1UCIA

Mutants of rnase sa
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
b'DTSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title The contribution of polar group burial to protein stability is strongly context-dependent
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 23
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1uciA00
1GMPA 1HZ1A 4BIRA 1I70A 1BANA 1BNIA 1RGEA 3WHOA 1RMSA 1B27A 2F5MA 1RHLA 1BAOA 3AGNA 1RLSA 2RNTA 3URPA 4J5GA 1HYFA 1BRGA 1TRPA 1BSCA 1BUJA 3DH2A 1IYYA 2ZA4A 4J5KA 1RNTA 2F4YA 1GMRA 3AHWA 1FW7A 2GSPA 1BNGA 1B2ZA 1I3IA 7RNTA 1LRAA 3Q3FA 3A5EA 1X1XA 1X1UA 1B2MA 3GSPA 1RCLA 1PY3A 1GMQA 2BIRA 1I3FA 3D5IA 4HOHA 6GSPA 1T2IA 1ZGXA 2AAEA 1B2XA 1Q9EA 1X1WA 1DE3A 1FUSA 1GSPA 1T2HA 3BU4A 1G02A 1I2FA 1RTUA 1RGCA 3SYUA 1FZUA 1I0XA 6RNTA 1B20A 1LOVA 1RN4A 1BNRA 1BNJA 1BSDA 2F56A 3RNTA 1YGWA 1BRJA 1X1YA 1JBTA 1BRKA 1RCKA 1BSBA 1BRNL 1RDSA 1A2PA 5GSPA 1LOWA 4BU4A 1GOYA 1YNVX 1JBSA 1UCIA 1B2UA 9RNTA 3KCHA 2F5WA 3BIRA 1RN1A 1PYLA 1RGKA 1RGAA 1AQZA 2KF6A 1GOUA 1SARA 3AGOA 1GOVA 1YVSA 1BRSA 1FYSA 1RGHA 2KF4A 1B3SA 1BU4A 2KF3A 7GSPA 1I8VA 3HOHA 1C54A 3D5GA 1RGLA 2SARA 1BRHA 4RNTA 1I0VA 1BIRA 5BIRA 1B2SA 1DETA 3D4AA 1BRIA 5BU4A 1R4YA 1BSEA 1BVIA 1BSAA 1RSNA 2KF5A 2AADA 3AHSA 4HAAA 1BNSA 1MGRA 2BU4A 1UCKA 2KAAA 5HOHA 1LNIA 1TRQA 1UCLA 2C4BA 1CH0A 4GSPA 1JBRA 1UCJA 1FUTA 2RBIA 1LOYA 1BNFA 8RNTA 1RNBA 1TTOA 1BNEA 1AY7A 1I2GA 2HOHA 1I2EA 1MGWA 3DGYA 1B21A 4GHOA 1BGSA 5RNTA 3WR2A 1RGGA 1BOXA 1RGFA
chains in the Genus database with same CATH superfamily
4AKYA 3KZTA 3KN4A 1WQLB 3GAXA 3LTBA 1RGEA 1ASKA 2Z6BA 4N6TA 4RNZA 4I5QA 1QAKA 2F5MA 1JB2A 2W03A 4HBRA 1NWWA 2XF3A 3F7SA 2YFLB 3DUKA 2QGUA 2CFKA 1VQ43 2ML5A 1YGEA 3HI7A 1SQWA 3KFQC 2PNCA 4G1MB 5D82A 1ROVA 3DH2A 3SEDA 2ZA4A 2Z76A 1FUWA 5M18A 1O7WB 1RNTA 2F4YA 2C10A 4RBNA 3AHWA 1UW1A 3B4PA 4JRFA 1YVBI 2BMOB 2GSPA 3FSDA 2GBXB 1JJ22 1EQKA 1LRAA 3DZLA 3Q3FA 4NPBA 4STDA 3GSPA 2CWUA 8CHOA 3J7Yd 1M904 5IENA 3MPHA 1RJOA 1I3FA 1TJDA 2IMJA 4U13A 1S723 3EN1B 3LOYA 1X1WA 3PYJA 3B7CA 4CPKA 1W2B2 4EBGA 2QEX3 3U1WA 3BB9A 3CNXA 3F40A 3BU4A 2Z7AA 4AKZA 1G02A 3F9SA 1ZO2A 1YJ93 3D3LA 4LMIA 6RNTA 7STDA 4OVMA 5IG5A 3BLZA 1BNJA 5D83A 2CFDA 1ZS7A 3NX0A 4WFOA 3G4S3 2CFWA 4R1KA 1K41A 3NUVA 2GBWB 4H61A 3BNDA 3NQYA 3NV0A 3MWZA 3PS8A 2P38A 3FGYA 1RDSA 1BRNL 4BU4A 2YFIB 3FF0A 1CQSA 2INXA 4KZ1A 1UCIA 4MEIA 3JUOA 4HZBB 3KCHA 4LEHA 5IG0A 3DGMA 1RN1A 1E97A 2UUGC 3DGOA 5G1KA 1RGKA 1AVLA 1RGAA 3EBYA 3EB8A 3KSED 5IG4A 2W9QA 4N6V0 3CXC2 3UB1A 3OW22 3EN8A 2OCTA 1ISKA 3AGOA 1WNHA 2CIUA 3EQQB 1FYSA 5KP4A 1BU4A 2PZVA 1VQK3 4RNYA 3STDA 1N5PA 2MF7A 2ZHXB 3HK4A 5D81A 7GSPA 3CNMA 3HOHA 1C54A 5KP3A 1GY7A 3I0YA 3JUQA 3NM2A 3JUNA 1Q814 2CG0A 2SARA 1BRHA 1QVG2 5AIHA 1IV7A 2QIYA 2R41A 3D4AA 4O8SA 