1UCIA

Mutants of rnase sa
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
DTSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
publication title The contribution of polar group burial to protein stability is strongly context-dependent
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 23
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1uciA00
1BSCA 1GOYA 1RGAA 1B2SA 2F5MA 1FUTA 3Q3FA 1FUSA 1I70A 2RBIA 2AADA 5BIRA 7GSPA 3BIRA 1RDSA 1I8VA 4GHOA 1SARA 1GSPA 1RGFA 1BUJA 1I2FA 1RGCA 3GSPA 1AY7A 1JBSA 1BANA 1I0XA 1I2EA 2SARA 1HZ1A 4J5KA 1B2UA 1CH0A 1RTUA 2AAEA 2BU4A 1RLSA 1BOXA 4BU4A 1RNTA 3SYUA 1BIRA 1RMSA 1FW7A 4J5GA 1BRIA 1MGRA 3BU4A 3WR2A 1C54A 2KF6A 1FYSA 2KF4A 3DGYA 1BU4A 2KF5A 1BRNL 1Q9EA 4GSPA 1BNFA 1X1YA 5BU4A 1B2ZA 2F4YA 1DETA 4HAAA 1BAOA 1GMQA 1BSDA 2HOHA 5HOHA 1B21A 1BRKA 2F56A 1JBRA 1I3IA 1MGWA 1GOUA 2ZA4A 1G02A 8RNTA 1JBTA 1YNVX 1TRPA 3D4AA 1X1UA 5GSPA 1BVIA 1A2PA 1X1WA 5RNTA 3HOHA 4BIRA 2F5WA 1RGLA 6GSPA 1RGKA 1BNEA 2RNTA 3AHWA 1UCLA 3AGNA 2KAAA 1UCKA 1GMRA 1GOVA 1B20A 1TTOA 1LOWA 3D5GA 1RGEA 1BGSA 1BRSA 1RHLA 4RNTA 3KCHA 1B2MA 1RNBA 1R4YA 1RCKA 3AGOA 1RSNA 1BRJA 1YVSA 2C4BA 3URPA 1PY3A 1X1XA 1ZGXA 6RNTA 1UCIA 4HOHA 3AHSA 1BSBA 1BSAA 3A5EA 1YGWA 1T2HA 1B3SA 1LOYA 1I0VA 1HYFA 1RN4A 1LRAA 1FZUA 1GMPA 1DE3A 1UCJA 1BNIA 1BRGA 1AQZA 2GSPA 1LOVA 1BSEA 3D5IA 1T2IA 1RN1A 2KF3A 1PYLA 1LNIA 1BNGA 3DH2A 1I2GA 1RGHA 3WHOA 1B2XA 1BNSA 1B27A 7RNTA 1IYYA 1BNRA 2BIRA 1I3FA 1BRHA 1BNJA 1TRQA 1RCLA 9RNTA 3RNTA 1RGGA
chains in the Genus database with same CATH superfamily
2XH9A 4WFOA 1JJ22 3WA3A 1YIJ3 5IF6A 1RGAA 1IDPA 2GU1A 2OOVC 2L1SA 3MPHA 3Q3FA 1I70A 4J8TA 3KE7A 3X42A 4KVHA 4AKYA 1WTHA 2GEXA 7GSPA 1I8VA 1YJ93 5AIFA 4L8PA 3ECFA 4FMCA 3DM8A 2IYJA 2OWPA 5AIIA 1IVUA 3GSPA 3JUPA 1I0XA 1HZ1A 3FKAA 1JKGA 1B2UA 3EC9A 2AAEA 2E2VA 4EV5A 2BU4A 1MWUA 3UB1A 1Q824 2E2TA 2IA7A 3CME3 4BU4A 1RNTA 2CFGA 3EN1B 5DREA 1BIRA 3OW22 4WP5A 2P09A 2RFRA 1TFOA 4WWUC 4K90B 4J5GA 1FGMA 1BRIA 1JNQA 1MGRA 1QALA 3Q90A 4K1VA 5AYSC 2QEX3 1VQO3 1FYSA 2CHCA 3FZWA 1PFPA 1BU4A 1TUHA 2KF5A 3CD63 1D6YA 4N6UA 3ER7A 2Z76A 1X1YA 2K0MA 4I5QA 4IPBA 5HGRA 3HX8A 4HM0B 3CCQ3 1YGEA 4EV2A 4HAAA 3ZFZA 1GMQA 3TDGA 2B24B 3PCRA 1DYUA 4ORLA 3N9HA 2K3DA 2HMJB 1OUNA 2MF7A 4WHAA 3FG1A 1MGWA 1W7CA 1EUIC 2L4VA 4LEHA 3T8NA 3IPTA 3U97A 4BTYA 8RNTA 1PU4A 1Q7Y4 1KQS2 3BNCA 4KZ1A 1YJW3 1IVVA 4TX4A 5GSPA 3LMLA 5IG5A 1QJGA 1V58A 3NXJA 1A90A 1V74A 3DMCA 3M8CA 3RDEA 4KFDA 3G713 3WDGB 4J9AA 2M7OA 1STFI 1JB2A 2Z7AA 3K5TA 2F99A 1IVXA 3AHWA 1UCLA 3AGNA 5TGNA 2Q07A 3X41A 1VQ73 3HZPA 3MG3A 2CH9A 3VSYA 2V1LA 1UGIA 3EE1A 1K41A 3PGBA 1BRSA 1RHLA 3KCHA 1IT7A 2YFIB 1RCKA 3AGOA 2R4IA 2UGIA 3OV4A 2HMNB 4R9KA 5JBSA 3G4S3 1N9JA 3URPA 4Q53A 1PY3A 3NX0A 3LH4A 2WGQA 3AHSA 1LQGC 1W5ZA 1N8QA 