1G96A

Human cystatin c; dimeric form with 3d domain swapping
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
111
Chain Sequence
VGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN C
publication title Human cystatin C, an amyloidogenic protein, dimerizes through three-dimensional domain swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 18
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1g96A00
3QRDA 4N6LA 2OCTA 2W9PA 2BO9B 4N6V0 1MOLA 1DVDA 1A67A 3KSED 1IV9A 1FUWA 4N6OB 1RN7A 1G96A 1DVCA 5EQLA 5A0OB 3MWZA 4TX4A 2CH9A 3SVAA 1TIJA 1ROAA 3UL5A 3K9MC 1STFI 3IMAB 1CEWI 1EQKA 3PS8A 5ELJA 5LC6A 2KXGA 3Q2PA 1KWIA 5LC7A 1MNLA 4ZM8A 3UL6A 2W9QA 1YVBI 4N6MA 3S67A 1R4CA 1WNHA 5ELUA 1PFPA 4EYCA 1GD3A 1FA3A 1N5HA 1A90A 1CYVA 3GAXA 1LXEA 4IT7A 4LZIA 4N6UA 1N5PA 3PYJA 1CYUA 4CCVA 3NX0A 1M9GA 4N6NB 1NB3I 1IV7A 4N6TA 3LH4A 3L0RA 1NB5I 3PXMA 2O9UX 1N9JA 3KFQC 1GD4A
chains in the Genus database with same CATH superfamily
1AVLA 2I9WA 1QAKA 4HM1B 2OCTA 1S5AA 2BNGA 1PY3A 3D3LA 5CXOA 1BNRA 3B4PA 2ZDJA 3U1WA 4LMIA 3JUNA 3KSED 2QIYA 4WYKB 1IK3A 1B21A 5BIRA 3MPHA 1SIHA 1NDOB 5IERA 3CCM3 1RN7A 3BLZA 2GU3A 2RGQA 3K63A 4FCJA 1CQSA 3I553 4XBYA 3HIIA 4DKIA 2F86B 3DY5A 3CCL3 5M18A 8RNTA 3EN8A 7STDA 1T3BA 1LQMB 2F56A 3DGLA 2H0GA 1O7NB 3G16A 3NQYA 3LT9A 5G2GA 2CG1A 4BU4A 3CCU3 2UUGC 2QEX3 3MG2A 1G0TA 3G8ZA 3FSDA 4H3UA 3OXAA 1AQZA 1B2SA 1RGCA 5A0OB 2HMJB 1DYUA 3Q3FA 5CF1A 4WFOA 1QJGA 3PGBA 5HOHA 2KF5A 1VQ93 1STDA 1QVF2 3LMLA 2WGOA 3F8HA 1F8NA 4R1KA 2C4BA 1I3IA 1UCLA 4GL6A 3FH1A 5DRVA 5IW9A 3F7SA 1TIJA 1D6ZA 1IT7A 3UL5A 3K9MC 1STFI 3BNBA 1I2FA 1OGZA 1MGWA 1V74A 3JUQA 2CKFB 1IQ8A 3FCSB 2WO0A 4HKVB 3S27A 3WOEB 3CCQ3 1DMMA 4WWUC 3SYUA 1UDII 3PS8A 5KP3A 2ML5A 2WOHA 2XH9A 3EBTA 4X2HA 2HMMB 3VSYA 7RNTA 2F5MA 2XFSA 1X1XA 1X1UA 4BL3A 2W6JH 3CCV3 4XBTA 1YJ93 3TDGA 5M1AA 3V92A 1Q7HA 3FLJA 2CX0A 3JVCA 5I97A 1DETA 5CF2A 2F99A 3DZLA 1B2XA 2P05A 3GRDA 1Z1SA 1IU7A 1C54A 3NBRA 1BRNL 3FG4A 1D6YA 4GHOA 1FUSA 1LOXA 4CDLA 1BUQA 3GWRA 1R4CA 1O7HB 1WNHA 4HZBB 1KQS2 3S5CA 3BU4A 4LGQA 3D4AA 3LTCA 1RGFA 4AKZA 1J2BA 3NXJA 3FG3A 4J8TA 1PFPA 3FF2A 1K41A 3GZRA 1A2VA 3DH2A 1W2B2 2XR8B 1N5HA 1NWWA 3LTBA 1UUVB 1YVSA 3CNXA 1CYVA 2MF7A 4LYLB 2FGTA 3GAXA 4IT7A 4KT3B 1Q824 4LZIA 1FGOA 4J9AA 1W6CA 2W0QA 1TFOA 4NPBA 1B2ZA 3ER7A 1B27A 1MWRA 1V58A 2D42A 4N6NB 3WR2A 4K1VA 2K54A 2P0MA 5G1KA 1PU4A 1M1K4 3PCRA 1Q9EA 1M1XB 1BSDA 1QMAA 2JQ5A 4LEHA 2PNCA 4MJDA 3ZFZA 1HU9A 1NB5I 3HOHA 1NO3A 2BU4A 1E97A 1EEJA 3X3XA 1N9JA 4ORLA 1D6UA 1EG9B 1VQ83 3D9RA 1BSAA 1UCJA 2CK3H 1BUJA 2ML6A 1OPYA 1SQWA 1ROVA 3QRDA 3JUOA 1B20A 3X3YA 5M19A 3DM8A 4HM6B 4R9LA 2CWUA 1MOLA 1GMQA 1HYFA 4U13A 2CX1A 3DGMA 2SBLA 2WOFA 3KZTA 5BU4A 1DVDA 2KCDA 1TTOA 3DUKA 3WDGB 2H0IA 1O7WB 1NU3A 1UCKA 2CW9A 1IV9A 1K734 5CK6A 2WGQA 4AKYA 1I3FA 2CWTA 1YHQ3 4KFEA 2BT3A 2IMJA 1VQP3 4L8PA 4WHAA 1Q814 4EV2A 1G96A 3ZG0A 1PYLA 1MWSA 4JF8A 4BTXA 1JBSA 3MHEA 1LRAA 2CWVA 1CH0A 1B2UA 1JBRA 2FXTA 2V1LA 4HYZA 1VQ63 3K0ZA 1T2IA 5EQLA 8CHOA 2XSOB 3NBJA 3X42A 1GS3A 2LQVA 1IQYA 3V98A 1LNHA 2O3OA 1JZOA 2ZL8A 3EJVA 3SOAA 2L4VA 1RNTA 3CMA3 2CG0A 1OUNA 1ULIB 3G4S3 1BRSA 4N3VA 3MWZA 1DMQA 3CXC2 1RHLA 4HZ9B 4KVHA 2A15A 3DGNA 3SVAA 1VQ43 5GSPA 2K0MA 4BL2A 1SIIA 1BRKA 3BIRA 3SX1A 1FGTA 3FGYA 2MC8A 2INXA 1I0VA 2CHCA 5JPPA 2IUJA 2B1XB 1VQ73 4K61A 4G1MB 3T8NA 1RDSA 2YFIB 3IMAB 4FCZA 1E3RA 3ALAA 3IPTA 3MKIA 3PCSA 5EVHA 1TRPA 4STDA 1TRQA 2GEXA 2GEYA 3OX9A 2BHMA 3NHXA 4HM7B 4QWTA 2E2VA 2XF3A 4Q53A 2KXGA 5FW5A 1N8R4 3CD63 1KWIA 1OF5A 4RNTA 1GMRA 3F8XA 4O02B 5HGRA 3NM7A 1BSEA 1MNLA 1ZX2A 5JBSA 2J8XB 3HZPA 4ZM8A 1ULJB 2R41A 1QVG2 5CLKA 2D1WA 1JV2B 3UL6A 1JJ22 3LXUX 1AVKA 1L5GB 4N6MA 2W03A 3FG1A 3KKGA 3G713 1ZS7A 1GY7A 4FCMA 1VQL3 1VQO3 5ELUA 3HX8A 4MEIA 2OTJ3 