI A;  3LTD A;  3WOF B;  1K9M 4;  2XFS A;  3G0K A;  1I8V A;  4HM4 B;  5EQL A;  3GAX A;  1PY3 A;  3PCR A;  2GXF A;  3MG1 A;  1VQ4 3;  1A90 A;  4MJD A;  5IG0 A;  1I2G A;  3EE1 A;  1TRP A;  3MG3 A;  3HK4 A;  3G4S 3;  1O7W B;  2CFW A;  3ZFZ A;  3AMO A;  3CD6 3;  3G8Z A;  1HKX A;  2HMN B;  1V57 A;  1VQ6 3;  4IT7 A;  1RGL A;  1O7H B;  4K61 A;  3T8U A;  3WA2 X;  1RGE A;  3Q1C A;  3CCU 3;  1KQS 2;  1C7H A;  1OCV A;  2O3O A;  2F4Y A;  2XRX B;  1GS3 A;  4RNZ A;  3SOA A;  1GY5 A;  3MG2 A;  1GOU A;  2H0H A;  4PEJ A;  3PYJ A;  4K1U A;  1MOL A;  2Q07 A;  3F8X A;  1W01 A;  1VZZ A;  3FG4 A;  3NQZ A;  2CIU A;  1RMS A;  5AIG A;  4RNY A;  3SVA A;  1W6C A;  1N8Q A;  4KT3 B;  1LVN A;  2B1X B;  2F5M A;  1T2I A;  3LYG A;  3VGN A;  3KKG A;  3FGY A;  2LQV A;  3CCE 3;  3CCJ 3;  1WTH A;  3N54 B;  1RGF A;  1L5G B;  5AYS C;  1YJN 3;  1M1K 4;  1QVG 2;  1JNQ A;  3SX1 A;  5KP3 A;  1RHL A;  1GOY A;  2HMK B;  3NV0 B;  4N6M A;  3Q2P A;  2OOV C;  4NHF A;  1BNI A;  1LNI A;  3OWU A;  4GSP A;  4OUQ A;  2CH9 A;  3V92 A;  3G16 A;  4N6L A;  2ZL8 A;  4EBG A;  4HM2 B;  2L1S A;  1GD3 A;  1UUG B;  2HMJ B;  1UGH I;  2SAR A;  3I0Y A;  4R80 A;  2WO0 A;  5AIF A;  4BL3 A;  2C11 A;  2C10 A;  1I0V A;  3EB8 A;  1DMM A;  2OQE C;  3NBB A;  4N6V 0;  1E3V A;  4FMB A;  3RGA A;  1WMN A;  2KRT A;  5G1K A;  5BVB A;  1AV4 A;  1GD4 A;  1M1X B;  2F86 B;  1RNT A;  2YFL B;  1A2K A;  2CX0 A;  1B2U A;  1UGI A;  1PU4 A;  1SII A;  1FUS A;  6STD A;  1YI2 3;  1SQW A;  1JN5 B;  5CK6 A;  3LOY A;  1D6Y A;  4OVM A;  8RNT A;  3G6E 3;  2W04 A;  3UB1 A;  3FF2 A;  3FKA A;  2Z7A A;  1UCI A;  1LQM B;  1OGX A;  1UCL A;  3BND A;  4N6O B;  1RN7 A;  2F5W A;  2MC8 A;  3MHE A;  3X40 A;  3SLU A;  1ISK A;  3EF8 A;  3DZL A;  1UDI I;  4EXR A;  4MMY B;  3GWR A;  5AEU B;  1Q7H A;  5FGO A;  2GEX A;  1BRN L;  3I56 3;  4AKY A;  1YHQ 3;  3CXC 2;  2SBL A;  4EYC A;  3SYU A;  1QAF A;  3OX9 A;  3B7C A;  1X1X A;  2RSX A;  3D9R A;  3HOH A;  1UCJ A;  2HML B;  1TFO A;  1JN5 A;  3MKI A;  3UJM A;  1FA3 A;  8CHO A;  1NNV A;  1YGW A;  4R4K A;  1EUI C;  2YFJ B;  1ZO2 A;  5D81 A;  3WMD A;  3EHC A;  2OQE A;  2YFI B;  4J5K A;  1CEW I;  3WOD G;  4BIR A;  1BU4 A;  2ZA4 A;  1BNR A;  4FMD A;  4GHO A;  2R41 A;  3HX8 A;  1K28 A;  1W4N A;  3JVC A;  3LML A;  4HZB B;  2RNT A;  3EC9 A;  3CNM A;  5GSP A;  1N8R 4;  4LZI A;  4I5Q A;  3GSP A;  2KF6 A;  3SED A;  5IG3 A;  1BUJ A;  1LRA A;  2JQ5 A;  1LOX A;  3CME 3;  1Z1S A;  3DM8 A;  1VQ7 3;  4O02 B;  1NB5 I;  1CYU A;  1A2P A;  1JV2 B;  3EBT A;  1DMQ A;  1BNF A;  2RFR A;  3S27 A;  3AGO A;  1MNL A;  4MMX B;  1GYB A;  5AYR B;  3V99 A;  3H51 A;  4ZM8 A;  3CNX A;  1RSN A;  1RGH A;  2CWT A;  3ZG5 A;  2W9Q A;  1JKG A;  3JUO A;  1E97 A;  3KZT A;  1BSA A;  1N5H A;  2CG0 A;  5HGR A;  4BTW A;  2OTL 3;  1YIJ 3;  3IMA B;  4XDW A;  4KVH A;  2H0G A;  3NBJ A;  2C4B A;  2CKF B;  2P05 A;  1RNB A;  1E3R A;  2W0Q A;  4RNT A;  2CG1 A;  1BRI A;  3BB9 A;  5HOH A;  1K73 4;  1B2M