1DETA

Ribonuclease t1 carboxymethylated at glu 58 in complex with 2'gmp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
103
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of ribonuclease T1 carboxymethylated at Glu58 in complex with 2'-GMP.
pubmed doi rcsb
molecule tags Hydrolase (endoribonuclease)
total genus 23
structure length 103
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1detA00
1GOVA 1LOYA 1FUSA 4GSPA 5BU4A 1I2FA 2KF6A 1R4YA 1I8VA 1ZGXA 1TTOA 1DE3A 1BSBA 1BVIA 1B2XA 1RMSA 3BU4A 1GOUA 2BIRA 1TRPA 1RNBA 4GHOA 1BRHA 1BNSA 1LRAA 1BANA 3AGNA 5RNTA 1X1WA 1BSEA 1BSCA 1CH0A 2RNTA 1RHLA 1RCKA 3D5IA 1T2IA 3AHSA 1I2EA 2F5MA 7RNTA 1IYYA 1BRIA 3KCHA 1BNIA 1RTUA 2KF5A 6RNTA 1RGFA 4BIRA 1BIRA 1RNTA 1BNJA 1RGHA 2AADA 1A2PA 1BRSA 3BIRA 3HOHA 1B2UA 4HAAA 7GSPA 2C4BA 1GSPA 1SARA 8RNTA 1JBTA 1MGWA 2KAAA 1JBRA 1RGCA 1GMQA 1BAOA 4HOHA 1RGKA 1X1XA 1X1UA 5GSPA 1BNRA 1BNGA 2BU4A 1LOVA 2ZA4A 3GSPA 6GSPA 1G02A 1DETA 2GSPA 1UCIA 3WR2A 4J5GA 1BSAA 2F5WA 1BU4A 1T2HA 3AGOA 3Q3FA 2SARA 3URPA 3D5GA 1I3IA 1I70A 1RGEA 1PYLA 1UCKA 1JBSA 3DGYA 1BRJA 4BU4A 1RGAA 1AY7A 3SYUA 1B20A 1RN4A 5BIRA 1FZUA 1RDSA 1FW7A 1AQZA 1YNVX 4J5KA 3AHWA 1I0VA 1I0XA 2F4YA 1TRQA 1YGWA 1GOYA 2RBIA 1I3FA 1BUJA 1BRNL 1FUTA 1RGGA 1RSNA 1B2SA 3WHOA 1BNEA 1BRGA 1I2GA 1BSDA 3RNTA 1FYSA 1Q9EA 1BOXA 1HYFA 1B3SA 1LNIA 1X1YA 3DH2A 1BGSA 1B21A 1RN1A 1YVSA 1B2MA 3A5EA 1MGRA 1BNFA 1RCLA 2HOHA 9RNTA 1UCJA 1RLSA 3D4AA 1LOWA 5HOHA 2AAEA 2F56A 1C54A 1BRKA 1UCLA 1B2ZA 1GMRA 2KF3A 1PY3A 4RNTA 1GMPA 2KF4A 1B27A 1HZ1A 1RGLA
chains in the Genus database with same CATH superfamily
3ROBA 1GOVA 1FUSA 1Q40B 3FSDA 1LOXA 1O7PB 5CXOA 1Q7Y4 3F8XA 4GSPA 3SOAA 3NBBA 3LTBA 2WOHA 3PS8A 4FCJA 5HGRA 2BIRA 1Q40A 1TRPA 2H0IA 3S28A 1UI8A 2H0HA 2SBLA 1BNSA 1C7HA 3T8UA 2OTL3 2OTJ3 1SIHA 5RNTA 2E2VA 4L8PA 3Q2PA 3ZG0A 2WGOA 2RNTA 3DGOA 5CK6A 3MHEA 3SLUA 4WP5A 1J2BA 1RRHA 3FCSB 1I2EA 5FW5A 3VSYA 3I563 1R4CA 1NDOB 3K7CA 4HM8B 3E99A 1BNIA 1JJ22 1UUVB 3FG4A 1OHSA 1RGFA 4BIRA 4L8OA 1BIRA 1BNJA 1RGHA 2LYXA 3BIRA 2P05A 3B7CA 2CG0A 4EW5A 1G96A 3T0UA 4O3VA 2JQ5A 7GSPA 1DMNA 5KP4A 1A2VA 2C4BA 2XGNA 3HI7A 8RNTA 2KAAA 3UL5A 1TU5A 1IU7A 1YJ93 1JZOA 1JN5A 1X1UA 4ILFA 5AEUB 1VQO3 3OWSA 1M1XB 1JNQA 2B1XB 2YFIB 1WMNA 3LYGA 1GD3A 3LOYA 4K1VA 2W9PA 3JUOA 6GSPA 4J5GA 1YI23 1BSAA 2F5WA 3K0ZA 3I553 3D5GA 1YIT3 3MYTA 1OACA 2D42A 2CFLA 3KKGA 4BL2A 2KRTA 4IPBA 1AR0A 1PYLA 1K28A 1UCKA 1W6YA 2CKFB 2ZL8A 5LC7A 1OF5A 1JBSA 3NX0A 1ULIB 1AVLA 2BMRB 1GD4A 3TDGA 4BU4A 3SYUA 5TGNA 4HM1B 3LT9A 2CC3A 3NQYA 2BO9B 3BLZA 4RNZA 1CEWI 3NBJA 3O8YA 3KE7A 4FR9A 1I0XA 5KP3A 1Q824 1YGWA 3UJMA 1STDA 3DY5A 5AIFA 5CLKA 1RGGA 3EX9A 3M8CA 5AYRB 3CCR3 1VQP3 2CK3H 3WDGB 1I2GA 1IV9A 1KSIA 2YFJB 4FMAA 4HJLB 4HM6B 3S27A 1BSDA 3GZBA 1Q9EA 5JPPA 1VQK3 