1OF5B 9RNTA 1BANA 1RN4A 1W02A 3CU3A 3GZYB 3CNMA 1BGSA 1IVUA 3H51A 4EYCA 1GD3A 3BNCA 2RSXA 3LTAA 3EX9A 1AV4A 4XBXA 1TU5A 3BB9A 4HAAA 2KF4A 1BSCA 1RRLA 4MMZB 4MMXB 1FGRA 3F40A 4XDWA 1BAOA 2Y73A 1UI8A 3H3HA 3MG1A 3EE1A 1T2HA 2CFKA 2IA7A 3DMCA 3PYJA 4I5QA 1LOYA 3STDA 1CYUA 2P09A 2ZA4A 3NX0A 1I8VA 3VGNA 1FUTA 1LOWA 1RRHA 2XFTA 1RMSA 1RSNA 2Z7AA 1N9EA 4HM3B 1K8A4 1GOYA 5IG4A 1NNVA 1LVNA 1ZGXA 1Q42A 3KSPA 4EC6A 1S723 2O9UX 3RGRA 3BNDA 1E3VA 1RGGA 1KSIA 2OQEA 1VQ53 1BU4A 1BNIA 1R4YA 3UJMA 1TP6A 2LYXA 3OW22 2HMNB 1GYBA 5KP1A 1V57A 2C10A 1IDPA 2BMOB 3WHOA 3SOYA 2W9PA 4HBRA 2BO9B 1YGEA 4PEJA 2GBWB 3Q90A 3CC73 1VQK3 1W6YA 4L7KA 3ROBA 1FYSA 4AEQA 3KCHA 2XEPA 5IEPA 1IT8A 5IG5A 3SXXA 3Q1CA 1MGRA 1FUWA 2QGUA 4N6OB 4J5GA 5TGNA 1VQM3 3EF8A 4KFDA 1LQGC 2GU1A 1OCVA 2AADA 4KZ1A 3MYTA 1UGIA 1WQLB 3A76A 1X1WA 1GOUA 4FMDA 2XSHB 3U97A 3WODG 2IYJA 4XDVA 4OVMA 2STDA 1UW1A 5DREA 1WTHA 3NM2A 4HM2B 1WMNA 4IIAA 2Y74A 4O8SA 1AR0A 3LZAA 1RNBA 6STDA 2CC3A 2L1SA 3DGOA 3AHWA 2FNQA 3I0YA 1A2PA 3V99A 4TX4A 4BIRA 3FF0A 3JUPA 3I563 2HMKB 5AEWB 4H61A 5IG0A 1BNGA 3WA2X 1YI23 1JN5A 2OTL3 3F14A 4XM4A 4IPBA 5AIFA 5AEUB 1BRIA 1RTUA 1WMPA 3OWUA 1YJN3 3ECFA 1IQXA 3A5EA 3OV4A 5STDA 2RBIA 1EUIC 1JZDA 2YX9A 2Z76A 4O2HA 5D81A 3S28A 1W6GA 3E99A 3EHCA 3N8BA 2CFGA 3HK4A 1MWTA 3KN4A 1JB5A 1K28A 5AYSC 1KC84 1EQKA 1BIRA 1BNEA 2IY2A 2RNTA 3EBYA 1QAFA 4RBNA 5LC6A 7GSPA 1K9M4 2BMRB 1UUWB 1JN5B 2B24B 4O3VA 3CC23 2F98A 1NJI4 1IVWA 5AIIA 5LC7A 5IENA 3QK9A 3WOFB 1YIT3 2KF6A 3EQQB 3T0UA 3NQZA 4FMBA 1GSPA 1B3SA 4RZMA 3AMOA 1ISKA 2W9QA 2SARA 3S67A 2UGIA 1UI7A 4BTWA 1JNQA 4CPKA 3HI7A 3KIIA 4K1UA 3RDEA 3SLUA 5EEOA 4EBGA 2BIRA 2GXFA 3EB8A 1KD14 1GMPA 3OWSA 4X2OA 1HKXA 4HM5B 1UCIA 1W01A 1FA3A 3PZWA 2W56A 3CPOA 1BSBA 2XGNA 3F7XA 4OUQA 2F4YA 1A90A 3AMOB 1UUGB 1C7HA 4NREA 1TUHA 2PZVA 2GBXB 1B2MA 5RNTA 3FKAA 2F5WA 2H0HA 5D82A 1RKYA 1EA2A 1SARA 3S29A 2Z77A 3GZBA 1W7CA 2E2TA 4HOHA 2CIUA 3LH4A 1FGMA 1RGEA 1N8QA 1SPUA 4WP5A 5IG3A 4HM4B 1BRHA 2W56B 3IJEB 3L0RA 3RGAA 1IVXA 1X1YA 2OOVA 4EV5A 1OGXA 3PXMA 5AI1A 1OH0A 1LOVA 3LOYA 3NV0A 3BNEA 1GY6A 1LNIA 3KFQC 2OWPA 5G1LA 4JRFA 3O8YA 1GD4A 2HMOB 1QALA 1AY7A 2OQEC 3WMDA 1Q40A 5FGOA 4EXRA 4N6LA 1ASKA 1RGKA 4N6V0 4BTYA 1U8CB 3RNTA 1BNSA 2Z6BA 4FMAA 4HVNA 3LTDA 3DGYA 1TJDA 1RJOA 2UX0A 1A67A 1MWUA 1BNJA 3MSOA 1O7GB 1ZO2A 1I70A 3EN1B 1EKMA 4I4KA 2BMQB 1RLSA 3NV0B 2E2UA 3CCS3 2W2CA 1Q7Y4 1O7MB 3OWYA 5D83A 1US1A 3GSPA 1YNVX 1DVCA 1Q40B 2YFLB 2KAAA 4XB5A 1VQN3 3CCE3 1OHOA 3X3ZA 1HZ1A 3JUMA 3FZWA 3K7CA 3G6E3 2GSPA 1FW7A 4CJNA 4J5KA 1VQQA 4LSOA 2XGLA 1BRJA 2JDIH 3UB1A 1RN1A 2CH9A 1YGWA 3D5GA 3EC9A 3LT8A 3CCJ3 1Y4KA 3UNLA 4R4KA 3NUVA 2HOHA 4L8OA 1ROAA 4R80A 1WMOA 4NHFA 1CEWI 4KFFA 1I2GA 1JKGA 2KF3A 3AGOA 3CME3 3B4OA 1UGHI 2IUKA 1W5ZA 2Q07A 1U5OA 1JB2A 1SJWA 1BOXA 1OHPA 2AAEA 2W04A 2YFJB 1BVIA 5ELJA 5JPUA 4GB5A 3Q2PA 1O7PB 4HJLB 1DMNA 1YJW3 1DE3A 2CFWA 3X41A 3CC43 1JB4A 1T5YA 3B7CA 4K90B 1BNFA 4GSPA 6GSPA 3AGNA 1W00A 1VZZA 2CFLA 1JBTA 3CPW2 2CFDA 5KP4A 1RCKA 1JKGB 2KRTA 1YVBI 2R4IA 3M8CA 5IEOA 3N54B 2RFRA 2RCDA 3URPA 3G0KA 3K5TA 4OK0A 3SEDA 1YIJ3 3NBBA 3LYGA 3VF1A 1GY5A 5BXQA 3KE7A 3D79A 4HM8B 1FZUA 3J7Yd 1I0XA 1IVVA 4HM0B 2P38A 4EW5A 1RGLA 4ILFA 5BVBA 3CCR3 1I2EA 1W4NA 3AHSA 3D5IA 3DXOA 1FGQA 1LXEA 1RGAA 4N6UA 3MG3A 3T8UA 3F9SA 2HMLB 2P0XA 3ZG5A 1N5PA 1M904 1Q864 4CCVA 1IYYA 1M9GA 1RGHA 1OACA 4RNYA 1RCLA 4FMCA 1NB3I 2XRXB 2ZHXB 5AIGA 2K3DA 1OHSA 1IV7A 1TFKA 3N9HA 6RNTA 4N6TA 1W2ZA 3X40A 3WA3A 1A2KA 5IF6A 4WYKA 2QA43 4FR9A 4MMYB 2M7OA 2C11A 1BRGA 1GOVA 1JRQA 4R9KA 3HIGA 5AYRB 3GZXB 2OOVC 3B8LA 4RNZA 5AIHA 1G02A
chains in the Genus database with same CATH topology
