1G96A

Human cystatin c; dimeric form with 3d domain swapping
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN C
publication title Human cystatin C, an amyloidogenic protein, dimerizes through three-dimensional domain swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 18
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1g96A00
1STFI 2W9PA 1N5PA 5A0OB 2CH9A 4N6MA 1TIJA 1FA3A 3Q2PA 2BO9B 3IMAB 1G96A 1RN7A 3MWZA 3LH4A 1A67A 3NX0A 5LC6A 1CYUA 1CYVA 4EYCA 4LZIA 1CEWI 4ZM8A 4TX4A 1WNHA 3SVAA 1FUWA 5LC7A 1R4CA 5EQLA 1IV7A 4N6TA 1MOLA 1DVCA 2KXGA 4CCVA 1MNLA 2W9QA 3PS8A 3S67A 1NB3I 3QRDA 4N6UA 3UL5A 1M9GA 5ELUA 1PFPA 4IT7A 4N6OB 1YVBI 3KSED 1KWIA 1N5HA 3PXMA 3L0RA 1GD3A 4N6LA 1GD4A 3K9MC 1N9JA 3PYJA 3GAXA 2OCTA 3UL6A 1DVDA 1NB5I 4N6NB 1A90A 1IV9A 4N6V0 1EQKA 5ELJA 1LXEA 2O9UX 3KFQC 1ROAA
chains in the Genus database with same CATH superfamily
4O3VA 1K41A 1ASKA 1I2GA 2C10A 1EKMA 4LSOA 1U8CB 2XF3A 3NM7A 1BRNL 2W2CA 2D42A 3FKAA 3T8NA 4CJNA 2QEX3 4EW5A 1E97A 4N6MA 3FZWA 1TIJA 2LQVA 2CKFB 3FG3A 1LRAA 4KZ1A 4MJDA 3G0KA 5JPUA 1W2ZA 4X2OA 1RRHA 1FA3A 3OX9A 4EV5A 3CCM3 2OTL3 2W03A 1G0TA 1SQWA 1BRGA 1GOYA 1IT7A 3H51A 4LGQA 8CHOA 3JUOA 1B2ZA 2BMRB 1PYLA 4L8OA 3DZLA 3WHOA 7STDA 5JBSA 4CPKA 1LNHA 2GEXA 1C7HA 4KVHA 1I0XA 1GOVA 1LQGC 2CWVA 1OCVA 3HOHA 4R80A 3X3XA 5BVBA 1TRQA 1FYSA 1SIIA 3EB8A 3NHXA 3PZWA 1JB5A 1WMOA 3ZG0A 3NBRA 3WMDA 5HOHA 3CCR3 1TJDA 3MKIA 1CYUA 4OUQA 1CYVA 3GZYB 5D81A 4EYCA 3OW22 4CDLA 1BUQA 1AR0A 1BOXA 1K28A 2OOVC 4LZIA 1IK3A 1CEWI 4GL6A 1DMQA 6GSPA 4XB5A 1AVLA 1WNHA 1FW7A 1JN5B 1US1A 1IT8A 1BRJA 1GS3A 1BNJA 1S5AA 3FGYA 1R4CA 3I0YA 3KKGA 4O02B 3H3HA 5KP1A 1K8A4 4I5QA 3LXUX 1X1XA 1HZ1A 2D1WA 2YX9A 4PEJA 2KCDA 1JJ22 3VSYA 7GSPA 1J2BA 2GEYA 4HM5B 6RNTA 1ZGXA 1DVCA 3EN8A 4EC6A 3X3YA 3AGNA 4CCVA 1MNLA 4BL3A 1KC84 2W9QA 1IQ8A 1QALA 4RNTA 1GMRA 3PS8A 1FGOA 1RRLA 4GHOA 1W7CA 4HM4B 3F7SA 3UL5A 2HMKB 2WO0A 1BRKA 3X40A 1IDPA 2CC3A 1NO3A 1N9EA 4LMIA 3GSPA 3OWUA 4IT7A 2BIRA 3NQZA 1DMNA 4O2HA 5I97A 2L4VA 1NNVA 3S5CA 3CC43 1BSCA 1LOXA 1I2FA 2KF6A 1AVKA 3NM2A 4U13A 2CIUA 7RNTA 1JB2A 1UCJA 1ZS7A 1SPUA 1N5HA 1N8QA 2BT3A 3LTAA 3B7CA 3RGRA 1RLSA 3B4PA 3BNDA 3PXMA 3WA2X 5HGRA 4HM8B 4N6LA 3B4OA 1KSIA 4HM6B 1N9JA 3MPHA 4FCJA 5IEOA 1V57A 1VQP3 3PYJA 5IW9A 2RSXA 2CX0A 2P09A 1Q40A 1BU4A 5JPPA 3WA3A 3FG4A 1UI7A 4L8PA 1WMNA 1ULIB 3UL6A 2CWUA 1QVG2 5IG4A 1B20A 2R4IA 4KFEA 3V92A 3GWRA 1BRIA 1WMPA 1JKGA 2CG1A 3N9HA 5IG5A 1RGFA 4HKVB 1BGSA 2MF7A 1WTHA 4J9AA 4X2HA 5G1LA 3CCL3 4H3UA 1Q7Y4 1BNRA 1W01A 2QGUA 1X1WA 2WGQA 4XDVA 1JBSA 3CD63 1K9M4 1BVIA 4KFDA 2SARA 4NHFA 1LXEA 2O9UX 4XBTA 1ROAA 4WWUC 2W9PA 2E2VA 1VQ73 2W04A 3X42A 1GSPA 2QIYA 3B8LA 3LTBA 1W4NA 5KP4A 5AIGA 2OQEC 3WOEB 2W6JH 1OGXA 2XSHB 3CU3A 1BSDA 1ROVA 4HM7B 5D82A 3CCJ3 2HMLB 1DE3A 4AKZA 2RNTA 2BO9B 3JUQA 1OACA 3T8UA 1GY7A 4HZ9B 1O7MB 4J5KA 1LOVA 2CFKA 1WQLB 1RGHA 1VQO3 5DREA 1HU9A 1OF5B 4L7KA 4R1KA 5AYSC 1LNIA 2W56B 1IQXA 1GY6A 3MWZA 4H61A 3WR2A 3N54B 2FGTA 5IERA 1IYYA 3FF2A 1YJ93 1W6CA 3CCU3 3URPA 1M1XB 3BU4A 5LC6A 3CXC2 1Q7HA 1GMQA 5CK6A 2C4BA 4RZMA 3GZRA 1ISKA 1VQL3 4STDA 3IJEB 5CLKA 3BIRA 3HZPA 5GSPA 1IVUA 1ZX2A 3GZXB 3PCRA 3SVAA 3AMOA 4J8TA 1YHQ3 1MWSA 1UGHI 1STDA 3CNMA 2XSOB 6STDA 2F56A 2RFRA 3X41A 2KF4A 3BLZA 1I70A 1IVVA 1Q824 4MEIA 2CFDA 1AQZA 1MOLA 1UGIA 3SYUA 3BB9A 3LT8A 1BNEA 2GU1A 2K54A 5G1KA 4BIRA 2BMOB 2HOHA 1NU3A 1MGWA 1RGLA 4EV2A 2F5MA 2YFIB 1LQMB 2Z6BA 3F7XA 1OHPA 1DETA 4OK0A 2RBIA 4LEHA 3LT9A 3LMLA 3CCQ3 1BUJA 3CMA3 2SBLA 3DY5A 1IU7A 2H0HA 4FMAA 4N3VA 2UX0A 1JZOA 3AHWA 1S723 3EBTA 1UUVB 2GSPA 4O8SA 1VZZA 2JDIH 3SXXA 2MC8A 2HMMB 3NV0B 3EBYA 2OOVA 1YVSA 1IVXA 2CFGA 3EF8A 3DUKA 3HI7A 1RHLA 1VQ93 1D6UA 3BNBA 4KFFA 3S28A 2ZHXB 3WDGB 3GZBA 1CH0A 1UUWB 2INXA 5M18A 