4MMZB 3RGAA 5AIHA 4HBRA 3CNXA 4O8SA 4LGQA 3AMOB 4K61A 1B2MA 2J8XB 3A5EA 5BXQA 1NB3I 3L0RA 1RCLA 4HM0B 4X2OA 3DM8A 9RNTA 1O7NB 1IT7A 1UCJA 2RGQA 1LOWA 2Y74A 3S5CA 3G16A 3QRDA 3D79A 1OHOA 2Z6BA 1STFI 3LT8A 1VQL3 2ZHXB 1NB5I 4HM7B 5IEPA 1YJW3 4GB5A 3LTDA 4H3UA 1IQXA 1O7HB 3MWZA 2WGQA 2CFGA 3A76A 3STDA 1YHQ3 3EF8A 2CIUA 1QVF2 1QJGA 1ZX2A 2XFSA 1DMMA 3HIIA 1NNVA 4XDVA 2O3OA 1N8QA 4N6MA 1ZGXA 4R1KA 3GAXA 1TTOA 5STDA 1BVIA 1O7GB 1B2XA 3GZYB 1IK3A 1UW1A 3WA2X 3SVAA 3CC23 3CC73 3X3ZA 1BRHA 5M1AA 1LRAA 1BANA 4J8TA 1E97A 1W7CA 3WODG 3KSPA 3FZWA 4I4KA 3HIGA 3N9HA 2XF3A 3V92A 2L1SA 1KC84 2CX1A 3G0KA 3I0YA 4XM4A 3X3YA 4FMDA 3CPW2 2CWVA 2CG1A 3D3LA 7RNTA 1ZO2A 4DKIA 4AKZA 3U1WA 1IYYA 3T8NA 4CJNA 1BRIA 3CCS3 2BMOB 1EA2A 5IG0A 1FGQA 1D6UA 1HKXA 3DUKA 1U8CB 2HMMB 1Q814 1VQQA 1MOLA 1DYUA 1BRSA 1ASKA 4KZ1A 3FF0A 4HM5B 2Z7AA 4ORLA 1FGTA 1WMOA 1TUHA 1IT8A 1UGIA 4MEIA 2CX0A 3HX8A 1GSPA 1JRQA 3RGRA 4K90B 4HM3B 2FNQA 1RGCA 1OPYA 1GMQA 1JBRA 3EC9A 2F98A 3NV0A 1IVWA 1RGKA 4G1MB 1UGHI 3CCQ3 1BNRA 1NU3A 4KFFA 1DETA 1JB2A 4OUQA 3Q3FA 1M1K4 1SPUA 3AGOA 2HMLB 1VQ83 3CU3A 5AYSC 3URPA 4KVHA 2HMNB 1YIJ3 2OOVA 1V57A 4R80A 5IENA 1DVCA 1G0TA 1UI7A 2I9WA 3VGNA 3G4S3 1RGAA 4EV5A 1VQ93 5AEWB 4NREA 4N6V0 1KQS2 3MG3A 1MWSA 3B4PA 3KN4A 3F40A 5IG5A 1JN5B 1RDSA 5EQLA 3OX9A 4J5KA 2RCDA 4RBNA 3AHWA 1I0VA 3LTAA 3BNDA 5G1KA 3F7XA 2PNCA 4KT3B 1VQN3 3MPHA 3F8HA 1I3FA 1N9JA 5IF6A 4HKVB 5LC6A 1RSNA 2RSXA 3BB9A 1HU9A 4IT7A 3CC43 1OF5B 3ER7A 2CW9A 3RDEA 2O9UX 4STDA 5EVHA 1HYFA 1B3SA 1LNIA 1QALA 3EN8A 1B21A 2MF7A 4LZIA 2WO0A 4RNYA 3JUNA 4EYCA 1EEJA 4H61A 2QIYA 2W6JH 1JKGA 2OQEC 2W2CA 2W04A 3S29A 3WOFB 3N54B 5EEOA 1BNFA 2HOHA 2K54A 1FUWA 1SQWA 5DRVA 1D6YA 1NWWA 1T5YA 2IUKA 1MWUA 5JPUA 1DMQA 4FMCA 1WTHA 1UCLA 2E2TA 1OUNA 2KCDA 3UB1A 4PEJA 2IYJA 1PY3A 2OCTA 3K9MC 5IERA 3K63A 3F14A 3K5TA 5JBSA 3SX1A 1BUQA 1RJOA 3NBRA 3NM2A 5BU4A 2K3DA 2F86B 1R4YA 1I8VA 4CPKA 1AVKA 4X2HA 3BU4A 1FGRA 1PFPA 1RMSA 2CH9A 2XFTA 1W6GA 1NO3A 2GEYA 3BNCA 4K1UA 3G8ZA 1M904 2BMQB 3OV4A 5DREA 3N8BA 1QAFA 1WQLB 3CNMA 1U5OA 1X1WA 1BSEA 2A15A 1JZDA 4R9LA 1W4NA 3X41A 3CCM3 1CH0A 5AIGA 4FMBA 2STDA 2YFLB 3D5IA 2GU1A 1A90A 4XDWA 1IQYA 2F5MA 4Q53A 2CFKA 4O02B 3WMDA 2XRXB 1RKYA 1N9EA 3SOYA 3EQQB 1EUIC 1RTUA 2CWUA 1IDPA 3KCHA 3HZPA 4HM2B 3ZFZA 2CFWA 4BTYA 1K8A4 2P38A 4XBXA 4HM4B 5G1LA 1RNTA 1JV2B 2AADA 1A2PA 4BTWA 4HAAA 4XBYA 3VF1A 1GYBA 2QA43 3V99A 1VQ73 2XSOB 4O2HA 2R41A 1VQ53 1LXEA 1JBTA 4N6TA 5A0OB 2L4VA 3PCRA 2CWTA 4BTXA 1L5GB 2HMJB 4HOHA 3FG3A 1X1XA 5IG4A 2E2UA 5GSPA 3GRDA 3DXOA 1Y4KA 1LOVA 2ZA4A 1EQKA 1FA3A 3NXJA 3OW22 3LZAA 1BU4A 1T2HA 1GY6A 3KZTA 3JVCA 3MG2A 1YJN3 2Z77A 2SARA 1Z1SA 4WFOA 5BVBA 3G713 3ALAA 1S723 2LQVA 1I70A 1RGEA 3EE1A 4IIAA 5AIIA 3DGNA 1DVDA 2QEX3 2W56A 1JB5A 3FKAA 1WMPA 4N3VA 5M19A 1AY7A 1LNHA 