1AVLA 2I9WA 1QAKA 4HM1B 2OCTA 1S5AA 2BNGA 3D3LA 5CXOA 3B4PA 2ZDJA 3U1WA 4LMIA 3JUNA 3KSED 2QIYA 4WYKB 1IK3A 3MPHA 1SIHA 1NDOB 5IERA 3CCM3 1RN7A 3BLZA 2GU3A 2RGQA 3K63A 4FCJA 1CQSA 3I553 4XBYA 3HIIA 2F86B 3DY5A 3CCL3 3EN8A 7STDA 3DGLA 3NQYA 3G16A 5G2GA 1O7NB 2CG1A 3CCU3 3LT9A 2QEX3 3MG2A 3G8ZA 3FSDA 4H3UA 3OXAA 5A0OB 2HMJB 1DYUA 5CF1A 4WFOA 1QJGA 3PGBA 1VQ93 1STDA 1QVF2 3LMLA 2WGOA 3F8HA 1F8NA 4R1KA 4GL6A 3FH1A 5DRVA 5IW9A 3F7SA 1TIJA 1D6ZA 1IT7A 3UL5A 3K9MC 1STFI 3BNBA 1OGZA 1V74A 3JUQA 2CKFB 1IQ8A 3FCSB 2WO0A 4HKVB 3S27A 3WOEB 3CCQ3 1DMMA 4WWUC 3PS8A 5KP3A 2ML5A 2WOHA 2XH9A 3EBTA 4X2HA 2HMMB 3VSYA 2XFSA 2W6JH 3CCV3 4XBTA 1YJ93 3TDGA 3V92A 3FLJA 3JVCA 5I97A 5CF2A 2F99A 3DZLA 2P05A 3GRDA 1Z1SA 1IU7A 3NBRA 3FG4A 1D6YA 4CDLA 1LOXA 1BUQA 3GWRA 1R4CA 1O7HB 1WNHA 4HZBB 1KQS2 3S5CA 4LGQA 3LTCA 4AKZA 1J2BA 3NXJA 3FG3A 4J8TA 1PFPA 3FF2A 1K41A 3GZRA 1A2VA 1W2B2 2XR8B 1N5HA 1NWWA 3LTBA 1UUVB 3CNXA 1CYVA 2MF7A 2FGTA 3GAXA 4IT7A 1Q824 4LZIA 1FGOA 4J9AA 1W6CA 2W0QA 1TFOA 3ER7A 4N6NB 2D42A 4K1VA 2K54A 2P0MA 1PU4A 1M1K4 3PCRA 1M1XB 1QMAA 2JQ5A 4LEHA 2PNCA 4MJDA 1HU9A 1NB5I 1NO3A 1E97A 3X3XA 1N9JA 4ORLA 1D6UA 1EG9B 1VQ83 3D9RA 2CK3H 2ML6A 1OPYA 1SQWA 1ROVA 3QRDA 3JUOA 3X3YA 3DM8A 4HM6B 4R9LA 2CWUA 1MOLA 4U13A 3DGMA 2SBLA 2WOFA 3KZTA 1DVDA 2KCDA 1K734 3DUKA 3WDGB 1O7WB 1NU3A 2CW9A 1IV9A 5CK6A 2WGQA 4AKYA 1YHQ3 2CWTA 4KFEA 2BT3A 2IMJA 1VQP3 4L8PA 4WHAA 1Q814 4EV2A 1G96A 4JF8A 4BTXA 3MHEA 2CWVA 2FXTA 2V1LA 4HYZA 1VQ63 3K0ZA 5EQLA 8CHOA 2XSOB 3NBJA 3X42A 1GS3A 2LQVA 1IQYA 3V98A 1LNHA 2O3OA 2ZL8A 3EJVA 3SOAA 2L4VA 3CMA3 2CG0A 1OUNA 1ULIB 3G4S3 4N3VA 3MWZA 1DMQA 3CXC2 4HZ9B 4KVHA 2A15A 3DGNA 3SVAA 1VQ43 2K0MA 1SIIA 3SX1A 1FGTA 3FGYA 2MC8A 2INXA 2CHCA 5JPPA 2IUJA 2B1XB 1VQ73 4K61A 4G1MB 3T8NA 2YFIB 3IMAB 4FCZA 1E3RA 3ALAA 3IPTA 3MKIA 3PCSA 5EVHA 4STDA 2GEXA 2GEYA 3OX9A 2BHMA 3NHXA 4HM7B 4QWTA 2E2VA 2XF3A 4Q53A 2KXGA 5FW5A 1N8R4 3CD63 1KWIA 1OF5A 3F8XA 4O02B 5HGRA 3NM7A 1MNLA 1ZX2A 5JBSA 3HZPA 4ZM8A 1ULJB 1QVG2 5CLKA 2D1WA 1JV2B 3UL6A 1JJ22 3LXUX 1AVKA 1L5GB 4N6MA 2W03A 3FG1A 3KKGA 3G713 1GY7A 4FCMA 1VQL3 1VQO3 5ELUA 3HX8A 4MEIA 2OTJ3 1OF5B 1W02A 3CU3A 3GZYB 3CNMA 1IVUA 3H51A 4EYCA 1GD3A 3BNCA 2RSXA 3LTAA 3EX9A 1AV4A 4XBXA 1TU5A 3BB9A 4MMZB 1RRLA 4MMXB 1FGRA 3F40A 4XDWA 2Y73A 1UI8A 3H3HA 3MG1A 3EE1A 2CFKA 3DMCA 2IA7A 3PYJA 3STDA 1CYUA 2P09A 3NX0A 3VGNA 2XFTA 1RRHA 2Z7AA 4HM3B 1N9EA 1K8A4 5IG4A 1LVNA 1Q42A 3KSPA 4EC6A 1S723 2O9UX 3RGRA 3BNDA 1E3VA 1KSIA 2OQEA 1VQ53 3UJMA 1TP6A 2LYXA 3OW22 2HMNB 1GYBA 5KP1A 2C10A 1IDPA 2BMOB 3SOYA 2W9PA 4HBRA 2BO9B 1YGEA 4PEJA 2GBWB 3Q90A 3CC73 1VQK3 1W6YA 4L7KA 3ROBA 4AEQA 2XEPA 5IEPA 1IT8A 5IG5A 3SXXA 3Q1CA 1FUWA 2QGUA 4N6OB 5TGNA 1VQM3 3EF8A 4KFDA 2GU1A 1OCVA 4KZ1A 3MYTA 1WQLB 3A76A 4FMDA 2XSHB 3U97A 3WODG 4XDVA 5DREA 4OVMA 2STDA 1UW1A 1WTHA 3NM2A 4HM2B 1WMNA 4IIAA 2Y74A 4O8SA 1AR0A 3LZAA 6STDA 2CC3A 3DGOA 2FNQA 3I0YA 3V99A 4TX4A 3FF0A 3JUPA 3I563 2HMKB 5AEWB 4H61A 5IG0A 3WA2X 1YI23 1JN5A 2OTL3 3F14A 4XM4A 4IPBA 5AIFA 5AEUB 1WMPA 1YJN3 3OWUA 3ECFA 1IQXA 3OV4A 5STDA 2YX9A 4O2HA 2Z76A 5D81A 3S28A 1W6GA 3E99A 3EHCA 3N8BA 2CFGA 3HK4A 3KN4A 5AYSC 1JB5A 1K28A 1KC84 1EQKA 3EBYA 1QAFA 4RBNA 5LC6A 1K9M4 2BMRB 1UUWB 1JN5B 2B24B 4O3VA 3CC23 2F98A 1NJI4 1IVWA 5AIIA 5LC7A 5IENA 3QK9A 3WOFB 1YIT3 3EQQB 3T0UA 3NQZA 4FMBA 4RZMA 3AMOA 1ISKA 2W9QA 3S67A 1UI7A 4BTWA 1JNQA 3HI7A 3KIIA 4K1UA 3RDEA 3SLUA 5EEOA 4EBGA 2GXFA 3EB8A 1KD14 3OWSA 4X2OA 1HKXA 4HM5B 1W01A 1FA3A 3PZWA 2W56A 3CPOA 3F7XA 2XGNA 4OUQA 1A90A 3AMOB 1C7HA 4NREA 1TUHA 2PZVA 2GBXB 3FKAA 5D82A 1EA2A 3S29A 2Z77A 3GZBA 1W7CA 2E2TA 2CIUA 3LH4A 1FGMA 1SPUA 1N8QA 5IG3A 4WP5A 1RKYA 4HM4B 2W56B 3IJEB 3RGAA 3L0RA 4EV5A 1IVXA 2OOVA 1OGXA 3PXMA 5AI1A 1OH0A 3LOYA 3NV0A 3BNEA 1GY6A 3KFQC 2OWPA 4JRFA 3O8YA 1GD4A 2HMOB 1QALA 2OQEC 3WMDA 1Q40A 5FGOA 4EXRA 4N6LA 1ASKA 4N6V0 4BTYA 1U8CB 2Z6BA 