2E2UA 3OXAA 5IENA 3F8HA 1RTUA 5AIIA 1TFKA 3CC23 3F40A 1Y4KA 4XM4A 3CCV3 3L0RA 2H0IA 1QVF2 1QJGA 4WYKB 5M1AA 3N8BA 1DYUA 1EEJA 3S29A 2ML6A 1YJW3 1PU4A 2W56A 5TGNA 4BTXA 3K5TA 4XBXA 1FUTA 3D4AA 3DGNA 5AI1A 1O7PB 1BNSA 1V58A 3CCE3 2XGNA 2XFSA 3FLJA 3KN4A 4G1MB 3SLUA 5CF2A 1IV9A 2JQ5A 3UNLA 5AYRB 5BIRA 1UCKA 1JNQA 2KF5A 2F4YA 1YGWA 3K7CA 3A76A 4NREA 4FMDA 1STFI 2IY2A 3MHEA 3S27A 2CK3H 1OPYA 3Q3FA 1W00A 5EEOA 4I4KA 2R41A 1Z1SA 1B21A 5IG0A 3MG3A 5A0OB 2CH9A 4HVNA 5IF6A 1KD14 1NJI4 4OVMA 3EN1B 3LTCA 4HM3B 1RKYA 1U5OA 3Q2PA 1YNVX 3K63A 1F8NA 3DM8A 1BRHA 3FF0A 4HZBB 2OWPA 5EVHA 1HKXA 1MWRA 4FCZA 2UUGC 3OWSA 1B2UA 3IMAB 1G96A 1MGRA 3ZFZA 3KIIA 2CFLA 1RN7A 1NWWA 1D6ZA 4MMXB 5IEPA 3D79A 1JN5A 3FH1A 4EBGA 3JUNA 3Q90A 2BMQB 1YI23 2L1SA 3WOFB 1RGAA 2B1XB 3RNTA 1FGTA 1UW1A 2RCDA 3DMCA 4JRFA 3STDA 4ZM8A 4Q53A 1A2PA 2M7OA 1UCLA 3G8ZA 1JBTA 4BL2A 1LOYA 2ZA4A 3EC9A 3EE1A 2QA43 3V99A 5EQLA 3LZAA 4FMCA 4WYKA 3SOAA 3CC73 2H0GA 4RNYA 1FGMA 1NDOB 1ZO2A 3ECFA 4RNZA 4XBYA 4RBNA 1YIT3 4K1UA 1Q42A 5AEWB 1E3RA 3JVCA 2A15A 2OQEA 2KRTA 1UUGB 3CNXA 3JUPA 2P38A 1B3SA 2GBXB 3G4S3 1BNGA 1UI8A 3FSDA 1OHSA 1I3FA 3VGNA 4FMBA 1FUSA 3DGMA 3BNCA 1VQN3 3S67A 4XDWA 3T0UA 1B2MA 2AAEA 1YIJ3 2V1LA 2HMOB 8RNTA 4N6UA 1I8VA 1SIHA 3D5GA 2XGLA 3VF1A 2CHCA 1KQS2 3UJMA 3RGAA 3D5IA 3OV4A 1FGQA 1VQ43 1BIRA 1BRSA 1YVBI 5AEUB 1D6YA 5DRVA 2E2TA 1FGRA 1FZUA 2KAAA 1T2IA 2OTJ3 3KSED 1KWIA 1ULJB 1T2HA 2Q07A 1BSEA 1YGEA 2PNCA 3NUVA 3U1WA 2F99A 1A2KA 1BAOA 2O3OA 4HYZA 1JBRA 2F98A 2YFLB 4K90B 1A2VA 3MG1A 1GMPA 1O7WB 2ZL8A 4FCMA 1GD3A 4JF8A 1RN1A 1GD4A 2PZVA 3NQYA 3G713 1QMAA 3OWYA 1Q864 3HIGA 1GYBA 2Z77A 2XR8B 1SARA 3MG2A 3EX9A 2OCTA 3LOYA 2HMNB 1E3VA 1CQSA 4HBRA 4NPBA 1OH0A 3PGBA 3SX1A 2GU3A 4LYLB 3G16A 1TP6A 4HM0B 3TDGA 1V74A 1RGEA 5KP3A 1EQKA 4GSPA 2J8XB 4R9LA 2I9WA 3EJVA 3MSOA 3SEDA 1Q40B 5AIHA 5ELJA 2P0MA 3FG1A 2IA7A 3AGOA 5CF1A 2IUJA 5BU4A 2Z76A 1TTOA 1W6GA 3KFQC 4QWTA 3V98A 1M904 2C11A 2F86B 3CCS3 1N5PA 3D3LA 2AADA 3SOYA 2UGIA 1RSNA 1LOWA 4IIAA 1JKGB 4HAAA 4WP5A 4J5GA 3DGOA 3KZTA 3UB1A 2Y74A 3ZG5A 1BSAA 2IMJA 2CW9A 1OUNA 1BNFA 3K0ZA 3KCHA 1OF5A 1I2EA 1T3BA 3QK9A 3NBJA 1PY3A 2BNGA 1C54A 1TUHA 1VQQA 4ORLA 1RGCA 3ALAA 1JZDA 3F14A 1UDII 3ER7A 5G2GA 1QAKA 1TU5A 2WOFA 4HM1B 3CME3 1RN4A 2B24B 4EXRA 5M19A 3NBBA 1QAFA 4IPBA 1R4YA 1K734 4AKYA 1IVWA 2RGQA 3KE7A 3LH4A 1A67A 4R4KA 5RNTA 3JUMA 3NX0A 1BANA 3RDEA 3E99A 1EA2A 1HYFA 5D83A 3CPOA 3KSPA 2CFWA 3U97A 2W0QA 1Q814 4TX4A 4WHAA 2XRXB 5FW5A 1JB4A 1W5ZA 1FUWA 2CWTA 3EHCA 4KT3B 5LC7A 4K1VA 1EUIC 1YJN3 4BTYA 3I563 2XFTA 3HIIA 4BU4A 2ZDJA 3ROBA 3BNEA 3FCSB 1IV7A 4N6TA 4AEQA 2CG0A 1RDSA 2XEPA 4DKIA 1BSBA 2P05A 3AHSA 1VQM3 2KXGA 3AMOB 1B27A 1MWUA 1Q9EA 3NV0A 1NB3I 4GB5A 2F5WA 3F8XA 1GOUA 3QRDA 1L5GB 4MMYB 1RCLA 2LYXA 3LTDA 1RNBA 1RJOA 2BU4A 1OGZA 2Z7AA 2P0XA 3DGYA 1LVNA 2ML5A 1M9GA 2STDA 3GRDA 3M8CA 3O8YA 5ELUA 3PCSA 1RNTA 1PFPA 2BHMA 4N6OB 5BXQA 2Y73A 2FXTA 4HOHA 1O7HB 3HK4A 1OHOA 1SJWA 1MWTA 1UCIA 4FR9A 4ILFA 2K0MA 1JV2B 1VQK3 1N8R4 5FGOA 1I0VA 2CX1A 3J7Yd 3Q1CA 1TFOA 5AIFA 1BNIA 1RGGA 3A5EA 2FNQA 1VQ53 1W02A 4K61A 2WOHA 5IG3A 3DGLA 1X1UA 1AV4A 1O7GB 2XH9A 4HJLB 1W2B2 2IUKA 2GXFA 2YFJB 1JRQA 3CPW2 3K9MC 3LYGA 1M1K4 2IYJA 4WFOA 3G6E3 1DMMA 1TRPA 5CXOA 1G02A 1VQ83 4MMZB 3DH2A 3GAXA 3WODG 1VQ63 1I3IA 3MYTA 9RNTA 3DXOA 4R9KA 1DVDA 1O7NB 1NB5I 4N6NB 2WGOA 3EQQB 1X1YA 1GY5A 3HX8A 3I553 1A90A 1RCKA 1B2SA 3D9RA 5STDA 2HMJB 1EG9B 4BTWA 1T5YA 4N6V0 1RGKA 3IPTA 1B2XA 1AY7A 4HM2B 3F9SA 2K3DA 2GBWB 2KF3A 1IQYA 3X3ZA 1RMSA 3NXJA 1W6YA
chains in the Genus database with same CATH topology