4MJDA 1R4YA 4R9KA 1F8NA 3SVAA 3G713 1BSEA 1BVIA 1YHQ3 1OHPA 2AADA 1MGRA 3E99A 4GB5A 2BU4A 2WOFA 3PCSA 5AYRB 3CCU3 1W6YA 1FGOA 2XFTA 1LNIA 5ELJA 3WA3A 1YJW3 1J2BA 5JBSA 4N3VA 5CXOA 4GSPA 1YI23 1GS3A 1TIJA 2LQVA 4BTWA 4K1UA 2RBIA 3ZG5A 1US1A 1MWUA 4OK0A 1OF5A 1KSIA 4N6OB 1VQN3 2BNGA 5M1AA 4K90B 5A0OB 3OX9A 4FCMA 1BNEA 1O7GB 1OUNA 1W4NA 5EEOA 1I2EA 1JRQA 2CKFB 3PGBA 5KP1A 3FG4A 3VSYA 3MG1A 2W56B 1RRHA 1STDA 4XBXA 1Q40A 3PCRA 3FG1A 3GWRA 2B1XB 1NDOB 2B24B 3T8UA 3ZG0A 1B27A 2GU1A 3K9MC 3B8LA 3K7CA 1BAOA 1IVVA 3NV0B 1RLSA 1STFI 2RNTA 1VQP3 3URPA 3CPW2 4ORLA 3LZAA 1ZX2A 1EG9B 4FR9A 2E2VA 2H0IA 4EW5A 2XFSA 1MWRA 1TRPA 1LQGC 4EV2A 1BUJA 1PU4A 1G0TA 2D1WA 2MC8A 1Q7HA 3EF8A 2JDIH 3ER7A 5IF6A 5JPPA 1N5HA 2HMNB 2K3DA 2BMRB 2HMMB 3DY5A 7RNTA 1X1UA 4FMCA 1PY3A 1U5OA 3X41A 4BTXA 3PZWA 3WA2X 5CF2A 6GSPA 4NHFA 1T2IA 1V58A 4O02B 1Q9EA 3I563 2HMKB 3DMCA 3V92A 4HM6B 4HM8B 1LXEA 2H0HA 3GZXB 1FUSA 2V1LA 1V74A 2R4IA 1N9EA 1GSPA 4L8OA 3RGAA 1I2FA 3UNLA 4FCJA 3IMAB 1I0XA 2CH9A 4Q53A 2BT3A 4HM5B 1MWTA 2F56A 1BSDA 3MHEA 1KD14 3BNCA 3KKGA 2XRXB 3QRDA 3CCJ3 4FMDA 3CC73 2L1SA 2F98A 1BRJA 1X1YA 2IYJA 2IUJA 3FLJA 5DREA 4LSOA 3LTCA 4J9AA 1C7HA 4HM0B 1CYUA 5AIFA 3D79A 1RRLA 4XDWA 1OF5B 1UI7A 3NXJA 2F5WA 1V57A 3G16A 3UL6A 1Q864 1DVDA 3LXUX 1QVF2 2XEPA 2KF6A 1NNVA 1N9JA 3F8XA 1Q40B 1YVSA 1GOVA 1BRSA 1RGHA 3FZWA 3M8CA 2ZDJA 2W56A 4O3VA 3HX8A 1I8VA 1VQM3 4LGQA 4ZM8A 2XH9A 1SJWA 2C11A 1I0VA 4WWUC 4JF8A 2E2UA 5AYSC 2WOHA 4O2HA 3V99A 5BU4A 1IK3A 2KF5A 1BSAA 1RSNA 1W6CA 1WMNA 3BNEA 1VQ83 2WO0A 1BNSA 3X3ZA 2W9PA 3N8BA 4IIAA 5HOHA 1L5GB 1Q7Y4 4K61A 4X2OA 3SXXA 1UCLA 2H0GA 1JB5A 1ULJB 1TUHA 1R4CA 3FF2A 3G8ZA 1NJI4 1AVKA 1OGXA 3H51A 1JN5A 1UGHI 2HMJB 1T5YA 2OTJ3 1KWIA 1UUGB 3DGNA 4MMYB 1DYUA 2K0MA 3O8YA 1I2GA 3H3HA 4FCZA 2Z77A 3G6E3 2O9UX 5BXQA 1B21A 2UGIA 4XBYA 3WDGB 5RNTA 3JVCA 3WR2A 3U97A 3A76A 6STDA 1RGGA 1QMAA 5AIIA 1BOXA 2Y74A 1I70A 3S67A 3MSOA 3OV4A 3X42A 1D6ZA 1RMSA 4MMXB 5FGOA 1DMMA 3OXAA 3LT9A 3AGNA 5IEOA 1TP6A 3FKAA 2CFLA 1GY5A 1VQO3 4J5GA 1HYFA 3DGLA 1FA3A 1A90A 2P05A 4LYLB 1ROAA 4J5KA 1W7CA 3N9HA 3EC9A 3CU3A 4FMBA 2CHCA 2OTL3 2W6JH 1FW7A 1SPUA 3ALAA 1W02A 1B2ZA 1I3IA 4HJLB 3QK9A 3UL5A 1JZDA 3I553 1OH0A 1B2MA 4DKIA 1RCLA 1A2KA 1GMQA 2BIRA 2QA43 2SBLA 2GEYA 3L0RA 2FNQA 4KFEA 1B2XA 2WGOA 3AMOA 3K63A 3VF1A 3MYTA 2HMOB 3NBRA 5IERA 2GU3A 3OWSA 4HM7B 2CG1A 3T0UA 1T2HA 2GXFA 3IJEB 3NHXA 4KFFA 2P0XA 3WODG 1RTUA 3LYGA 5HGRA 1RGCA 3SYUA 1FZUA 4CCVA 4IPBA 3X3YA 1KC84 1B20A 1O7MB 1LOVA 1RN4A 1VQ73 1BNRA 1IDPA 1W2ZA 1DMNA 1LOXA 2I9WA 4J8TA 3CCE3 1EA2A 2KRTA 1FGMA 3RNTA 1YGWA 1JNQA 4EC6A 1JBTA 3JUMA 2FGTA 2Y73A 1NU3A 4WHAA 1VQL3 1HKXA 1BSBA 5TGNA 5GSPA 1JN5B 3V98A 1LOWA 3WOFB 2Q07A 3EHCA 4HYZA 4BTYA 1YNVX 3S5CA 1B2UA 1AV4A 5G2GA 4AEQA 9RNTA 1E3VA 1OCVA 2BHMA 1K734 