4HVNA 4FMAA 3LTDA 1RJOA 2UX0A 1A67A 3MSOA 1O7GB 1ZO2A 3EN1B 4I4KA 1EKMA 2BMQB 3NV0B 2E2UA 3CCS3 2W2CA 1Q7Y4 1O7MB 3OWYA 5D83A 1US1A 1DVCA 1Q40B 2YFLB 4XB5A 1VQN3 3CCE3 1OHOA 3X3ZA 3JUMA 3FZWA 3K7CA 3G6E3 4LSOA 2XGLA 2JDIH 3UB1A 2CH9A 3EC9A 3LT8A 3CCJ3 1Y4KA 3UNLA 4R4KA 3NUVA 4L8OA 1ROAA 4R80A 1WMOA 4NHFA 1CEWI 4KFFA 1JKGA 3CME3 3B4OA 2IUKA 1W5ZA 2Q07A 1U5OA 1JB2A 1SJWA 1OHPA 2W04A 2YFJB 5ELJA 5JPUA 4GB5A 3Q2PA 1O7PB 4HJLB 1DMNA 1YJW3 2CFWA 3X41A 3CC43 1JB4A 1T5YA 3B7CA 4K90B 1W00A 1VZZA 2CFLA 3CPW2 2CFDA 5KP4A 1JKGB 2KRTA 1YVBI 2R4IA 3M8CA 5IEOA 3N54B 2RFRA 2RCDA 3G0KA 3K5TA 4OK0A 3SEDA 1YIJ3 3NBBA 3LYGA 3VF1A 1GY5A 5BXQA 3KE7A 4HM8B 3J7Yd 1IVVA 4HM0B 2P38A 5BVBA 3CCR3 1W4NA 3DXOA 1FGQA 1LXEA 4N6UA 3MG3A 3T8UA 3F9SA 2HMLB 2P0XA 1N5PA 1M904 1Q864 4CCVA 1M9GA 1OACA 4RNYA 4FMCA 1NB3I 2XRXB 5AIGA 1OHSA 1IV7A 1TFKA 3N9HA 4N6TA 1W2ZA 3X40A 3WA3A 1A2KA 5IF6A 4WYKA 2QA43 4FR9A 4MMYB 2M7OA 2C11A 4R9KA 1JRQA 3HIGA 5AYRB 3GZXB 2OOVC 3B8LA 4RNZA 5AIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRD A;  4N6L A;  2OCT A;  2W9P A;  2BO9 B;  4N6V 0;  1MOL A;  1DVD A;  1A67 A;  3KSE D;  1IV9 A;  1FUW A;  4N6O B;  1RN7 A;  1G96 A;  1DVC A;  5EQL A;  5A0O B;  3MWZ A;  4TX4 A;  2CH9 A;  3SVA A;  1TIJ A;  1ROA A;  3UL5 A;  3K9M C;  1STF I;  3IMA B;  1CEW I;  1EQK A;  3PS8 A;  5ELJ A;  5LC6 A;  2KXG A;  3Q2P A;  1KWI A;  5LC7 A;  1MNL A;  4ZM8 A;  3UL6 A;  2W9Q A;  1YVB I;  4N6M A;  3S67 A;  1R4C A;  1WNH A;  5ELU A;  1PFP A;  4EYC A;  1GD3 A;  1FA3 A;  1N5H A;  1A90 A;  1CYV A;  3GAX A;  1LXE A;  4IT7 A;  4LZI A;  4N6U A;  1N5P A;  3PYJ A;  1CYU A;  4CCV A;  3NX0 A;  1M9G A;  4N6N B;  1NB3 I;  1IV7 A;  4N6T A;  3LH4 A;  3L0R A;  1NB5 I;  3PXM A;  2O9U X;  1N9J A;  3KFQ C;  1GD4 A; 
#chains in the Genus database with same CATH topology
 1AVL A;  2I9W A;  1QAK A;  4HM1 B;  2OCT A;  1S5A A;  2BNG A;  1PY3 A;  3D3L A;  5CXO A;  1BNR A;  3B4P A;  2ZDJ A;  3U1W A;  4LMI A;  3JUN A;  3KSE D;  2QIY A;  4WYK B;  1IK3 A;  1B21 A;  5BIR A;  3MPH A;  1SIH A;  1NDO B;  5IER A;  3CCM 3;  1RN7 A;  3BLZ A;  2GU3 A;  2RGQ A;  3K63 A;  4FCJ A;  1CQS A;  3I55 3;  4XBY A;  3HII A;  4DKI A;  2F86 B;  3DY5 A;  3CCL 3;  5M18 A;  8RNT A;  3EN8 A;  7STD A;  1T3B A;  1LQM B;  2F56 A;  3DGL A;  2H0G A;  1O7N B;  3G16 A;  3NQY A;  3LT9 A;  5G2G A;  2CG1 A;  4BU4 A;  3CCU 3;  2UUG C;  2QEX 3;  3MG2 A;  1G0T A;  3G8Z A;  3FSD A;  4H3U A;  3OXA A;  1AQZ A;  1B2S A;  1RGC A;  5A0O B;  2HMJ B;  1DYU A;  3Q3F A;  5CF1 A;  4WFO A;  1QJG A;  3PGB A;  5HOH A;  2KF5 A;  1VQ9 3;  1STD A;  1QVF 2;  3LML A;  2WGO A;  3F8H A;  1F8N A;  4R1K A;  2C4B A;  1I3I A;  1UCL A;  4GL6 A;  3FH1 A;  5DRV A;  5IW9 A;  3F7S A;  1TIJ A;  1D6Z A;  1IT7 A;  3UL5 A;  3K9M C;  1STF I;  3BNB A;  1I2F A;  1OGZ A;  1MGW A;  1V74 A;  3JUQ A;  2CKF B;  1IQ8 A;  3FCS B;  2WO0 A;  4HKV B;  3S27 A;  3WOE B;  3CCQ 3;  1DMM A;  4WWU C;  3SYU A;  1UDI I;  3PS8 A;  5KP3 A;  2ML5 A;  2WOH A;  2XH9 A;  3EBT A;  4X2H A;  2HMM B;  3VSY A;  7RNT A;  2F5M A;  2XFS A;  1X1X A;  1X1U A;  4BL3 A;  2W6J H;  3CCV 3;  4XBT A;  1YJ9 3;  3TDG A;  5M1A A;  3V92 A;  1Q7H A;  3FLJ A;  2CX0 A;  3JVC A;  5I97 A;  1DET A;  5CF2 A;  2F99 A;  3DZL A;  1B2X A;  2P05 A;  3GRD A;  1Z1S A;  1IU7 A;  1C54 A;  3NBR A;  1BRN L;  3FG4 A;  1D6Y A;  4GHO A;  1FUS A;  1LOX A;  4CDL A;  1BUQ A;  3GWR A;  1R4C A;  1O7H B;  1WNH A;  4HZB B;  1KQS 2;  3S5C A;  3BU4 A;  4LGQ A;  3D4A A;  3LTC A;  1RGF A;  4AKZ A;  1J2B A;  3NXJ A;  3FG3 A;  4J8T A;  1PFP A;  3FF2 A;  1K41 A;  3GZR A;  1A2V A;  3DH2 A;  1W2B 2;  2XR8 B;  1N5H A;  1NWW A;  3LTB A;  1UUV B;  1YVS A;  3CNX A;  1CYV A;  2MF7 A;  4LYL B;  2FGT A;  3GAX A;  4IT7 A;  4KT3 B;  1Q82 4;  4LZI