1DETA

Ribonuclease t1 carboxymethylated at glu 58 in complex with 2'gmp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
103
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of ribonuclease T1 carboxymethylated at Glu58 in complex with 2'-GMP.
pubmed doi rcsb
total genus 23
structure length 103
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1detA00
3D5GA 2KF6A 4HOHA 2AADA 1BRNL 1B2SA 3BU4A 1BIRA 1LOYA 1T2HA 1BRGA 1B2MA 1BNIA 1RGFA 1MGWA 1I0XA 1G02A 1B3SA 1I70A 1GMRA 1GMPA 2F5WA 2HOHA 1RGEA 1JBTA 8RNTA 1BSAA 1BNSA 3AGNA 1RMSA 1I8VA 1FUTA 1I0VA 2KF4A 1BANA 1X1UA 2C4BA 3D4AA 1BU4A 1RN4A 5RNTA 1JBRA 1BNFA 2KF5A 3DGYA 6RNTA 1BAOA 4GHOA 1FZUA 1RGLA 1X1XA 1MGRA 1X1YA 1BNEA 1B20A 1RHLA 3HOHA 1YVSA 1LOWA 1BRJA 1B2UA 1I3IA 1PY3A 3A5EA 4HAAA 7RNTA 1B2XA 1BRKA 1BRSA 1I2EA 1RGKA 1RGCA 3AGOA 2AAEA 1YGWA 4RNTA 1BSDA 1LNIA 1UCKA 1RGAA 2F4YA 2KAAA 1RNBA 1AQZA 1BRHA 3WHOA 3GSPA 4BIRA 2BIRA 1GOUA 2RNTA 1BSEA 9RNTA 1BUJA 1RGHA 1GMQA 2F56A 1RN1A 4GSPA 6GSPA 5HOHA 3BIRA 3DH2A 2F5MA 1TRPA 1DETA 1YNVX 4J5GA 3Q3FA 1GOVA 1X1WA 1AY7A 1BRIA 1CH0A 3WR2A 3RNTA 1BNRA 1I3FA 2BU4A 5GSPA 1RTUA 1RCLA 2KF3A 4BU4A 1BSBA 3AHSA 1SARA 1Q9EA 2RBIA 1ZGXA 3AHWA 1BOXA 3D5IA 5BIRA 1TRQA 1RCKA 1TTOA 1UCLA 1LOVA 1RLSA 7GSPA 1C54A 1DE3A 1BSCA 2GSPA 1RGGA 1JBSA 1HYFA 1BNGA 1B27A 1FYSA 1RDSA 1UCJA 1FW7A 2SARA 1GSPA 1I2GA 1GOYA 1I2FA 3URPA 5BU4A 1B21A 1BVIA 1BNJA 4J5KA 1IYYA 1HZ1A 1LRAA 2ZA4A 1T2IA 1A2PA 1RSNA 1UCIA 1FUSA 3KCHA 1B2ZA 1RNTA 1R4YA 3SYUA 1BGSA 1PYLA
chains in the Genus database with same CATH superfamily
3HX8A 4WP5A 4EXRA 1W00A 3LT9A 4KFDA 3FZWA 1ZS7A 1BRNL 1YJ93 4IPBA 1SPUA 3EN1B 1JRQA 3AMOB 3X42A 3STDA 1OH0A 3OWSA 5D82A 3MG2A 1RGFA 3F7SA 4FCZA 3X3XA 1M9GA 1A67A 2MF7A 2FXTA 4LMIA 3NBBA 1GMPA 3EN8A 3SVAA 1RGEA 3OWUA 4FR9A 4R9LA 8RNTA 4EYCA 2ML6A 5TGNA 3U97A 1JB5A 4K61A 2HMLB 4MMYB 3WDGB 1X1UA 3K0ZA 3O8YA 2CC3A 5RNTA 3MSOA 3AMOA 2Y74A 4KT3B 3LYGA 1VQM3 1EA2A 1O7PB 6STDA 3I0YA 4X2HA 3HIGA 4GHOA 2K3DA 4HJLB 2WGOA 1JN5B 2GU3A 1A2VA 1X1YA 3PXMA 2XSOB 