4O3VA 1K41A 1ASKA 2C10A 1EKMA 4LSOA 1U8CB 2XF3A 3NM7A 2W2CA 2D42A 3FKAA 3T8NA 2QEX3 1E97A 4N6MA 3FZWA 1TIJA 2LQVA 2CKFB 3FG3A 4KZ1A 5JPUA 4MJDA 3G0KA 1FA3A 1W2ZA 4X2OA 1RRHA 3OX9A 4EV5A 3CCM3 2OTL3 2W03A 1SQWA 1IT7A 3H51A 4LGQA 8CHOA 3JUOA 2BMRB 4L8OA 3DZLA 7STDA 5JBSA 1LNHA 2GEXA 1C7HA 4KVHA 2CWVA 3X3XA 1OCVA 4R80A 5BVBA 3EB8A 1SIIA 3NHXA 3PZWA 1JB5A 1WMOA 3NBRA 3WMDA 3CCR3 1CYUA 3MKIA 4OUQA 1CYVA 3GZYB 5D81A 4EYCA 3OW22 4CDLA 1BUQA 1AR0A 4LZIA 1K28A 2OOVC 1IK3A 1CEWI 4GL6A 1DMQA 4XB5A 1AVLA 1WNHA 1JN5B 1US1A 1IT8A 1GS3A 1S5AA 3FGYA 1R4CA 3I0YA 3KKGA 4O02B 3H3HA 5KP1A 1K8A4 3LXUX 2D1WA 2YX9A 4PEJA 2KCDA 1JJ22 3VSYA 1J2BA 2GEYA 4HM5B 1DVCA 3EN8A 4EC6A 3X3YA 4CCVA 1MNLA 1KC84 2W9QA 1IQ8A 1QALA 3PS8A 1FGOA 1RRLA 1W7CA 4HM4B 3F7SA 3UL5A 2HMKB 2WO0A 3X40A 1IDPA 2CC3A 1NO3A 1N9EA 4LMIA 4IT7A 3OWUA 3NQZA 1DMNA 4O2HA 5I97A 2L4VA 3S5CA 3CC43 1LOXA 1AVKA 3NM2A 4U13A 2CIUA 1JB2A 3LTAA 1SPUA 1N5HA 1N8QA 2BT3A 3RGRA 3B7CA 3B4PA 3BNDA 3PXMA 3WA2X 5HGRA 4HM8B 4N6LA 3B4OA 1KSIA 4HM6B 1N9JA 3MPHA 4FCJA 5IEOA 1VQP3 3PYJA 5IW9A 2RSXA 2P09A 1Q40A 5JPPA 3WA3A 3FG4A 1UI7A 4L8PA 1WMNA 1ULIB 3UL6A 2CWUA 1QVG2 5IG4A 3V92A 2R4IA 4KFEA 3GWRA 1WMPA 1JKGA 2CG1A 3N9HA 5IG5A 4HKVB 2MF7A 1WTHA 4J9AA 4X2HA 3CCL3 4H3UA 1Q7Y4 1W01A 2QGUA 2WGQA 4XDVA 3CD63 1K9M4 4KFDA 4NHFA 1LXEA 2O9UX 4XBTA 1ROAA 4WWUC 2W9PA 2E2VA 1VQ73 2W04A 3X42A 2QIYA 3B8LA 3LTBA 1W4NA 5KP4A 5AIGA 2OQEC 3WOEB 2W6JH 1OGXA 2XSHB 3CU3A 3CCJ3 1ROVA 4HM7B 5D82A 2HMLB 4AKZA 3JUQA 2BO9B 3T8UA 1OACA 1GY7A 4HZ9B 1O7MB 2CFKA 1WQLB 1VQO3 5DREA 1HU9A 1OF5B 4L7KA 4R1KA 5AYSC 2W56B 1IQXA 1GY6A 3MWZA 4H61A 3N54B 2FGTA 5IERA 3FF2A 1YJ93 1W6CA 3CCU3 1M1XB 5LC6A 3CXC2 5CK6A 4RZMA 3GZRA 1ISKA 1VQL3 4STDA 3IJEB 5CLKA 3HZPA 1IVUA 1ZX2A 3GZXB 3PCRA 3SVAA 3AMOA 4J8TA 1YHQ3 1STDA 3CNMA 2XSOB 6STDA 2RFRA 3X41A 3BLZA 1IVVA 1Q824 4MEIA 2CFDA 1MOLA 3BB9A 3LT8A 2GU1A 2K54A 2BMOB 1NU3A 4EV2A 2YFIB 2Z6BA 3F7XA 1OHPA 4OK0A 4LEHA 3LT9A 3LMLA 3CCQ3 3CMA3 2SBLA 3DY5A 1IU7A 4FMAA 4N3VA 2UX0A 1S723 3EBTA 1UUVB 4O8SA 1VZZA 2JDIH 3SXXA 2MC8A 2HMMB 3NV0B 3EBYA 2OOVA 1IVXA 2CFGA 3EF8A 3DUKA 3HI7A 1VQ93 1D6UA 3BNBA 4KFFA 3S28A 3WDGB 3GZBA 1UUWB 2INXA 2E2UA 3OXAA 5IENA 3F8HA 5AIIA 1TFKA 3CC23 3F40A 1Y4KA 4XM4A 3CCV3 3L0RA 1QVF2 1QJGA 4WYKB 3N8BA 1DYUA 3S29A 2ML6A 1YJW3 1PU4A 2W56A 5TGNA 4BTXA 3K5TA 4XBXA 3DGNA 5AI1A 1O7PB 3CCE3 2XGNA 2XFSA 3FLJA 3KN4A 4G1MB 3SLUA 5CF2A 1IV9A 2JQ5A 3UNLA 5AYRB 1JNQA 4NREA 3K7CA 3A76A 4FMDA 1STFI 3S27A 3MHEA 2CK3H 1OPYA 1W00A 5EEOA 4I4KA 1Z1SA 5IG0A 3MG3A 5A0OB 2CH9A 4HVNA 5IF6A 1KD14 1NJI4 4OVMA 3EN1B 3LTCA 4HM3B 1RKYA 1U5OA 3Q2PA 3K63A 1F8NA 3DM8A 3FF0A 4HZBB 2OWPA 5EVHA 1HKXA 4FCZA 3OWSA 3IMAB 1G96A 3KIIA 2CFLA 1RN7A 1NWWA 1D6ZA 4MMXB 5IEPA 1JN5A 3FH1A 4EBGA 3JUNA 3Q90A 2BMQB 1YI23 3WOFB 2B1XB 1FGTA 1UW1A 2RCDA 3DMCA 4JRFA 3STDA 4ZM8A 4Q53A 2M7OA 3G8ZA 3EC9A 3EE1A 2QA43 3V99A 5EQLA 3LZAA 4FMCA 4WYKA 3SOAA 3CC73 4RNYA 1FGMA 1NDOB 1ZO2A 3ECFA 4RNZA 4XBYA 4RBNA 1YIT3 4K1UA 1Q42A 5AEWB 1E3RA 3JVCA 2A15A 2OQEA 2KRTA 3JUPA 3CNXA 2P38A 3G4S3 2GBXB 1UI8A 3FSDA 1OHSA 3VGNA 4FMBA 3DGMA 3BNCA 1VQN3 3S67A 4XDWA 3T0UA 1YIJ3 2V1LA 2HMOB 4N6UA 1SIHA 2XGLA 3VF1A 2CHCA 1KQS2 3UJMA 3RGAA 3OV4A 1FGQA 1VQ43 1YVBI 5AEUB 1D6YA 5DRVA 2E2TA 1FGRA 2OTJ3 3KSED 1KWIA 1ULJB 2Q07A 1YGEA 2PNCA 3NUVA 3U1WA 2F99A 1A2KA 2O3OA 4HYZA 2F98A 2YFLB 4K90B 1A2VA 3MG1A 1O7WB 2ZL8A 4FCMA 1GD3A 4JF8A 3G713 1GD4A 2PZVA 3NQYA 1QMAA 3OWYA 1Q864 3HIGA 1GYBA 2Z77A 2XR8B 3MG2A 3EX9A 2OCTA 3LOYA 2HMNB 1E3VA 1CQSA 4HBRA 1OH0A 3PGBA 3SX1A 2GU3A 3G16A 1TP6A 4HM0B 3TDGA 1V74A 5KP3A 1EQKA 4R9LA 2I9WA 3EJVA 3MSOA 3SEDA 1Q40B 5AIHA 5ELJA 2P0MA 3FG1A 2IA7A 5CF1A 2IUJA 2Z76A 4QWTA 1W6GA 3KFQC 1M904 3V98A 2C11A 2F86B 3CCS3 1N5PA 3D3LA 3SOYA 4WP5A 4IIAA 1JKGB 3DGOA 3KZTA 3UB1A 2Y74A 2IMJA 2CW9A 1OUNA 3K0ZA 1OF5A 3QK9A 3NBJA 2BNGA 1TUHA 4ORLA 3ALAA 3F14A 5G2GA 3ER7A 1QAKA 1TU5A 2WOFA 4HM1B 3CME3 4EXRA 2B24B 