2RFRA 4LEHA 1B20A 3NHXA 1PU4A 1Q864 1FZUA 3EBYA 3NV0B 4N6LA 1AQZA 1YNVX 3DGLA 1N8R4 3CD63 3DMCA 2C11A 1V58A 3OXAA 2P0XA 3NQZA 2R4IA 3X3XA 5CF2A 1ROAA 3MSOA 1WNHA 1GOYA 2RBIA 3LXUX 1QVG2 2UUGC 5IG3A 1BUJA 1BRNL 1FUTA 2ML5A 3UNLA 3Q1CA 1VZZA 1MNLA 5M18A 1BRGA 2IMJA 3NM7A 3DZLA 4TX4A 1FGOA 3EHCA 3D9RA 4I5QA 1VQ63 4OVMA 3IMAB 4N6NB 1X1YA 3DH2A 4RZMA 6STDA 1M9GA 1RN1A 1TFKA 1YVSA 3X42A 4WYKB 1TJDA 4AEQA 3PZWA 2D1WA 3H3HA 2HMOB 1SIIA 2P09A 1K41A 3ZG5A 3JUMA 3J7Yd 5ELJA 3CCU3 1W00A 4CCVA 3HK4A 3CPOA 4R4KA 5D81A 3SEDA 2AAEA 1GY5A 4WYKA 1VQ43 5KP1A 1UUWB 3CME3 4LMIA 1BRKA 1US1A 1JB4A 1B2ZA 3EJVA 1GMRA 2KF3A 2ZDJA 3PGBA 3KFQC 3WA3A 2H0GA 2W03A 3FF2A 2KF4A 5D83A 1S5AA 1HZ1A 1ULJB 4NHFA 3GWRA 2IY2A 3JUQA 2FGTA 1LOYA 2ML6A 1JKGB 4MJDA 1CQSA 7STDA 4MMXB 1W6CA 3OWYA 1LQGC 1I2FA 2KF6A 1LQMB 3EN1B 2Q07A 1FGMA 1DE3A 1BSBA 1E3RA 1RRLA 4NPBA 1GOUA 2FXTA 1KWIA 1CYVA 1K734 1RNBA 4GHOA 2GU3A 3PYJA 3AGNA 3JUPA 4N6UA 3CCJ3 1IV7A 1IQ8A 1RN7A 3F9SA 1BSCA 3LMLA 1F8NA 4FCZA 2GBXB 1YVBI 1GS3A 1OHPA 1ZS7A 1RHLA 1W2B2 1TIJA 3F7SA 1W02A 1RCKA 2MC8A 4U13A 5I97A 2C10A 3Q90A 2JDIH 1ROVA 1T2IA 3PCSA 1NJI4 3AHSA 2IUJA 1O7MB 2F99A 1W01A 5G2GA 1OH0A 2K0MA 4HYZA 4ZM8A 1W2ZA 2KF5A 2GXFA 5IEOA 4CDLA 2W0QA 6RNTA 3CCL3 1N5PA 2XR8B 1V74A 5FGOA 4EXRA 3ECFA 2PZVA 2V1LA 1IVXA 3HOHA 4MMYB 2XGLA 4OK0A 1B2UA 5IW9A 2HMKB 3FG1A 1SARA 1UUGB 1MGWA 8CHOA 3X40A 4LSOA 3CMA3 2B24B 4FCMA 1BAOA 3GZXB 1W5ZA 3G6E3 1QAKA 1OCVA 1BNGA 2BU4A 3GSPA 3UL6A 1AV4A 1G02A 2GSPA 1UCIA 4KFDA 1O7WB 3FGYA 3H51A 3WR2A 1EKMA 3DGMA 2OOVC 2YX9A 1TFOA 1I3IA 3GZRA 3NUVA 1VQM3 3QK9A 3PXMA 4J9AA 2BNGA 3DGYA 4WWUC 1BRJA 1TP6A 2XSHB 2INXA 3FLJA 2XEPA 3LH4A 1K9M4 1RN4A 5BIRA 1OGXA 2QGUA 1RGLA 1OGZA 1A2KA 4JF8A 3SXXA 1FW7A 2XH9A 4KFEA 3EB8A 4GL6A 2UX0A 3WOEB 3MKIA 2OWPA 3AMOA 1QMAA 2F4YA 4EBGA 1TRQA 3CCV3 3V98A 1IVVA 2BT3A 1Q42A 3MG1A 2GEXA 1SJWA 4AKYA 5D82A 5CF1A 4HZ9B 2M7OA 2W56B 1B2SA 3B4OA 3WHOA 3U97A 3IPTA 1YGEA 3FH1A 1D6ZA 3BNBA 1BNEA 2CFDA 2CHCA 1Q7HA 3B8LA 3RNTA 1FYSA 1BOXA 3IJEB 5ELUA 2IA7A 1BGSA 2UGIA 4L7KA 3CCE3 4EC6A 4WHAA 4HZBB 4XB5A 1A67A 1E3VA 2WOFA 1MGRA 1IVUA 4N6OB 3LTCA 3KIIA 4BL3A 1EG9B 1GY7A 2Y73A 3BNEA 3EBTA 4EV2A 1ISKA 4R9KA 2OQEA 2BHMA 1T3BA 1RLSA 3D4AA 3KSED 4HVNA 5HOHA 3S67A 3CXC2 2F56A 1KD14 3OWUA 1MWTA 1C54A 4XBTA 2Z76A 1MWRA 4LYLB 2KXGA 4QWTA 4JRFA 2W9QA 2P0MA 1CYUA 1UDII 5AI1A 1N5HA 2GBWB 4RNTA 1GMPA 1B27A 1LVNA
chains in the Genus database with same CATH topology