2KCDA 3HZPA 1Y4KA 3CCQ3 5ELUA 1IVUA 1HU9A 2YFJB 2RSXA 3RDEA 2OQEC 1RKYA 1OPYA 1GOUA 3CCM3 1M1XB 1TFKA 1PFPA 1TFOA 2HMLB 1B3SA 2XSOB 1Z1SA 4HM4B 4R4KA 5M19A 2BO9B 1SIIA 3MG2A 2W2CA 3HIIA 3CCL3 1IV9A 1Q42A 4N6UA 5AI1A 2ML6A 4KVHA 5CLKA 1B2SA 1DETA 3S27A 2RGQA 3Q90A 1BRIA 1GD4A 1DMQA 3AHSA 1TU5A 1K9M4 4MMZB 2KAAA 1UCKA 4EXRA 3CC23 1YJN3 2IY2A 3GZRA 1IU7A 3RGRA 3TDGA 3VGNA 5IG3A 1EEJA 1OHSA 1W01A 2C4BA 1JKGA 4R9LA 1JBRA 1UCJA 1IVWA 1JV2B 1UI8A 2F86B 1UUVB 3NBJA 3FG3A 2XSHB 5LC6A 1O7PB 3GZYB 2CW9A 4KT3B 2M7OA 2OOVA 2J8XB 3AMOB 3EX9A 1QAFA 4BL3A 3CCR3 1W00A 2CK3H 1AY7A 1G96A 3FH1A 2HOHA 2CC3A 1NB3I 1MGWA 2STDA 1S5AA 4GHOA 3N54B 1BGSA 5IEPA 4TX4A 1O7HB 3KSPA 2E2TA 3OWYA 3ZFZA 3CCS3 1GMPA 4HVNA 1HZ1A 3WOEB 3NQZA 2OQEA 1E3RA 4BIRA 1BANA 1YIJ3 1BNIA 3WHOA 3WMDA 2F99A 2CX0A 3LTDA 4KFDA 2UX0A 5FW5A 1RHLA 4EV5A 1IQ8A 2P09A 2XR8B 3DM8A 4N6NB 4QWTA 2W04A 4XDVA 4HKVB 5CK6A 1RN7A 1BRGA 2RCDA 3X3XA 3Q2PA 1BSCA 1N8R4 1AR0A 1QALA 4OUQA 4HZ9B 4L8PA 1IYYA 1Q824 4HM2B 4RZMA 3SOAA 1A2VA 1GMRA 2W0QA 3IPTA 4CJNA 2RFRA 4N6MA 1EUIC 1T3BA 1BNGA 3NBBA 3FCSB 5EVHA 3A5EA 1X1XA 3F14A 1CYVA 1JZOA 1D6UA 2O3OA 3CPOA 4LZIA 3CMA3 3KIIA 4N6LA 4WYKA 1IT7A 1K8A4 1M1K4 1LNHA 2ZL8A 3D5IA 4HOHA 3B4OA 5I97A 1VQ93 1ZGXA 2AAEA 3CD63 3GRDA 4XBTA 1YIT3 1DE3A 2CX1A 4ILFA 4CDLA 1VQ63 2KXGA 4X2HA 3OWUA 4WP5A 2JQ5A 3NM7A 5JPUA 5BVBA 5AEWB 1N8QA 1IVXA 1IT8A 3MKIA 1IQYA 3DXOA 2IUKA 1MNLA 2FXTA 3EJVA 1JKGB 1BRKA 1RCKA 2IA7A 1W6GA 3JUPA 2BMQB 1A2PA 1FGQA 1KQS2 3CC43 3BNBA 1GOYA 1GYBA 3GZBA 2A15A 4PEJA 1JBSA 1VQ53 2CWTA 4H3UA 3BIRA 3PXMA 3CME3 1MWSA 3UJMA 1FGRA 1PYLA 2P0MA 2CFGA 1LQMB 1D6YA 1AQZA 3S29A 5IW9A 1SARA 2L4VA 3LH4A 4HM3B 1MOLA 2KF4A 1NB5I 4R80A 1VZZA 1WTHA 2KF3A 2CWVA 3F8HA 1GD3A 3EBTA 4EYCA 3SLUA 1SIHA 1W5ZA 4GL6A 3D5GA 2K54A 1LVNA 2YX9A 3Q1CA 1RGLA 2D42A 3EE1A 3T8NA 1WMOA 1OACA 3MG3A 4RNTA 5DRVA 1UUWB 5BIRA 1BIRA 2OOVC 3S28A 5G1LA 4HM1B 1OGZA 1DVCA 3ECFA 5AIGA 1A67A 1UGIA 2GEXA 1M9GA 3K5TA 1O7NB 4HAAA 4I4KA 1U8CB 1CEWI 3HIGA 4XB5A 2LYXA 3D9RA 1EKMA 1ULIB 4NREA 5CF1A 1GY6A 1WMPA 1TRQA 3K0ZA 4K1VA 1VQQA 5LC7A 1CH0A 1UDII 1FUTA 3ROBA 1JB4A 4FMAA 5STDA 2XGLA 4WYKB 4XM4A 1LOYA 1FGTA 5AEUB 4L7KA 1BNFA 5EQLA 8RNTA 3LMLA 1RNBA 1BUQA 1TTOA 4BL2A 3X40A 3LT8A 2WGQA 3LTAA 1K28A 1IQXA 3KE7A 3SOYA 3DGYA 3F7XA 3SX1A 1NO3A 3G0KA 2XGNA 3CCV3 1OHOA 4IT7A 1RGFA 2OWPA 1QJGA
chains in the Genus database with same CATH topology