2BMOB 3DUKA 5D83A 1YGWA 4QWTA 4HM2B 3PYJA 2XSHB 3GRDA 1UGHI 1QVF2 4NPBA 2W56A 2BHMA 1VQ63 1O7GB 3B4OA 5FGOA 2QA43 3LZAA 2CC3A 1OCVA 1QAKA 1Q814 2GBXB 1STDA 3QRDA 4H3UA 3D5IA 1T2IA 1LNHA 1RN1A 2I9WA 1RN7A 1LXEA 2BO9B 3UJMA 3WHOA 1B2XA 5IENA 2SBLA 1IYYA 4HBRA 3IMAB 3NBBA 3CMA3 2OTJ3 1YI23 2K54A 1WMPA 1TRQA 3NQZA 2GEYA 1CYVA 1O7WB 9RNTA 4PEJA 3D9RA 1U5OA 1ISKA 3MKIA 1J2BA 2BMQB 3CCL3 4XBYA 3K63A 1RRLA 4FR9A 4L8OA 1B2SA 4RZMA 1FGOA 4IT7A 3SX1A 1FUTA 1OF5A 2W9PA 4N6LA 3F7XA 4LMIA 2RBIA 3NV0A 1K8A4 3S28A 2PZVA 5FW5A 3X3YA 4N6V0 1MWTA 1SARA 5LC7A 2E2UA 3CC73 1GSPA 1KSIA 2CK3H 2LQVA 1E97A 1RGFA 3GZRA 2JDIH 1QMAA 4NHFA 2D1WA 3EF8A 2HMKB 4KFFA 2GU3A 4XDVA 2SARA 1L5GB 5KP1A 4STDA 4J5KA 3DGNA 1CH0A 3SXXA 1D6ZA 1RTUA 5G2GA 5CF2A 1RLSA 4HJLB 1CYUA 3CNXA 3JUNA 3CCU3 1A2KA 5G1LA 2WGOA 4L7KA 4OK0A 1OACA 3SYUA 3B7CA 5IEPA 1FGRA 1FW7A 3WR2A 2C10A 1C54A 1U8CB 2WO0A 2RGQA 3CPW2 1O7PB 2KF6A 1F8NA 1IV7A 3DGYA 1EKMA 3MWZA 3S29A 3NUVA 1W6GA 1GY5A 1NDOB 3KKGA 1Q9EA 3O8YA 4FCMA 4GSPA 3QK9A 5BU4A 3DY5A 5JPPA 1W6CA 1DMMA 1N5PA 2Z77A 3DGMA 2O3OA 3FG4A 3K7CA 4R9LA 3D79A 4CJNA 2A15A 2CFWA 2KRTA 4HZBB 1MWRA 3NBRA 5CLKA 3SOAA 2OQEA 2XEPA 1GOUA 1EQKA 1IQ8A 2ZA4A 3G8ZA 2CKFB 1JBTA 5CK6A 4G1MB 1YNVX 1TRPA 4FMDA 4O2HA 3D4AA 1IT8A 3CPOA 5BVBA 2CFLA 3KN4A 4GB5A 2CX1A 2XFTA 5RNTA 4XBXA 4DKIA 1UW1A 1S723 4R1KA 1KWIA 3MHEA 1A67A 1BNEA 1RJOA 1N5HA 5AEWB 1DMQA 1WNHA 4EW5A 3T8UA 4HM7B 4BTXA 3EJVA 1VQM3 1B20A 1LOWA 1ROAA 5DRVA 3PCSA 1RGEA 3ZG0A 2H0IA 3KSED 3F14A 2XRXB 7STDA 1RNBA 3BNEA 5AEUB 1WQLB 2CX0A 1EA2A 3CNMA 1MWSA 1BRJA 2C4BA 3JUQA 1Q40A 1M904 1UCIA 1BSBA 2ML5A 3NM7A 3F8XA 1T2HA 1B3SA 1JN5B 5AIHA 1RN4A 5D82A 1W2B2 1KC84 3KSPA 3PS8A 1EEJA 1DE3A 4WYKB 3GZYB 1NB3I 1QVG2 3EHCA 4LYLB 3HK4A 3JUOA 1GY6A 3KFQC 1QAFA 1LOVA 1BSEA 2CW9A 2OOVA 1OPYA 1CQSA 2UUGC 1LNIA 2JQ5A 3AMOA 1FGQA 3ROBA 1AV4A 3EBYA 1T5YA 1RGHA 4HZ9B 7RNTA 3CCV3 1ZS7A 2STDA 2O9UX 3SVAA 4X2HA 5M19A 1RCLA 3HIGA 1VQ53 1DVDA 2CWVA 4FCJA 1BUQA 1T3BA 4HM3B 2BMRB 1TIJA 1V57A 4N3VA 4U13A 5EVHA 3T0UA 1BSCA 5EQLA 3RGRA 3OXAA 3F8HA 5M1AA 4GL6A 1JRQA 2FGTA 2AADA 5BIRA 1E3RA 3FSDA 5STDA 3S67A 2PNCA 3DXOA 5EEOA 3STDA 3G6E3 3CCM3 2C11A 3A76A 1VQN3 1VQK3 2W0QA 4R4KA 1BUJA 3UL5A 1YVBI 3VGNA 1JKGB 1RGCA 2FXTA 1AY7A 1JBSA 1I2EA 1NO3A 3I0YA 1R4CA 2P0MA 3CU3A 4BTWA 5IG3A 1TP6A 3B8LA 1BOXA 5M18A 1M1XB 1RMSA 1M1K4 4XB5A 3ALAA 3WOFB 1Q864 2CIUA 1D6UA 2W2CA 2D42A 3FF2A 3X3XA 2CWTA 1IV9A 3X40A 1UUGB 5IG0A 2F4YA 3NBJA 3HIIA 1WMNA 1MNLA 3LTBA 3N54B 2UX0A 1DETA 4LZIA 1KD14 1BAOA 1UUVB 1BSDA 2OCTA 3V98A 6STDA 2CG0A 1K734 1BRKA 2F56A 1JBRA 1M9GA 4O02B 1OHSA 4MMZB 1G02A 5AIGA 2W03A 4EC6A 1ULJB 1W2ZA 1JB4A 1X1UA 4XM4A 1VQL3 5AI1A 1BVIA 1GS3A 4BL3A 1JN5A 2CWUA 2XF3A 1Q42A 2CG1A 2W9QA 3HOHA 4N6MA 4AEQA 5A0OB 1AR0A 4MEIA 2F5WA 5G1KA 