5D83A 1JZDA 3UB1A 5M19A 3G0KA 1RHLA 2JDIH 1VQK3 3F8XA 3LOYA 5IW9A 4WWUC 1V57A 2FNQA 3GRDA 3KSED 2Z7AA 5IEOA 3G713 2H0IA 1N9EA 1T5YA 2P38A 3D79A 4HM0B 5FGOA 3V98A 1YVBI 1PU4A 1RGCA 4O8SA 5IERA 2KCDA 3PYJA 1DYUA 5CF1A 3SOYA 1K734 1MNLA 2F4YA 4RNYA 3PCSA 3NV0A 3U1WA 1BRHA 3K5TA 4HM4B 3WHOA 2UX0A 4TX4A 5HGRA 1AVKA 2RNTA 3CPOA 4MJDA 3X40A 2PNCA 1VQ73 1W7CA 2OWPA 3KFQC 4N6OB 1SIHA 3CNMA 2XGLA 2H0GA 1RKYA 4HZBB 4R4KA 1RN7A 4RZMA 1HKXA 3CNXA 4K1VA 3JUOA 1FA3A 3CCV3 3Q3FA 4N6V0 3I553 3KN4A 2CFWA 3GZBA 1VQ63 3DZLA 1N8QA 1BRIA 4XBYA 1ROVA 4N3VA 2ZDJA 3N8BA 1WMOA 4FMCA 4IIAA 3F8HA 2CKFB 4DKIA 2W9PA 2P0MA 1RTUA 1S723 4ILFA 2RCDA 2W0QA 3NHXA 1WTHA 1RCLA 3WOFB 1OHPA 1VZZA 1IV9A 2FGTA 3RGAA 2WGQA 4K1UA 4GL6A 2GEXA 3AHSA 5HOHA 1Q9EA 1CYVA 5BIRA 3N9HA 3SX1A 1QVF2 1RCKA 4HYZA 3BB9A 2BO9B 1LOVA 7GSPA 1C54A 1TP6A 3GZRA 1DVDA 2LQVA 3EB8A 1QJGA 3GWRA 4GB5A 3GZXB 3KE7A 4K90B 2J8XB 3JVCA 1HYFA 3VSYA 1JBSA 1BNGA 2Z76A 1UCJA 2H0HA 3MKIA 2GBXB 1FGOA 1GOYA 1I2FA 1JJ22 3CMA3 3X3YA 1W6CA 1IYYA 3CCE3 2R41A 2CW9A 3HIIA 4L8PA 1VQ53 2K54A 3FF2A 4WYKA 2C10A 3EHCA 2BNGA 1W2ZA 3Q1CA 5JPPA 3B4OA 3D5GA 4HOHA 1NU3A 3QK9A 1IVUA 3KKGA 3BU4A 2Z77A 1W02A 1Q40B 2E2VA 3RGRA 1T2HA 1B2MA 1W4NA 1BNIA 1MGWA 1NDOB 1EQKA 2W56A 4JF8A 3ZG5A 4N6NB 1I70A 3CU3A 5AIIA 1GMRA 2GBWB 3X41A 1K8A4 1JBTA 1YJW3 3GAXA 1BSAA 1BNSA 3AGNA 3ZFZA 1FUTA 1I0VA 1OACA 1V58A 3BNDA 2W6JH 4HM8B 2RSXA 4X2OA 3X3ZA 2CG1A 5KP4A 3D4AA 2XEPA 1Q40A 1KQS2 2KF5A 2XFSA 5CXOA 1IVXA 3S29A 1MWUA 4XDWA 2R4IA 1TUHA 1RGLA 3UNLA 5IG4A 1UDII 2IYJA 5JBSA 1ASKA 1OCVA 1QAKA 1BNEA 1OF5B 3OWYA 1GD3A 3ALAA 1FUWA 5IG0A 2CWUA 1LOWA 1VQ83 1JB4A 3E99A 1GS3A 1O7WB 3FG4A 3JUPA 3T0UA 1I3IA 4CJNA 1N8R4 2XFTA 2RFRA 1ULJB 2IUKA 1Y4KA 1JNQA 2F99A 3DGLA 3A5EA 4HAAA 1W01A 3FG1A 2CH9A 3B8LA 2ZL8A 3ECFA 3G8ZA 4BTYA 4OVMA 1OPYA 3CME3 2B1XB 1ZX2A 2GU1A 2O9UX 1LNIA 3VGNA 3LT8A 1IVVA 2IMJA 3UJMA 3NXJA 3FCSB 3WA2X 3MYTA 1GD4A 4BTWA 1U5OA 5STDA 2STDA 4CDLA 3LZAA 1ROAA 1RGHA 1VQQA 2F56A 5AEWB 1O7GB 2W9QA 4XM4A 5G2GA 2F98A 3BIRA 2BMQB 2F5MA 3DH2A 