A;  1FGO A;  4J9A A;  1W6C A;  2W0Q A;  1TFO A;  4NPB A;  1B2Z A;  3ER7 A;  1B27 A;  1MWR A;  1V58 A;  2D42 A;  4N6N B;  3WR2 A;  4K1V A;  2K54 A;  2P0M A;  5G1K A;  1PU4 A;  1M1K 4;  3PCR A;  1Q9E A;  1M1X B;  1BSD A;  1QMA A;  2JQ5 A;  4LEH A;  2PNC A;  4MJD A;  3ZFZ A;  1HU9 A;  1NB5 I;  3HOH A;  1NO3 A;  2BU4 A;  1E97 A;  1EEJ A;  3X3X A;  1N9J A;  4ORL A;  1D6U A;  1EG9 B;  1VQ8 3;  3D9R A;  1BSA A;  1UCJ A;  2CK3 H;  1BUJ A;  2ML6 A;  1OPY A;  1SQW A;  1ROV A;  3QRD A;  3JUO A;  1B20 A;  3X3Y A;  5M19 A;  3DM8 A;  4HM6 B;  4R9L A;  2CWU A;  1MOL A;  1GMQ A;  1HYF A;  4U13 A;  2CX1 A;  3DGM A;  2SBL A;  2WOF A;  3KZT A;  5BU4 A;  1DVD A;  2KCD A;  1TTO A;  3DUK A;  3WDG B;  2H0I A;  1O7W B;  1NU3 A;  1UCK A;  2CW9 A;  1IV9 A;  1K73 4;  5CK6 A;  2WGQ A;  4AKY A;  1I3F A;  2CWT A;  1YHQ 3;  4KFE A;  2BT3 A;  2IMJ A;  1VQP 3;  4L8P A;  4WHA A;  1Q81 4;  4EV2 A;  1G96 A;  3ZG0 A;  1PYL A;  1MWS A;  4JF8 A;  4BTX A;  1JBS A;  3MHE A;  1LRA A;  2CWV A;  1CH0 A;  1B2U A;  1JBR A;  2FXT A;  2V1L A;  4HYZ A;  1VQ6 3;  3K0Z A;  1T2I A;  5EQL A;  8CHO A;  2XSO B;  3NBJ A;  3X42 A;  1GS3 A;  2LQV A;  1IQY A;  3V98 A;  1LNH A;  2O3O A;  1JZO A;  2ZL8 A;  3EJV A;  3SOA A;  2L4V A;  1RNT A;  3CMA 3;  2CG0 A;  1OUN A;  1ULI B;  3G4S 3;  1BRS A;  4N3V A;  3MWZ A;  1DMQ A;  3CXC 2;  1RHL A;  4HZ9 B;  4KVH A;  2A15 A;  3DGN A;  3SVA A;  1VQ4 3;  5GSP A;  2K0M A;  4BL2 A;  1SII A;  1BRK A;  3BIR A;  3SX1 A;  1FGT A;  3FGY A;  2MC8 A;  2INX A;  1I0V A;  2CHC A;  5JPP A;  2IUJ A;  2B1X B;  1VQ7 3;  4K61 A;  4G1M B;  3T8N A;  1RDS A;  2YFI B;  3IMA B;  4FCZ A;  1E3R A;  3ALA A;  3IPT A;  3MKI A;  3PCS A;  5EVH A;  1TRP A;  4STD A;  1TRQ A;  2GEX A;  2GEY A;  3OX9 A;  2BHM A;  3NHX A;  4HM7 B;  4QWT A;  2E2V A;  2XF3 A;  4Q53 A;  2KXG A;  5FW5 A;  1N8R 4;  3CD6 3;  1KWI A;  1OF5 A;  4RNT A;  1GMR A;  3F8X A;  4O02 B;  5HGR A;  3NM7 A;  1BSE A;  1MNL A;  1ZX2 A;  5JBS A;  2J8X B;  3HZP A;  4ZM8 A;  1ULJ B;  2R41 A;  1QVG 2;  5CLK A;  2D1W A;  1JV2 B;  3UL6 A;  1JJ2 2;  3LXU X;  1AVK A;  1L5G B;  4N6M A;  2W03 A;  3FG1 A;  3KKG A;  3G71 3;  1ZS7 A;  1GY7 A;  4FCM A;  1VQL 3;  1VQO 3;  5ELU A;  3HX8 A;  4MEI A;  2OTJ 3;  1OF5 B;  9RNT A;  1BAN A;  1RN4 A;  1W02 A;  3CU3 A;  3GZY B;  3CNM A;  1BGS A;  1IVU A;  3H51 A;  4EYC A;  1GD3 A;  3BNC A;  2RSX A;  3LTA A;  3EX9 A;  1AV4 A;  4XBX A;  1TU5 A;  3BB9 A;  4HAA A;  2KF4 A;  1BSC A;  1RRL A;  4MMZ B;  4MMX B;  1FGR A;  3F40 A;  4XDW A;  1BAO A;  2Y73 A;  1UI8 A;  3H3H A;  3MG1 A;  3EE1 A;  1T2H A;  2CFK A;  2IA7 A;  3DMC A;  3PYJ A;  4I5Q A;  1LOY A;  3STD A;  1CYU A;  2P09 A;  2ZA4 A;  3NX0 A;  1I8V A;  3VGN A;  1FUT A;  1LOW A;  1RRH A;  2XFT A;  1RMS A;  1RSN A;  2Z7A A;  1N9E A;  4HM3 B;  1K8A 4;  1GOY A;  5IG4 A;  1NNV A;  1LVN A;  1ZGX A;  1Q42 A;  3KSP A;  4EC6 A;  1S72 3;  2O9U X;  3RGR A;  3BND A;  1E3V A;  1RGG A;  1KSI A;  2OQE A;  1VQ5 3;  1BU4 A;  1BNI A;  1R4Y A;  3UJM A;  1TP6 A;  2LYX A;  3OW2 2;  2HMN B;  1GYB A;  5KP1 A;  1V57 A;  2C10 A;  1IDP A;  2BMO B;  3WHO A;  3SOY A;  2W9P A;  4HBR A;  2BO9 B;  1YGE A;  4PEJ A;  2GBW B;  3Q90 A;  3CC7 3;  1VQK 3;  1W6Y A;  4L7K A;  3ROB A;  1FYS A;  4AEQ A;  3KCH A;  2XEP A;  5IEP A;  1IT8 A;  5IG5 A;  3SXX A;  3Q1C A;  1MGR A;  1FUW A;  2QGU A;  4N6O B;  4J5G A;  5TGN A;  1VQM 3;  3EF8 A;  4KFD A;  1LQG C;  2GU1 A;  1OCV A;  2AAD A;  4KZ1 A;  3MYT A;  1UGI A;  1WQL B;  3A76 A;  1X1W A;  1GOU A;  4FMD A;  2XSH B;  3U97 A;  3WOD G;  2IYJ A;  4XDV A;  4OVM A;  2STD A;  1UW1 A;  5DRE A;  1WTH A;  3NM2 A;  4HM2 B;  1WMN A;  4IIA A;  2Y74 A;  4O8S A;  1AR0 A;  3LZA A;  1RNB A;  6STD A;  2CC3 A;  2L1S A;  3DGO A;  3AHW A;  2FNQ A;  3I0Y A;  1A2P