1GMPA 1HZ1A 4BIRA 1I70A 1BANA 1BNIA 1RGEA 3WHOA 1RMSA 1B27A 2F5MA 1RHLA 1BAOA 3AGNA 1RLSA 2RNTA 3URPA 4J5GA 1HYFA 1BRGA 1TRPA 1BSCA 1BUJA 3DH2A 1IYYA 2ZA4A 4J5KA 1RNTA 2F4YA 1GMRA 3AHWA 1FW7A 2GSPA 1BNGA 1B2ZA 1I3IA 7RNTA 1LRAA 3Q3FA 3A5EA 1X1XA 1X1UA 1B2MA 3GSPA 1RCLA 1PY3A 1GMQA 2BIRA 1I3FA 3D5IA 4HOHA 6GSPA 1T2IA 1ZGXA 2AAEA 1B2XA 1Q9EA 1X1WA 1DE3A 1FUSA 1GSPA 1T2HA 3BU4A 1G02A 1I2FA 1RTUA 1RGCA 3SYUA 1FZUA 1I0XA 6RNTA 1B20A 1LOVA 1RN4A 1BNRA 1BNJA 1BSDA 2F56A 3RNTA 1YGWA 1BRJA 1X1YA 1JBTA 1BRKA 1RCKA 1BSBA 1BRNL 1RDSA 1A2PA 5GSPA 1LOWA 4BU4A 1GOYA 1YNVX 1JBSA 1UCIA 1B2UA 9RNTA 3KCHA 2F5WA 3BIRA 1RN1A 1PYLA 1RGKA 1RGAA 1AQZA 2KF6A 1GOUA 1SARA 3AGOA 1GOVA 1YVSA 1BRSA 1FYSA 1RGHA 2KF4A 1B3SA 1BU4A 2KF3A 7GSPA 1I8VA 3HOHA 1C54A 3D5GA 1RGLA 2SARA 1BRHA 4RNTA 1I0VA 1BIRA 5BIRA 1B2SA 1DETA 3D4AA 1BRIA 5BU4A 1R4YA 1BSEA 1BVIA 1BSAA 1RSNA 2KF5A 2AADA 3AHSA 4HAAA 1BNSA 1MGRA 2BU4A 1UCKA 2KAAA 5HOHA 1LNIA 1TRQA 1UCLA 2C4BA 1CH0A 4GSPA 1JBRA 1UCJA 1FUTA 2RBIA 1LOYA 1BNFA 8RNTA 1RNBA 1TTOA 1BNEA 1AY7A 1I2GA 2HOHA 1I2EA 1MGWA 3DGYA 1B21A 4GHOA 1BGSA 5RNTA 3WR2A 1RGGA 1BOXA 1RGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMP A;  1HZ1 A;  4BIR A;  1I70 A;  1BAN A;  1BNI A;  1RGE A;  3WHO A;  1RMS A;  1B27 A;  2F5M A;  1RHL A;  1BAO A;  3AGN A;  1RLS A;  2RNT A;  3URP A;  4J5G A;  1HYF A;  1BRG A;  1TRP A;  1BSC A;  1BUJ A;  3DH2 A;  1IYY A;  2ZA4 A;  4J5K A;  1RNT A;  2F4Y A;  1GMR A;  3AHW A;  1FW7 A;  2GSP A;  1BNG A;  1B2Z A;  1I3I A;  7RNT A;  1LRA A;  3Q3F A;  3A5E A;  1X1X A;  1X1U A;  1B2M A;  3GSP A;  1RCL A;  1PY3 A;  1GMQ A;  2BIR A;  1I3F A;  3D5I A;  4HOH A;  6GSP A;  1T2I A;  1ZGX A;  2AAE A;  1B2X A;  1Q9E A;  1X1W A;  1DE3 A;  1FUS A;  1GSP A;  1T2H A;  3BU4 A;  1G02 A;  1I2F A;  1RTU A;  1RGC A;  3SYU A;  1FZU A;  1I0X A;  6RNT A;  1B20 A;  1LOV A;  1RN4 A;  1BNR A;  1BNJ A;  1BSD A;  2F56 A;  3RNT A;  1YGW A;  1BRJ A;  1X1Y A;  1JBT A;  1BRK A;  1RCK A;  1BSB A;  1BRN L;  1RDS A;  1A2P A;  5GSP A;  1LOW A;  4BU4 A;  1GOY A;  1YNV X;  1JBS A;  1UCI A;  1B2U A;  9RNT A;  3KCH A;  2F5W A;  3BIR A;  1RN1 A;  1PYL A;  1RGK A;  1RGA A;  1AQZ A;  2KF6 A;  1GOU A;  1SAR A;  3AGO A;  1GOV A;  1YVS A;  1BRS A;  1FYS A;  1RGH A;  2KF4 A;  1B3S A;  1BU4 A;  2KF3 A;  7GSP A;  1I8V A;  3HOH A;  1C54 A;  3D5G A;  1RGL A;  2SAR A;  1BRH A;  4RNT A;  1I0V A;  1BIR A;  5BIR A;  1B2S A;  1DET A;  3D4A A;  1BRI A;  5BU4 A;  1R4Y A;  1BSE A;  1BVI A;  1BSA A;  1RSN A;  2KF5 A;  2AAD A;  3AHS A;  4HAA A;  1BNS A;  1MGR A;  2BU4 A;  1UCK A;  2KAA A;  5HOH A;  1LNI A;  1TRQ A;  1UCL A;  2C4B A;  1CH0 A;  4GSP A;  1JBR A;  1UCJ A;  1FUT A;  2RBI A;  1LOY A;  1BNF A;  8RNT A;  1RNB A;  1TTO A;  1BNE A;  1AY7 A;  1I2G A;  2HOH A;  1I2E A;  1MGW A;  3DGY A;  1B21 A;  4GHO A;  1BGS A;  5RNT A;  3WR2 A;  1RGG A;  1BOX A;  1RGF A; 
#chains in the Genus database with same CATH topology