3WODG 4CDLA 3BNBA 2RNTA 3HI7A 1FA3A 3EBTA 3CCR3 1TJDA 2KAAA 4HYZA 4MMXB 1HU9A 1UCKA 1GMRA 3VF1A 2ZHXB 4HM5B 1C7HA 1TTOA 1LVNA 3SLUA 4NREA 1O7HB 4LSOA 2IY2A 3GAXA 2P05A 4RNZA 1FUWA 1VQ93 2QGUA 3GZXB 2ZL8A 1US1A 5IW9A 1X1XA 1ZGXA 3FLJA 4XDWA 3V99A 2W04A 3UL6A 5KP3A 2BNGA 4HM4B 2W56B 1OGZA 3EB8A 1LOYA 1IQXA 1HYFA 2IMJA 4KT3B 1NJI4 1LRAA 2QIYA 2CFKA 4K1UA 1GMPA 2XSOB 1JZOA 4KFEA 2RCDA 2IUKA 1UCJA 3FG3A 4HM8B 1NNVA 1BNIA 4EBGA 5CF1A 1BRGA 2GSPA 3JVCA 4OVMA 2W6JH 1AVKA 1GD3A 2B1XB 3WA2X 2F86B 1PYLA 3CCS3 2KCDA 3WOEB 1ULIB 1BNGA 3I553 1LOXA 3I563 3EN8A 1I2GA 8CHOA 4FMAA 2XR8B 3J7Yd 3LYGA 1JZDA 3BB9A 3OX9A 1A2VA 1SQWA 2KXGA 3D3LA 3H3HA 4BL2A 2HMOB 2BT3A 1I3FA 2XGLA 1OH0A 1BRHA 2F98A 1BNJA 1YHQ3 2XGNA 1NB5I 3SEDA 2R41A 3RNTA 1K9M4 3MSOA 1RGGA 1ASKA 5IERA 1OF5B 1W4NA 1E3VA 1GOYA 1DVCA 3IJEB 2F5MA 3NHXA 3NV0B 3BNDA 1FUSA 1W02A 3BLZA 3FF0A 2XFSA 4H61A 1IU7A 1W00A 3BIRA 4FCZA 1GYBA 3NM2A 5D81A 3SOYA 5BXQA 1RDSA 2ZDJA 4GHOA 3NQYA 4ZM8A 3LXUX 1I2FA 1W01A 1Z1SA 5IG4A 3FCSB 1BANA 3LTCA 1HKXA 5IEOA 2YFLB 3LTAA 3F40A 2WOFA 1Y4KA 3N8BA 4AKZA 3OWYA 1UDII 3Q1CA 1SIIA 2H0HA 3BU4A 3K0ZA 1IVWA 1UI8A 3KZTA 2KF4A 1VZZA 2YX9A 3MYTA 3PZWA 4N6TA 4X2OA 1SIHA 3K9MC 1BRNL 1ROVA 2INXA 1W6YA 1IK3A 1BNFA 1S5AA 3LTDA 3U1WA 1SJWA 1B2ZA 3LT9A 1O7MB 1ZO2A 1ZX2A 5HOHA 2HOHA 1YIT3 1B21A 3G16A 1MOLA 5CXOA 5ELUA 1I3IA 3EQQB 1YJN3 4JF8A 1WMOA 4MJDA 4JRFA 4HVNA 3CXC2 3B4PA 1TU5A 2HMLB 2ML6A 1GY7A 1VQ83 4CPKA 3DZLA 3UNLA 4K61A 1OGXA 1RKYA 1A2PA 4XBTA 1X1WA 3MG2A 2CFDA 1VQP3 2Y74A 3S27A 4BIRA 2MC8A 1UUWB 1RGLA 6GSPA 1RGKA 3EX9A 3CCJ3 1AVLA 2H0GA 3X3ZA 1NWWA 2FNQA 4HM6B 2OQEC 1O7NB 1GOVA 3PXMA 4O8SA 3OWUA 1CEWI 3D5GA 4OUQA 1JV2B 1BGSA 3FH1A 1GD4A 3E99A 2GBWB 4RNTA 1R4YA 4EXRA 1B2MA 1Q40B 2IUJA 3MG1A 2RSXA 1K28A 1RSNA 3DGLA 3WMDA 1N8R4 1YVSA 3KIIA 1EG9B 2P0XA 3FGYA 1VQQA 6RNTA 4HOHA 3RGAA 5KP4A 1Q7HA 1BSAA 4CCVA 1TFKA 2LYXA 3A5EA 2P38A 1OHOA 4O3VA 1FGTA 4R80A 1I0VA 3CC23 4HKVB 4EYCA 3ZG5A 3CC43 3V92A 1FZUA 3F7SA 3H51A 5ELJA 1RRHA 3JUMA 5I97A 3F9SA 2Z6BA 3OWSA 3GWRA 1AQZA 4N6NB 4WYKA 1SPUA 3AMOB 4N6OB 2Y73A 2OTL3 5JPUA 2KF3A 3G0KA 1NU3A 5AYRB 3DH2A 1OHPA 4ILFA 1VQ43 2J8XB 3DGOA 3Q2PA 3S5CA 3L0RA 1BNSA 1B27A 1G96A 4FMBA 1BNRA 2BIRA 4RNYA 1DMNA 4LGQA 3LOYA 4RBNA 3LT8A 1JB5A 4I4KA 1IQYA 2HMMB 4HM1B 4MMYB 1G0TA 2GXFA 2YFJB 4IIAA 5LC6A 3GZBA 3CCE3 1LQMB 2WOHA 1N9EA 1UI7A
chains in the Genus database with same CATH topology
