1G96A

Human cystatin c; dimeric form with 3d domain swapping
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords CYSTATIN C
publication title Human cystatin C, an amyloidogenic protein, dimerizes through three-dimensional domain swapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1g96A00
4CCVA 1KWIA 1LXEA 3SVAA 4EYCA 4LZIA 4N6MA 1WNHA 1R4CA 5EQLA 1N5PA 1CYVA 1NB3I 2BO9B 4N6UA 3S67A 2KXGA 1GD3A 3Q2PA 1ROAA 2CH9A 5ELUA 1DVCA 1IV7A 1IV9A 1CYUA 1FA3A 1GD4A 1CEWI 4TX4A 2W9QA 4N6TA 2O9UX 1EQKA 3L0RA 3KSED 1DVDA 1FUWA 5LC6A 3PXMA 4N6LA 5LC7A 5ELJA 5A0OB 3LH4A 4ZM8A 3IMAB 3UL5A 1NB5I 1YVBI 1MOLA 1STFI 3PYJA 1M9GA 1A90A 1A67A 4N6V0 3NX0A 4IT7A 3GAXA 1MNLA 3KFQC 3MWZA 4N6OB 1G96A 1PFPA 3K9MC 2W9PA 1TIJA 1N9JA 1N5HA 4N6NB 3UL6A 3PS8A 3QRDA 2OCTA 1RN7A
chains in the Genus database with same CATH superfamily
3EC9A 1X1YA 1GS3A 1V57A 3X40A 1J2BA 4PEJA 2YFLB 1R4YA 2RBIA 1LOYA 4I4KA 4XBXA 1AVKA 2H0IA 1KD14 3LTCA 5BXQA 1DETA 2UX0A 2CK3H 3V98A 1IQXA 1VZZA 1ROVA 4STDA 3SX1A 1IVUA 3S28A 4R9LA 3FH1A 1IT7A 2GEYA 2XSOB 1IQYA 1BANA 4KVHA 1R4CA 3OX9A 5AIFA 1BRSA 1RCKA 1BU4A 1WTHA 3OV4A 5RNTA 5G1KA 4N6UA 2PZVA 1STDA 3MHEA 1VQM3 4IIAA 1LOXA 4XBYA 3Q90A 4HM8B 4FMDA 2OQEC 3UJMA 3H3HA 4EXRA 1G0TA 1JNQA 4AEQA 3JVCA 3WODG 4OUQA 3F40A 4HZBB 1QJGA 3D79A 1MWTA 1RCLA 2KF6A 4O8SA 1NDOB 5I97A 1IV9A 3FZWA 3GRDA 2W0QA 2Y74A 2K54A 4HM4B 1D6UA 1VQ83 2RSXA 3ECFA 4J5KA 1JB2A 1LOVA 1TRQA 1FA3A 1AQZA 2Q07A 1JJ22 1SIIA 1GD4A 4O2HA 1CEWI 1VQO3 4JRFA 1I8VA 2XFSA 1MWSA 4KFDA 5CK6A 3AHSA 3LTAA 3OWSA 1RGGA 1TTOA 4R1KA 5IEPA 1GY5A 4ORLA 2O9UX 4HM2B 4EBGA 3CU3A 3FG4A 4GSPA 1BRKA 1GMRA 1KQS2 1I0VA 2SBLA 4R80A 4CPKA 1QALA 2RFRA 2ZHXB 2K0MA 3ALAA 3D5GA 3F8HA 3HZPA 5KP1A 3KSED 2KRTA 1Q824 1ZX2A 1Q864 1HU9A 5IG3A 7STDA 1YNVX 4FCMA 3EBTA 1OHPA 3CPOA 4J9AA 3U97A 1Q814 3PXMA 1W01A 1W00A 3NBBA 2F99A 1C7HA 1EG9B 1UI7A 5LC7A 3CME3 4CDLA 2D42A 1RRHA 2F86B 2IA7A 3LTBA 5IG0A 2Z6BA 3WOEB 1ULIB 5BVBA 1JB4A 1ASKA 1RJOA 3IMAB 1W6YA 1NNVA 1VQ73 1FUSA 2PNCA 1QVF2 4R9KA 3EQQB 1OGZA 3PYJA 3PCRA 1S723 1D6ZA 1M9GA 1HZ1A 3KIIA 3U1WA 2CHCA 4HM1B 5AIIA 2B1XB 1A90A 1LNIA 5STDA 5BIRA 3WHOA 3CCQ3 3J7Yd 3N54B 1IU7A 1VQ43 1BUQA 5AI1A 2ZL8A 3T0UA 1RGFA 2OOVC 1DMMA 3F9SA 3FGYA 1JN5B 1S5AA 3F14A 4IT7A 1QMAA 1RRLA 1Q40A 2BMQB 1BNEA 2R41A 4WHAA 2V1LA 1M1K4 1MGRA 5CF2A 1FGTA 3KKGA 1I3FA 3AGNA 4NPBA 1TIJA 3STDA 2H0HA 3LMLA 1N5HA 1Q7HA 1UUVB 1RHLA 1A2VA 1W6GA 2C4BA 2GU3A 2OWPA 2P05A 3EBYA 1LRAA 1PYLA 1IVVA 3FF2A 3JUPA 2QIYA 3PS8A 6STDA 2HMLB 1EKMA 2JQ5A 3OW22 1RN7A 2BNGA 2HOHA 1BAOA 3D5IA 1W6CA 4L8PA 3OWYA 5M1AA 2IUKA 1IQ8A 3GZBA 3PCSA 1BSDA 1NU3A 2XGNA 1Q42A 2B24B 3I0YA 2CFWA 6RNTA 2W56A 1O7WB 1FGRA 2CW9A 5G1LA 4HM7B 3EN1B 4EYCA 1BNJA 4K1VA 4LZIA 5CF1A 1QAKA 1ZO2A 2E2TA 3G8ZA 4N6MA 1BSCA 2KF5A 2A15A 2RGQA 1RGCA 2XH9A 1B2SA 3IPTA 2XFTA 3G6E3 1U8CB 1RN4A 1C54A 3OWUA 3O8YA 3F8XA 4L7KA 5AYRB 4MJDA 4LEHA 3MPHA 2IYJA 5AIHA 2KXGA 3DGNA 4FMBA 1JZOA 3Q2PA 5M18A 1OACA 3EB8A 3GZXB 5ELUA 2FNQA 4FCZA 2D1WA 3NV0A 1SIHA 1M1XB 4DKIA 1W4NA 3G4S3 1K8A4 3DGLA 1AY7A 2KAAA 2AAEA 2BT3A 3T8UA 2BIRA 3IJEB 4HAAA 3NM7A 1N8R4 1FW7A 3HK4A 3DH2A 3X3ZA 5IEOA 1I2GA 2QEX3 3ER7A 1CYUA 3X42A 4J8TA 3SXXA 1K28A 1B3SA 4TX4A 3NBJA 4XB5A 1GYBA 3K7CA 2MF7A 2W9QA 3JUNA 1US1A 3HIIA 2OTJ3 4KZ1A 1B2UA 4GHOA 3A76A 5AEWB 2XSHB 1YIJ3 2Z7AA 2J8XB 3G713 3LTDA 1UW1A 1SPUA 1MGWA 3CPW2 1UDII 2CFDA 3K63A 2CFKA 3NBRA 1B2ZA 4CJNA 1E97A 1FYSA 1RGHA 3FG3A 4EV2A 2GBWB 1GOUA 2GU1A 1FUWA 3FCSB 1X1UA 1HYFA 3X3YA 4FCJA 4N6LA 2GSPA 1O7HB 4I5QA 1N9EA 3F7XA 3EF8A 4NREA 1TFOA 2XR8B 1OF5A 3V92A 2F4YA 4MMZB 5A0OB 4BL3A 1IK3A 3CC23 1BNSA 3K0ZA 1VQ53 2OQEA 3GWRA 4ZM8A 1DMQA 4WP5A 1BNFA 1A2PA 1KC84 5JPUA 4EV5A 1X1WA 2W2CA 1LVNA 2C10A 2YFIB 3MKIA 2STDA 4HM3B 