 4AKY A;  3KZT A;  3KN4 A;  1WQL B;  3GAX A;  3LTB A;  1RGE A;  1ASK A;  2Z6B A;  4N6T A;  4RNZ A;  4I5Q A;  1QAK A;  2F5M A;  1JB2 A;  2W03 A;  4HBR A;  1NWW A;  2XF3 A;  3F7S A;  2YFL B;  3DUK A;  2QGU A;  2CFK A;  1VQ4 3;  2ML5 A;  1YGE A;  3HI7 A;  1SQW A;  3KFQ C;  2PNC A;  4G1M B;  5D82 A;  1ROV A;  3DH2 A;  3SED A;  2ZA4 A;  2Z76 A;  1FUW A;  5M18 A;  1O7W B;  1RNT A;  2F4Y A;  2C10 A;  4RBN A;  3AHW A;  1UW1 A;  3B4P A;  4JRF A;  1YVB I;  2BMO B;  2GSP A;  3FSD A;  2GBX B;  1JJ2 2;  1EQK A;  1LRA A;  3DZL A;  3Q3F A;  4NPB A;  4STD A;  3GSP A;  2CWU A;  8CHO A;  3J7Y d;  1M90 4;  5IEN A;  3MPH A;  1RJO A;  1I3F A;  1TJD A;  2IMJ A;  4U13 A;  1S72 3;  3EN1 B;  3LOY A;  1X1W A;  3PYJ A;  3B7C A;  4CPK A;  1W2B 2;  4EBG A;  2QEX 3;  3U1W A;  3BB9 A;  3CNX A;  3F40 A;  3BU4 A;  2Z7A A;  4AKZ A;  1G02 A;  3F9S A;  1ZO2 A;  1YJ9 3;  3D3L A;  4LMI A;  6RNT A;  7STD A;  4OVM A;  5IG5 A;  3BLZ A;  1BNJ A;  5D83 A;  2CFD A;  1ZS7 A;  3NX0 A;  4WFO A;  3G4S 3;  2CFW A;  4R1K A;  1K41 A;  3NUV A;  2GBW B;  4H61 A;  3BND A;  3NQY A;  3NV0 A;  3MWZ A;  3PS8 A;  2P38 A;  3FGY A;  1RDS A;  1BRN L;  4BU4 A;  2YFI B;  3FF0 A;  1CQS A;  2INX A;  4KZ1 A;  1UCI A;  4MEI A;  3JUO A;  4HZB B;  3KCH A;  4LEH A;  5IG0 A;  3DGM A;  1RN1 A;  1E97 A;  2UUG C;  3DGO A;  5G1K A;  1RGK A;  1AVL A;  1RGA A;  3EBY A;  3EB8 A;  3KSE D;  5IG4 A;  2W9Q A;  4N6V 0;  3CXC 2;  3UB1 A;  3OW2 2;  3EN8 A;  2OCT A;  1ISK A;  3AGO A;  1WNH A;  2CIU A;  3EQQ B;  1FYS A;  5KP4 A;  1BU4 A;  2PZV A;  1VQK 3;  4RNY A;  3STD A;  1N5P A;  2MF7 A;  2ZHX B;  3HK4 A;  5D81 A;  7GSP A;  3CNM A;  3HOH A;  1C54 A;  5KP3 A;  1GY7 A;  3I0Y A;  3JUQ A;  3NM2 A;  3JUN A;  1Q81 4;  2CG0 A;  2SAR A;  1BRH A;  1QVG 2;  5AIH A;  1IV7 A;  2QIY A;  2R41 A;  3D4A A;  4O8S A;  4MJD A;  1R4Y A;  4R9K A;  1F8N A;  3SVA A;  3G71 3;  1BSE A;  1BVI A;  1YHQ 3;  1OHP A;  2AAD A;  1MGR A;  3E99 A;  4GB5 A;  2BU4 A;  2WOF A;  3PCS A;  5AYR B;  3CCU 3;  1W6Y A;  1FGO A;  2XFT A;  1LNI A;  5ELJ A;  3WA3 A;  1YJW 3;  1J2B A;  5JBS A;  4N3V A;  5CXO A;  4GSP A;  1YI2 3;  1GS3 A;  1TIJ A;  2LQV A;  4BTW A;  4K1U A;  2RBI A;  3ZG5 A;  1US1 A;  1MWU A;  4OK0 A;  1OF5 A;  1KSI A;  4N6O B;  1VQN 3;  2BNG A;  5M1A A;  4K90 B;  5A0O B;  3OX9 A;  4FCM A;  1BNE A;  1O7G B;  1OUN A;  1W4N A;  5EEO A;  1I2E A;  1JRQ A;  2CKF B;  3PGB A;  5KP1 A;  3FG4 A;  3VSY A;  3MG1 A;  2W56 B;  1RRH A;  1STD A;  4XBX A;  1Q40 A;  3PCR A;  3FG1 A;  3GWR A;  2B1X B;  1NDO B;  2B24 B;  3T8U A;  3ZG0 A;  1B27 A;  2GU1 A;  3K9M C;  3B8L A;  3K7C A;  1BAO A;  1IVV A;  3NV0 B;  1RLS A;  1STF I;  2RNT A;  1VQP 3;  3URP A;  3CPW 2;  4ORL A;  3LZA A;  1ZX2 A;  1EG9 B;  4FR9 A;  2E2V A;  2H0I A;  4EW5 A;  2XFS A;  1MWR A;  1TRP A;  1LQG C;  4EV2 A;  1BUJ A;  1PU4 A;  1G0T A;  2D1W A;  2MC8 A;  1Q7H A;  3EF8 A;  2JDI H;  3ER7 A;  5IF6 A;  5JPP A;  1N5H A;  2HMN B;  2K3D A;  2BMR B;  2HMM B;  3DY5 A;  7RNT A;  1X1U A;  4FMC