3NBBA 1QAFA 4IPBA 1K734 4AKYA 1IVWA 2RGQA 3KE7A 3LH4A 1A67A 4R4KA 3JUMA 3NX0A 3RDEA 3E99A 1EA2A 5D83A 3CPOA 3KSPA 2CFWA 3U97A 2W0QA 1Q814 4TX4A 4WHAA 2XRXB 5FW5A 1JB4A 1W5ZA 1FUWA 2CWTA 3EHCA 5LC7A 4K1VA 1YJN3 4BTYA 3I563 2XFTA 3HIIA 2ZDJA 3ROBA 3BNEA 3FCSB 1IV7A 4N6TA 4AEQA 2CG0A 2XEPA 2P05A 1VQM3 2KXGA 3AMOB 3NV0A 1NB3I 4GB5A 3F8XA 3QRDA 1L5GB 4MMYB 2LYXA 3LTDA 1RJOA 1OGZA 2Z7AA 2P0XA 1LVNA 2ML5A 1M9GA 2STDA 3GRDA 3M8CA 3O8YA 5ELUA 3PCSA 1PFPA 2BHMA 4N6OB 5BXQA 2Y73A 2FXTA 1O7HB 3HK4A 1OHOA 1SJWA 4FR9A 1VQK3 2K0MA 1JV2B 1N8R4 5FGOA 3J7Yd 3Q1CA 1TFOA 5AIFA 2FNQA 1VQ53 1W02A 4K61A 2WOHA 5IG3A 3DGLA 1AV4A 1O7GB 2XH9A 4HJLB 1W2B2 2IUKA 2GXFA 2YFJB 1JRQA 3CPW2 3K9MC 3LYGA 1M1K4 4WFOA 3G6E3 1DMMA 5CXOA 1VQ83 4MMZB 3GAXA 3WODG 1VQ63 3MYTA 3DXOA 4R9KA 1DVDA 1O7NB 1NB5I 4N6NB 2WGOA 3EQQB 3HX8A 1GY5A 3I553 1A90A 3D9RA 5STDA 2HMJB 1EG9B 4BTWA 1T5YA 4N6V0 3IPTA 4HM2B 3F9SA 2GBWB 1IQYA 3X3ZA 3NXJA 1W6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STF I;  2W9P A;  1N5P A;  5A0O B;  2CH9 A;  4N6M A;  1TIJ A;  1FA3 A;  3Q2P A;  2BO9 B;  3IMA B;  1G96 A;  1RN7 A;  3MWZ A;  3LH4 A;  1A67 A;  3NX0 A;  5LC6 A;  1CYU A;  1CYV A;  4EYC A;  4LZI A;  1CEW I;  4ZM8 A;  4TX4 A;  1WNH A;  3SVA A;  1FUW A;  5LC7 A;  1R4C A;  5EQL A;  1IV7 A;  4N6T A;  1MOL A;  1DVC A;  2KXG A;  4CCV A;  1MNL A;  2W9Q A;  3PS8 A;  3S67 A;  1NB3 I;  3QRD A;  4N6U A;  3UL5 A;  1M9G A;  5ELU A;  1PFP A;  4IT7 A;  4N6O B;  1YVB I;  3KSE D;  1KWI A;  1N5H A;  3PXM A;  3L0R A;  1GD3 A;  4N6L A;  1GD4 A;  3K9M C;  1N9J A;  3PYJ A;  3GAX A;  2OCT A;  3UL6 A;  1DVD A;  1NB5 I;  4N6N B;  1A90 A;  1IV9 A;  4N6V 0;  1EQK A;  5ELJ A;  1LXE A;  2O9U X;  3KFQ C;  1ROA A; 
#chains in the Genus database with same CATH topology
 4O3V A;  1K41 A;  1ASK A;  1I2G A;  2C10 A;  1EKM A;  4LSO A;  1U8C B;  2XF3 A;  3NM7 A;  1BRN L;  2W2C A;  2D42 A;  3FKA A;  3T8N A;  4CJN A;  2QEX 3;  4EW5 A;  1E97 A;  4N6M A;  3FZW A;  1TIJ A;  2LQV A;  2CKF B;  3FG3 A;  1LRA A;  4KZ1 A;  4MJD A;  3G0K A;  5JPU A;  1W2Z A;  4X2O A;  1RRH A;  1FA3 A;  3OX9 A;  4EV5 A;  3CCM 3;  2OTL 3;  2W03 A;  1G0T A;  1SQW A;  1BRG A;  1GOY A;  1IT7 A;  3H51 A;  4LGQ A;  8CHO A;  3JUO A;  1B2Z A;  2BMR B;  1PYL A;  4L8O A;  3DZL A;  3WHO A;  7STD A;  5JBS A;  4CPK A;  1LNH A;  2GEX A;  1C7H A;  4KVH A;  1I0X A;  1GOV A;  1LQG C;  2CWV A;  1OCV A;  3HOH A;  4R80 A;  3X3X A;  5BVB A;  1TRQ A;  1FYS A;  1SII A;  3EB8 A;  3NHX A;  3PZW A;  1JB5 A;  1WMO A;  3ZG0 A;  3NBR A;  3WMD A;  5HOH A;  3CCR 3;  1TJD A;  3MKI A;  1CYU A;  4OUQ A;  1CYV A;  3GZY B;  5D81 A;  4EYC A;  3OW2 2;  4CDL A;  1BUQ A;  1AR0 A;  1BOX A;  1K28 A;  2OOV C;  4LZI A;  1IK3 A;  1CEW I;  4GL6 A;  1DMQ A;  6GSP A;  4XB5 A;  1AVL A;  1WNH A;  1FW7 A;  1JN5 B;  1US1 A;  1IT8 A;  1BRJ A;  1GS3 A;  1BNJ A;  1S5A A;  3FGY A;  1R4C A;  3I0Y A;  3KKG A;  4O02 B;  3H3H A;  5KP1 A;  1K8A 4;  4I5Q A;  3LXU X;  1X1X A;  1HZ1 A;  2D1W A;  2YX9 A;  4PEJ A;  2KCD A;  1JJ2 2;  3VSY A;  7GSP A;  1J2B A;  2GEY A;  4HM5 B;  6RNT A;  1ZGX A;  1DVC A;  3EN8 A;  4EC6 A;  3X3Y A;  3AGN A;  4CCV A;  1MNL A;  4BL3 A;  1KC8 4;  2W9Q A;  1IQ8 A;  1QAL A;  4RNT A;  1GMR A;  3PS8 A;  1FGO A;  1RRL A;  4GHO A;  1W7C A;  4HM4 B;  3F7S A;  3UL5 A;  2HMK B;  2WO0 A;  1BRK A;  3X40 A;  1IDP A;  2CC3 A;  1NO3 A;  1N9E A;  4LMI A;  3GSP A;  3OWU A;  4IT7 A;  2BIR A;  3NQZ A;  1DMN A;  4O2H A;  5I97 A;  2L4V A;  1NNV A;  3S5C A;  3CC4 3;  1BSC A;  1LOX A;  1I2F A;  2KF6 A;  1AVK A;  3NM2 A;  4U13 A;  2CIU A;  7RNT A;  1JB2 A;  1UCJ A;  1ZS7 A;  1SPU A;  1N5H A;  1N8Q A;  2BT3 A;  3LTA A;  3B7C A;  3RGR A;  1RLS A;  3B4P A;  3BND A;  3PXM A;  3WA2 X;  5HGR A;  4HM8 B;  4N6L