1GOVA 1LOYA 1FUSA 4GSPA 5BU4A 1I2FA 2KF6A 1R4YA 1I8VA 1ZGXA 1TTOA 1DE3A 1BSBA 1BVIA 1B2XA 1RMSA 3BU4A 1GOUA 2BIRA 1TRPA 1RNBA 4GHOA 1BRHA 1BNSA 1LRAA 1BANA 3AGNA 5RNTA 1X1WA 1BSEA 1BSCA 1CH0A 2RNTA 1RHLA 1RCKA 3D5IA 1T2IA 3AHSA 1I2EA 2F5MA 7RNTA 1IYYA 1BRIA 3KCHA 1BNIA 1RTUA 2KF5A 6RNTA 1RGFA 4BIRA 1BIRA 1RNTA 1BNJA 1RGHA 2AADA 1A2PA 1BRSA 3BIRA 3HOHA 1B2UA 4HAAA 7GSPA 2C4BA 1GSPA 1SARA 8RNTA 1JBTA 1MGWA 2KAAA 1JBRA 1RGCA 1GMQA 1BAOA 4HOHA 1RGKA 1X1XA 1X1UA 5GSPA 1BNRA 1BNGA 2BU4A 1LOVA 2ZA4A 3GSPA 6GSPA 1G02A 1DETA 2GSPA 1UCIA 3WR2A 4J5GA 1BSAA 2F5WA 1BU4A 1T2HA 3AGOA 3Q3FA 2SARA 3URPA 3D5GA 1I3IA 1I70A 1RGEA 1PYLA 1UCKA 1JBSA 3DGYA 1BRJA 4BU4A 1RGAA 1AY7A 3SYUA 1B20A 1RN4A 5BIRA 1FZUA 1RDSA 1FW7A 1AQZA 1YNVX 4J5KA 3AHWA 1I0VA 1I0XA 2F4YA 1TRQA 1YGWA 1GOYA 2RBIA 1I3FA 1BUJA 1BRNL 1FUTA 1RGGA 1RSNA 1B2SA 3WHOA 1BNEA 1BRGA 1I2GA 1BSDA 3RNTA 1FYSA 1Q9EA 1BOXA 1HYFA 1B3SA 1LNIA 1X1YA 3DH2A 1BGSA 1B21A 1RN1A 1YVSA 1B2MA 3A5EA 1MGRA 1BNFA 1RCLA 2HOHA 9RNTA 1UCJA 1RLSA 3D4AA 1LOWA 5HOHA 2AAEA 2F56A 1C54A 1BRKA 1UCLA 1B2ZA 1GMRA 2KF3A 1PY3A 4RNTA 1GMPA 2KF4A 1B27A 1HZ1A 1RGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOV A;  1LOY A;  1FUS A;  4GSP A;  5BU4 A;  1I2F A;  2KF6 A;  1R4Y A;  1I8V A;  1ZGX A;  1TTO A;  1DE3 A;  1BSB A;  1BVI A;  1B2X A;  1RMS A;  3BU4 A;  1GOU A;  2BIR A;  1TRP A;  1RNB A;  4GHO A;  1BRH A;  1BNS A;  1LRA A;  1BAN A;  3AGN A;  5RNT A;  1X1W A;  1BSE A;  1BSC A;  1CH0 A;  2RNT A;  1RHL A;  1RCK A;  3D5I A;  1T2I A;  3AHS A;  1I2E A;  2F5M A;  7RNT A;  1IYY A;  1BRI A;  3KCH A;  1BNI A;  1RTU A;  2KF5 A;  6RNT A;  1RGF A;  4BIR A;  1BIR A;  1RNT A;  1BNJ A;  1RGH A;  2AAD A;  1A2P A;  1BRS A;  3BIR A;  3HOH A;  1B2U A;  4HAA A;  7GSP A;  2C4B A;  1GSP A;  1SAR A;  8RNT A;  1JBT A;  1MGW A;  2KAA A;  1JBR A;  1RGC A;  1GMQ A;  1BAO A;  4HOH A;  1RGK A;  1X1X A;  1X1U A;  5GSP A;  1BNR A;  1BNG A;  2BU4 A;  1LOV A;  2ZA4 A;  3GSP A;  6GSP A;  1G02 A;  1DET A;  2GSP A;  1UCI A;  3WR2 A;  4J5G A;  1BSA A;  2F5W A;  1BU4 A;  1T2H A;  3AGO A;  3Q3F A;  2SAR A;  3URP A;  3D5G A;  1I3I A;  1I70 A;  1RGE A;  1PYL A;  1UCK A;  1JBS A;  3DGY A;  1BRJ A;  4BU4 A;  1RGA A;  1AY7 A;  3SYU A;  1B20 A;  1RN4 A;  5BIR A;  1FZU A;  1RDS A;  1FW7 A;  1AQZ A;  1YNV X;  4J5K A;  3AHW A;  1I0V A;  1I0X A;  2F4Y A;  1TRQ A;  1YGW A;  1GOY A;  2RBI A;  1I3F A;  1BUJ A;  1BRN L;  1FUT A;  1RGG A;  1RSN A;  1B2S A;  3WHO A;  1BNE A;  1BRG A;  1I2G A;  1BSD A;  3RNT A;  1FYS A;  1Q9E A;  1BOX A;  1HYF A;  1B3S A;  1LNI A;  1X1Y A;  3DH2 A;  1BGS A;  1B21 A;  1RN1 A;  1YVS A;  1B2M A;  3A5E A;  1MGR A;  1BNF A;  1RCL A;  2HOH A;  9RNT A;  1UCJ A;  1RLS A;  3D4A A;  1LOW A;  5HOH A;  2AAE A;  2F56 A;  1C54 A;  1BRK A;  1UCL A;  1B2Z A;  1GMR A;  2KF3 A;  1PY3 A;  4RNT A;  1GMP A;  2KF4 A;  1B27 A;  1HZ1 A;  1RGL A; 
#chains in the Genus database with same CATH topology