1YIT3 1ZS7A 3CNXA 3FLJA 2L4VA 3LYGA 3OXAA 1HKXA 4GB5A 2IUJA 5JPPA 1VQP3 4BTXA 1YJN3 1OCVA 2W6JH 4WYKA 3I553 3Q3FA 1T5YA 3TDGA 3NX0A 2W03A 2CFLA 4G1MB 3GAXA 1MNLA 3KFQC 4BTYA 2Z77A 1W02A 3B7CA 2FGTA 1VQQA 3FF0A 2OTL3 4N3VA 3D9RA 3CNMA 1N9JA 1B2XA 1FGOA 2AADA 2LQVA 5KP4A 1TUHA 3UL6A 3M8CA 4J5GA 1T2IA 2F98A 2RNTA 1UUGB 3CCL3 1LXEA 2OCTA 4O02B 1JB5A 5EEOA 2E2VA 3X41A 4MEIA 1WMPA 7RNTA 1RSNA 4KFEA 4OVMA 1GSPA 9RNTA 1KSIA 1FGMA 2C11A 5AYSC 1PU4A 1E3VA 4RBNA 3K5TA 3RNTA 1RGEA 1I70A 1GOVA 1NO3A 1W5ZA 3A5EA 3DXOA 2HMMB 1I2EA 4K90B 3VSYA 2CWUA 2W04A 4KFFA 3FKAA 2Y73A 8RNTA 2F5WA 4H61A 2UGIA 1I3IA 4R4KA 5IG5A 4HZ9B 8CHOA 2CWTA 5AIGA 1UCJA 1CYVA 2BO9B 2WOHA 2WOFA 5AEUB 4FMAA 3S67A 1EUIC 2W56B 1BNRA 4H3UA 3KCHA 1GMPA 4HKVB 2XRXB 1GD3A 1WMNA 3HX8A 4NHFA 3ZG5A 5EVHA 1YJ93 1BUJA 1BRHA 1I0XA 3NQYA 3JUOA 3NQZA 1IYYA 1OH0A 1JKGA 1UGHI 1O7GB 2ML5A 5FW5A 4XBTA 1UCIA 1PY3A 3MG3A 5M19A 1BSBA 1BIRA 4BTWA 1UCLA 4MMYB 4BIRA 4O3VA 1RTUA 1SJWA 3BNCA 3PZWA 5CXOA 3WR2A 1B20A 1T2HA 2L1SA 4HBRA 1ISKA 4BU4A 3NUVA 1YHQ3 2RCDA 1B21A 3DGYA 1IDPA 1U5OA 3CCJ3 2INXA 3NV0B 2ML6A 3DGMA 4GL6A 3CCM3 5IENA 2IMJA 1JBSA 3B4OA 2QA43 3S5CA 1G02A 1AVLA 2P38A 1BVIA 1L5GB 5JBSA 1A2KA 3BLZA 3DY5A 1Q9EA 4QWTA 1IT8A 1BRNL 1EQKA 1B2MA 1OUNA 4LGQA 1MWUA 1TFKA 3EN8A 1V74A 3N9HA 2CG1A 1N8QA 3CCS3 5GSPA 1RNTA 4HVNA 1W2B2 1DVDA 1Z1SA 3V99A 2YX9A 3PGBA 2XF3A 3BNBA 2ZDJA 5LC6A 3KN4A 3DMCA 1UCKA 1VQL3 4L8OA 5D81A 2UUGC 3G0KA 3EE1A 4HM0B 1BRJA 1BRGA 2KF3A 3SLUA 3LOYA 4LSOA 1BSAA 1NWWA 1IVXA 3F7SA 6GSPA 3FG1A 1WMOA 5TGNA 1YVBI 3UL5A 1EEJA 1RDSA 1W7CA 1MOLA 3GZRA 1STFI 3NM2A 3LT8A 3CMA3 1M904 3AMOA 3B4PA 1ULJB 4OK0A 3E99A 4X2HA 1GY6A 1RMSA 3KE7A 2R4IA 1OF5B 1RKYA 2F5MA 5BU4A 3URPA 2MC8A 3ROBA 2QGUA 3FSDA 2GBXB 4WFOA 1RN1A 2CG0A 3BB9A 2CIUA 2XGLA 3NHXA 2M7OA 1K734 1JBRA 1BNIA 3DZLA 4KT3B 3CCU3 2HMNB 1DYUA 2BU4A 1JBTA 1PFPA 3K9MC 1QVG2 1VQN3 1TJDA 2CX1A 1YGWA 3BIRA 3MYTA 2P09A 1O7PB 4U13A 5HGRA 2I9WA 4N6NB 1OGXA 5IW9A 1GY7A 4FMCA 1G96A 3EX9A 4WYKB 3QRDA 4CCVA 2GXFA 1KWIA 1JZDA 4WWUC 4EC6A 4AKZA 1FZUA 1W2ZA 4LYLB 1MWRA 1O7NB 2BHMA 1FUTA 3H51A 3LT9A 2H0GA 2GEXA 7GSPA 3X3XA 4JF8A 2IY2A 3EHCA 1V58A 1UGIA 1E3RA 1OHSA 3DGOA 3SVAA 1SARA 2HMJB 1NJI4 3CCV3 3EJVA 3BNDA 3S29A 4XDVA 3GSPA 1D6YA 1WNHA 2ZA4A 3VF1A 2BMRB 3JUQA 3AHWA 5D82A 1JRQA 5EQLA 2WO0A 1N5PA 3T8NA 1NB3I 1IVWA 3CCR3 3GZYB 5DREA 2FXTA 3RGRA 1K9M4 1OHOA 2O3OA 1ROAA 2CH9A 3DUKA 1TU5A 3CXC2 1Q40B 1DVCA 2E2UA 3MG1A 5CLKA 1IV7A 1BRIA 4K1UA 3ZFZA 1LNHA 4XDWA 1SQWA 3CC43 3WA2X 5D83A 3UNLA 2JDIH 2KF4A 1BSEA 2SARA 3DM8A 4ILFA 3KZTA 3RDEA 4HM5B 1YGEA 1GOYA 3SOYA 1VQK3 1AV4A 1LQGC 3AGOA 5IF6A 3D3LA 1DMNA 1TP6A 1TRPA 2XEPA 2CWVA 4HYZA 3LZAA 1JKGB 3WA3A 3D4AA 4N6TA 3WOFB 1T3BA 1DE3A 3NXJA 1CQSA 1B27A 3Q1CA 2OOVA 3HOHA 1RNBA 3UB1A 1CH0A 1BOXA 1Q7Y4 3L0RA 3N8BA 3WDGB 4RNZA 1BGSA 1YVSA 3CD63 3QK9A 1RGLA 3ZG0A 2KCDA 5IERA 2HMKB 1OPYA 2WGQA 1AR0A 1ZGXA 1X1XA 4IPBA 3VGNA 2WGOA 3JUMA 5ELJA 3G16A 2CC3A 3SYUA 1UI8A 4BL2A 3LH4A 1YI23 1O7MB 4RNYA 1LQMB 1RGAA 2YFJB 3MSOA 4HM6B 5FGOA 1JN5A 1I2FA 3HI7A 1NB5I 1FGQA 2K3DA 4HJLB 1GMQA 5G2GA 1RGKA 3B8LA 3KSPA 4K61A 3SOAA 4HOHA 2LYXA 2CKFB 3MG2A 4RZMA 2P0XA 4MMXB 2HMOB 1VQ93 1RLSA 4EW5A 5KP3A 3S27A 2BMOB 3SEDA 4X2OA 1A67A 1QAFA 1F8NA 4XM4A 3BNEA 4N6V0 1K41A 1WQLB 3CCE3 4RNTA 1EA2A 2P0MA 1JV2B 3MWZA 4N6OB 4FR9A 4LMIA 1VQ63 3LXUX 3RGAA 3AMOB 3BU4A 1YJW3 1UUWB 2F56A 1Y4KA 2W9PA 3CC73 2Z76A 3HIGA 5DRVA 2CX0A 5HOHA 5IG4A 2CFGA 1BNGA 4AKYA 3WMDA 3I563 4Q53A 1LOWA
chains in the Genus database with same CATH topology