8CHOA 1LNHA 3F9SA 1S5AA 1DETA 2E2UA 4FCMA 4J5GA 4CPKA 1N5HA 4MMXB 5IENA 3FGYA 1GOVA 1X1WA 1E3RA 1TJDA 1CH0A 1DMQA 1OGXA 2D1WA 5AIFA 1K9M4 2QA43 3RNTA 1OUNA 1GY6A 4J9AA 3WOEB 1QVG2 3V99A 3SEDA 1JN5A 4EBGA 4AKYA 4NHFA 4PEJA 1VQO3 2CFLA 1VQ43 2KF3A 3K63A 1DMNA 2CWVA 4FCJA 3T8UA 1Q814 1D6ZA 3AHWA 1ZGXA 3DUKA 1BOXA 1NO3A 4ZM8A 3HI7A 3OXAA 3BLZA 1UCLA 1DMMA 1NWWA 2HMJB 4XBXA 1IDPA 1CYUA 1BSCA 1A90A 1K41A 1STFI 5AYRB 4NPBA 1UUWB 4HZ9B 1FYSA 1RDSA 1Q7Y4 3F7XA 3NQZA 1GSPA 1MOLA 3K9MC 1I2GA 1V74A 5CF2A 2CG0A 1SIIA 3JUQA 3URPA 1B21A 5IEPA 2CIUA 3EX9A 4KVHA 1JV2B 7STDA 1HZ1A 1G96A 3EBYA 3CCS3 1T2IA 1UCIA 3SXXA 3VF1A 4H61A 1FUSA 3D3LA 3KCHA 1B2ZA 1RNTA 1EKMA 2GXFA 3SYUA 1IT7A 1VQ93 3MG1A 4OUQA 1IVWA 1W5ZA 1D6UA 2INXA 5AEUB 5G1LA 1LQGC 5EQLA 5FW5A 1LOYA 2XGNA 1Q824 3S27A 1D6YA 1B3SA 4R80A 3GZYB 3WA3A 1MWSA 2W2CA 3IJEB 3I563 2F5WA 2HOHA 1AVLA 2RGQA 1F8NA 1JKGB 1JB2A 2KRTA 2BMOB 2SBLA 4FMDA 3L0RA 1L5GB 1I8VA 4NREA 1BANA 5EVHA 2W03A 1LVNA 4G1MB 4LEHA 5BXQA 1E97A 1GY7A 4RBNA 1DVCA 4KFFA 1BAOA 3S28A 6RNTA 1AR0A 2XR8B 5AI1A 1X1XA 4HM7B 1TFOA 2YFJB 4RNZA 4MEIA 1NB3I 1O7HB 3LTAA 1JKGA 1B20A 3KIIA 1YVSA 2CX0A 1WMNA 2XH9A 1BRJA 2UGIA 2ZHXB 5IG5A 1B2UA 3OW22 3D9RA 1YJN3 1ISKA 1PY3A 1Q42A 2YFIB 1FGQA 3F40A 3LTDA 3QRDA 4OK0A 1YI23 2XRXB 2W04A 7RNTA 5IG3A 3FSDA 1BRKA 1BRSA 1I2EA 1RGKA 2L1SA 3AGOA 4H3UA 2AAEA 2KXGA 5D81A 2CFKA 2Z6BA 3H3HA 4RNTA 1UGHI 1UGIA 5I97A 1C7HA 3G6E3 1UCKA 1RGAA 2CFDA 1RNBA 4N6UA 5AIHA 1J2BA 3MPHA 3IMAB 1QMAA 2BIRA 1GOUA 2CHCA 3UL5A 3OX9A 4N6LA 4BL3A 3JUNA 9RNTA 6GSPA 1GMQA 4R1KA 3KSPA 1BUQA 2IY2A 3PZWA 4LZIA 5M18A 1SJWA 2OTL3 1QALA 3DXOA 2A15A 5AYSC 1M1K4 1AV4A 3G4S3 3NBJA 1OGZA 1WQLB 4L8OA 1AY7A 1O7MB 3LMLA 4O2HA 4EV2A 3DMCA 3LXUX 2L4VA 4L7KA 3CCL3 4BTXA 4J8TA 4U13A 3F14A 1IV7A 4WHAA 2K0MA 2IUJA 2CFGA 1NB5I 3WMDA 2B24B 3EC9A 5EEOA 2V1LA 1OF5A 1WNHA 4BU4A 2BMRB 1VQP3 3B4PA 4XBTA 5JPUA 4HM6B 3OV4A 1SARA 2HMMB 2RBIA 3LTBA 4XDVA 2OTJ3 1TRQA 4STDA 1RRLA 3DM8A 1RLSA 1TIJA 3CCR3 1RGGA 4O3VA 1WMPA 3A76A 1KC84 1OHSA 1OHOA 3PCRA 4FMBA 