1BSCA 1GOYA 1RGAA 1B2SA 2F5MA 1FUTA 3Q3FA 1FUSA 1I70A 2RBIA 2AADA 5BIRA 7GSPA 3BIRA 1RDSA 1I8VA 4GHOA 1SARA 1GSPA 1RGFA 1BUJA 1I2FA 1RGCA 3GSPA 1AY7A 1JBSA 1BANA 1I0XA 1I2EA 2SARA 1HZ1A 4J5KA 1B2UA 1CH0A 1RTUA 2AAEA 2BU4A 1RLSA 1BOXA 4BU4A 1RNTA 3SYUA 1BIRA 1RMSA 1FW7A 4J5GA 1BRIA 1MGRA 3BU4A 3WR2A 1C54A 2KF6A 1FYSA 2KF4A 3DGYA 1BU4A 2KF5A 1BRNL 1Q9EA 4GSPA 1BNFA 1X1YA 5BU4A 1B2ZA 2F4YA 1DETA 4HAAA 1BAOA 1GMQA 1BSDA 2HOHA 5HOHA 1B21A 1BRKA 2F56A 1JBRA 1I3IA 1MGWA 1GOUA 2ZA4A 1G02A 8RNTA 1JBTA 1YNVX 1TRPA 3D4AA 1X1UA 5GSPA 1BVIA 1A2PA 1X1WA 5RNTA 3HOHA 4BIRA 2F5WA 1RGLA 6GSPA 1RGKA 1BNEA 2RNTA 3AHWA 1UCLA 3AGNA 2KAAA 1UCKA 1GMRA 1GOVA 1B20A 1TTOA 1LOWA 3D5GA 1RGEA 1BGSA 1BRSA 1RHLA 4RNTA 3KCHA 1B2MA 1RNBA 1R4YA 1RCKA 3AGOA 1RSNA 1BRJA 1YVSA 2C4BA 3URPA 1PY3A 1X1XA 1ZGXA 6RNTA 1UCIA 4HOHA 3AHSA 1BSBA 1BSAA 3A5EA 1YGWA 1T2HA 1B3SA 1LOYA 1I0VA 1HYFA 1RN4A 1LRAA 1FZUA 1GMPA 1DE3A 1UCJA 1BNIA 1BRGA 1AQZA 2GSPA 1LOVA 1BSEA 3D5IA 1T2IA 1RN1A 2KF3A 1PYLA 1LNIA 1BNGA 3DH2A 1I2GA 1RGHA 3WHOA 1B2XA 1BNSA 1B27A 7RNTA 1IYYA 1BNRA 2BIRA 1I3FA 1BRHA 1BNJA 1TRQA 1RCLA 9RNTA 3RNTA 1RGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSC A;  1GOY A;  1RGA A;  1B2S A;  2F5M A;  1FUT A;  3Q3F A;  1FUS A;  1I70 A;  2RBI A;  2AAD A;  5BIR A;  7GSP A;  3BIR A;  1RDS A;  1I8V A;  4GHO A;  1SAR A;  1GSP A;  1RGF A;  1BUJ A;  1I2F A;  1RGC A;  3GSP A;  1AY7 A;  1JBS A;  1BAN A;  1I0X A;  1I2E A;  2SAR A;  1HZ1 A;  4J5K A;  1B2U A;  1CH0 A;  1RTU A;  2AAE A;  2BU4 A;  1RLS A;  1BOX A;  4BU4 A;  1RNT A;  3SYU A;  1BIR A;  1RMS A;  1FW7 A;  4J5G A;  1BRI A;  1MGR A;  3BU4 A;  3WR2 A;  1C54 A;  2KF6 A;  1FYS A;  2KF4 A;  3DGY A;  1BU4 A;  2KF5 A;  1BRN L;  1Q9E A;  4GSP A;  1BNF A;  1X1Y A;  5BU4 A;  1B2Z A;  2F4Y A;  1DET A;  4HAA A;  1BAO A;  1GMQ A;  1BSD A;  2HOH A;  5HOH A;  1B21 A;  1BRK A;  2F56 A;  1JBR A;  1I3I A;  1MGW A;  1GOU A;  2ZA4 A;  1G02 A;  8RNT A;  1JBT A;  1YNV X;  1TRP A;  3D4A A;  1X1U A;  5GSP A;  1BVI A;  1A2P A;  1X1W A;  5RNT A;  3HOH A;  4BIR A;  2F5W A;  1RGL A;  6GSP A;  1RGK A;  1BNE A;  2RNT A;  3AHW A;  1UCL A;  3AGN A;  2KAA A;  1UCK A;  1GMR A;  1GOV A;  1B20 A;  1TTO A;  1LOW A;  3D5G A;  1RGE A;  1BGS A;  1BRS A;  1RHL A;  4RNT A;  3KCH A;  1B2M A;  1RNB A;  1R4Y A;  1RCK A;  3AGO A;  1RSN A;  1BRJ A;  1YVS A;  2C4B A;  3URP A;  1PY3 A;  1X1X A;  1ZGX A;  6RNT A;  1UCI A;  4HOH A;  3AHS A;  1BSB A;  1BSA A;  3A5E A;  1YGW A;  1T2H A;  1B3S A;  1LOY A;  1I0V A;  1HYF A;  1RN4 A;  1LRA A;  1FZU A;  1GMP A;  1DE3 A;  1UCJ A;  1BNI A;  1BRG A;  1AQZ A;  2GSP A;  1LOV A;  1BSE A;  3D5I A;  1T2I A;  1RN1 A;  2KF3 A;  1PYL A;  1LNI A;  1BNG A;  3DH2 A;  1I2G A;  1RGH A;  3WHO A;  1B2X A;  1BNS A;  1B27 A;  7RNT A;  1IYY A;  1BNR A;  2BIR A;  1I3F A;  1BRH A;  1BNJ A;  1TRQ A;  1RCL A;  9RNT A;  3RNT A;  1RGG A; 
#chains in the Genus database with same CATH topology