 3ROB A;  1GOV A;  1FUS A;  1Q40 B;  3FSD A;  1LOX A;  1O7P B;  5CXO A;  1Q7Y 4;  3F8X A;  4GSP A;  3SOA A;  3NBB A;  3LTB A;  2WOH A;  3PS8 A;  4FCJ A;  5HGR A;  2BIR A;  1Q40 A;  1TRP A;  2H0I A;  3S28 A;  1UI8 A;  2H0H A;  2SBL A;  1BNS A;  1C7H A;  3T8U A;  2OTL 3;  2OTJ 3;  1SIH A;  5RNT A;  2E2V A;  4L8P A;  3Q2P A;  3ZG0 A;  2WGO A;  2RNT A;  3DGO A;  5CK6 A;  3MHE A;  3SLU A;  4WP5 A;  1J2B A;  1RRH A;  3FCS B;  1I2E A;  5FW5 A;  3VSY A;  3I56 3;  1R4C A;  1NDO B;  3K7C A;  4HM8 B;  3E99 A;  1BNI A;  1JJ2 2;  1UUV B;  3FG4 A;  1OHS A;  1RGF A;  4BIR A;  4L8O A;  1BIR A;  1BNJ A;  1RGH A;  2LYX A;  3BIR A;  2P05 A;  3B7C A;  2CG0 A;  4EW5 A;  1G96 A;  3T0U A;  4O3V A;  2JQ5 A;  7GSP A;  1DMN A;  5KP4 A;  1A2V A;  2C4B A;  2XGN A;  3HI7 A;  8RNT A;  2KAA A;  3UL5 A;  1TU5 A;  1IU7 A;  1YJ9 3;  1JZO A;  1JN5 A;  1X1U A;  4ILF A;  5AEU B;  1VQO 3;  3OWS A;  1M1X B;  1JNQ A;  2B1X B;  2YFI B;  1WMN A;  3LYG A;  1GD3 A;  3LOY A;  4K1V A;  2W9P A;  3JUO A;  6GSP A;  4J5G A;  1YI2 3;  1BSA A;  2F5W A;  3K0Z A;  3I55 3;  3D5G A;  1YIT 3;  3MYT A;  1OAC A;  2D42 A;  2CFL A;  3KKG A;  4BL2 A;  2KRT A;  4IPB A;  1AR0 A;  1PYL A;  1K28 A;  1UCK A;  1W6Y A;  2CKF B;  2ZL8 A;  5LC7 A;  1OF5 A;  1JBS A;  3NX0 A;  1ULI B;  1AVL A;  2BMR B;  1GD4 A;  3TDG A;  4BU4 A;  3SYU A;  5TGN A;  4HM1 B;  3LT9 A;  2CC3 A;  3NQY A;  2BO9 B;  3BLZ A;  4RNZ A;  1CEW I;  3NBJ A;  3O8Y A;  3KE7 A;  4FR9 A;  1I0X A;  5KP3 A;  1Q82 4;  1YGW A;  3UJM A;  1STD A;  3DY5 A;  5AIF A;  5CLK A;  1RGG A;  3EX9 A;  3M8C A;  5AYR B;  3CCR 3;  1VQP 3;  2CK3 H;  3WDG B;  1I2G A;  1IV9 A;  1KSI A;  2YFJ B;  4FMA A;  4HJL B;  4HM6 B;  3S27 A;  1BSD A;  3GZB A;  1Q9E A;  5JPP A;  1VQK 3;  4MMZ B;  3RGA A;  5AIH A;  4HBR A;  3CNX A;  4O8S A;  4LGQ A;  3AMO B;  4K61 A;  1B2M A;  2J8X B;  3A5E A;  5BXQ A;  1NB3 I;  3L0R A;  1RCL A;  4HM0 B;  4X2O A;  3DM8 A;  9RNT A;  1O7N B;  1IT7 A;  1UCJ A;  2RGQ A;  1LOW A;  2Y74 A;  3S5C A;  3G16 A;  3QRD A;  3D79 A;  1OHO A;  2Z6B A;  1STF I;  3LT8 A;  1VQL 3;  2ZHX B;  1NB5 I;  4HM7 B;  5IEP A;  1YJW 3;  4GB5 A;  3LTD A;  4H3U A;  1IQX A;  1O7H B;  3MWZ A;  2WGQ A;  2CFG A;  3A76 A;  3STD A;  1YHQ 3;  3EF8 A;  2CIU A;  1QVF 2;  1QJG A;  1ZX2 A;  2XFS A;  1DMM A;  3HII A;  1NNV A;  4XDV A;  2O3O A;  1N8Q A;  4N6M A;  1ZGX A;  4R1K A;  3GAX A;  1TTO A;  5STD A;  1BVI A;  1O7G B;  1B2X A;  3GZY B;  1IK3 A;  1UW1 A;  3WA2 X;  3SVA A;  3CC2 3;  3CC7 3;  3X3Z A;  1BRH A;  5M1A A;  1LRA A;  1BAN A;  4J8T A;  1E97 A;  1W7C A;  3WOD G;  3KSP A;  3FZW A;  4I4K A;  3HIG A;  3N9H A;  2XF3 A;  3V92 A;  2L1S A;  1KC8 4;  2CX1 A;  3G0K A;  3I0Y A;  4XM4 A;  3X3Y A;  4FMD A;  3CPW 2;  2CWV A;  2CG1 A;  3D3L A;  7RNT A;  1ZO2 A;  4DKI A;  4AKZ A;  3U1W A;  1IYY A;  3T8N A;  4CJN A;  1BRI A;  3CCS 3;  2BMO B;  1EA2 A;  5IG0 A;  1FGQ A;  1D6U A;  1HKX A;  3DUK A;  1U8C B;  2HMM B;  1Q81 4;  1VQQ A;  1MOL A;  1DYU A;  