3CC23 1UI7A 5ELJA 2MC8A 1M1XB 1W6GA 3S5CA 3CCU3 2JQ5A 2SARA 3CCJ3 1G0TA 2WOFA 1CQSA 1ZO2A 4HM5B 1VQN3 3PS8A 1NJI4 4R9KA 1BNJA 3FLJA 1MWRA 4HM1B 1KWIA 2CWTA 1RSNA 3NX0A 3CCM3 4MMZB 2OOVC 4EV5A 1FGTA 2M7OA 2OOVA 3DGMA 3CPW2 1BGSA 1PYLA 2C4BA 1IQXA 4CCVA 2KF6A 2Y73A 4I4KA 2AADA 1B2SA 2P09A 5M1AA 3NBRA 3NV0B 3EE1A 5AIGA 3NUVA 4XB5A 1YIT3 2UUGC 3KZTA 1BIRA 3CXC2 1BRGA 4AKZA 1MWTA 4ORLA 3M8CA 2QEX3 2Q07A 3TDGA 1I0XA 1G02A 2XSHB 1NNVA 2BT3A 3BNBA 2CK3H 1A2KA 3FKAA 3ZG0A 4EC6A 4BL2A 3IPTA 3BNEA 1GYBA 3K7CA 1W2B2 1ULIB 3NM2A 1RMSA 1KSIA 2KF4A 1FGMA 1RRHA 2I9WA 1BU4A 1RN4A 4Q53A 5KP1A 1JBRA 2C11A 1BNFA 2HMKB 3DGYA 1IQYA 5G1KA 1EG9B 4O02B 1JZOA 1FZUA 1IQ8A 3EQQB 3NM7A 4QWTA 1MGRA 5LC6A 3T8NA 4EW5A 1U8CB 3LH4A 4JRFA 3HZPA 3HOHA 2PZVA 3FF0A 4I5QA 3MHEA 1Z1SA 3B7CA 5CLKA 3DGOA 1STDA 1UUGB 3EJVA 1EUIC 2YFLB 4N6TA 3SLUA 4WFOA 1VQL3 1PFPA 1UW1A 5DREA 2P05A 1Q864 1B2XA 5LC7A 1SQWA 4HKVB 3RDEA 1IK3A 2O3OA 1M904 3FG3A 5BVBA 1YGWA 1BSDA 3LTCA 5CK6A 3WODG 2IA7A 2KAAA 3BNCA 3ER7A 1AQZA 1YGEA 5IF6A 4BIRA 2OQEC 2OQEA 1Q7HA 1BSEA 2YX9A 1BUJA 1IU7A 3DY5A 4GSPA 1RN1A 4AEQA 3CD63 1IT8A 1QAFA 4KFEA 3CC43 1TRPA 4WYKB 3N54B 4HM2B 1YIJ3 1E3VA 1T3BA 3H51A 1UUVB 1YNVX 3HK4A 3JUMA 3J7Yd 3CC73 2XF3A 2F86B 3SOAA 2CX1A 4HM3B 1LXEA 5A0OB 4IT7A 1HU9A 1RJOA 5KP3A 3WR2A 5ELUA 3CCQ3 1BNRA 1I3FA 2W56B 3UL6A 1EEJA 2BU4A 5GSPA 2QGUA 1O7NB 2OCTA 3DGNA 4HVNA 1US1A 3MG3A 3S67A 2WO0A 5DRVA 2WOHA 1BSBA 3PGBA 1TU5A 3D5IA 3ROBA 1TFKA 4LGQA 1TTOA 3EF8A 1DE3A 4LYLB 2E2TA 2GSPA 3FH1A 2ML5A 2QIYA 1N5PA 1B27A 1FW7A 2HMNB 1LQMB 4LSOA 1YHQ3 1GY5A 2LYXA 3EBTA 5BU4A 1BVIA 1N9JA 1W6YA 3Q2PA 1K28A 4J5KA 4KZ1A 3V92A 1UI8A 1R4CA 4N6MA 1LRAA 2D42A 2GEYA 2P0XA 2ZA4A 4HBRA 1A2PA 1CEWI 3NQYA 3Q90A 1KD14 1LOXA 4FMAA 2HMOB 3G16A 1FGRA 2BHMA 1R4YA 3MWZA 3GSPA
chains in the Genus database with same CATH topology