A;  3B4O A;  1KSI A;  4HM6 B;  1N9J A;  3MPH A;  4FCJ A;  5IEO A;  1V57 A;  1VQP 3;  3PYJ A;  5IW9 A;  2RSX A;  2CX0 A;  2P09 A;  1Q40 A;  1BU4 A;  5JPP A;  3WA3 A;  3FG4 A;  1UI7 A;  4L8P A;  1WMN A;  1ULI B;  3UL6 A;  2CWU A;  1QVG 2;  5IG4 A;  1B20 A;  2R4I A;  4KFE A;  3V92 A;  3GWR A;  1BRI A;  1WMP A;  1JKG A;  2CG1 A;  3N9H A;  5IG5 A;  1RGF A;  4HKV B;  1BGS A;  2MF7 A;  1WTH A;  4J9A A;  4X2H A;  5G1L A;  3CCL 3;  4H3U A;  1Q7Y 4;  1BNR A;  1W01 A;  2QGU A;  1X1W A;  2WGQ A;  4XDV A;  1JBS A;  3CD6 3;  1K9M 4;  1BVI A;  4KFD A;  2SAR A;  4NHF A;  1LXE A;  2O9U X;  4XBT A;  1ROA A;  4WWU C;  2W9P A;  2E2V A;  1VQ7 3;  2W04 A;  3X42 A;  1GSP A;  2QIY A;  3B8L A;  3LTB A;  1W4N A;  5KP4 A;  5AIG A;  2OQE C;  3WOE B;  2W6J H;  1OGX A;  2XSH B;  3CU3 A;  1BSD A;  1ROV A;  4HM7 B;  5D82 A;  3CCJ 3;  2HML B;  1DE3 A;  4AKZ A;  2RNT A;  2BO9 B;  3JUQ A;  1OAC A;  3T8U A;  1GY7 A;  4HZ9 B;  1O7M B;  4J5K A;  1LOV A;  2CFK A;  1WQL B;  1RGH A;  1VQO 3;  5DRE A;  1HU9 A;  1OF5 B;  4L7K A;  4R1K A;  5AYS C;  1LNI A;  2W56 B;  1IQX A;  1GY6 A;  3MWZ A;  4H61 A;  3WR2 A;  3N54 B;  2FGT A;  5IER A;  1IYY A;  3FF2 A;  1YJ9 3;  1W6C A;  3CCU 3;  3URP A;  1M1X B;  3BU4 A;  5LC6 A;  3CXC 2;  1Q7H A;  1GMQ A;  5CK6 A;  2C4B A;  4RZM A;  3GZR A;  1ISK A;  1VQL 3;  4STD A;  3IJE B;  5CLK A;  3BIR A;  3HZP A;  5GSP A;  1IVU A;  1ZX2 A;  3GZX B;  3PCR A;  3SVA A;  3AMO A;  4J8T A;  1YHQ 3;  1MWS A;  1UGH I;  1STD A;  3CNM A;  2XSO B;  6STD A;  2F56 A;  2RFR A;  3X41 A;  2KF4 A;  3BLZ A;  1I70 A;  1IVV A;  1Q82 4;  4MEI A;  2CFD A;  1AQZ A;  1MOL A;  1UGI A;  3SYU A;  3BB9 A;  3LT8 A;  1BNE A;  2GU1 A;  2K54 A;  5G1K A;  4BIR A;  2BMO B;  2HOH A;  1NU3 A;  1MGW A;  1RGL A;  4EV2 A;  2F5M A;  2YFI B;  1LQM B;  2Z6B A;  3F7X A;  1OHP A;  1DET A;  4OK0 A;  2RBI A;  4LEH A;  3LT9 A;  3LML A;  3CCQ 3;  1BUJ A;  3CMA 3;  2SBL A;  3DY5 A;  1IU7 A;  2H0H A;  4FMA A;  4N3V A;  2UX0 A;  1JZO A;  3AHW A;  1S72 3;  3EBT A;  1UUV B;  2GSP A;  4O8S A;  1VZZ A;  2JDI H;  3SXX A;  2MC8 A;  2HMM B;  3NV0 B;  3EBY A;  2OOV A;  1YVS A;  1IVX A;  2CFG A;  3EF8 A;  3DUK A;  3HI7 A;  1RHL A;  1VQ9 3;  1D6U A;  3BNB A;  4KFF A;  3S28 A;  2ZHX B;  3WDG B;  3GZB A;  1CH0 A;  1UUW B;  2INX A;  5M18 A;  2E2U A;  3OXA A;  5IEN A;  3F8H A;  1RTU A;  5AII A;  1TFK A;  3CC2 3;  3F40 A;  1Y4K A;  4XM4 A;  3CCV 3;  3L0R A;  2H0I A;  1QVF 2;  1QJG A;  4WYK B;  5M1A A;  3N8B A;  1DYU A;  1EEJ A;  3S29 A;  2ML6 A;  1YJW 3;  1PU4 A;  2W56 A;  5TGN A;  4BTX A;  3K5T A;  4XBX A;  1FUT A;  3D4A A;  3DGN A;  5AI1 A;  1O7P B;  1BNS A;  1V58 A;  3CCE 3;  2XGN A;  2XFS A;  3FLJ A;  3KN4 A;  4G1M B;  3SLU A;  5CF2 A;  1IV9 A;  2JQ5 A;  3UNL A;  5AYR B;  5BIR A;  1UCK A;  1JNQ A;  2KF5 A;  2F4Y A;  1YGW A;  3K7C A;  3A76 A;  4NRE A;  4FMD A;  1STF I;  2IY2 A;  3MHE A;  3S27 A;  2CK3 H;  1OPY A;  3Q3F A;  1W00 A;  5EEO A;  4I4K A;  2R41 A;  1Z1S A;  1B21 A;  5IG0 A;  3MG3 A;  5A0O B;  2CH9 A;  4HVN A;  5IF6 A;  1KD1 4;  1NJI 4;  4OVM A;  3EN1 B;  3LTC A;  4HM3 B;  1RKY A;  1U5O A;  3Q2P A;  1YNV X;  3K63 A;  1F8N A;  3DM8 A;  1BRH A;  3FF0 A;  4HZB B;  2OWP A;  5EVH A;  1HKX A;  1MWR A;  4FCZ A;  2UUG C;  3OWS A;  1B2U A;  3IMA B;  1G96 A;  1MGR A;  3ZFZ A;  3KII A;  2CFL A;  1RN7 A;  1NWW A;  1D6Z A;  4MMX B;  5IEP A;  3D79 A;  1JN5 A;  3FH1 A;  4EBG A;  3JUN A;  3Q90 A;  2BMQ B;  1YI2 3;  2L1S A;  3WOF B;  1RGA A;  2B1X B;  3RNT A;  1FGT A;  1UW1 A;  2RCD A;  3DMC A;  4JRF A;  3STD A;  4ZM8 A;  4Q53 A;  1A2P A;  2M7O A;  1UCL A;  3G8Z A;  1JBT A;  4BL2 A;  1LOY A;  2ZA4 A;  3EC9 A;  3EE1 A;  2QA4 3;  3V99 A;  5EQL A;  3LZA A;  4FMC A;  4WYK A;  3SOA A;  3CC7 3;  2H0G A;  4RNY