A;  3V99 A;  4TX4 A;  4BIR A;  3FF0 A;  3JUP A;  3I56 3;  2HMK B;  5AEW B;  4H61 A;  5IG0 A;  1BNG A;  3WA2 X;  1YI2 3;  1JN5 A;  2OTL 3;  3F14 A;  4XM4 A;  4IPB A;  5AIF A;  5AEU B;  1BRI A;  1RTU A;  1WMP A;  3OWU A;  1YJN 3;  3ECF A;  1IQX A;  3A5E A;  3OV4 A;  5STD A;  2RBI A;  1EUI C;  1JZD A;  2YX9 A;  2Z76 A;  4O2H A;  5D81 A;  3S28 A;  1W6G A;  3E99 A;  3EHC A;  3N8B A;  2CFG A;  3HK4 A;  1MWT A;  3KN4 A;  1JB5 A;  1K28 A;  5AYS C;  1KC8 4;  1EQK A;  1BIR A;  1BNE A;  2IY2 A;  2RNT A;  3EBY A;  1QAF A;  4RBN A;  5LC6 A;  7GSP A;  1K9M 4;  2BMR B;  1UUW B;  1JN5 B;  2B24 B;  4O3V A;  3CC2 3;  2F98 A;  1NJI 4;  1IVW A;  5AII A;  5LC7 A;  5IEN A;  3QK9 A;  3WOF B;  1YIT 3;  2KF6 A;  3EQQ B;  3T0U A;  3NQZ A;  4FMB A;  1GSP A;  1B3S A;  4RZM A;  3AMO A;  1ISK A;  2W9Q A;  2SAR A;  3S67 A;  2UGI A;  1UI7 A;  4BTW A;  1JNQ A;  4CPK A;  3HI7 A;  3KII A;  4K1U A;  3RDE A;  3SLU A;  5EEO A;  4EBG A;  2BIR A;  2GXF A;  3EB8 A;  1KD1 4;  1GMP A;  3OWS A;  4X2O A;  1HKX A;  4HM5 B;  1UCI A;  1W01 A;  1FA3 A;  3PZW A;  2W56 A;  3CPO A;  1BSB A;  2XGN A;  3F7X A;  4OUQ A;  2F4Y A;  1A90 A;  3AMO B;  1UUG B;  1C7H A;  4NRE A;  1TUH A;  2PZV A;  2GBX B;  1B2M A;  5RNT A;  3FKA A;  2F5W A;  2H0H A;  5D82 A;  1RKY A;  1EA2 A;  1SAR A;  3S29 A;  2Z77 A;  3GZB A;  1W7C A;  2E2T A;  4HOH A;  2CIU A;  3LH4 A;  1FGM A;  1RGE A;  1N8Q A;  1SPU A;  4WP5 A;  5IG3 A;  4HM4 B;  1BRH A;  2W56 B;  3IJE B;  3L0R A;  3RGA A;  1IVX A;  1X1Y A;  2OOV A;  4EV5 A;  1OGX A;  3PXM A;  5AI1 A;  1OH0 A;  1LOV A;  3LOY A;  3NV0 A;  3BNE A;  1GY6 A;  1LNI A;  3KFQ C;  2OWP A;  5G1L A;  4JRF A;  3O8Y A;  1GD4 A;  2HMO B;  1QAL A;  1AY7 A;  2OQE C;  3WMD A;  1Q40 A;  5FGO A;  4EXR A;  4N6L A;  1ASK A;  1RGK A;  4N6V 0;  4BTY A;  1U8C B;  3RNT A;  1BNS A;  2Z6B A;  4FMA A;  4HVN A;  3LTD A;  3DGY A;  1TJD A;  1RJO A;  2UX0 A;  1A67 A;  1MWU A;  1BNJ A;  3MSO A;  1O7G B;  1ZO2 A;  1I70 A;  3EN1 B;  1EKM A;  4I4K A;  2BMQ B;  1RLS A;  3NV0 B;  2E2U A;  3CCS 3;  2W2C A;  1Q7Y 4;  1O7M B;  3OWY A;  5D83 A;  1US1 A;  3GSP A;  1YNV X;  1DVC A;  1Q40 B;  2YFL B;  2KAA A;  4XB5 A;  1VQN 3;  3CCE 3;  1OHO A;  3X3Z A;  1HZ1 A;  3JUM A;  3FZW A;  3K7C A;  3G6E 3;  2GSP A;  1FW7 A;  4CJN A;  4J5K A;  1VQQ A;  4LSO A;  2XGL A;  1BRJ A;  2JDI H;  3UB1 A;  1RN1 A;  2CH9 A;  1YGW A;  3D5G A;  3EC9 A;  3LT8 A;  3CCJ 3;  1Y4K A;  3UNL A;  4R4K A;  3NUV A;  2HOH A;  4L8O A;  1ROA A;  4R80 A;  1WMO A;  4NHF A;  1CEW I;  4KFF A;  1I2G A;  1JKG A;  2KF3 A;  3AGO A;  3CME 3;  3B4O A;  1UGH I;  2IUK A;  1W5Z A;  2Q07 A;  1U5O A;  1JB2 A;  1SJW A;  1BOX A;  1OHP A;  2AAE A;  2W04 A;  2YFJ B;  1BVI A;  5ELJ A;  5JPU A;  4GB5 A;  3Q2P A;  1O7P B;  4HJL B;  1DMN A;  1YJW 3;  1DE3 A;  2CFW A;  3X41 A;  3CC4 3;  1JB4 A;  1T5Y A;  3B7C A;  4K90 B;  1BNF A;  4GSP A;  6GSP A;  3AGN A;  1W00 A;  1VZZ A;  2CFL A;  1JBT A;  3CPW 2;  2CFD A;  5KP4 A;  1RCK A;  1JKG B;  2KRT A;  1YVB I;  2R4I A;  3M8C A;  5IEO A;  3N54 B;  2RFR A;  2RCD A;  3URP A;  3G0K A;  3K5T A;  4OK0 A;  3SED A;  1YIJ 3;  3NBB A;  3LYG A;  3VF1 A;  1GY5 A;  5BXQ A;  3KE7 A;  3D79 A;  4HM8 B;  1FZU A;  3J7Y d;  1I0X A;  1IVV A;  4HM0 B;  2P38 A;  4EW5 A;  1RGL A;  4ILF A;  5BVB A;  3CCR 3;  1I2E A;  1W4N A;  3AHS A;  3D5I A;  3DXO A;  1FGQ A;  1LXE A;  1RGA A;  4N6U A;  3MG3 A;  3T8U A;  3F9S A;  2HML B;  2P0X A;  3ZG5 A;  1N5P A;  1M90 4;  1Q86 4;  4CCV A;  1IYY A;  1M9G A;  1RGH A;  1OAC A;  4RNY A;  1RCL A;  4FMC A;  1NB3 I;  2XRX B;  2ZHX B;  5AIG A;  2K3D A;  1OHS A;  1IV7 A;  1TFK A;  3N9H A;  6RNT A;  4N6T A;  1W2Z A;  3X40 A;  3WA3 A;  1A2K A;  5IF6 A;  4WYK A;  2QA4 3;  4FR9 A;  4MMY B;  2M7O A;  2C11 A;  1BRG A;  1GOV A;  1JRQ A;  4R9K A;  3HIG A;  5AYR B;  3GZX B;  2OOV C;  3B8L A;  4RNZ A;  5AIH A;  1G02 A; 