A;  1PY3 A;  1U5O A;  3X41 A;  4BTX A;  3PZW A;  3WA2 X;  5CF2 A;  6GSP A;  4NHF A;  1T2I A;  1V58 A;  4O02 B;  1Q9E A;  3I56 3;  2HMK B;  3DMC A;  3V92 A;  4HM6 B;  4HM8 B;  1LXE A;  2H0H A;  3GZX B;  1FUS A;  2V1L A;  1V74 A;  2R4I A;  1N9E A;  1GSP A;  4L8O A;  3RGA A;  1I2F A;  3UNL A;  4FCJ A;  3IMA B;  1I0X A;  2CH9 A;  4Q53 A;  2BT3 A;  4HM5 B;  1MWT A;  2F56 A;  1BSD A;  3MHE A;  1KD1 4;  3BNC A;  3KKG A;  2XRX B;  3QRD A;  3CCJ 3;  4FMD A;  3CC7 3;  2L1S A;  2F98 A;  1BRJ A;  1X1Y A;  2IYJ A;  2IUJ A;  3FLJ A;  5DRE A;  4LSO A;  3LTC A;  4J9A A;  1C7H A;  4HM0 B;  1CYU A;  5AIF A;  3D79 A;  1RRL A;  4XDW A;  1OF5 B;  1UI7 A;  3NXJ A;  2F5W A;  1V57 A;  3G16 A;  3UL6 A;  1Q86 4;  1DVD A;  3LXU X;  1QVF 2;  2XEP A;  2KF6 A;  1NNV A;  1N9J A;  3F8X A;  1Q40 B;  1YVS A;  1GOV A;  1BRS A;  1RGH A;  3FZW A;  3M8C A;  2ZDJ A;  2W56 A;  4O3V A;  3HX8 A;  1I8V A;  1VQM 3;  4LGQ A;  4ZM8 A;  2XH9 A;  1SJW A;  2C11 A;  1I0V A;  4WWU C;  4JF8 A;  2E2U A;  5AYS C;  2WOH A;  4O2H A;  3V99 A;  5BU4 A;  1IK3 A;  2KF5 A;  1BSA A;  1RSN A;  1W6C A;  1WMN A;  3BNE A;  1VQ8 3;  2WO0 A;  1BNS A;  3X3Z A;  2W9P A;  3N8B A;  4IIA A;  5HOH A;  1L5G B;  1Q7Y 4;  4K61 A;  4X2O A;  3SXX A;  1UCL A;  2H0G A;  1JB5 A;  1ULJ B;  1TUH A;  1R4C A;  3FF2 A;  3G8Z A;  1NJI 4;  1AVK A;  1OGX A;  3H51 A;  1JN5 A;  1UGH I;  2HMJ B;  1T5Y A;  2OTJ 3;  1KWI A;  1UUG B;  3DGN A;  4MMY B;  1DYU A;  2K0M A;  3O8Y A;  1I2G A;  3H3H A;  4FCZ A;  2Z77 A;  3G6E 3;  2O9U X;  5BXQ A;  1B21 A;  2UGI A;  4XBY A;  3WDG B;  5RNT A;  3JVC A;  3WR2 A;  3U97 A;  3A76 A;  6STD A;  1RGG A;  1QMA A;  5AII A;  1BOX A;  2Y74 A;  1I70 A;  3S67 A;  3MSO A;  3OV4 A;  3X42 A;  1D6Z A;  1RMS A;  4MMX B;  5FGO A;  1DMM A;  3OXA A;  3LT9 A;  3AGN A;  5IEO A;  1TP6 A;  3FKA A;  2CFL A;  1GY5 A;  1VQO 3;  4J5G A;  1HYF A;  3DGL A;  1FA3 A;  1A90 A;  2P05 A;  4LYL B;  1ROA A;  4J5K A;  1W7C A;  3N9H A;  3EC9 A;  3CU3 A;  4FMB A;  2CHC A;  2OTL 3;  2W6J H;  1FW7 A;  1SPU A;  3ALA A;  1W02 A;  1B2Z A;  1I3I A;  4HJL B;  3QK9 A;  3UL5 A;  1JZD A;  3I55 3;  1OH0 A;  1B2M A;  4DKI A;  1RCL A;  1A2K A;  1GMQ A;  2BIR A;  2QA4 3;  2SBL A;  2GEY A;  3L0R A;  2FNQ A;  4KFE A;  1B2X A;  2WGO A;  3AMO A;  3K63 A;  3VF1 A;  3MYT A;  2HMO B;  3NBR A;  5IER A;  2GU3 A;  3OWS A;  4HM7 B;  2CG1 A;  3T0U A;  1T2H A;  2GXF A;  3IJE B;  3NHX A;  4KFF A;  2P0X A;  3WOD G;  1RTU A;  3LYG A;  5HGR A;  1RGC A;  3SYU A;  1FZU A;  4CCV A;  4IPB A;  3X3Y A;  1KC8 4;  1B20 A;  1O7M B;  1LOV A;  1RN4 A;  1VQ7 3;  1BNR A;  1IDP A;  1W2Z A;  1DMN A;  1LOX A;  2I9W A;  4J8T A;  3CCE 3;  1EA2 A;  2KRT A;  1FGM A;  3RNT A;  1YGW A;  1JNQ A;  4EC6 A;  1JBT A;  3JUM A;  2FGT A;  2Y73 A;  1NU3 A;  4WHA A;  