1BRS A;  1ASK A;  4KZ1 A;  3FF0 A;  4HM5 B;  2Z7A A;  4ORL A;  1FGT A;  1WMO A;  1TUH A;  1IT8 A;  1UGI A;  4MEI A;  2CX0 A;  3HX8 A;  1GSP A;  1JRQ A;  3RGR A;  4K90 B;  4HM3 B;  2FNQ A;  1RGC A;  1OPY A;  1GMQ A;  1JBR A;  3EC9 A;  2F98 A;  3NV0 A;  1IVW A;  1RGK A;  4G1M B;  1UGH I;  3CCQ 3;  1BNR A;  1NU3 A;  4KFF A;  1DET A;  1JB2 A;  4OUQ A;  3Q3F A;  1M1K 4;  1SPU A;  3AGO A;  2HML B;  1VQ8 3;  3CU3 A;  5AYS C;  3URP A;  4KVH A;  2HMN B;  1YIJ 3;  2OOV A;  1V57 A;  4R80 A;  5IEN A;  1DVC A;  1G0T A;  1UI7 A;  2I9W A;  3VGN A;  3G4S 3;  1RGA A;  4EV5 A;  1VQ9 3;  5AEW B;  4NRE A;  4N6V 0;  1KQS 2;  3MG3 A;  1MWS A;  3B4P A;  3KN4 A;  3F40 A;  5IG5 A;  1JN5 B;  1RDS A;  5EQL A;  3OX9 A;  4J5K A;  2RCD A;  4RBN A;  3AHW A;  1I0V A;  3LTA A;  3BND A;  5G1K A;  3F7X A;  2PNC A;  4KT3 B;  1VQN 3;  3MPH A;  3F8H A;  1I3F A;  1N9J A;  5IF6 A;  4HKV B;  5LC6 A;  1RSN A;  2RSX A;  3BB9 A;  1HU9 A;  4IT7 A;  3CC4 3;  1OF5 B;  3ER7 A;  2CW9 A;  3RDE A;  2O9U X;  4STD A;  5EVH A;  1HYF A;  1B3S A;  1LNI A;  1QAL A;  3EN8 A;  1B21 A;  2MF7 A;  4LZI A;  2WO0 A;  4RNY A;  3JUN A;  4EYC A;  1EEJ A;  4H61 A;  2QIY A;  2W6J H;  1JKG A;  2OQE C;  2W2C A;  2W04 A;  3S29 A;  3WOF B;  3N54 B;  5EEO A;  1BNF A;  2HOH A;  2K54 A;  1FUW A;  1SQW A;  5DRV A;  1D6Y A;  1NWW A;  1T5Y A;  2IUK A;  1MWU A;  5JPU A;  1DMQ A;  4FMC A;  1WTH A;  1UCL A;  2E2T A;  1OUN A;  2KCD A;  3UB1 A;  4PEJ A;  2IYJ A;  1PY3 A;  2OCT A;  3K9M C;  5IER A;  3K63 A;  3F14 A;  3K5T A;  5JBS A;  3SX1 A;  1BUQ A;  1RJO A;  3NBR A;  3NM2 A;  5BU4 A;  2K3D A;  2F86 B;  1R4Y A;  1I8V A;  4CPK A;  1AVK A;  4X2H A;  3BU4 A;  1FGR A;  1PFP A;  1RMS A;  2CH9 A;  2XFT A;  1W6G A;  1NO3 A;  2GEY A;  3BNC A;  4K1U A;  3G8Z A;  1M90 4;  2BMQ B;  3OV4 A;  5DRE A;  3N8B A;  1QAF A;  1WQL B;  3CNM A;  1U5O A;  1X1W A;  1BSE A;  2A15 A;  1JZD A;  4R9L A;  1W4N A;  3X41 A;  3CCM 3;  1CH0 A;  5AIG A;  4FMB A;  2STD A;  2YFL B;  3D5I A;  2GU1 A;  1A90 A;  4XDW A;  1IQY A;  2F5M A;  4Q53 A;  2CFK A;  4O02 B;  3WMD A;  2XRX B;  1RKY A;  1N9E A;  3SOY A;  3EQQ B;  1EUI C;  1RTU A;  2CWU A;  1IDP A;  3KCH A;  3HZP A;  4HM2 B;  3ZFZ A;  2CFW A;  4BTY A;  1K8A 4;  2P38 A;  4XBX A;  4HM4 B;  5G1L A;  1RNT A;  1JV2 B;  2AAD A;  1A2P A;  4BTW A;  4HAA A;  4XBY A;  3VF1 A;  1GYB A;  2QA4 3;  3V99 A;  1VQ7 3;  2XSO B;  4O2H A;  2R41 A;  1VQ5 3;  1LXE A;  1JBT A;  4N6T A;  5A0O B;  2L4V A;  3PCR A;  2CWT A;  4BTX A;  1L5G B;  2HMJ B;  4HOH A;  3FG3 A;  1X1X A;  5IG4 A;  2E2U A;  5GSP A;  3GRD A;  3DXO A;  1Y4K A;  1LOV A;  2ZA4 A;  1EQK A;  1FA3 A;  3NXJ A;  3OW2 2;  3LZA A;  1BU4 A;  1T2H A;  1GY6 A;  3KZT A;  3JVC A;  3MG2 A;  1YJN 3;  2Z77 A;  2SAR A;  1Z1S A;  4WFO A;  5BVB A;  3G71 3;  3ALA