3EC9A 1GS3A 3X40A 1J2BA 4PEJA 2YFLB 4I4KA 4XBXA 1AVKA 1KD14 3LTCA 5BXQA 2UX0A 2CK3H 3V98A 1IQXA 1VZZA 1ROVA 4STDA 3SX1A 1IVUA 3S28A 4R9LA 3FH1A 1IT7A 2GEYA 2XSOB 1IQYA 4KVHA 1R4CA 3OX9A 5AIFA 1WTHA 3OV4A 4N6UA 2PZVA 1STDA 3MHEA 1VQM3 4IIAA 1LOXA 4XBYA 3Q90A 4HM8B 4FMDA 2OQEC 3UJMA 3H3HA 4EXRA 1JNQA 4AEQA 3JVCA 4OUQA 3F40A 4HZBB 1QJGA 4O8SA 1NDOB 5I97A 1IV9A 3FZWA 3GRDA 2W0QA 2Y74A 2K54A 4HM4B 1D6UA 1VQ83 2RSXA 3ECFA 1JB2A 1FA3A 2Q07A 1JJ22 1SIIA 1GD4A 4O2HA 1CEWI 1VQO3 4JRFA 2XFSA 4KFDA 5CK6A 3LTAA 3OWSA 4R1KA 5IEPA 1GY5A 4ORLA 2O9UX 4HM2B 4EBGA 3CU3A 3FG4A 1KQS2 2SBLA 4R80A 1QALA 2RFRA 3F8HA 2K0MA 3ALAA 3HZPA 5KP1A 3KSED 2KRTA 1Q824 1ZX2A 1Q864 1HU9A 5IG3A 7STDA 4FCMA 3EBTA 1OHPA 3CPOA 4J9AA 3U97A 1Q814 3PXMA 1W01A 1W00A 3NBBA 2F99A 1C7HA 1EG9B 1UI7A 5LC7A 3CME3 4CDLA 2D42A 1RRHA 2F86B 2IA7A 3LTBA 5IG0A 2Z6BA 3WOEB 1ULIB 5BVBA 1JB4A 1ASKA 1RJOA 3IMAB 1W6YA 1VQ73 2PNCA 1QVF2 4R9KA 3EQQB 1OGZA 3PYJA 3PCRA 1S723 1M9GA 1D6ZA 3KIIA 3U1WA 2CHCA 4HM1B 5AIIA 2B1XB 1A90A 5STDA 3CCQ3 3J7Yd 3N54B 1IU7A 1VQ43 1BUQA 5AI1A 2ZL8A 3T0UA 2OOVC 1DMMA 3F9SA 3FGYA 1JN5B 1S5AA 3F14A 4IT7A 1QMAA 1RRLA 1Q40A 2BMQB 1M1K4 4WHAA 2V1LA 5CF2A 1FGTA 3KKGA 1TIJA 3STDA 3LMLA 1N5HA 1UUVB 1W6GA 2GU3A 1A2VA 2OWPA 3EBYA 2P05A 4QWTA 3FF2A 1IVVA 3JUPA 2QIYA 3PS8A 6STDA 2HMLB 1EKMA 2JQ5A 3OW22 1RN7A 2BNGA 4L8PA 1W6CA 3OWYA 2IUKA 1IQ8A 3GZBA 3PCSA 1NU3A 2XGNA 1Q42A 2B24B 3I0YA 2CFWA 2W56A 1O7WB 1FGRA 2CW9A 4HM7B 3EN1B 4EYCA 4K1VA 4LZIA 5CF1A 1QAKA 1ZO2A 2E2TA 3G8ZA 4N6MA 2RGQA 2A15A 2XH9A 3IPTA 2XFTA 3G6E3 1U8CB 3OWUA 3O8YA 3F8XA 4L7KA 5AYRB 4MJDA 4LEHA 3MPHA 5AIHA 2KXGA 3DGNA 4FMBA 3Q2PA 1OACA 3EB8A 3GZXB 5ELUA 2FNQA 4FCZA 2D1WA 3NV0A 1SIHA 1M1XB 1W4NA 3G4S3 1K8A4 3DGLA 2BT3A 3T8UA 3IJEB 3NM7A 1N8R4 3HK4A 3X3ZA 5IEOA 2QEX3 3ER7A 1CYUA 3X42A 4J8TA 3SXXA 1K28A 4XB5A 4TX4A 3NBJA 1GYBA 3K7CA 2MF7A 2W9QA 3JUNA 1US1A 3HIIA 2OTJ3 4KZ1A 3A76A 5AEWB 2XSHB 1YIJ3 2Z7AA 3G713 3LTDA 1UW1A 1SPUA 3CPW2 2CFDA 3K63A 2CFKA 3NBRA 1E97A 3FG3A 4EV2A 2GBWB 2GU1A 1FUWA 3FCSB 3X3YA 4FCJA 4N6LA 1O7HB 1N9EA 3F7XA 3EF8A 4NREA 1TFOA 2XR8B 1OF5A 3V92A 4MMZB 5A0OB 1IK3A 3CC23 3K0ZA 1VQ53 2OQEA 3GWRA 4ZM8A 1DMQA 4WP5A 1KC84 5JPUA 4EV5A 2W2CA 1LVNA 2C10A 2YFIB 3MKIA 2STDA 4HM3B 1YIT3 3CNXA 3FLJA 2L4VA 3LYGA 3OXAA 1HKXA 4GB5A 2IUJA 5JPPA 1VQP3 4BTXA 1YJN3 1OCVA 2W6JH 4WYKA 3I553 1T5YA 3TDGA 3NX0A 2W03A 2CFLA 4G1MB 3GAXA 1MNLA 3KFQC 4BTYA 2Z77A 1W02A 3B7CA 2FGTA 3FF0A 2OTL3 4N3VA 3D9RA 3CNMA 1N9JA 1FGOA 2LQVA 5KP4A 1TUHA 3UL6A 3M8CA 2F98A 3CCL3 2OCTA 1LXEA 4O02B 1JB5A 5EEOA 2E2VA 3X41A 4MEIA 1WMPA 4KFEA 4OVMA 1KSIA 1FGMA 2C11A 5AYSC 1PU4A 1E3VA 4RBNA 3K5TA 3DXOA 1NO3A 1W5ZA 3VSYA 4K90B 2HMMB 2CWUA 2W04A 4KFFA 3FKAA 2Y73A 4H61A 4R4KA 5IG5A 4HZ9B 8CHOA 2CWTA 5AIGA 1CYVA 2BO9B 2WOHA 2WOFA 5AEUB 4FMAA 3S67A 2W56B 4H3UA 4HKVB 2XRXB 1GD3A 1WMNA 3HX8A 4NHFA 5EVHA 1YJ93 3NQYA 3JUOA 3NQZA 1OH0A 1JKGA 1O7GB 2ML5A 5FW5A 4XBTA 3MG3A 4BTWA 4MMYB 4O3VA 1SJWA 3BNCA 3PZWA 5CXOA 4HBRA 1ISKA 3NUVA 1YHQ3 2RCDA 1IDPA 1U5OA 3CCJ3 2INXA 3NV0B 2ML6A 3DGMA 4GL6A 3CCM3 5IENA 2IMJA 3B4OA 2QA43 3S5CA 1AVLA 2P38A 1L5GB 5JBSA 1A2KA 3BLZA 3DY5A 1IT8A 1EQKA 1OUNA 4LGQA 1TFKA 3EN8A 1V74A 3N9HA 2CG1A 1N8QA 3CCS3 4HVNA 1W2B2 1DVDA 1Z1SA 3V99A 2YX9A 3PGBA 2XF3A 3BNBA 2ZDJA 5LC6A 3KN4A 3DMCA 1VQL3 4L8OA 5D81A 3G0KA 3EE1A 4HM0B 3SLUA 3LOYA 4LSOA 3F7SA 1NWWA 1IVXA 3FG1A 1WMOA 5TGNA 1YVBI 3UL5A 1W7CA 1MOLA 3GZRA 1STFI 3NM2A 3LT8A 3CMA3 1M904 3AMOA 3B4PA 1ULJB 4OK0A 3E99A 4X2HA 1GY6A 3KE7A 2R4IA 1OF5B 1RKYA 2MC8A 3ROBA 2QGUA 3FSDA 2GBXB 4WFOA 2CG0A 3BB9A 2CIUA 2XGLA 3NHXA 2M7OA 1K734 3DZLA 3CCU3 2HMNB 1DYUA 1PFPA 3K9MC 1QVG2 1VQN3 3MYTA 2P09A 1O7PB 4U13A 5HGRA 2I9WA 4N6NB 1OGXA 5IW9A 1GY7A 4FMCA 1G96A 3EX9A 4WYKB 3QRDA 4CCVA 2GXFA 1KWIA 4WWUC 4EC6A 4AKZA 1W2ZA 1O7NB 2BHMA 3LT9A 3H51A 2GEXA 3X3XA 4JF8A 3WODG 3EHCA 3SVAA 1NJI4 1E3RA 1OHSA 3DGOA 2HMJB 3CCV3 3EJVA 3BNDA 3S29A 4XDVA 1D6YA 1WNHA 3VF1A 2BMRB 3JUQA 5D82A 