1VQL 3;  1HKX A;  1BSB A;  5TGN A;  5GSP A;  1JN5 B;  3V98 A;  1LOW A;  3WOF B;  2Q07 A;  3EHC A;  4HYZ A;  4BTY A;  1YNV X;  3S5C A;  1B2U A;  1AV4 A;  5G2G A;  4AEQ A;  9RNT A;  1E3V A;  1OCV A;  2BHM A;  1K73 4;  2KCD A;  3HZP A;  1Y4K A;  3CCQ 3;  5ELU A;  1IVU A;  1HU9 A;  2YFJ B;  2RSX A;  3RDE A;  2OQE C;  1RKY A;  1OPY A;  1GOU A;  3CCM 3;  1M1X B;  1TFK A;  1PFP A;  1TFO A;  2HML B;  1B3S A;  2XSO B;  1Z1S A;  4HM4 B;  4R4K A;  5M19 A;  2BO9 B;  1SII A;  3MG2 A;  2W2C A;  3HII A;  3CCL 3;  1IV9 A;  1Q42 A;  4N6U A;  5AI1 A;  2ML6 A;  4KVH A;  5CLK A;  1B2S A;  1DET A;  3S27 A;  2RGQ A;  3Q90 A;  1BRI A;  1GD4 A;  1DMQ A;  3AHS A;  1TU5 A;  1K9M 4;  4MMZ B;  2KAA A;  1UCK A;  4EXR A;  3CC2 3;  1YJN 3;  2IY2 A;  3GZR A;  1IU7 A;  3RGR A;  3TDG A;  3VGN A;  5IG3 A;  1EEJ A;  1OHS A;  1W01 A;  2C4B A;  1JKG A;  4R9L A;  1JBR A;  1UCJ A;  1IVW A;  1JV2 B;  1UI8 A;  2F86 B;  1UUV B;  3NBJ A;  3FG3 A;  2XSH B;  5LC6 A;  1O7P B;  3GZY B;  2CW9 A;  4KT3 B;  2M7O A;  2OOV A;  2J8X B;  3AMO B;  3EX9 A;  1QAF A;  4BL3 A;  3CCR 3;  1W00 A;  2CK3 H;  1AY7 A;  1G96 A;  3FH1 A;  2HOH A;  2CC3 A;  1NB3 I;  1MGW A;  2STD A;  1S5A A;  4GHO A;  3N54 B;  1BGS A;  5IEP A;  4TX4 A;  1O7H B;  3KSP A;  2E2T A;  3OWY A;  3ZFZ A;  3CCS 3;  1GMP A;  4HVN A;  1HZ1 A;  3WOE B;  3NQZ A;  2OQE A;  1E3R A;  4BIR A;  1BAN A;  1YIJ 3;  1BNI A;  3WHO A;  3WMD A;  2F99 A;  2CX0 A;  3LTD A;  4KFD A;  2UX0 A;  5FW5 A;  1RHL A;  4EV5 A;  1IQ8 A;  2P09 A;  2XR8 B;  3DM8 A;  4N6N B;  4QWT A;  2W04 A;  4XDV A;  4HKV B;  5CK6 A;  1RN7 A;  1BRG A;  2RCD A;  3X3X A;  3Q2P A;  1BSC A;  1N8R 4;  1AR0 A;  1QAL A;  4OUQ A;  4HZ9 B;  4L8P A;  1IYY A;  1Q82 4;  4HM2 B;  4RZM A;  3SOA A;  1A2V A;  1GMR A;  2W0Q A;  3IPT A;  4CJN A;  2RFR A;  4N6M A;  1EUI C;  1T3B A;  1BNG A;  3NBB A;  3FCS B;  5EVH A;  3A5E A;  1X1X A;  3F14 A;  1CYV A;  1JZO A;  1D6U A;  2O3O A;  3CPO A;  4LZI A;  3CMA 3;  3KII A;  4N6L A;  4WYK A;  1IT7 A;  1K8A 4;  1M1K 4;  1LNH A;  2ZL8 A;  3D5I A;  4HOH A;  3B4O A;  5I97 A;  1VQ9 3;  1ZGX A;  2AAE A;  3CD6 3;  3GRD A;  4XBT A;  1YIT 3;  1DE3 A;  2CX1 A;  4ILF A;  4CDL A;  1VQ6 3;  2KXG A;  4X2H A;  3OWU A;  4WP5 A;  2JQ5 A;  3NM7 A;  5JPU A;  5BVB A;  5AEW B;  1N8Q A;  1IVX A;  1IT8 A;  3MKI A;  1IQY A;  3DXO A;  2IUK A;  1MNL A;  2FXT A;  3EJV A;  1JKG B;  1BRK A;  1RCK A;  2IA7 A;  1W6G A;  3JUP A;  2BMQ B;  1A2P A;  1FGQ A;  1KQS 2;  3CC4 3;  3BNB A;  1GOY A;  1GYB A;  3GZB A;  2A15 A;  4PEJ A;  1JBS A;  1VQ5 3;  2CWT A;  4H3U A;  3BIR A;  3PXM A;  3CME 3;  1MWS A;  3UJM A;  1FGR A;  1PYL A;  2P0M A;  2CFG A;  1LQM B;  1D6Y A;  1AQZ A;  3S29 A;  5IW9 A;  1SAR A;  2L4V A;  3LH4 A;  4HM3 B;  1MOL A;  2KF4 A;  1NB5 I;  4R80 A;  1VZZ A;  