3D5GA 2KF6A 4HOHA 2AADA 1BRNL 1B2SA 3BU4A 1BIRA 1LOYA 1T2HA 1BRGA 1B2MA 1BNIA 1RGFA 1MGWA 1I0XA 1G02A 1B3SA 1I70A 1GMRA 1GMPA 2F5WA 2HOHA 1RGEA 1JBTA 8RNTA 1BSAA 1BNSA 3AGNA 1RMSA 1I8VA 1FUTA 1I0VA 2KF4A 1BANA 1X1UA 2C4BA 3D4AA 1BU4A 1RN4A 5RNTA 1JBRA 1BNFA 2KF5A 3DGYA 6RNTA 1BAOA 4GHOA 1FZUA 1RGLA 1X1XA 1MGRA 1X1YA 1BNEA 1B20A 1RHLA 3HOHA 1YVSA 1LOWA 1BRJA 1B2UA 1I3IA 1PY3A 3A5EA 4HAAA 7RNTA 1B2XA 1BRKA 1BRSA 1I2EA 1RGKA 1RGCA 3AGOA 2AAEA 1YGWA 4RNTA 1BSDA 1LNIA 1UCKA 1RGAA 2F4YA 2KAAA 1RNBA 1AQZA 1BRHA 3WHOA 3GSPA 4BIRA 2BIRA 1GOUA 2RNTA 1BSEA 9RNTA 1BUJA 1RGHA 1GMQA 2F56A 1RN1A 4GSPA 6GSPA 5HOHA 3BIRA 3DH2A 2F5MA 1TRPA 1DETA 1YNVX 4J5GA 3Q3FA 1GOVA 1X1WA 1AY7A 1BRIA 1CH0A 3WR2A 3RNTA 1BNRA 1I3FA 2BU4A 5GSPA 1RTUA 1RCLA 2KF3A 4BU4A 1BSBA 3AHSA 1SARA 1Q9EA 2RBIA 1ZGXA 3AHWA 1BOXA 3D5IA 5BIRA 1TRQA 1RCKA 1TTOA 1UCLA 1LOVA 1RLSA 7GSPA 1C54A 1DE3A 1BSCA 2GSPA 1RGGA 1JBSA 1HYFA 1BNGA 1B27A 1FYSA 1RDSA 1UCJA 1FW7A 2SARA 1GSPA 1I2GA 1GOYA 1I2FA 3URPA 5BU4A 1B21A 1BVIA 1BNJA 4J5KA 1IYYA 1HZ1A 1LRAA 2ZA4A 1T2IA 1A2PA 1RSNA 1UCIA 1FUSA 3KCHA 1B2ZA 1RNTA 1R4YA 3SYUA 1BGSA 1PYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5G A;  2KF6 A;  4HOH A;  2AAD A;  1BRN L;  1B2S A;  3BU4 A;  1BIR A;  1LOY A;  1T2H A;  1BRG A;  1B2M A;  1BNI A;  1RGF A;  1MGW A;  1I0X A;  1G02 A;  1B3S A;  1I70 A;  1GMR A;  1GMP A;  2F5W A;  2HOH A;  1RGE A;  1JBT A;  8RNT A;  1BSA A;  1BNS A;  3AGN A;  1RMS A;  1I8V A;  1FUT A;  1I0V A;  2KF4 A;  1BAN A;  1X1U A;  2C4B A;  3D4A A;  1BU4 A;  1RN4 A;  5RNT A;  1JBR A;  1BNF A;  2KF5 A;  3DGY A;  6RNT A;  1BAO A;  4GHO A;  1FZU A;  1RGL A;  1X1X A;  1MGR A;  1X1Y A;  1BNE A;  1B20 A;  1RHL A;  3HOH A;  1YVS A;  1LOW A;  1BRJ A;  1B2U A;  1I3I A;  1PY3 A;  3A5E A;  4HAA A;  7RNT A;  1B2X A;  1BRK A;  1BRS A;  1I2E A;  1RGK A;  1RGC A;  3AGO A;  2AAE A;  1YGW A;  4RNT A;  1BSD A;  1LNI A;  1UCK A;  1RGA A;  2F4Y A;  2KAA A;  1RNB A;  1AQZ A;  1BRH A;  3WHO A;  3GSP A;  4BIR A;  2BIR A;  1GOU A;  2RNT A;  1BSE A;  9RNT A;  1BUJ A;  1RGH A;  1GMQ A;  2F56 A;  1RN1 A;  4GSP A;  6GSP A;  5HOH A;  3BIR A;  3DH2 A;  2F5M A;  1TRP A;  1DET A;  1YNV X;  4J5G A;  3Q3F A;  1GOV A;  1X1W A;  1AY7 A;  1BRI