1JRQA 5EQLA 2WO0A 1N5PA 3T8NA 1NB3I 1IVWA 3CCR3 3GZYB 5DREA 2FXTA 3RGRA 1K9M4 1OHOA 2O3OA 1ROAA 2CH9A 3DUKA 1TU5A 3CXC2 1Q40B 1DVCA 2E2UA 3MG1A 5CLKA 1IV7A 4K1UA 1LNHA 4XDWA 1SQWA 3CC43 3WA2X 5D83A 3UNLA 2JDIH 3DM8A 3KZTA 3RDEA 4HM5B 1YGEA 3SOYA 1VQK3 1AV4A 5IF6A 3D3LA 1DMNA 1TP6A 2XEPA 2CWVA 4HYZA 3LZAA 1JKGB 3WA3A 4N6TA 3WOFB 3NXJA 1CQSA 3Q1CA 2OOVA 3UB1A 1Q7Y4 3L0RA 3N8BA 3WDGB 4RNZA 3CD63 3QK9A 2KCDA 5IERA 2HMKB 1OPYA 2WGQA 1AR0A 4IPBA 3VGNA 2WGOA 3JUMA 5ELJA 3G16A 2CC3A 1UI8A 3LH4A 1YI23 1O7MB 4RNYA 2YFJB 3MSOA 4HM6B 5FGOA 1JN5A 3HI7A 1NB5I 1FGQA 4HJLB 5G2GA 3B8LA 3KSPA 4K61A 3SOAA 2LYXA 2CKFB 3MG2A 4RZMA 2P0XA 4MMXB 2HMOB 1VQ93 5KP3A 3S27A 2BMOB 3SEDA 4X2OA 1A67A 1QAFA 1F8NA 4XM4A 3BNEA 4N6V0 1K41A 1WQLB 3CCE3 1EA2A 2P0MA 1JV2B 3MWZA 4N6OB 4FR9A 4LMIA 1VQ63 3LXUX 3RGAA 3AMOB 1YJW3 1UUWB 2W9PA 1Y4KA 3CC73 2Z76A 3HIGA 5DRVA 5IG4A 2CFGA 4AKYA 3WMDA 3I563 4Q53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCV A;  1KWI A;  1LXE A;  3SVA A;  4EYC A;  4LZI A;  4N6M A;  1WNH A;  1R4C A;  5EQL A;  1N5P A;  1CYV A;  1NB3 I;  2BO9 B;  4N6U A;  3S67 A;  2KXG A;  1GD3 A;  3Q2P A;  1ROA A;  2CH9 A;  5ELU A;  1DVC A;  1IV7 A;  1IV9 A;  1CYU A;  1FA3 A;  1GD4 A;  1CEW I;  4TX4 A;  2W9Q A;  4N6T A;  2O9U X;  1EQK A;  3L0R A;  3KSE D;  1DVD A;  1FUW A;  5LC6 A;  3PXM A;  4N6L A;  5LC7 A;  5ELJ A;  5A0O B;  3LH4 A;  4ZM8 A;  3IMA B;  3UL5 A;  1NB5 I;  1YVB I;  1MOL A;  1STF I;  3PYJ A;  1M9G A;  1A90 A;  1A67 A;  4N6V 0;  3NX0 A;  4IT7 A;  3GAX A;  1MNL A;  3KFQ C;  3MWZ A;  4N6O B;  1G96 A;  1PFP A;  3K9M C;  2W9P A;  1TIJ A;  1N9J A;  1N5H A;  4N6N B;  3UL6 A;  3PS8 A;  3QRD A;  2OCT A;  1RN7 A; 
#chains in the Genus database with same CATH topology
 3EC9 A;  1X1Y A;  1GS3 A;  1V57 A;  3X40 A;  1J2B A;  4PEJ A;  2YFL B;  1R4Y A;  2RBI A;  1LOY A;  4I4K A;  4XBX A;  1AVK A;  2H0I A;  1KD1 4;  3LTC A;  5BXQ A;  1DET A;  2UX0 A;  2CK3 H;  3V98 A;  1IQX A;  1VZZ A;  1ROV A;  4STD A;  3SX1 A;  1IVU A;  3S28 A;  4R9L A;  3FH1 A;  1IT7 A;  2GEY A;  2XSO B;  1IQY A;  1BAN A;  4KVH A;  1R4C A;  3OX9 A;  5AIF A;  1BRS A;  1RCK A;  1BU4 A;  1WTH A;  3OV4 A;  5RNT A;  5G1K A;  4N6U A;  2PZV A;  1STD A;  3MHE A;  1VQM 3;  4IIA A;  1LOX A;  4XBY A;  3Q90 A;  4HM8 B;  4FMD A;  2OQE C;  3UJM A;  3H3H A;  4EXR A;  1G0T A;  1JNQ A;  4AEQ A;  3JVC A;  3WOD G;  4OUQ A;  3F40 A;  4HZB B;  1QJG A;  3D79 A;  1MWT A;  1RCL A;  2KF6 A;  4O8S A;  1NDO B;  5I97 A;  1IV9 A;  3FZW A;  3GRD A;  2W0Q A;  2Y74 A;  2K54 A;  4HM4 B;  1D6U A;  1VQ8 3;  2RSX A;  3ECF A;  4J5K A;  1JB2 A;  1LOV A;  1TRQ A;  1FA3 A;  1AQZ A;  2Q07 A;  1JJ2 2;  1SII A;  1GD4 A;  4O2H A;  1CEW I;  1VQO 3;  4JRF A;  1I8V A;  2XFS A;  1MWS A;  4KFD A;  5CK6 A;  3AHS A;  3LTA A;  3OWS A;  1RGG A;  1TTO A;  4R1K A;  5IEP A;  1GY5 A;  4ORL A;  2O9U X;  4HM2 B;  4EBG A;  3CU3 A;  3FG4 A;  4GSP A;  1BRK A;  1GMR A;  1KQS 2;  1I0V A;  2SBL A;  4R80 A;  4CPK A;  1QAL A;  2RFR A;  2ZHX B;  2K0M A;  3ALA A;  3D5G A;  3F8H A;  3HZP A;  5KP1 A;  3KSE D;  2KRT A;  1Q82 4;  1ZX2 A;  1Q86 4;  1HU9 A;  5IG3 A;  7STD A;  1YNV X;  4FCM A;  3EBT A;  1OHP A;  3CPO A;  4J9A A;  3U97 A;  1Q81 4;  3PXM A;  1W01 A;  1W00 A;  3NBB A;  2F99 A;  1C7H A;  1EG9 B;  1UI7 A;  5LC7 A;  3CME 3;  4CDL A;  2D42 A;  1RRH A;  2F86 B;  2IA7 A;  3LTB A;  5IG0 A;  2Z6B A;  3WOE B;  1ULI B;  5BVB A;  1JB4 A;  1ASK A;  1RJO A;  3IMA B;  1W6Y A;  1NNV A;  1VQ7 3;  1FUS A;  2PNC A;  1QVF 2;  4R9K A;  3EQQ B;  1OGZ A;  3PYJ A;  3PCR A;  1S72 3;  1D6Z A;  1M9G A;  1HZ1 A;  3KII A;  3U1W A;  2CHC A;  4HM1 B;  5AII A;  2B1X B;  1A90 A;  1LNI A;  5STD A;  5BIR A;  3WHO A;  3CCQ 3;  3J7Y d;  3N54 B;  1IU7 A;  1VQ4 3;  