 2XH9 A;  4WFO A;  1JJ2 2;  3WA3 A;  1YIJ 3;  5IF6 A;  1RGA A;  1IDP A;  2GU1 A;  2OOV C;  2L1S A;  3MPH A;  3Q3F A;  1I70 A;  4J8T A;  3KE7 A;  3X42 A;  4KVH A;  4AKY A;  1WTH A;  2GEX A;  7GSP A;  1I8V A;  1YJ9 3;  5AIF A;  4L8P A;  3ECF A;  4FMC A;  3DM8 A;  2IYJ A;  2OWP A;  5AII A;  1IVU A;  3GSP A;  3JUP A;  1I0X A;  1HZ1 A;  3FKA A;  1JKG A;  1B2U A;  3EC9 A;  2AAE A;  2E2V A;  4EV5 A;  2BU4 A;  1MWU A;  3UB1 A;  1Q82 4;  2E2T A;  2IA7 A;  3CME 3;  4BU4 A;  1RNT A;  2CFG A;  3EN1 B;  5DRE A;  1BIR A;  3OW2 2;  4WP5 A;  2P09 A;  2RFR A;  1TFO A;  4WWU C;  4K90 B;  4J5G A;  1FGM A;  1BRI A;  1JNQ A;  1MGR A;  1QAL A;  3Q90 A;  4K1V A;  5AYS C;  2QEX 3;  1VQO 3;  1FYS A;  2CHC A;  3FZW A;  1PFP A;  1BU4 A;  1TUH A;  2KF5 A;  3CD6 3;  1D6Y A;  4N6U A;  3ER7 A;  2Z76 A;  1X1Y A;  2K0M A;  4I5Q A;  4IPB A;  5HGR A;  3HX8 A;  4HM0 B;  3CCQ 3;  1YGE A;  4EV2 A;  4HAA A;  3ZFZ A;  1GMQ A;  3TDG A;  2B24 B;  3PCR A;  1DYU A;  4ORL A;  3N9H A;  2K3D A;  2HMJ B;  1OUN A;  2MF7 A;  4WHA A;  3FG1 A;  1MGW A;  1W7C A;  1EUI C;  2L4V A;  4LEH A;  3T8N A;  3IPT A;  3U97 A;  4BTY A;  8RNT A;  1PU4 A;  1Q7Y 4;  1KQS 2;  3BNC A;  4KZ1 A;  1YJW 3;  1IVV A;  4TX4 A;  5GSP A;  3LML A;  5IG5 A;  1QJG A;  1V58 A;  3NXJ A;  1A90 A;  1V74 A;  3DMC A;  3M8C A;  3RDE A;  4KFD A;  3G71 3;  3WDG B;  4J9A A;  2M7O A;  1STF I;  1JB2 A;  2Z7A A;  3K5T A;  2F99 A;  1IVX A;  3AHW A;  1UCL A;  3AGN A;  5TGN A;  2Q07 A;  3X41 A;  1VQ7 3;  3HZP A;  3MG3 A;  2CH9 A;  3VSY A;  2V1L A;  1UGI A;  3EE1 A;  1K41 A;  3PGB A;  1BRS A;  1RHL A;  3KCH A;  1IT7 A;  2YFI B;  1RCK A;  3AGO A;  2R4I A;  2UGI A;  3OV4 A;  2HMN B;  4R9K A;  5JBS A;  3G4S 3;  1N9J A;  3URP A;  4Q53 A;  1PY3 A;  3NX0 A;  3LH4 A;  2WGQ A;  3AHS A;  1LQG C;  1W5Z A;  1N8Q A;  2BMO B;  3DUK A;  5D83 A;  1YGW A;  4QWT A;  4HM2 B;  3PYJ A;  2XSH B;  3GRD A;  1UGH I;  1QVF 2;  4NPB A;  2W56 A;  2BHM A;  1VQ6 3;  1O7G B;  3B4O A;  5FGO A;  2QA4 3;  3LZA A;  2CC3 A;  1OCV A;  1QAK A;  1Q81 4;  2GBX B;  1STD A;  3QRD A;  4H3U A;  3D5I A;  1T2I A;  1LNH A;  1RN1 A;  2I9W A;  1RN7 A;  1LXE A;  2BO9 B;  3UJM A;  3WHO A;  1B2X A;  5IEN A;  2SBL A;  1IYY A;  4HBR A;  3IMA B;  3NBB A;  3CMA 3;  2OTJ 3;  1YI2 3;  2K54 A;  1WMP A;  1TRQ A;  3NQZ A;  2GEY A;  1CYV A;  1O7W B;  9RNT A;  4PEJ A;  3D9R A;  1U5O A;  1ISK A;  3MKI A;  1J2B A;  2BMQ B;  3CCL 3;  4XBY A;  3K63 A;  1RRL A;  4FR9 A;  4L8O A;  1B2S A;  4RZM A;  1FGO A;  4IT7 A;  3SX1 A;  1FUT A;  1OF5 A;  2W9P A;  4N6L A;  3F7X A;  4LMI A;  2RBI A;  3NV0 A;  1K8A 4;  3S28 A;  2PZV A;  5FW5 A;  3X3Y A;  4N6V 0;  1MWT A;  1SAR A;  5LC7 A;  2E2U A;  3CC7 3;  1GSP A;  1KSI A;  2CK3 H;  2LQV A;  1E97 A;  1RGF A;  3GZR A;  2JDI H;  1QMA A;  4NHF A;  2D1W A;  3EF8 A;  2HMK B;  4KFF A;  2GU3 A;  4XDV A;  2SAR A;  1L5G B;  5KP1 A;  4STD A;  4J5K A;  3DGN A;  1CH0 A;  3SXX A;  1D6Z A;  1RTU A;  5G2G A;  5CF2 A;  1RLS A;  4HJL B;  1CYU A;  3CNX A;  