A;  1CH0 A;  3WR2 A;  3RNT A;  1BNR A;  1I3F A;  2BU4 A;  5GSP A;  1RTU A;  1RCL A;  2KF3 A;  4BU4 A;  1BSB A;  3AHS A;  1SAR A;  1Q9E A;  2RBI A;  1ZGX A;  3AHW A;  1BOX A;  3D5I A;  5BIR A;  1TRQ A;  1RCK A;  1TTO A;  1UCL A;  1LOV A;  1RLS A;  7GSP A;  1C54 A;  1DE3 A;  1BSC A;  2GSP A;  1RGG A;  1JBS A;  1HYF A;  1BNG A;  1B27 A;  1FYS A;  1RDS A;  1UCJ A;  1FW7 A;  2SAR A;  1GSP A;  1I2G A;  1GOY A;  1I2F A;  3URP A;  5BU4 A;  1B21 A;  1BVI A;  1BNJ A;  4J5K A;  1IYY A;  1HZ1 A;  1LRA A;  2ZA4 A;  1T2I A;  1A2P A;  1RSN A;  1UCI A;  1FUS A;  3KCH A;  1B2Z A;  1RNT A;  1R4Y A;  3SYU A;  1BGS A;  1PYL A; 
#chains in the Genus database with same CATH topology
 3HX8 A;  4WP5 A;  4EXR A;  1W00 A;  3LT9 A;  4KFD A;  3FZW A;  1ZS7 A;  1BRN L;  1YJ9 3;  4IPB A;  1SPU A;  3EN1 B;  1JRQ A;  3AMO B;  3X42 A;  3STD A;  1OH0 A;  3OWS A;  5D82 A;  3MG2 A;  1RGF A;  3F7S A;  4FCZ A;  3X3X A;  1M9G A;  1A67 A;  2MF7 A;  2FXT A;  4LMI A;  3NBB A;  1GMP A;  3EN8 A;  3SVA A;  1RGE A;  3OWU A;  4FR9 A;  4R9L A;  8RNT A;  4EYC A;  2ML6 A;  5TGN A;  3U97 A;  1JB5 A;  4K61 A;  2HML B;  4MMY B;  3WDG B;  1X1U A;  3K0Z A;  3O8Y A;  2CC3 A;  5RNT A;  3MSO A;  3AMO A;  2Y74 A;  4KT3 B;  3LYG A;  1VQM 3;  1EA2 A;  1O7P B;  6STD A;  3I0Y A;  4X2H A;  3HIG A;  4GHO A;  2K3D A;  4HJL B;  2WGO A;  1JN5 B;  2GU3 A;  1A2V A;  1X1Y A;  3PXM A;  2XSO B;  5D83 A;  1JZD A;  3UB1 A;  5M19 A;  3G0K A;  1RHL A;  2JDI H;  1VQK 3;  3F8X A;  3LOY A;  5IW9 A;  4WWU C;  1V57 A;  2FNQ A;  3GRD A;  3KSE D;  2Z7A A;  5IEO A;  3G71 3;  2H0I A;  1N9E A;  1T5Y A;  2P38 A;  3D79 A;  4HM0 B;  5FGO A;  3V98 A;  1YVB I;  1PU4 A;  1RGC A;  4O8S A;  5IER A;  2KCD A;  3PYJ A;  1DYU A;  5CF1 A;  3SOY A;  1K73 4;  1MNL A;  2F4Y A;  4RNY A;  3PCS A;  3NV0 A;  3U1W A;  1BRH A;  3K5T A;  4HM4 B;  3WHO A;  2UX0 A;  4TX4 A;  5HGR A;  1AVK A;  2RNT A;  3CPO A;  4MJD A;  3X40 A;  2PNC A;  1VQ7 3;  1W7C A;  2OWP A;  3KFQ C;  4N6O B;  1SIH A;  3CNM A;  2XGL A;  2H0G A;  1RKY A;  4HZB