1BUQ A;  5AI1 A;  2ZL8 A;  3T0U A;  1RGF A;  2OOV C;  1DMM A;  3F9S A;  3FGY A;  1JN5 B;  1S5A A;  3F14 A;  4IT7 A;  1QMA A;  1RRL A;  1Q40 A;  2BMQ B;  1BNE A;  2R41 A;  4WHA A;  2V1L A;  1M1K 4;  1MGR A;  5CF2 A;  1FGT A;  3KKG A;  1I3F A;  3AGN A;  4NPB A;  1TIJ A;  3STD A;  2H0H A;  3LML A;  1N5H A;  1Q7H A;  1UUV B;  1RHL A;  1A2V A;  1W6G A;  2C4B A;  2GU3 A;  2OWP A;  2P05 A;  3EBY A;  1LRA A;  1PYL A;  1IVV A;  3FF2 A;  3JUP A;  2QIY A;  3PS8 A;  6STD A;  2HML B;  1EKM A;  2JQ5 A;  3OW2 2;  1RN7 A;  2BNG A;  2HOH A;  1BAO A;  3D5I A;  1W6C A;  4L8P A;  3OWY A;  5M1A A;  2IUK A;  1IQ8 A;  3GZB A;  3PCS A;  1BSD A;  1NU3 A;  2XGN A;  1Q42 A;  2B24 B;  3I0Y A;  2CFW A;  6RNT A;  2W56 A;  1O7W B;  1FGR A;  2CW9 A;  5G1L A;  4HM7 B;  3EN1 B;  4EYC A;  1BNJ A;  4K1V A;  4LZI A;  5CF1 A;  1QAK A;  1ZO2 A;  2E2T A;  3G8Z A;  4N6M A;  1BSC A;  2KF5 A;  2A15 A;  2RGQ A;  1RGC A;  2XH9 A;  1B2S A;  3IPT A;  2XFT A;  3G6E 3;  1U8C B;  1RN4 A;  1C54 A;  3OWU A;  3O8Y A;  3F8X A;  4L7K A;  5AYR B;  4MJD A;  4LEH A;  3MPH A;  2IYJ A;  5AIH A;  2KXG A;  3DGN A;  4FMB A;  1JZO A;  3Q2P A;  5M18 A;  1OAC A;  3EB8 A;  3GZX B;  5ELU A;  2FNQ A;  4FCZ A;  2D1W A;  3NV0 A;  1SIH A;  1M1X B;  4DKI A;  1W4N A;  3G4S 3;  1K8A 4;  3DGL A;  1AY7 A;  2KAA A;  2AAE A;  2BT3 A;  3T8U A;  2BIR A;  3IJE B;  4HAA A;  3NM7 A;  1N8R 4;  1FW7 A;  3HK4 A;  3DH2 A;  3X3Z A;  5IEO A;  1I2G A;  2QEX 3;  3ER7 A;  1CYU A;  3X42 A;  4J8T A;  3SXX A;  1K28 A;  1B3S A;  4TX4 A;  3NBJ A;  4XB5 A;  1GYB A;  3K7C A;  2MF7 A;  2W9Q A;  3JUN A;  1US1 A;  3HII A;  2OTJ 3;  4KZ1 A;  1B2U A;  4GHO A;  3A76 A;  5AEW B;  2XSH B;  1YIJ 3;  2Z7A A;  2J8X B;  3G71 3;  3LTD A;  1UW1 A;  1SPU A;  1MGW A;  3CPW 2;  1UDI I;  2CFD A;  3K63 A;  2CFK A;  3NBR A;  1B2Z A;  4CJN A;  1E97 A;  1FYS A;  1RGH A;  3FG3 A;  4EV2 A;  2GBW B;  1GOU A;  2GU1 A;  1FUW A;  3FCS B;  1X1U A;  1HYF A;  3X3Y A;  4FCJ A;  4N6L A;  2GSP A;  1O7H B;  4I5Q A;  1N9E A;  3F7X A;  3EF8 A;  4NRE A;  1TFO A;  2XR8 B;  1OF5 A;  3V92 A;  2F4Y A;  4MMZ B;  5A0O B;  4BL3 A;  1IK3 A;  3CC2 3;  1BNS A;  3K0Z A;  1VQ5 3;  2OQE A;  3GWR A;  4ZM8 A;  1DMQ A;  4WP5 A;  1BNF A;  1A2P A;  1KC8 4;  5JPU A;  4EV5 A;  1X1W A;  2W2C A;  1LVN A;  2C10 A;  2YFI B;  3MKI A;  2STD A;  4HM3 B;  1YIT 3;  1ZS7 A;  3CNX A;  3FLJ A;  2L4V A;  3LYG A;  3OXA A;  1HKX A;  4GB5 A;  2IUJ A;  5JPP A;  1VQP 3;  4BTX A;  1YJN 3;  1OCV A;  2W6J H;  4WYK A;  3I55 3;  3Q3F A;  1T5Y A;  3TDG A;  3NX0 A;  2W03 A;  2CFL A;  4G1M B;  3GAX A;  1MNL A;  3KFQ C;  4BTY A;  2Z77 A;  1W02 A;  3B7C A;  2FGT A;  1VQQ A;  3FF0 A;  2OTL 3;  4N3V A;  3D9R A;  3CNM A;  1N9J A;  1B2X A;  1FGO A;  2AAD A;  2LQV A;  5KP4 A;  1TUH A;  3UL6 A;  3M8C A;  4J5G A;  1T2I A;  2F98 A;  2RNT A;  1UUG B;  3CCL 3;  1LXE A;  2OCT A;  4O02 B;  1JB5 A;  5EEO A;  2E2V A;  3X41 A;  4MEI A;  1WMP A;  7RNT A;  1RSN A;  4KFE A;  4OVM A;  1GSP A;  9RNT A;  1KSI A;  1FGM A;  2C11 A;  5AYS C;  1PU4 A;  1E3V A;  4RBN A;  3K5T A;  3RNT A;  1RGE A;  1I70 A;  1GOV A;  1NO3 A;  1W5Z A;  3A5E A;  3DXO A;  2HMM B;  1I2E A;  4K90 B;  3VSY A;  2CWU A;  2W04 A;  4KFF A;  3FKA A;  2Y73 A;  8RNT A;  2F5W A;  4H61 A;  2UGI A;  1I3I A;  4R4K A;  5IG5 A;  4HZ9 B;  8CHO A;  2CWT A;  5AIG A;  1UCJ A;  1CYV A;  2BO9 B;  2WOH A;  2WOF A;  5AEU B;  4FMA A;  3S67 A;  1EUI C;  2W56 B;  1BNR A;  4H3U A;  3KCH A;  1GMP A;  4HKV B;  2XRX B;  1GD3 A;  1WMN A;  3HX8 A;  4NHF A;  3ZG5 A;  5EVH A;  1YJ9 3;  1BUJ A;  1BRH A;  1I0X A;  3NQY A;  3JUO A;  3NQZ A;  1IYY A;  1OH0 A;  1JKG A;  1UGH I;  1O7G B;  2ML5 A;  5FW5 A;  4XBT A;  1UCI A;  1PY3 A;  3MG3 A;  5M19 A;  1BSB A;  1BIR A;  4BTW A;  1UCL