A;  1FGM A;  1NDO B;  1ZO2 A;  3ECF A;  4RNZ A;  4XBY A;  4RBN A;  1YIT 3;  4K1U A;  1Q42 A;  5AEW B;  1E3R A;  3JVC A;  2A15 A;  2OQE A;  2KRT A;  1UUG B;  3CNX A;  3JUP A;  2P38 A;  1B3S A;  2GBX B;  3G4S 3;  1BNG A;  1UI8 A;  3FSD A;  1OHS A;  1I3F A;  3VGN A;  4FMB A;  1FUS A;  3DGM A;  3BNC A;  1VQN 3;  3S67 A;  4XDW A;  3T0U A;  1B2M A;  2AAE A;  1YIJ 3;  2V1L A;  2HMO B;  8RNT A;  4N6U A;  1I8V A;  1SIH A;  3D5G A;  2XGL A;  3VF1 A;  2CHC A;  1KQS 2;  3UJM A;  3RGA A;  3D5I A;  3OV4 A;  1FGQ A;  1VQ4 3;  1BIR A;  1BRS A;  1YVB I;  5AEU B;  1D6Y A;  5DRV A;  2E2T A;  1FGR A;  1FZU A;  2KAA A;  1T2I A;  2OTJ 3;  3KSE D;  1KWI A;  1ULJ B;  1T2H A;  2Q07 A;  1BSE A;  1YGE A;  2PNC A;  3NUV A;  3U1W A;  2F99 A;  1A2K A;  1BAO A;  2O3O A;  4HYZ A;  1JBR A;  2F98 A;  2YFL B;  4K90 B;  1A2V A;  3MG1 A;  1GMP A;  1O7W B;  2ZL8 A;  4FCM A;  1GD3 A;  4JF8 A;  1RN1 A;  1GD4 A;  2PZV A;  3NQY A;  3G71 3;  1QMA A;  3OWY A;  1Q86 4;  3HIG A;  1GYB A;  2Z77 A;  2XR8 B;  1SAR A;  3MG2 A;  3EX9 A;  2OCT A;  3LOY A;  2HMN B;  1E3V A;  1CQS A;  4HBR A;  4NPB A;  1OH0 A;  3PGB A;  3SX1 A;  2GU3 A;  4LYL B;  3G16 A;  1TP6 A;  4HM0 B;  3TDG A;  1V74 A;  1RGE A;  5KP3 A;  1EQK A;  4GSP A;  2J8X B;  4R9L A;  2I9W A;  3EJV A;  3MSO A;  3SED A;  1Q40 B;  5AIH A;  5ELJ A;  2P0M A;  3FG1 A;  2IA7 A;  3AGO A;  5CF1 A;  2IUJ A;  5BU4 A;  2Z76 A;  1TTO A;  1W6G A;  3KFQ C;  4QWT A;  3V98 A;  1M90 4;  2C11 A;  2F86 B;  3CCS 3;  1N5P A;  3D3L A;  2AAD A;  3SOY A;  2UGI A;  1RSN A;  1LOW A;  4IIA A;  1JKG B;  4HAA A;  4WP5 A;  4J5G A;  3DGO A;  3KZT A;  3UB1 A;  2Y74 A;  3ZG5 A;  1BSA A;  2IMJ A;  2CW9 A;  1OUN A;  1BNF A;  3K0Z A;  3KCH A;  1OF5 A;  1I2E A;  1T3B A;  3QK9 A;  3NBJ A;  1PY3 A;  2BNG A;  1C54 A;  1TUH A;  1VQQ A;  4ORL A;  1RGC A;  3ALA A;  1JZD A;  3F14 A;  1UDI I;  3ER7 A;  5G2G A;  1QAK A;  1TU5 A;  2WOF A;  4HM1 B;  3CME 3;  1RN4 A;  2B24 B;  4EXR A;  5M19 A;  3NBB A;  1QAF A;  4IPB A;  1R4Y A;  1K73 4;  4AKY A;  1IVW A;  2RGQ A;  3KE7 A;  3LH4 A;  1A67 A;  4R4K A;  5RNT A;  3JUM A;  3NX0 A;  1BAN A;  3RDE A;  3E99 A;  1EA2 A;  1HYF A;  5D83 A;  3CPO A;  3KSP A;  2CFW A;  3U97 A;  2W0Q A;  1Q81 4;  4TX4 A;  4WHA A;  2XRX B;  5FW5 A;  1JB4 A;  1W5Z A;  1FUW A;  2CWT A;  3EHC A;  4KT3 B;  5LC7 A;  4K1V A;  1EUI C;  1YJN 3;  4BTY A;  3I56 3;  2XFT A;  3HII A;  4BU4 A;  2ZDJ A;  3ROB A;  3BNE A;  3FCS B;  1IV7 A;  4N6T A;  4AEQ A;  2CG0 A;  1RDS A;  2XEP A;  4DKI A;  1BSB A;  2P05 A;  3AHS A;  1VQM 3;  2KXG A;  3AMO B;  1B27 A;  1MWU A;  1Q9E A;  3NV0 A;  1NB3 I;  4GB5 A;  2F5W A;  3F8X A;  1GOU A;  3QRD A;  1L5G B;  4MMY B;  1RCL A;  2LYX A;  3LTD A;  1RNB A;  1RJO A;  2BU4 A;  1OGZ A;  2Z7A A;  2P0X A;  3DGY A;  1LVN A;  2ML5 A;  1M9G A;  2STD A;  3GRD A;  3M8C A;  3O8Y A;  5ELU A;  3PCS A;  1RNT A;  1PFP A;  2BHM A;  4N6O B;  5BXQ A;  2Y73 A;  2FXT A;  4HOH A;  1O7H B;  3HK4 A;  1OHO A;  1SJW A;  1MWT A;  1UCI A;  4FR9 A;  4ILF A;  2K0M A;  1JV2 B;  1VQK 3;  1N8R 4;  5FGO A;  1I0V A;  2CX1 A;  3J7Y d;  3Q1C A;  1TFO A;  5AIF A;  1BNI A;  1RGG A;  3A5E A;  2FNQ A;  1VQ5 3;  1W02 A;  4K61 A;  2WOH A;  5IG3 A;  3DGL A;  1X1U A;  1AV4 A;  1O7G B;  2XH9 A;  4HJL B;  1W2B 2;  2IUK A;  2GXF A;  2YFJ B;  1JRQ A;  3CPW 2;  3K9M C;  3LYG A;  1M1K 4;  2IYJ A;  4WFO A;  3G6E 3;  1DMM A;  1TRP A;  5CXO A;  1G02 A;  1VQ8 3;  4MMZ B;  3DH2 A;  3GAX A;  3WOD G;  1VQ6 3;  1I3I A;  3MYT A;  9RNT A;  3DXO A;  4R9K A;  1DVD A;  1O7N B;  1NB5 I;  4N6N B;  2WGO A;  3EQQ B;  1X1Y A;  1GY5 A;  3HX8 A;  3I55 3;  1A90 A;  1RCK A;  1B2S A;  3D9R A;  5STD A;  2HMJ B;  1EG9 B;  4BTW A;  1T5Y A;  4N6V 0;  1RGK A;  3IPT A;  1B2X A;  1AY7 A;  4HM2 B;  3F9S A;  2K3D A;  2GBW B;  2KF3 A;  1IQY A;  3X3Z A;  1RMS A;  3NXJ A;  1W6Y A; 