#chains in the Genus database with same CATH homology
 1AVL A;  2I9W A;  1QAK A;  4HM1 B;  2OCT A;  1S5A A;  2BNG A;  3D3L A;  5CXO A;  3B4P A;  2ZDJ A;  3U1W A;  4LMI A;  3JUN A;  3KSE D;  2QIY A;  4WYK B;  1IK3 A;  3MPH A;  1SIH A;  1NDO B;  5IER A;  3CCM 3;  1RN7 A;  3BLZ A;  2GU3 A;  2RGQ A;  3K63 A;  4FCJ A;  1CQS A;  3I55 3;  4XBY A;  3HII A;  2F86 B;  3DY5 A;  3CCL 3;  3EN8 A;  7STD A;  3DGL A;  3NQY A;  3G16 A;  5G2G A;  1O7N B;  2CG1 A;  3CCU 3;  3LT9 A;  2QEX 3;  3MG2 A;  3G8Z A;  3FSD A;  4H3U A;  3OXA A;  5A0O B;  2HMJ B;  1DYU A;  5CF1 A;  4WFO A;  1QJG A;  3PGB A;  1VQ9 3;  1STD A;  1QVF 2;  3LML A;  2WGO A;  3F8H A;  1F8N A;  4R1K A;  4GL6 A;  3FH1 A;  5DRV A;  5IW9 A;  3F7S A;  1TIJ A;  1D6Z A;  1IT7 A;  3UL5 A;  3K9M C;  1STF I;  3BNB A;  1OGZ A;  1V74 A;  3JUQ A;  2CKF B;  1IQ8 A;  3FCS B;  2WO0 A;  4HKV B;  3S27 A;  3WOE B;  3CCQ 3;  1DMM A;  4WWU C;  3PS8 A;  5KP3 A;  2ML5 A;  2WOH A;  2XH9 A;  3EBT A;  4X2H A;  2HMM B;  3VSY A;  2XFS A;  2W6J H;  3CCV 3;  4XBT A;  1YJ9 3;  3TDG A;  3V92 A;  3FLJ A;  3JVC A;  5I97 A;  5CF2 A;  2F99 A;  3DZL A;  2P05 A;  3GRD A;  1Z1S A;  1IU7 A;  3NBR A;  3FG4 A;  1D6Y A;  4CDL A;  1LOX A;  1BUQ A;  3GWR A;  1R4C A;  1O7H B;  1WNH A;  4HZB B;  1KQS 2;  3S5C A;  4LGQ A;  3LTC A;  4AKZ A;  1J2B A;  3NXJ A;  3FG3 A;  4J8T A;  1PFP A;  3FF2 A;  1K41 A;  3GZR A;  1A2V A;  1W2B 2;  2XR8 B;  1N5H A;  1NWW A;  3LTB A;  1UUV B;  3CNX A;  1CYV A;  2MF7 A;  2FGT A;  3GAX A;  4IT7 A;  1Q82 4;  4LZI A;  1FGO A;  4J9A A;  1W6C A;  2W0Q A;  1TFO A;  3ER7 A;  4N6N B;  2D42 A;  4K1V A;  2K54 A;  2P0M A;  1PU4 A;  1M1K 4;  3PCR A;  1M1X B;  1QMA A;  2JQ5 A;  4LEH A;  2PNC A;  4MJD A;  1HU9 A;  1NB5 I;  1NO3 A;  1E97 A;  3X3X A;  1N9J A;  4ORL A;  1D6U A;  1EG9 B;  1VQ8 3;  3D9R A;  2CK3 H;  2ML6 A;  1OPY A;  1SQW A;  1ROV A;  3QRD A;  3JUO A;  3X3Y A;  3DM8 A;  4HM6 B;  4R9L A;  2CWU A;  1MOL A;  4U13 A;  3DGM A;  2SBL A;  2WOF A;  3KZT A;  1DVD A;  2KCD A;  1K73 4;  3DUK A;  3WDG B;  1O7W B;  1NU3 A;  2CW9 A;  1IV9 A;  5CK6 A;  2WGQ A;  4AKY A;  1YHQ 3;  2CWT A;  4KFE A;  2BT3 A;  2IMJ A;  1VQP 3;  4L8P A;  4WHA A;  1Q81 4;  4EV2 A;  1G96 A;  4JF8 A;  4BTX A;  3MHE A;  2CWV A;  2FXT A;  2V1L A;  4HYZ A;  1VQ6 3;  3K0Z A;  5EQL A;  8CHO A;  2XSO B;  3NBJ A;  3X42 A;  1GS3 A;  2LQV A;  1IQY A;  3V98 A;  1LNH A;  2O3O A;  2ZL8 A;  3EJV A;  3SOA A;  2L4V A;  3CMA 3;  2CG0 A;  1OUN A;  1ULI B;  3G4S 3;  4N3V A;  3MWZ A;  1DMQ A;  3CXC 2;  4HZ9 B;  4KVH A;  2A15 A;  3DGN A;  3SVA A;  1VQ4 3;  2K0M A;  1SII A;  3SX1 A;  1FGT A;  3FGY A;  2MC8 A;  2INX A;  2CHC A;  5JPP A;  2IUJ A;  2B1X B;  1VQ7 3;  4K61 A;  4G1M B;  3T8N A;  2YFI B;  3IMA B;  4FCZ A;  1E3R A;  3ALA A;  3IPT A;  3MKI A;  3PCS A;  5EVH A;  4STD A;  2GEX A;  2GEY A;  3OX9 A;  2BHM A;  3NHX A;  4HM7 B;  4QWT A;  2E2V A;  2XF3 A;  4Q53 A;  2KXG A;  5FW5 A;  1N8R 4;  3CD6 3;  1KWI A;  1OF5 A;  3F8X A;  4O02 B;  5HGR A;  3NM7 A;  1MNL A;  1ZX2 A;  5JBS A;  3HZP A;  4ZM8 A;  1ULJ B;  1QVG 2;  5CLK A;  2D1W A;  1JV2 B;  3UL6 A;  1JJ2 2;  3LXU X;  1AVK A;  1L5G B;  4N6M A;  2W03 A;  3FG1 A;  3KKG A;  3G71 3;  1GY7 A;  4FCM A;  1VQL 3;  1VQO 3;  5ELU A;  3HX8 A;  4MEI A;  2OTJ 3;  1OF5 B;  1W02 A;  3CU3 A;  3GZY B;  3CNM A;  1IVU A;  3H51 A;  4EYC A;  1GD3 A;  3BNC A;  2RSX A;  3LTA A;  3EX9 A;  1AV4 A;  4XBX A;  1TU5 A;  3BB9 A;  4MMZ B;  1RRL A;  4MMX B;  1FGR A;  3F40 A;  4XDW A;  2Y73 A;  1UI8 A;  3H3H A;  3MG1 A;  3EE1 A;  2CFK A;  3DMC A;  2IA7 A;  3PYJ A;  3STD A;  1CYU A;  2P09 A;  3NX0 A;  3VGN A;  2XFT A;  1RRH A;  2Z7A A;  4HM3 B;  1N9E A;  1K8A 4;  5IG4 A;  1LVN A;  1Q42 A;  3KSP A;  4EC6 A;  1S72 3;  2O9U X;  3RGR A;  3BND A;  1E3V A;  1KSI A;  2OQE A;  1VQ5 3;  3UJM A;  1TP6 A;  2LYX A;  3OW2 2;  2HMN B;  1GYB A;  5KP1 A;  2C10 A;  1IDP A;  2BMO B;  3SOY A;  2W9P A;  4HBR A;  2BO9 B;  1YGE A;  4PEJ A;  2GBW B;  3Q90 A;  3CC7 3;  1VQK 3;  1W6Y A;  4L7K A;  3ROB A;  4AEQ A;  2XEP A;  5IEP A;  1IT8 A;  5IG5 A;  3SXX A;  3Q1C A;  1FUW A;  2QGU A;  4N6O B;  5TGN A;  1VQM 3;  3EF8 A;  4KFD A;  2GU1 A;  1OCV A;  4KZ1 A;  3MYT A;  1WQL B;  3A76 A;  4FMD A;  2XSH B;  3U97 A;  3WOD G;  4XDV A;  5DRE A;  4OVM A;  2STD A;  1UW1 A;  1WTH A;  3NM2 A;  4HM2 B;  1WMN A;  4IIA A;  2Y74 A;  4O8S A;  1AR0 A;  3LZA A;  6STD A;  2CC3 A;  3DGO A;  2FNQ A;  3I0Y A;  3V99 A;  4TX4 A;  3FF0 A;  3JUP A;  3I56 3;  2HMK B;  5AEW B;  4H61 A;  5IG0 A;  3WA2 X;  1YI2 3;  1JN5 A;  2OTL 3;  3F14 A;  4XM4 A;  4IPB A;  5AIF A;  5AEU B;  1WMP A;  1YJN 3;  3OWU A;  3ECF A;  1IQX A;  3OV4 A;  5STD A;  2YX9 A;  4O2H A;  2Z76 A;  5D81 A;  3S28 A;  1W6G A;  3E99 A;  3EHC A;  3N8B A;  2CFG A;  3HK4 A;  3KN4 A;  5AYS C;  1JB5 A;  1K28 A;  1KC8 4;  1EQK A;  3EBY A;  1QAF A;  4RBN A;  5LC6 A;  1K9M 4;  2BMR B;  1UUW B;  1JN5 B;  2B24 B;  4O3V A;  3CC2 3;  2F98 A;  1NJI 4;  1IVW A;  5AII A;  5LC7 A;  5IEN A;  3QK9 A;  3WOF B;  1YIT 3;  3EQQ B;  3T0U A;  3NQZ A;  4FMB A;  4RZM A;  3AMO A;  1ISK A;  2W9Q A;  3S67 A;  1UI7 A;  4BTW A;  1JNQ A;  3HI7 A;  3KII A;  4K1U A;  3RDE A;  3SLU A;  5EEO A;  4EBG A;  2GXF A;  3EB8 A;  1KD1 4;  3OWS A;  4X2O A;  1HKX A;  4HM5 B;  1W01 A;  1FA3 A;  3PZW A;  2W56 A;  3CPO A;  3F7X A;  2XGN A;  4OUQ A;  1A90 A;  3AMO B;  1C7H A;  4NRE A;  1TUH A;  2PZV A;  2GBX B;  3FKA A;  5D82 A;  1EA2 A;  3S29 A;  2Z77 A;  3GZB A;  1W7C A;  2E2T A;  2CIU A;  3LH4 A;  1FGM A;  1SPU A;  1N8Q A;  5IG3 A;  4WP5 A;  1RKY A;  4HM4 B;  2W56 B;  3IJE B;  3RGA A;  3L0R A;  4EV5 A;  1IVX A;  2OOV A;  1OGX A;  3PXM A;  5AI1 A;  1OH0 A;  3LOY A;  3NV0 A;  3BNE A;  1GY6 A;  3KFQ C;  2OWP A;  4JRF A;  3O8Y A;  1GD4 A;  2HMO B;  1QAL A;  2OQE C;  3WMD A;  1Q40 A;  5FGO A;  4EXR A;  4N6L A;  1ASK A;  4N6V 0;  4BTY A;  1U8C B;  2Z6B A;  4HVN A;  4FMA A;  3LTD A;  1RJO A;  2UX0 A;  1A67 A;  3MSO A;  1O7G B;  1ZO2 A;  3EN1 B;  4I4K A;  1EKM A;  2BMQ B;  3NV0 B;  2E2U A;  3CCS 3;  2W2C A;  1Q7Y 4;  1O7M B;  3OWY A;  5D83 A;  1US1 A;  1DVC A;  1Q40 B;  2YFL B;  4XB5 A;  1VQN 3;  3CCE 3;  1OHO A;  3X3Z A;  3JUM A;  3FZW A;  3K7C A;  3G6E 3;  4LSO A;  2XGL A;  2JDI H;  3UB1 A;  2CH9 A;  3EC9 A;  3LT8 A;  3CCJ 3;  1Y4K A;  3UNL A;  4R4K A;  3NUV A;  4L8O A;  1ROA A;  4R80 A;  1WMO A;  4NHF A;  1CEW I;  4KFF A;  1JKG A;  3CME 3;  3B4O A;  2IUK A;  1W5Z A;  2Q07 A;  1U5O A;  1JB2 A;  1SJW A;  1OHP A;  2W04 A;  2YFJ B;  5ELJ A;  5JPU A;  4GB5 A;  3Q2P A;  1O7P B;  4HJL B;  1DMN A;  1YJW 3;  2CFW A;  3X41 A;  3CC4 3;  1JB4 A;  1T5Y A;  3B7C A;  4K90 B;  1W00 A;  1VZZ A;  2CFL A;  3CPW 2;  2CFD A;  5KP4 A;  1JKG B;  2KRT A;  1YVB I;  2R4I A;  3M8C A;  5IEO A;  3N54 B;  2RFR A;  2RCD A;  3G0K A;  3K5T A;  4OK0 A;  3SED A;  1YIJ 3;  3NBB A;  3LYG A;  3VF1 A;  1GY5 A;  5BXQ A;  3KE7 A;  4HM8 B;  3J7Y d;  1IVV A;  4HM0 B;  2P38 A;  5BVB A;  3CCR 3;  1W4N A;  3DXO A;  1FGQ A;  1LXE A;  4N6U A;  3MG3 A;  3T8U A;  3F9S A;  2HML B;  2P0X A;  1N5P A;  1M90 4;  1Q86 4;  4CCV A;  1M9G A;  1OAC A;  4RNY A;  4FMC A;  1NB3 I;  2XRX B;  5AIG A;  1OHS A;  1IV7 A;  1TFK A;  3N9H A;  4N6T A;  1W2Z A;  3X40 A;  3WA3 A;  1A2K A;  5IF6 A;  4WYK A;  2QA4 3;  4FR9 A;  4MMY B;  2M7O A;  2C11 A;  4R9K A;  1JRQ A;  3HIG A;  5AYR B;  3GZX B;  2OOV C;  3B8L A;  4RNZ A;  5AIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...