A;  2K54 A;  4KFE A;  1EQK A;  5BXQ A;  4NPB A;  1IQX A;  4CDL A;  5IG4 A;  3PZW A;  1S72 3;  2F98 A;  2K3D A;  3S29 A;  1B21 A;  4CJN A;  3BIR A;  2ML5 A;  3CC2 3;  4WWU C;  1RN1 A;  3NUV A;  4N6N B;  2RGQ A;  3KE7 A;  1G96 A;  4OK0 A;  4TX4 A;  1J2B A;  1A2V A;  3MSO A;  1G02 A;  1ZS7 A;  3M8C A;  4Q53 A;  7STD A;  4HAA A;  3WA3 A;  4HKV B;  1MWT A;  1TUH A;  1W6Y A;  1EA2 A;  3QRD A;  4XBT A;  4FCM A;  2QEX 3;  3OW2 2;  3F7S A;  2CWU A;  1JBS A;  1UI8 A;  1ROA A;  3OWS A;  3QK9 A;  1UUW B;  1BVI A;  5JPP A;  1I70 A;  3I55 3;  1FGM A;  2KF4 A;  2RBI A;  4LSO A;  1KD1 4;  1N5P A;  4MEI A;  6RNT A;  2BT3 A;  1B20 A;  4U13 A;  3RGR A;  4CPK A;  2R4I A;  3CPO A;  5ELJ A;  9RNT A;  3CC4 3;  3B4P A;  3HI7 A;  2IUK A;  2ZHX B;  1RGA A;  2KF5 A;  1IQY A;  1UI7 A;  2KCD A;  4FCZ A;  3UL5 A;  1LNH A;  3F40 A;  5EEO A;  1O7M B;  3SXX A;  5AEW B;  1K8A 4;  3DGM A;  3JUQ A;  1W02 A;  3DGL A;  2XSH B;  3LH4 A;  3CC7 3;  1SJW A;  1US1 A;  2E2V A;  3S5C A;  2WOH A;  3NQY A;  5JPU A;  1DVD A;  3S67 A;  5AIH A;  2BMR B;  3K9M C;  2Y74 A;  4FMA A;  3OWY A;  1GMR A;  2GU3 A;  4HM3 B;  3S28 A; 
#chains in the Genus database with same CATH homology
 3D5G A;  1BRN L;  3BU4 A;  1B3S A;  3SYU A;  1YVS A;  1RDS A;  1RLS A;  1BNJ A;  5BIR A;  1HYF A;  1X1X A;  3DH2 A;  1BGS A;  1UCJ A;  3HOH A;  1LOW A;  1FYS A;  1BSD A;  2BIR A;  1BRH A;  1YGW A;  2HOH A;  3URP A;  2GSP A;  3Q3F A;  1X1Y A;  4J5G A;  1JBR A;  2KF3 A;  3WHO A;  2KAA A;  1AQZ A;  1BRS A;  3D5I A;  1I0X A;  1BOX A;  4J5K A;  4BIR A;  1JBT A;  1X1U A;  1BU4 A;  2ZA4 A;  1BNR A;  1BNG A;  1IYY A;  4GHO A;  1C54 A;  5RNT A;  1T2H A;  1GOV A;  1RCK A;  1R4Y A;  1B2S A;  6GSP A;  2RNT A;  3D4A A;  5GSP A;  3GSP A;  2KF6 A;  1BUJ A;  3WR2 A;  1LRA A;  1RGK A;  1BNS A;  1A2P A;  1LOV A;  1BIR A;  1BNF A;  1RCL A;  3AGO A;  2BU4 A;  1BAN A;  1I8V A;  1RSN A;  1RGH A;  1PY3 A;  3AHS A;  4HOH A;  2AAD A;  1BSC A;  1BRJ A;  1I2G A;  1BSA A;  1B2Z A;  1TRP A;  1SAR A;  2C4B A;  1DE3 A;  1RNB A;  1RGL A;  4RNT A;  1BRI A;  1RGE A;  5HOH A;  1B2M A;  2F4Y A;  1GOU A;  1ZGX A;  2F56 A;  1TRQ A;  1B21 A;  3DGY A;  1I2F A;  3KCH A;  3BIR A;  1RMS A;  1YNV X;  1RN1 A;  2F5M A;  1T2I A;  5BU4 A;  7RNT A;  1RGF A;  1G02 A;  1GSP A;  1AY7 A;  4HAA A;  1B2X A;  1BSE A;  1I3F A;  1BSB A;  1RHL A;  1GOY A;  1FW7 A;  1BAO A;  1JBS A;  1BNI A;  1LNI A;  1TTO A;  4GSP A;  1HZ1 A;  1BVI A;  1BNE A;  1DET A;  1I2E A;  1I70 A;  1Q9E A;  1RGC A;  1RN4 A;  2SAR A;  2KF4 A;  1FZU A;  2RBI A;  1I0V A;  1RGG A;  1UCK A;  1B27 A;  1GMP A;  1RTU A;  6RNT A;  1RNT A;  1B20 A;  3RNT A;  1BRK A;  9RNT A;  1B2U A;  1LOY A;  1MGW A;  1RGA A;  2KF5 A;  1FUS A;  1X1W A;  3AGN A;  4BU4 A;  2AAE A;  1PYL A;  7GSP A;  8RNT A;  3A5E A;  3AHW A;  1CH0 A;  1UCI A;  1UCL A;  1MGR A;  1I3I A;  2F5W A;  1BRG A;  1FUT A;  1GMR A;  1GMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...