A;  1S72 3;  2LQV A;  1I70 A;  1RGE A;  3EE1 A;  4IIA A;  5AII A;  3DGN A;  1DVD A;  2QEX 3;  2W56 A;  1JB5 A;  3FKA A;  1WMP A;  4N3V A;  5M19 A;  1AY7 A;  1LNH A;  2RFR A;  4LEH A;  1B20 A;  3NHX A;  1PU4 A;  1Q86 4;  1FZU A;  3EBY A;  3NV0 B;  4N6L A;  1AQZ A;  1YNV X;  3DGL A;  1N8R 4;  3CD6 3;  3DMC A;  2C11 A;  1V58 A;  3OXA A;  2P0X A;  3NQZ A;  2R4I A;  3X3X A;  5CF2 A;  1ROA A;  3MSO A;  1WNH A;  1GOY A;  2RBI A;  3LXU X;  1QVG 2;  2UUG C;  5IG3 A;  1BUJ A;  1BRN L;  1FUT A;  2ML5 A;  3UNL A;  3Q1C A;  1VZZ A;  1MNL A;  5M18 A;  1BRG A;  2IMJ A;  3NM7 A;  3DZL A;  4TX4 A;  1FGO A;  3EHC A;  3D9R A;  4I5Q A;  1VQ6 3;  4OVM A;  3IMA B;  4N6N B;  1X1Y A;  3DH2 A;  4RZM A;  6STD A;  1M9G A;  1RN1 A;  1TFK A;  1YVS A;  3X42 A;  4WYK B;  1TJD A;  4AEQ A;  3PZW A;  2D1W A;  3H3H A;  2HMO B;  1SII A;  2P09 A;  1K41 A;  3ZG5 A;  3JUM A;  3J7Y d;  5ELJ A;  3CCU 3;  1W00 A;  4CCV A;  3HK4 A;  3CPO A;  4R4K A;  5D81 A;  3SED A;  2AAE A;  1GY5 A;  4WYK A;  1VQ4 3;  5KP1 A;  1UUW B;  3CME 3;  4LMI A;  1BRK A;  1US1 A;  1JB4 A;  1B2Z A;  3EJV A;  1GMR A;  2KF3 A;  2ZDJ A;  3PGB A;  3KFQ C;  3WA3 A;  2H0G A;  2W03 A;  3FF2 A;  2KF4 A;  5D83 A;  1S5A A;  1HZ1 A;  1ULJ B;  4NHF A;  3GWR A;  2IY2 A;  3JUQ A;  2FGT A;  1LOY A;  2ML6 A;  1JKG B;  4MJD A;  1CQS A;  7STD A;  4MMX B;  1W6C A;  3OWY A;  1LQG C;  1I2F A;  2KF6 A;  1LQM B;  3EN1 B;  2Q07 A;  1FGM A;  1DE3 A;  1BSB A;  1E3R A;  1RRL A;  4NPB A;  1GOU A;  2FXT A;  1KWI A;  1CYV A;  1K73 4;  1RNB A;  4GHO A;  2GU3 A;  3PYJ A;  3AGN A;  3JUP A;  4N6U A;  3CCJ 3;  1IV7 A;  1IQ8 A;  1RN7 A;  3F9S A;  1BSC A;  3LML A;  1F8N A;  4FCZ A;  2GBX B;  1YVB I;  1GS3 A;  1OHP A;  1ZS7 A;  1RHL A;  1W2B 2;  1TIJ A;  3F7S A;  1W02 A;  1RCK A;  2MC8 A;  4U13 A;  5I97 A;  2C10 A;  3Q90 A;  2JDI H;  1ROV A;  1T2I A;  3PCS A;  1NJI 4;  3AHS A;  2IUJ A;  1O7M B;  2F99 A;  1W01 A;  5G2G A;  1OH0 A;  2K0M A;  4HYZ A;  4ZM8 A;  1W2Z A;  2KF5 A;  2GXF A;  5IEO A;  4CDL A;  2W0Q A;  6RNT A;  3CCL 3;  1N5P A;  2XR8 B;  1V74 A;  5FGO A;  4EXR A;  3ECF A;  2PZV A;  2V1L A;  1IVX A;  3HOH A;  4MMY B;  2XGL A;  4OK0 A;  1B2U A;  5IW9 A;  2HMK B;  3FG1 A;  1SAR A;  1UUG B;  1MGW A;  8CHO A;  3X40 A;  4LSO A;  3CMA 3;  2B24 B;  4FCM A;  1BAO A;  3GZX B;  1W5Z A;  3G6E 3;  1QAK A;  1OCV A;  1BNG A;  2BU4 A;  3GSP A;  3UL6 A;  1AV4 A;  1G02 A;  2GSP A;  1UCI A;  4KFD A;  1O7W B;  3FGY A;  3H51 A;  3WR2 A;  1EKM A;  3DGM A;  2OOV C;  2YX9 A;  1TFO A;  1I3I A;  3GZR A;  3NUV A;  1VQM 3;  3QK9 A;  3PXM A;  4J9A A;  2BNG A;  3DGY A;  4WWU C;  1BRJ A;  1TP6 A;  2XSH B;  2INX A;  3FLJ A;  2XEP A;  3LH4 A;  1K9M 4;  1RN4 A;  5BIR A;  1OGX A;  2QGU A;  1RGL A;  1OGZ A;  1A2K A;  4JF8 A;  3SXX A;  1FW7 A;  2XH9 A;  