A;  4MMY B;  4BIR A;  4O3V A;  1RTU A;  1SJW A;  3BNC A;  3PZW A;  5CXO A;  3WR2 A;  1B20 A;  1T2H A;  2L1S A;  4HBR A;  1ISK A;  4BU4 A;  3NUV A;  1YHQ 3;  2RCD A;  1B21 A;  3DGY A;  1IDP A;  1U5O A;  3CCJ 3;  2INX A;  3NV0 B;  2ML6 A;  3DGM A;  4GL6 A;  3CCM 3;  5IEN A;  2IMJ A;  1JBS A;  3B4O A;  2QA4 3;  3S5C A;  1G02 A;  1AVL A;  2P38 A;  1BVI A;  1L5G B;  5JBS A;  1A2K A;  3BLZ A;  3DY5 A;  1Q9E A;  4QWT A;  1IT8 A;  1BRN L;  1EQK A;  1B2M A;  1OUN A;  4LGQ A;  1MWU A;  1TFK A;  3EN8 A;  1V74 A;  3N9H A;  2CG1 A;  1N8Q A;  3CCS 3;  5GSP A;  1RNT A;  4HVN A;  1W2B 2;  1DVD A;  1Z1S A;  3V99 A;  2YX9 A;  3PGB A;  2XF3 A;  3BNB A;  2ZDJ A;  5LC6 A;  3KN4 A;  3DMC A;  1UCK A;  1VQL 3;  4L8O A;  5D81 A;  2UUG C;  3G0K A;  3EE1 A;  4HM0 B;  1BRJ A;  1BRG A;  2KF3 A;  3SLU A;  3LOY A;  4LSO A;  1BSA A;  1NWW A;  1IVX A;  3F7S A;  6GSP A;  3FG1 A;  1WMO A;  5TGN A;  1YVB I;  3UL5 A;  1EEJ A;  1RDS A;  1W7C A;  1MOL A;  3GZR A;  1STF I;  3NM2 A;  3LT8 A;  3CMA 3;  1M90 4;  3AMO A;  3B4P A;  1ULJ B;  4OK0 A;  3E99 A;  4X2H A;  1GY6 A;  1RMS A;  3KE7 A;  2R4I A;  1OF5 B;  1RKY A;  2F5M A;  5BU4 A;  3URP A;  2MC8 A;  3ROB A;  2QGU A;  3FSD A;  2GBX B;  4WFO A;  1RN1 A;  2CG0 A;  3BB9 A;  2CIU A;  2XGL A;  3NHX A;  2M7O A;  1K73 4;  1JBR A;  1BNI A;  3DZL A;  4KT3 B;  3CCU 3;  2HMN B;  1DYU A;  2BU4 A;  1JBT A;  1PFP A;  3K9M C;  1QVG 2;  1VQN 3;  1TJD A;  2CX1 A;  1YGW A;  3BIR A;  3MYT A;  2P09 A;  1O7P B;  4U13 A;  5HGR A;  2I9W A;  4N6N B;  1OGX A;  5IW9 A;  1GY7 A;  4FMC A;  1G96 A;  3EX9 A;  4WYK B;  3QRD A;  4CCV A;  2GXF A;  1KWI A;  1JZD A;  4WWU C;  4EC6 A;  4AKZ A;  1FZU A;  1W2Z A;  4LYL B;  1MWR A;  1O7N B;  2BHM A;  1FUT A;  3H51 A;  3LT9 A;  2H0G A;  2GEX A;  7GSP A;  3X3X A;  4JF8 A;  2IY2 A;  3EHC A;  1V58 A;  1UGI A;  1E3R A;  1OHS A;  3DGO A;  3SVA A;  1SAR A;  2HMJ B;  1NJI 4;  3CCV 3;  3EJV A;  3BND A;  3S29 A;  4XDV A;  3GSP A;  1D6Y A;  1WNH A;  2ZA4 A;  3VF1 A;  2BMR B;  3JUQ A;  3AHW A;  5D82 A;  1JRQ A;  5EQL A;  2WO0 A;  1N5P A;  3T8N A;  1NB3 I;  1IVW A;  3CCR 3;  3GZY B;  5DRE A;  2FXT A;  3RGR A;  1K9M 4;  1OHO A;  2O3O A;  1ROA A;  2CH9 A;  3DUK A;  1TU5 A;  3CXC 2;  1Q40 B;  1DVC A;  2E2U A;  3MG1 A;  5CLK A;  1IV7 A;  1BRI A;  4K1U A;  3ZFZ A;  1LNH A;  4XDW A;  1SQW A;  3CC4 3;  3WA2 X;  5D83 A;  3UNL A;  2JDI H;  2KF4 A;  1BSE A;  2SAR A;  3DM8 A;  4ILF A;  3KZT A;  3RDE A;  4HM5 B;  1YGE A;  1GOY A;  3SOY A;  1VQK 3;  1AV4 A;  1LQG C;  3AGO A;  5IF6 A;  3D3L A;  1DMN A;  1TP6 A;  1TRP A;  2XEP A;  2CWV A;  4HYZ A;  3LZA A;  1JKG B;  3WA3 A;  3D4A A;  4N6T A;  3WOF B;  1T3B A;  1DE3 A;  3NXJ A;  1CQS A;  1B27 A;  3Q1C A;  2OOV A;  3HOH A;  1RNB A;  3UB1 A;  1CH0 A;  1BOX A;  1Q7Y 4;  3L0R A;  3N8B A;  3WDG B;  4RNZ A;  1BGS A;  1YVS A;  3CD6 3;  3QK9 A;  1RGL A;  3ZG0 A;  2KCD A;  5IER A;  2HMK B;  1OPY A;  2WGQ A;  1AR0 A;  1ZGX A;  1X1X A;  4IPB A;  3VGN A;  2WGO A;  3JUM A;  5ELJ A;  3G16 A;  2CC3 A;  3SYU A;  1UI8 A;  4BL2 A;  3LH4 A;  1YI2 3;  1O7M B;  4RNY A;  1LQM B;  1RGA A;  2YFJ B;  3MSO A;  4HM6 B;  5FGO A;  1JN5 A;  1I2F A;  3HI7 A;  1NB5 I;  1FGQ A;  2K3D A;  4HJL B;  1GMQ A;  5G2G A;  1RGK A;  3B8L A;  3KSP A;  4K61 A;  3SOA A;  4HOH A;  2LYX A;  2CKF B;  3MG2 A;  4RZM A;  2P0X A;  4MMX B;  2HMO B;  1VQ9 3;  1RLS A;  4EW5 A;  5KP3 A;  3S27 A;  2BMO B;  3SED A;  4X2O A;  1A67 A;  1QAF A;  1F8N A;  4XM4 A;  3BNE A;  4N6V 0;  1K41 A;  1WQL B;  3CCE 3;  4RNT A;  1EA2 A;  2P0M A;  1JV2 B;  3MWZ A;  4N6O B;  4FR9 A;  4LMI A;  1VQ6 3;  3LXU X;  3RGA A;  3AMO B;  3BU4 A;  1YJW 3;  1UUW B;  2F56 A;  1Y4K A;  2W9P A;  3CC7 3;  2Z76 A;  3HIG A;  5DRV A;  2CX0 A;  5HOH A;  5IG4 A;  2CFG A;  1BNG A;  4AKY A;  3WMD A;  3I56 3;  4Q53 A;  1LOW A; 