3JUN A;  3CCU 3;  1A2K A;  5G1L A;  2WGO A;  4L7K A;  4OK0 A;  1OAC A;  3SYU A;  3B7C A;  5IEP A;  1FGR A;  1FW7 A;  3WR2 A;  2C10 A;  1C54 A;  1U8C B;  2WO0 A;  2RGQ A;  3CPW 2;  1O7P B;  2KF6 A;  1F8N A;  1IV7 A;  3DGY A;  1EKM A;  3MWZ A;  3S29 A;  3NUV A;  1W6G A;  1GY5 A;  1NDO B;  3KKG A;  1Q9E A;  3O8Y A;  4FCM A;  4GSP A;  3QK9 A;  5BU4 A;  3DY5 A;  5JPP A;  1W6C A;  1DMM A;  1N5P A;  2Z77 A;  3DGM A;  2O3O A;  3FG4 A;  3K7C A;  4R9L A;  3D79 A;  4CJN A;  2A15 A;  2CFW A;  2KRT A;  4HZB B;  1MWR A;  3NBR A;  5CLK A;  3SOA A;  2OQE A;  2XEP A;  1GOU A;  1EQK A;  1IQ8 A;  2ZA4 A;  3G8Z A;  2CKF B;  1JBT A;  5CK6 A;  4G1M B;  1YNV X;  1TRP A;  4FMD A;  4O2H A;  3D4A A;  1IT8 A;  3CPO A;  5BVB A;  2CFL A;  3KN4 A;  4GB5 A;  2CX1 A;  2XFT A;  5RNT A;  4XBX A;  4DKI A;  1UW1 A;  1S72 3;  4R1K A;  1KWI A;  3MHE A;  1A67 A;  1BNE A;  1RJO A;  1N5H A;  5AEW B;  1DMQ A;  1WNH A;  4EW5 A;  3T8U A;  4HM7 B;  4BTX A;  3EJV A;  1VQM 3;  1B20 A;  1LOW A;  1ROA A;  5DRV A;  3PCS A;  1RGE A;  3ZG0 A;  2H0I A;  3KSE D;  3F14 A;  2XRX B;  7STD A;  1RNB A;  3BNE A;  5AEU B;  1WQL B;  2CX0 A;  1EA2 A;  3CNM A;  1MWS A;  1BRJ A;  2C4B A;  3JUQ A;  1Q40 A;  1M90 4;  1UCI A;  1BSB A;  2ML5 A;  3NM7 A;  3F8X A;  1T2H A;  1B3S A;  1JN5 B;  5AIH A;  1RN4 A;  5D82 A;  1W2B 2;  1KC8 4;  3KSP A;  3PS8 A;  1EEJ A;  1DE3 A;  4WYK B;  3GZY B;  1NB3 I;  1QVG 2;  3EHC A;  4LYL B;  3HK4 A;  3JUO A;  1GY6 A;  3KFQ C;  1QAF A;  1LOV A;  1BSE A;  2CW9 A;  2OOV A;  1OPY A;  1CQS A;  2UUG C;  1LNI A;  2JQ5 A;  3AMO A;  1FGQ A;  3ROB A;  1AV4 A;  3EBY A;  1T5Y A;  1RGH A;  4HZ9 B;  7RNT A;  3CCV 3;  1ZS7 A;  2STD A;  2O9U X;  3SVA A;  4X2H A;  5M19 A;  1RCL A;  3HIG A;  1VQ5 3;  1DVD A;  2CWV A;  4FCJ A;  1BUQ A;  1T3B A;  4HM3 B;  2BMR B;  1TIJ A;  1V57 A;  4N3V A;  4U13 A;  5EVH A;  3T0U A;  1BSC A;  5EQL A;  3RGR A;  3OXA A;  3F8H A;  5M1A A;  4GL6 A;  1JRQ A;  2FGT A;  2AAD A;  5BIR A;  1E3R A;  3FSD A;  5STD A;  3S67 A;  2PNC A;  3DXO A;  5EEO A;  3STD A;  3G6E 3;  3CCM 3;  2C11 A;  3A76 A;  1VQN 3;  1VQK 3;  2W0Q A;  4R4K A;  1BUJ A;  3UL5 A;  1YVB I;  3VGN A;  1JKG B;  1RGC A;  2FXT A;  1AY7 A;  1JBS A;  1I2E A;  1NO3 A;  3I0Y A;  1R4C A;  2P0M A;  3CU3 A;  4BTW A;  5IG3 A;  1TP6 A;  3B8L A;  1BOX A;  5M18 A;  1M1X B;  1RMS A;  1M1K 4;  4XB5 A;  3ALA A;  3WOF B;  1Q86 4;  2CIU A;  1D6U A;  2W2C A;  2D42 A;  3FF2 A;  3X3X A;  2CWT A;  1IV9 A;  3X40 A;  1UUG B;  5IG0 A;  2F4Y A;  3NBJ A;  3HII A;  1WMN A;  1MNL A;  3LTB A;  3N54 B;  2UX0 A;  1DET A;  4LZI A;  1KD1 4;  1BAO A;  1UUV B;  1BSD A;  2OCT A;  3V98 A;  6STD A;  2CG0 A;  1K73 4;  1BRK A;  2F56 A;  1JBR A;  1M9G A;  4O02 B;  1OHS A;  4MMZ B;  1G02 A;  5AIG A;  2W03 A;  4EC6 A;  1ULJ B;  