4KFE A;  3EB8 A;  4GL6 A;  2UX0 A;  3WOE B;  3MKI A;  2OWP A;  3AMO A;  1QMA A;  2F4Y A;  4EBG A;  1TRQ A;  3CCV 3;  3V98 A;  1IVV A;  2BT3 A;  1Q42 A;  3MG1 A;  2GEX A;  1SJW A;  4AKY A;  5D82 A;  5CF1 A;  4HZ9 B;  2M7O A;  2W56 B;  1B2S A;  3B4O A;  3WHO A;  3U97 A;  3IPT A;  1YGE A;  3FH1 A;  1D6Z A;  3BNB A;  1BNE A;  2CFD A;  2CHC A;  1Q7H A;  3B8L A;  3RNT A;  1FYS A;  1BOX A;  3IJE B;  5ELU A;  2IA7 A;  1BGS A;  2UGI A;  4L7K A;  3CCE 3;  4EC6 A;  4WHA A;  4HZB B;  4XB5 A;  1A67 A;  1E3V A;  2WOF A;  1MGR A;  1IVU A;  4N6O B;  3LTC A;  3KII A;  4BL3 A;  1EG9 B;  1GY7 A;  2Y73 A;  3BNE A;  3EBT A;  4EV2 A;  1ISK A;  4R9K A;  2OQE A;  2BHM A;  1T3B A;  1RLS A;  3D4A A;  3KSE D;  4HVN A;  5HOH A;  3S67 A;  3CXC 2;  2F56 A;  1KD1 4;  3OWU A;  1MWT A;  1C54 A;  4XBT A;  2Z76 A;  1MWR A;  4LYL B;  2KXG A;  4QWT A;  4JRF A;  2W9Q A;  2P0M A;  1CYU A;  1UDI I;  5AI1 A;  1N5H A;  2GBW B;  4RNT A;  1GMP A;  1B27 A;  1LVN A; 
#chains in the Genus database with same CATH homology
 1GOV A;  1LOY A;  1FUS A;  4GSP A;  5BU4 A;  1I2F A;  2KF6 A;  1R4Y A;  1I8V A;  1ZGX A;  1TTO A;  1DE3 A;  1BSB A;  1BVI A;  1B2X A;  1RMS A;  3BU4 A;  1GOU A;  2BIR A;  1TRP A;  1RNB A;  4GHO A;  1BRH A;  1BNS A;  1LRA A;  1BAN A;  3AGN A;  5RNT A;  1X1W A;  1BSE A;  1BSC A;  1CH0 A;  2RNT A;  1RHL A;  1RCK A;  3D5I A;  1T2I A;  3AHS A;  1I2E A;  2F5M A;  7RNT A;  1IYY A;  1BRI A;  3KCH A;  1BNI A;  1RTU A;  2KF5 A;  6RNT A;  1RGF A;  4BIR A;  1BIR A;  1RNT A;  1BNJ A;  1RGH A;  2AAD A;  1A2P A;  1BRS A;  3BIR A;  3HOH A;  1B2U A;  4HAA A;  7GSP A;  2C4B A;  1GSP A;  1SAR A;  8RNT A;  1JBT A;  1MGW A;  2KAA A;  1JBR A;  1RGC A;  1GMQ A;  1BAO A;  4HOH A;  1RGK A;  1X1X A;  1X1U A;  5GSP A;  1BNR A;  1BNG A;  2BU4 A;  1LOV A;  2ZA4 A;  3GSP A;  6GSP A;  1G02 A;  1DET A;  2GSP A;  1UCI A;  3WR2 A;  4J5G A;  1BSA A;  2F5W A;  1BU4 A;  1T2H A;  3AGO A;  3Q3F A;  2SAR A;  3URP A;  3D5G A;  1I3I A;  1I70 A;  1RGE A;  1PYL A;  1UCK A;  1JBS A;  3DGY A;  1BRJ A;  4BU4 A;  1RGA A;  1AY7 A;  3SYU A;  1B20 A;  1RN4 A;  5BIR A;  1FZU A;  1RDS A;  1FW7 A;  1AQZ A;  1YNV X;  4J5K A;  3AHW A;  1I0V A;  1I0X A;  2F4Y A;  1TRQ A;  1YGW A;  1GOY A;  2RBI A;  1I3F A;  1BUJ A;  1BRN L;  1FUT A;  1RGG A;  1RSN A;  1B2S A;  3WHO A;  1BNE A;  1BRG A;  1I2G A;  1BSD A;  3RNT A;  1FYS A;  1Q9E A;  1BOX A;  1HYF A;  1B3S A;  1LNI A;  1X1Y A;  3DH2 A;  1BGS A;  1B21 A;  1RN1 A;  1YVS A;  1B2M A;  3A5E A;  1MGR A;  1BNF A;  1RCL A;  2HOH A;  9RNT A;  1UCJ A;  1RLS A;  3D4A A;  1LOW A;  5HOH A;  2AAE A;  2F56 A;  1C54 A;  1BRK A;  1UCL A;  1B2Z A;  1GMR A;  2KF3 A;  1PY3 A;  4RNT A;  1GMP A;  2KF4 A;  1B27 A;  1HZ1 A;  1RGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...