#chains in the Genus database with same CATH homology
 4O3V A;  1K41 A;  1ASK A;  2C10 A;  1EKM A;  4LSO A;  1U8C B;  2XF3 A;  3NM7 A;  2W2C A;  2D42 A;  3FKA A;  3T8N A;  2QEX 3;  1E97 A;  4N6M A;  3FZW A;  1TIJ A;  2LQV A;  2CKF B;  3FG3 A;  4KZ1 A;  5JPU A;  4MJD A;  3G0K A;  1FA3 A;  1W2Z A;  4X2O A;  1RRH A;  3OX9 A;  4EV5 A;  3CCM 3;  2OTL 3;  2W03 A;  1SQW A;  1IT7 A;  3H51 A;  4LGQ A;  8CHO A;  3JUO A;  2BMR B;  4L8O A;  3DZL A;  7STD A;  5JBS A;  1LNH A;  2GEX A;  1C7H A;  4KVH A;  2CWV A;  3X3X A;  1OCV A;  4R80 A;  5BVB A;  3EB8 A;  1SII A;  3NHX A;  3PZW A;  1JB5 A;  1WMO A;  3NBR A;  3WMD A;  3CCR 3;  1CYU A;  3MKI A;  4OUQ A;  1CYV A;  3GZY B;  5D81 A;  4EYC A;  3OW2 2;  4CDL A;  1BUQ A;  1AR0 A;  4LZI A;  1K28 A;  2OOV C;  1IK3 A;  1CEW I;  4GL6 A;  1DMQ A;  4XB5 A;  1AVL A;  1WNH A;  1JN5 B;  1US1 A;  1IT8 A;  1GS3 A;  1S5A A;  3FGY A;  1R4C A;  3I0Y A;  3KKG A;  4O02 B;  3H3H A;  5KP1 A;  1K8A 4;  3LXU X;  2D1W A;  2YX9 A;  4PEJ A;  2KCD A;  1JJ2 2;  3VSY A;  1J2B A;  2GEY A;  4HM5 B;  1DVC A;  3EN8 A;  4EC6 A;  3X3Y A;  4CCV A;  1MNL A;  1KC8 4;  2W9Q A;  1IQ8 A;  1QAL A;  3PS8 A;  1FGO A;  1RRL A;  1W7C A;  4HM4 B;  3F7S A;  3UL5 A;  2HMK B;  2WO0 A;  3X40 A;  1IDP A;  2CC3 A;  1NO3 A;  1N9E A;  4LMI A;  4IT7 A;  3OWU A;  3NQZ A;  1DMN A;  4O2H A;  5I97 A;  2L4V A;  3S5C A;  3CC4 3;  1LOX A;  1AVK A;  3NM2 A;  4U13 A;  2CIU A;  1JB2 A;  3LTA A;  1SPU A;  1N5H A;  1N8Q A;  2BT3 A;  3RGR A;  3B7C A;  3B4P A;  3BND A;  3PXM A;  3WA2 X;  5HGR A;  4HM8 B;  4N6L A;  3B4O A;  1KSI A;  4HM6 B;  1N9J A;  3MPH A;  4FCJ A;  5IEO A;  1VQP 3;  3PYJ A;  5IW9 A;  2RSX A;  2P09 A;  1Q40 A;  5JPP A;  3WA3 A;  3FG4 A;  1UI7 A;  4L8P A;  1WMN A;  1ULI B;  3UL6 A;  2CWU A;  1QVG 2;  5IG4 A;  3V92 A;  2R4I A;  4KFE A;  3GWR A;  1WMP A;  1JKG A;  2CG1 A;  3N9H A;  5IG5 A;  4HKV B;  2MF7 A;  1WTH A;  4J9A A;  4X2H A;  3CCL 3;  4H3U A;  1Q7Y 4;  1W01 A;  2QGU A;  2WGQ A;  4XDV A;  3CD6 3;  1K9M 4;  4KFD A;  4NHF A;  1LXE A;  2O9U X;  4XBT A;  1ROA A;  4WWU C;  2W9P A;  2E2V A;  1VQ7 3;  2W04 A;  3X42 A;  2QIY A;  3B8L A;  3LTB A;  1W4N A;  5KP4 A;  5AIG A;  2OQE C;  3WOE B;  2W6J H;  1OGX A;  2XSH B;  3CU3 A;  3CCJ 3;  1ROV A;  4HM7 B;  5D82 A;  2HML B;  4AKZ A;  3JUQ A;  2BO9 B;  3T8U A;  1OAC A;  1GY7 A;  4HZ9 B;  1O7M B;  2CFK A;  1WQL B;  1VQO 3;  5DRE A;  1HU9 A;  1OF5 B;  4L7K A;  4R1K A;  5AYS C;  2W56 B;  1IQX A;  1GY6 A;  3MWZ A;  4H61 A;  3N54 B;  2FGT A;  5IER A;  3FF2 A;  1YJ9 3;  1W6C A;  3CCU 3;  1M1X B;  5LC6 A;  3CXC 2;  5CK6 A;  4RZM A;  3GZR A;  1ISK A;  1VQL 3;  4STD A;  3IJE B;  5CLK A;  3HZP A;  1IVU A;  1ZX2 A;  3GZX B;  3PCR A;  3SVA A;  3AMO A;  4J8T A;  1YHQ 3;  1STD A;  3CNM A;  2XSO B;  6STD A;  2RFR A;  3X41 A;  3BLZ A;  1IVV A;  1Q82 4;  4MEI A;  2CFD A;  1MOL A;  3BB9 A;  3LT8 A;  2GU1 A;  2K54 A;  2BMO B;  1NU3 A;  4EV2 A;  2YFI B;  2Z6B A;  3F7X A;  1OHP A;  4OK0 A;  4LEH A;  3LT9 A;  3LML A;  3CCQ 3;  3CMA 3;  2SBL A;  3DY5 A;  1IU7 A;  4FMA A;  4N3V A;  2UX0 A;  1S72 3;  3EBT A;  1UUV B;  4O8S A;  1VZZ A;  2JDI H;  3SXX A;  2MC8 A;  2HMM B;  3NV0 B;  3EBY A;  2OOV A;  1IVX A;  2CFG A;  3EF8 A;  3DUK A;  3HI7 A;  1VQ9 3;  1D6U A;  3BNB A;  4KFF A;  3S28 A;  3WDG B;  3GZB A;  1UUW B;  2INX A;  2E2U A;  3OXA A;  5IEN A;  3F8H A;  5AII A;  1TFK A;  3CC2 3;  3F40 A;  1Y4K A;  4XM4 A;  3CCV 3;  3L0R A;  1QVF 2;  1QJG A;  4WYK B;  3N8B A;  1DYU A;  3S29 A;  2ML6 A;  1YJW 3;  1PU4 A;  2W56 A;  5TGN A;  4BTX A;  3K5T A;  4XBX A;  3DGN A;  5AI1 A;  1O7P B;  3CCE 3;  2XGN A;  2XFS A;  3FLJ A;  3KN4 A;  4G1M B;  3SLU A;  