#chains in the Genus database with same CATH homology
 3EC9 A;  1GS3 A;  3X40 A;  1J2B A;  4PEJ A;  2YFL B;  4I4K A;  4XBX A;  1AVK A;  1KD1 4;  3LTC A;  5BXQ A;  2UX0 A;  2CK3 H;  3V98 A;  1IQX A;  1VZZ A;  1ROV A;  4STD A;  3SX1 A;  1IVU A;  3S28 A;  4R9L A;  3FH1 A;  1IT7 A;  2GEY A;  2XSO B;  1IQY A;  4KVH A;  1R4C A;  3OX9 A;  5AIF A;  1WTH A;  3OV4 A;  4N6U A;  2PZV A;  1STD A;  3MHE A;  1VQM 3;  4IIA A;  1LOX A;  4XBY A;  3Q90 A;  4HM8 B;  4FMD A;  2OQE C;  3UJM A;  3H3H A;  4EXR A;  1JNQ A;  4AEQ A;  3JVC A;  4OUQ A;  3F40 A;  4HZB B;  1QJG A;  4O8S A;  1NDO B;  5I97 A;  1IV9 A;  3FZW A;  3GRD A;  2W0Q A;  2Y74 A;  2K54 A;  4HM4 B;  1D6U A;  1VQ8 3;  2RSX A;  3ECF A;  1JB2 A;  1FA3 A;  2Q07 A;  1JJ2 2;  1SII A;  1GD4 A;  4O2H A;  1CEW I;  1VQO 3;  4JRF A;  2XFS A;  4KFD A;  5CK6 A;  3LTA A;  3OWS A;  4R1K A;  5IEP A;  1GY5 A;  4ORL A;  2O9U X;  4HM2 B;  4EBG A;  3CU3 A;  3FG4 A;  1KQS 2;  2SBL A;  4R80 A;  1QAL A;  2RFR A;  3F8H A;  2K0M A;  3ALA A;  3HZP A;  5KP1 A;  3KSE D;  2KRT A;  1Q82 4;  1ZX2 A;  1Q86 4;  1HU9 A;  5IG3 A;  7STD A;  4FCM A;  3EBT A;  1OHP A;  3CPO A;  4J9A A;  3U97 A;  1Q81 4;  3PXM A;  1W01 A;  1W00 A;  3NBB A;  2F99 A;  1C7H A;  1EG9 B;  1UI7 A;  5LC7 A;  3CME 3;  4CDL A;  2D42 A;  1RRH A;  2F86 B;  2IA7 A;  3LTB A;  5IG0 A;  2Z6B A;  3WOE B;  1ULI B;  5BVB A;  1JB4 A;  1ASK A;  1RJO A;  3IMA B;  1W6Y A;  1VQ7 3;  2PNC A;  1QVF 2;  4R9K A;  3EQQ B;  1OGZ A;  3PYJ A;  3PCR A;  1S72 3;  1M9G A;  1D6Z A;  3KII A;  3U1W A;  2CHC A;  4HM1 B;  5AII A;  2B1X B;  1A90 A;  5STD A;  3CCQ 3;  3J7Y d;  3N54 B;  1IU7 A;  1VQ4 3;  1BUQ A;  5AI1 A;  2ZL8 A;  3T0U A;  2OOV C;  1DMM A;  3F9S A;  3FGY A;  1JN5 B;  1S5A A;  3F14 A;  4IT7 A;  1QMA A;  1RRL A;  1Q40 A;  2BMQ B;  1M1K 4;  4WHA A;  2V1L A;  5CF2 A;  1FGT A;  3KKG A;  1TIJ A;  3STD A;  3LML A;  1N5H A;  1UUV B;  1W6G A;  2GU3 A;  1A2V A;  2OWP A;  3EBY A;  2P05 A;  4QWT A;  3FF2 A;  1IVV A;  3JUP A;  2QIY A;  3PS8 A;  6STD A;  2HML B;  1EKM A;  2JQ5 A;  3OW2 2;  1RN7 A;  2BNG A;  4L8P A;  1W6C A;  3OWY A;  2IUK A;  1IQ8 A;  3GZB A;  3PCS A;  1NU3 A;  2XGN A;  1Q42 A;  2B24 B;  3I0Y A;  2CFW A;  2W56 A;  1O7W B;  1FGR A;  2CW9 A;  4HM7 B;  3EN1 B;  4EYC A;  4K1V A;  4LZI A;  5CF1 A;  1QAK A;  1ZO2 A;  2E2T A;  3G8Z A;  4N6M A;  2RGQ A;  2A15 A;  2XH9 A;  3IPT A;  2XFT A;  3G6E 3;  1U8C B;  3OWU A;  3O8Y A;  3F8X A;  4L7K A;  5AYR B;  4MJD A;  4LEH A;  3MPH A;  5AIH A;  2KXG A;  3DGN A;  4FMB A;  3Q2P A;  1OAC A;  3EB8 A;  3GZX B;  5ELU A;  2FNQ A;  4FCZ A;  2D1W A;  3NV0 A;  1SIH A;  1M1X B;  1W4N A;  3G4S 3;  1K8A 4;  3DGL A;  2BT3 A;  3T8U A;  3IJE B;  3NM7 A;  1N8R 4;  3HK4 A;  3X3Z A;  5IEO A;  2QEX 3;  3ER7 A;  1CYU A;  3X42 A;  4J8T A;  3SXX A;  1K28 A;  4XB5 A;  4TX4 A;  3NBJ A;  1GYB A;  3K7C A;  2MF7 A;  2W9Q A;  3JUN A;  1US1 A;  3HII A;  2OTJ 3;  4KZ1 A;  3A76 A;  5AEW B;  2XSH B;  1YIJ 3;  2Z7A A;  3G71 3;  3LTD A;  1UW1 A;  1SPU A;  3CPW 2;  2CFD A;  3K63 A;  2CFK A;  3NBR A;  1E97 A;  3FG3 A;  4EV2 A;  2GBW B;  2GU1 A;  1FUW A;  3FCS B;  3X3Y A;  4FCJ A;  4N6L A;  1O7H B;  1N9E A;  3F7X A;  3EF8 A;  4NRE A;  1TFO A;  2XR8 B;  1OF5 A;  3V92 A;  4MMZ B;  5A0O B;  1IK3 A;  3CC2 3;  3K0Z A;  1VQ5 3;  2OQE A;  3GWR A;  4ZM8 A;  1DMQ A;  4WP5 A;  1KC8 4;  5JPU A;  4EV5 A;  2W2C A;  1LVN A;  2C10 A;  2YFI B;  3MKI A;  2STD A;  4HM3 B;  1YIT 3;  3CNX A;  3FLJ A;  2L4V A;  3LYG A;  3OXA A;  1HKX A;  4GB5 A;  2IUJ A;  5JPP A;  1VQP 3;  4BTX A;  1YJN 3;  1OCV A;  2W6J H;  4WYK A;  3I55 3;  1T5Y A;  3TDG A;  3NX0 A;  2W03 A;  2CFL A;  4G1M B;  3GAX A;  1MNL A;  3KFQ C;  4BTY A;  2Z77 A;  1W02 A;  3B7C A;  2FGT A;  3FF0 A;  2OTL 3;  4N3V A;  3D9R A;  3CNM A;  1N9J A;  1FGO A;  2LQV A;  5KP4 A;  1TUH A;  3UL6 A;  3M8C A;  2F98 A;  3CCL 3;  2OCT A;  1LXE A;  4O02 B;  1JB5 A;  5EEO A;  2E2V A;  3X41 A;  4MEI A;  1WMP A;  4KFE A;  4OVM A;  1KSI A;  1FGM A;  2C11 A;  5AYS C;  1PU4 A;  1E3V A;  4RBN A;  3K5T A;  3DXO A;  1NO3 A;  1W5Z A;  3VSY A;  4K90 B;  2HMM B;  2CWU A;  2W04 A;  4KFF A;  3FKA A;  2Y73 A;  4H61 A;  4R4K A;  5IG5 A;  4HZ9 B;  8CHO A;  2CWT A;  5AIG A;  1CYV A;  2BO9 B;  2WOH A;  2WOF A;  5AEU B;  4FMA A;  3S67 A;  2W56 B;  4H3U A;  4HKV B;  2XRX B;  1GD3 A;  1WMN A;  3HX8 A;  4NHF A;  5EVH A;  1YJ9 3;  3NQY A;  3JUO A;  3NQZ A;  1OH0 A;  1JKG A;  1O7G B;  2ML5 A;  5FW5 A;  4XBT A;  3MG3 A;  4BTW A;  4MMY B;  4O3V A;  1SJW A;  3BNC A;  3PZW A;  5CXO A;  4HBR A;  1ISK A;  3NUV A;  1YHQ 3;  2RCD A;  1IDP A;  1U5O A;  3CCJ 3;  2INX A;  3NV0 B;  2ML6 A;  3DGM A;  4GL6 A;  3CCM 3;  5IEN A;  2IMJ A;  3B4O A;  2QA4 3;  3S5C A;  1AVL A;  2P38 A;  1L5G B;  5JBS A;  1A2K A;  3BLZ A;  3DY5 A;  1IT8 A;  1EQK A;  1OUN A;  4LGQ A;  1TFK A;  3EN8 A;  1V74 A;  3N9H A;  2CG1 A;  1N8Q A;  3CCS 3;  4HVN A;  1W2B 2;  1DVD A;  1Z1S A;  3V99 A;  2YX9 A;  3PGB A;  2XF3 A;  3BNB A;  2ZDJ A;  5LC6 A;  3KN4 A;  3DMC A;  1VQL 3;  4L8O A;  5D81 A;  3G0K A;  3EE1 A;  4HM0 B;  3SLU A;  3LOY A;  4LSO A;  3F7S A;  1NWW A;  1IVX A;  3FG1 A;  1WMO A;  5TGN A;  1YVB I;  3UL5 A;  1W7C A;  1MOL A;  3GZR A;  1STF I;  3NM2 A;  3LT8 A;  3CMA 3;  1M90 4;  3AMO A;  3B4P A;  1ULJ B;  4OK0 A;  3E99 A;  4X2H A;  1GY6 A;  3KE7 A;  2R4I A;  1OF5 B;  1RKY A;  2MC8 A;  3ROB A;  2QGU A;  3FSD A;  2GBX B;  4WFO A;  2CG0 A;  3BB9 A;  2CIU A;  2XGL A;  3NHX A;  2M7O A;  1K73 4;  3DZL A;  3CCU 3;  2HMN B;  1DYU A;  1PFP A;  3K9M C;  1QVG 2;  1VQN 3;  3MYT A;  2P09 A;  1O7P B;  4U13 A;  5HGR A;  2I9W A;  4N6N B;  1OGX A;  5IW9 A;  1GY7 A;  4FMC A;  1G96 A;  3EX9 A;  4WYK B;  3QRD A;  4CCV A;  2GXF A;  1KWI A;  4WWU C;  4EC6 A;  4AKZ A;  1W2Z A;  1O7N B;  2BHM A;  3LT9 A;  3H51 A;  2GEX A;  3X3X A;  4JF8 A;  3WOD G;  3EHC A;  3SVA A;  1NJI 4;  1E3R A;  1OHS A;  3DGO A;  2HMJ B;  3CCV 3;  3EJV A;  3BND A;  3S29 A;  4XDV A;  1D6Y A;  1WNH A;  3VF1 A;  2BMR B;  3JUQ A;  5D82 A;  1JRQ A;  5EQL A;  2WO0 A;  1N5P A;  3T8N A;  1NB3 I;  1IVW A;  3CCR 3;  3GZY B;  5DRE A;  2FXT A;  3RGR A;  1K9M 4;  1OHO A;  2O3O A;  1ROA A;  2CH9 A;  3DUK A;  1TU5 A;  3CXC 2;  1Q40 B;  1DVC A;  2E2U A;  3MG1 A;  5CLK A;  1IV7 A;  4K1U A;  1LNH A;  4XDW A;  1SQW A;  3CC4 3;  3WA2 X;  5D83 A;  3UNL A;  2JDI H;  3DM8 A;  3KZT A;  3RDE A;  4HM5 B;  1YGE A;  3SOY A;  1VQK 3;  1AV4 A;  5IF6 A;  3D3L A;  1DMN A;  1TP6 A;  2XEP A;  2CWV A;  4HYZ A;  3LZA A;  1JKG B;  3WA3 A;  4N6T A;  3WOF B;  3NXJ A;  1CQS A;  3Q1C A;  2OOV A;  3UB1 A;  1Q7Y 4;  3L0R A;  3N8B A;  3WDG B;  4RNZ A;  3CD6 3;  3QK9 A;  2KCD A;  5IER A;  2HMK B;  1OPY A;  2WGQ A;  1AR0 A;  4IPB A;  3VGN A;  2WGO A;  3JUM A;  5ELJ A;  3G16 A;  2CC3 A;  1UI8 A;  3LH4 A;  1YI2 3;  1O7M B;  4RNY A;  2YFJ B;  3MSO A;  4HM6 B;  5FGO A;  1JN5 A;  3HI7 A;  1NB5 I;  1FGQ A;  4HJL B;  5G2G A;  3B8L A;  3KSP A;  4K61 A;  3SOA A;  2LYX A;  2CKF B;  3MG2 A;  4RZM A;  2P0X A;  4MMX B;  2HMO B;  1VQ9 3;  5KP3 A;  3S27 A;  2BMO B;  3SED A;  4X2O A;  1A67 A;  1QAF A;  1F8N A;  4XM4 A;  3BNE A;  4N6V 0;  1K41 A;  1WQL B;  3CCE 3;  1EA2 A;  2P0M A;  1JV2 B;  3MWZ A;  4N6O B;  4FR9 A;  4LMI A;  1VQ6 3;  3LXU X;  3RGA A;  3AMO B;  1YJW 3;  1UUW B;  2W9P A;  1Y4K A;  3CC7 3;  2Z76 A;  3HIG A;  5DRV A;  5IG4 A;  2CFG A;  4AKY A;  3WMD A;  3I56 3;  4Q53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...