1W2Z A;  1JB4 A;  1X1U A;  4XM4 A;  1VQL 3;  5AI1 A;  1BVI A;  1GS3 A;  4BL3 A;  1JN5 A;  2CWU A;  2XF3 A;  1Q42 A;  2CG1 A;  2W9Q A;  3HOH A;  4N6M A;  4AEQ A;  5A0O B;  1AR0 A;  4MEI A;  2F5W A;  5G1K A;  3WOD G;  4CDL A;  3BNB A;  2RNT A;  3HI7 A;  1FA3 A;  3EBT A;  3CCR 3;  1TJD A;  2KAA A;  4HYZ A;  4MMX B;  1HU9 A;  1UCK A;  1GMR A;  3VF1 A;  2ZHX B;  4HM5 B;  1C7H A;  1TTO A;  1LVN A;  3SLU A;  4NRE A;  1O7H B;  4LSO A;  2IY2 A;  3GAX A;  2P05 A;  4RNZ A;  1FUW A;  1VQ9 3;  2QGU A;  3GZX B;  2ZL8 A;  1US1 A;  5IW9 A;  1X1X A;  1ZGX A;  3FLJ A;  4XDW A;  3V99 A;  2W04 A;  3UL6 A;  5KP3 A;  2BNG A;  4HM4 B;  2W56 B;  1OGZ A;  3EB8 A;  1LOY A;  1IQX A;  1HYF A;  2IMJ A;  4KT3 B;  1NJI 4;  1LRA A;  2QIY A;  2CFK A;  4K1U A;  1GMP A;  2XSO B;  1JZO A;  4KFE A;  2RCD A;  2IUK A;  1UCJ A;  3FG3 A;  4HM8 B;  1NNV A;  1BNI A;  4EBG A;  5CF1 A;  1BRG A;  2GSP A;  3JVC A;  4OVM A;  2W6J H;  1AVK A;  1GD3 A;  2B1X B;  3WA2 X;  2F86 B;  1PYL A;  3CCS 3;  2KCD A;  3WOE B;  1ULI B;  1BNG A;  3I55 3;  1LOX A;  3I56 3;  3EN8 A;  1I2G A;  8CHO A;  4FMA A;  2XR8 B;  3J7Y d;  3LYG A;  1JZD A;  3BB9 A;  3OX9 A;  1A2V A;  1SQW A;  2KXG A;  3D3L A;  3H3H A;  4BL2 A;  2HMO B;  2BT3 A;  1I3F A;  2XGL A;  1OH0 A;  1BRH A;  2F98 A;  1BNJ A;  1YHQ 3;  2XGN A;  1NB5 I;  3SED A;  2R41 A;  3RNT A;  1K9M 4;  3MSO A;  1RGG A;  1ASK A;  5IER A;  1OF5 B;  1W4N A;  1E3V A;  1GOY A;  1DVC A;  3IJE B;  2F5M A;  3NHX A;  3NV0 B;  3BND A;  1FUS A;  1W02 A;  3BLZ A;  3FF0 A;  2XFS A;  4H61 A;  1IU7 A;  1W00 A;  3BIR A;  4FCZ A;  1GYB A;  3NM2 A;  5D81 A;  3SOY A;  5BXQ A;  1RDS A;  2ZDJ A;  4GHO A;  3NQY A;  4ZM8 A;  3LXU X;  1I2F A;  1W01 A;  1Z1S A;  5IG4 A;  3FCS B;  1BAN A;  3LTC A;  1HKX A;  5IEO A;  2YFL B;  3LTA A;  3F40 A;  2WOF A;  1Y4K A;  3N8B A;  4AKZ A;  3OWY A;  1UDI I;  3Q1C A;  1SII A;  2H0H A;  3BU4 A;  3K0Z A;  1IVW A;  1UI8 A;  3KZT A;  2KF4 A;  1VZZ A;  2YX9 A;  3MYT A;  3PZW A;  4N6T A;  4X2O A;  1SIH A;  3K9M C;  1BRN L;  1ROV A;  2INX A;  1W6Y A;  1IK3 A;  1BNF A;  1S5A A;  3LTD A;  3U1W A;  1SJW A;  1B2Z A;  3LT9 A;  1O7M B;  1ZO2 A;  1ZX2 A;  5HOH A;  2HOH A;  1YIT 3;  1B21 A;  3G16 A;  1MOL A;  5CXO A;  5ELU A;  1I3I A;  3EQQ B;  1YJN 3;  4JF8 A;  1WMO A;  4MJD A;  4JRF A;  4HVN A;  3CXC 2;  3B4P A;  1TU5 A;  2HML B;  2ML6 A;  1GY7 A;  1VQ8 3;  4CPK A;  3DZL A;  3UNL A;  4K61 A;  1OGX A;  1RKY A;  1A2P A;  4XBT A;  1X1W A;  3MG2 A;  2CFD A;  1VQP 3;  2Y74 A;  3S27 A;  4BIR A;  2MC8 A;  1UUW B;  1RGL A;  6GSP A;  1RGK A;  3EX9 A;  3CCJ 3;  1AVL A;  2H0G A;  3X3Z A;  1NWW A;  2FNQ A;  4HM6 B;  2OQE C;  1O7N B;  1GOV A;  3PXM A;  4O8S A;  3OWU A;  1CEW I;  3D5G A;  4OUQ A;  1JV2 B;  1BGS A;  3FH1 A;  1GD4 A;  3E99 A;  2GBW