1WTH A;  2KF3 A;  2CWV A;  3F8H A;  1GD3 A;  3EBT A;  4EYC A;  3SLU A;  1SIH A;  1W5Z A;  4GL6 A;  3D5G A;  2K54 A;  1LVN A;  2YX9 A;  3Q1C A;  1RGL A;  2D42 A;  3EE1 A;  3T8N A;  1WMO A;  1OAC A;  3MG3 A;  4RNT A;  5DRV A;  1UUW B;  5BIR A;  1BIR A;  2OOV C;  3S28 A;  5G1L A;  4HM1 B;  1OGZ A;  1DVC A;  3ECF A;  5AIG A;  1A67 A;  1UGI A;  2GEX A;  1M9G A;  3K5T A;  1O7N B;  4HAA A;  4I4K A;  1U8C B;  1CEW I;  3HIG A;  4XB5 A;  2LYX A;  3D9R A;  1EKM A;  1ULI B;  4NRE A;  5CF1 A;  1GY6 A;  1WMP A;  1TRQ A;  3K0Z A;  4K1V A;  1VQQ A;  5LC7 A;  1CH0 A;  1UDI I;  1FUT A;  3ROB A;  1JB4 A;  4FMA A;  5STD A;  2XGL A;  4WYK B;  4XM4 A;  1LOY A;  1FGT A;  5AEU B;  4L7K A;  1BNF A;  5EQL A;  8RNT A;  3LML A;  1RNB A;  1BUQ A;  1TTO A;  4BL2 A;  3X40 A;  3LT8 A;  2WGQ A;  3LTA A;  1K28 A;  1IQX A;  3KE7 A;  3SOY A;  3DGY A;  3F7X A;  3SX1 A;  1NO3 A;  3G0K A;  2XGN A;  3CCV 3;  1OHO A;  4IT7 A;  1RGF A;  2OWP A;  1QJG A; 
#chains in the Genus database with same CATH homology
 1GMP A;  1HZ1 A;  4BIR A;  1I70 A;  1BAN A;  1BNI A;  1RGE A;  3WHO A;  1RMS A;  1B27 A;  2F5M A;  1RHL A;  1BAO A;  3AGN A;  1RLS A;  2RNT A;  3URP A;  4J5G A;  1HYF A;  1BRG A;  1TRP A;  1BSC A;  1BUJ A;  3DH2 A;  1IYY A;  2ZA4 A;  4J5K A;  1RNT A;  2F4Y A;  1GMR A;  3AHW A;  1FW7 A;  2GSP A;  1BNG A;  1B2Z A;  1I3I A;  7RNT A;  1LRA A;  3Q3F A;  3A5E A;  1X1X A;  1X1U A;  1B2M A;  3GSP A;  1RCL A;  1PY3 A;  1GMQ A;  2BIR A;  1I3F A;  3D5I A;  4HOH A;  6GSP A;  1T2I A;  1ZGX A;  2AAE A;  1B2X A;  1Q9E A;  1X1W A;  1DE3 A;  1FUS A;  1GSP A;  1T2H A;  3BU4 A;  1G02 A;  1I2F A;  1RTU A;  1RGC A;  3SYU A;  1FZU A;  1I0X A;  6RNT A;  1B20 A;  1LOV A;  1RN4 A;  1BNR A;  1BNJ A;  1BSD A;  2F56 A;  3RNT A;  1YGW A;  1BRJ A;  1X1Y A;  1JBT A;  1BRK A;  1RCK A;  1BSB A;  1BRN L;  1RDS A;  1A2P A;  5GSP A;  1LOW A;  4BU4 A;  1GOY A;  1YNV X;  1JBS A;  1UCI A;  1B2U A;  9RNT A;  3KCH A;  2F5W A;  3BIR A;  1RN1 A;  1PYL A;  1RGK A;  1RGA A;  1AQZ A;  2KF6 A;  1GOU A;  1SAR A;  3AGO A;  1GOV A;  1YVS A;  1BRS A;  1FYS A;  1RGH A;  2KF4 A;  1B3S A;  1BU4 A;  2KF3 A;  7GSP A;  1I8V A;  3HOH A;  1C54 A;  3D5G A;  1RGL A;  2SAR A;  1BRH A;  4RNT A;  1I0V A;  1BIR A;  5BIR A;  1B2S A;  1DET A;  3D4A A;  1BRI A;  5BU4 A;  1R4Y A;  1BSE A;  1BVI A;  1BSA A;  1RSN A;  2KF5 A;  2AAD A;  3AHS A;  4HAA A;  1BNS A;  1MGR A;  2BU4 A;  1UCK A;  2KAA A;  5HOH A;  1LNI A;  1TRQ A;  1UCL A;  2C4B A;  1CH0 A;  4GSP A;  1JBR A;  1UCJ A;  1FUT A;  2RBI A;  1LOY A;  1BNF A;  8RNT A;  1RNB A;  1TTO A;  1BNE A;  1AY7 A;  1I2G A;  2HOH A;  1I2E A;  1MGW A;  3DGY A;  1B21 A;  4GHO A;  1BGS A;  5RNT A;  3WR2 A;  1RGG A;  1BOX A;  1RGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...