5CF2 A;  1IV9 A;  2JQ5 A;  3UNL A;  5AYR B;  1JNQ A;  4NRE A;  3K7C A;  3A76 A;  4FMD A;  1STF I;  3S27 A;  3MHE A;  2CK3 H;  1OPY A;  1W00 A;  5EEO A;  4I4K A;  1Z1S A;  5IG0 A;  3MG3 A;  5A0O B;  2CH9 A;  4HVN A;  5IF6 A;  1KD1 4;  1NJI 4;  4OVM A;  3EN1 B;  3LTC A;  4HM3 B;  1RKY A;  1U5O A;  3Q2P A;  3K63 A;  1F8N A;  3DM8 A;  3FF0 A;  4HZB B;  2OWP A;  5EVH A;  1HKX A;  4FCZ A;  3OWS A;  3IMA B;  1G96 A;  3KII A;  2CFL A;  1RN7 A;  1NWW A;  1D6Z A;  4MMX B;  5IEP A;  1JN5 A;  3FH1 A;  4EBG A;  3JUN A;  3Q90 A;  2BMQ B;  1YI2 3;  3WOF B;  2B1X B;  1FGT A;  1UW1 A;  2RCD A;  3DMC A;  4JRF A;  3STD A;  4ZM8 A;  4Q53 A;  2M7O A;  3G8Z A;  3EC9 A;  3EE1 A;  2QA4 3;  3V99 A;  5EQL A;  3LZA A;  4FMC A;  4WYK A;  3SOA A;  3CC7 3;  4RNY A;  1FGM A;  1NDO B;  1ZO2 A;  3ECF A;  4RNZ A;  4XBY A;  4RBN A;  1YIT 3;  4K1U A;  1Q42 A;  5AEW B;  1E3R A;  3JVC A;  2A15 A;  2OQE A;  2KRT A;  3JUP A;  3CNX A;  2P38 A;  3G4S 3;  2GBX B;  1UI8 A;  3FSD A;  1OHS A;  3VGN A;  4FMB A;  3DGM A;  3BNC A;  1VQN 3;  3S67 A;  4XDW A;  3T0U A;  1YIJ 3;  2V1L A;  2HMO B;  4N6U A;  1SIH A;  2XGL A;  3VF1 A;  2CHC A;  1KQS 2;  3UJM A;  3RGA A;  3OV4 A;  1FGQ A;  1VQ4 3;  1YVB I;  5AEU B;  1D6Y A;  5DRV A;  2E2T A;  1FGR A;  2OTJ 3;  3KSE D;  1KWI A;  1ULJ B;  2Q07 A;  1YGE A;  2PNC A;  3NUV A;  3U1W A;  2F99 A;  1A2K A;  2O3O A;  4HYZ A;  2F98 A;  2YFL B;  4K90 B;  1A2V A;  3MG1 A;  1O7W B;  2ZL8 A;  4FCM A;  1GD3 A;  4JF8 A;  3G71 3;  1GD4 A;  2PZV A;  3NQY A;  1QMA A;  3OWY A;  1Q86 4;  3HIG A;  1GYB A;  2Z77 A;  2XR8 B;  3MG2 A;  3EX9 A;  2OCT A;  3LOY A;  2HMN B;  1E3V A;  1CQS A;  4HBR A;  1OH0 A;  3PGB A;  3SX1 A;  2GU3 A;  3G16 A;  1TP6 A;  4HM0 B;  3TDG A;  1V74 A;  5KP3 A;  1EQK A;  4R9L A;  2I9W A;  3EJV A;  3MSO A;  3SED A;  1Q40 B;  5AIH A;  5ELJ A;  2P0M A;  3FG1 A;  2IA7 A;  5CF1 A;  2IUJ A;  2Z76 A;  4QWT A;  1W6G A;  3KFQ C;  1M90 4;  3V98 A;  2C11 A;  2F86 B;  3CCS 3;  1N5P A;  3D3L A;  3SOY A;  4WP5 A;  4IIA A;  1JKG B;  3DGO A;  3KZT A;  3UB1 A;  2Y74 A;  2IMJ A;  2CW9 A;  1OUN A;  3K0Z A;  1OF5 A;  3QK9 A;  3NBJ A;  2BNG A;  1TUH A;  4ORL A;  3ALA A;  3F14 A;  5G2G A;  3ER7 A;  1QAK A;  1TU5 A;  2WOF A;  4HM1 B;  3CME 3;  4EXR A;  2B24 B;  3NBB A;  1QAF A;  4IPB A;  1K73 4;  4AKY A;  1IVW A;  2RGQ A;  3KE7 A;  3LH4 A;  1A67 A;  4R4K A;  3JUM A;  3NX0 A;  3RDE A;  3E99 A;  1EA2 A;  5D83 A;  3CPO A;  3KSP A;  2CFW A;  3U97 A;  2W0Q A;  1Q81 4;  4TX4 A;  4WHA A;  2XRX B;  5FW5 A;  1JB4 A;  1W5Z A;  1FUW A;  2CWT A;  3EHC A;  5LC7 A;  4K1V A;  1YJN 3;  4BTY A;  3I56 3;  2XFT A;  3HII A;  2ZDJ A;  3ROB A;  3BNE A;  3FCS B;  1IV7 A;  4N6T A;  4AEQ A;  2CG0 A;  2XEP A;  2P05 A;  1VQM 3;  2KXG A;  3AMO B;  3NV0 A;  1NB3 I;  4GB5 A;  3F8X A;  3QRD A;  1L5G B;  4MMY B;  2LYX A;  3LTD A;  1RJO A;  1OGZ A;  2Z7A A;  2P0X A;  1LVN A;  2ML5 A;  1M9G A;  2STD A;  3GRD A;  3M8C A;  3O8Y A;  5ELU A;  3PCS A;  1PFP A;  2BHM A;  4N6O B;  5BXQ A;  2Y73 A;  2FXT A;  1O7H B;  3HK4 A;  1OHO A;  1SJW A;  4FR9 A;  1VQK 3;  2K0M A;  1JV2 B;  1N8R 4;  5FGO A;  3J7Y d;  3Q1C A;  1TFO A;  5AIF A;  2FNQ A;  1VQ5 3;  1W02 A;  4K61 A;  2WOH A;  5IG3 A;  3DGL A;  1AV4 A;  1O7G B;  2XH9 A;  4HJL B;  1W2B 2;  2IUK A;  2GXF A;  2YFJ B;  1JRQ A;  3CPW 2;  3K9M C;  3LYG A;  1M1K 4;  4WFO A;  3G6E 3;  1DMM A;  5CXO A;  1VQ8 3;  4MMZ B;  3GAX A;  3WOD G;  1VQ6 3;  3MYT A;  3DXO A;  4R9K A;  1DVD A;  1O7N B;  1NB5 I;  4N6N B;  2WGO A;  3EQQ B;  3HX8 A;  1GY5 A;  3I55 3;  1A90 A;  3D9R A;  5STD A;  2HMJ B;  1EG9 B;  4BTW A;  1T5Y A;  4N6V 0;  3IPT A;  4HM2 B;  3F9S A;  2GBW B;  1IQY A;  3X3Z A;  3NXJ A;  1W6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...