B;  4RNT A;  1R4Y A;  4EXR A;  1B2M A;  1Q40 B;  2IUJ A;  3MG1 A;  2RSX A;  1K28 A;  1RSN A;  3DGL A;  3WMD A;  1N8R 4;  1YVS A;  3KII A;  1EG9 B;  2P0X A;  3FGY A;  1VQQ A;  6RNT A;  4HOH A;  3RGA A;  5KP4 A;  1Q7H A;  1BSA A;  4CCV A;  1TFK A;  2LYX A;  3A5E A;  2P38 A;  1OHO A;  4O3V A;  1FGT A;  4R80 A;  1I0V A;  3CC2 3;  4HKV B;  4EYC A;  3ZG5 A;  3CC4 3;  3V92 A;  1FZU A;  3F7S A;  3H51 A;  5ELJ A;  1RRH A;  3JUM A;  5I97 A;  3F9S A;  2Z6B A;  3OWS A;  3GWR A;  1AQZ A;  4N6N B;  4WYK A;  1SPU A;  3AMO B;  4N6O B;  2Y73 A;  2OTL 3;  5JPU A;  2KF3 A;  3G0K A;  1NU3 A;  5AYR B;  3DH2 A;  1OHP A;  4ILF A;  1VQ4 3;  2J8X B;  3DGO A;  3Q2P A;  3S5C A;  3L0R A;  1BNS A;  1B27 A;  1G96 A;  4FMB A;  1BNR A;  2BIR A;  4RNY A;  1DMN A;  4LGQ A;  3LOY A;  4RBN A;  3LT8 A;  1JB5 A;  4I4K A;  1IQY A;  2HMM B;  4HM1 B;  4MMY B;  1G0T A;  2GXF A;  2YFJ B;  4IIA A;  5LC6 A;  3GZB A;  3CCE 3;  1LQM B;  2WOH A;  1N9E A;  1UI7 A; 
#chains in the Genus database with same CATH homology
 1BSC A;  1GOY A;  1RGA A;  1B2S A;  2F5M A;  1FUT A;  3Q3F A;  1FUS A;  1I70 A;  2RBI A;  2AAD A;  5BIR A;  7GSP A;  3BIR A;  1RDS A;  1I8V A;  4GHO A;  1SAR A;  1GSP A;  1RGF A;  1BUJ A;  1I2F A;  1RGC A;  3GSP A;  1AY7 A;  1JBS A;  1BAN A;  1I0X A;  1I2E A;  2SAR A;  1HZ1 A;  4J5K A;  1B2U A;  1CH0 A;  1RTU A;  2AAE A;  2BU4 A;  1RLS A;  1BOX A;  4BU4 A;  1RNT A;  3SYU A;  1BIR A;  1RMS A;  1FW7 A;  4J5G A;  1BRI A;  1MGR A;  3BU4 A;  3WR2 A;  1C54 A;  2KF6 A;  1FYS A;  2KF4 A;  3DGY A;  1BU4 A;  2KF5 A;  1BRN L;  1Q9E A;  4GSP A;  1BNF A;  1X1Y A;  5BU4 A;  1B2Z A;  2F4Y A;  1DET A;  4HAA A;  1BAO A;  1GMQ A;  1BSD A;  2HOH A;  5HOH A;  1B21 A;  1BRK A;  2F56 A;  1JBR A;  1I3I A;  1MGW A;  1GOU A;  2ZA4 A;  1G02 A;  8RNT A;  1JBT A;  1YNV X;  1TRP A;  3D4A A;  1X1U A;  5GSP A;  1BVI A;  1A2P A;  1X1W A;  5RNT A;  3HOH A;  4BIR A;  2F5W A;  1RGL A;  6GSP A;  1RGK A;  1BNE A;  2RNT A;  3AHW A;  1UCL A;  3AGN A;  2KAA A;  1UCK A;  1GMR A;  1GOV A;  1B20 A;  1TTO A;  1LOW A;  3D5G A;  1RGE A;  1BGS A;  1BRS A;  1RHL A;  4RNT A;  3KCH A;  1B2M A;  1RNB A;  1R4Y A;  1RCK A;  3AGO A;  1RSN A;  1BRJ A;  1YVS A;  2C4B A;  3URP A;  1PY3 A;  1X1X A;  1ZGX A;  6RNT A;  1UCI A;  4HOH A;  3AHS A;  1BSB A;  1BSA A;  3A5E A;  1YGW A;  1T2H A;  1B3S A;  1LOY A;  1I0V A;  1HYF A;  1RN4 A;  1LRA A;  1FZU A;  1GMP A;  1DE3 A;  1UCJ A;  1BNI A;  1BRG A;  1AQZ A;  2GSP A;  1LOV A;  1BSE A;  3D5I A;  1T2I A;  1RN1 A;  2KF3 A;  1PYL A;  1LNI A;  1BNG A;  3DH2 A;  1I2G A;  1RGH A;  3WHO A;  1B2X A;  1BNS A;  1B27 A;  7RNT A;  1IYY A;  1BNR A;  2BIR A;  1I3F A;  1BRH A;  1BNJ A;  1TRQ A;  1RCL A;  9RNT A;  3RNT A;  1RGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...