B;  4R4K A;  1RN7 A;  4RZM A;  1HKX A;  3CNX A;  4K1V A;  3JUO A;  1FA3 A;  3CCV 3;  3Q3F A;  4N6V 0;  3I55 3;  3KN4 A;  2CFW A;  3GZB A;  1VQ6 3;  3DZL A;  1N8Q A;  1BRI A;  4XBY A;  1ROV A;  4N3V A;  2ZDJ A;  3N8B A;  1WMO A;  4FMC A;  4IIA A;  3F8H A;  2CKF B;  4DKI A;  2W9P A;  2P0M A;  1RTU A;  1S72 3;  4ILF A;  2RCD A;  2W0Q A;  3NHX A;  1WTH A;  1RCL A;  3WOF B;  1OHP A;  1VZZ A;  1IV9 A;  2FGT A;  3RGA A;  2WGQ A;  4K1U A;  4GL6 A;  2GEX A;  3AHS A;  5HOH A;  1Q9E A;  1CYV A;  5BIR A;  3N9H A;  3SX1 A;  1QVF 2;  1RCK A;  4HYZ A;  3BB9 A;  2BO9 B;  1LOV A;  7GSP A;  1C54 A;  1TP6 A;  3GZR A;  1DVD A;  2LQV A;  3EB8 A;  1QJG A;  3GWR A;  4GB5 A;  3GZX B;  3KE7 A;  4K90 B;  2J8X B;  3JVC A;  1HYF A;  3VSY A;  1JBS A;  1BNG A;  2Z76 A;  1UCJ A;  2H0H A;  3MKI A;  2GBX B;  1FGO A;  1GOY A;  1I2F A;  1JJ2 2;  3CMA 3;  3X3Y A;  1W6C A;  1IYY A;  3CCE 3;  2R41 A;  2CW9 A;  3HII A;  4L8P A;  1VQ5 3;  2K54 A;  3FF2 A;  4WYK A;  2C10 A;  3EHC A;  2BNG A;  1W2Z A;  3Q1C A;  5JPP A;  3B4O A;  3D5G A;  4HOH A;  1NU3 A;  3QK9 A;  1IVU A;  3KKG A;  3BU4 A;  2Z77 A;  1W02 A;  1Q40 B;  2E2V A;  3RGR A;  1T2H A;  1B2M A;  1W4N A;  1BNI A;  1MGW A;  1NDO B;  1EQK A;  2W56 A;  4JF8 A;  3ZG5 A;  4N6N B;  1I70 A;  3CU3 A;  5AII A;  1GMR A;  2GBW B;  3X41 A;  1K8A 4;  1JBT A;  1YJW 3;  3GAX A;  1BSA A;  1BNS A;  3AGN A;  3ZFZ A;  1FUT A;  1I0V A;  1OAC A;  1V58 A;  3BND A;  2W6J H;  4HM8 B;  2RSX A;  4X2O A;  3X3Z A;  2CG1 A;  5KP4 A;  3D4A A;  2XEP A;  1Q40 A;  1KQS 2;  2KF5 A;  2XFS A;  5CXO A;  1IVX A;  3S29 A;  1MWU A;  4XDW A;  2R4I A;  1TUH A;  1RGL A;  3UNL A;  5IG4 A;  1UDI I;  2IYJ A;  5JBS A;  1ASK A;  1OCV A;  1QAK A;  1BNE A;  1OF5 B;  3OWY A;  1GD3 A;  3ALA A;  1FUW A;  5IG0 A;  2CWU A;  1LOW A;  1VQ8 3;  1JB4 A;  3E99 A;  1GS3 A;  1O7W B;  3FG4 A;  3JUP A;  3T0U A;  1I3I A;  4CJN A;  1N8R 4;  2XFT A;  2RFR A;  1ULJ B;  2IUK A;  1Y4K A;  1JNQ A;  2F99 A;  3DGL A;  3A5E A;  4HAA A;  1W01 A;  3FG1 A;  2CH9 A;  3B8L A;  2ZL8 A;  3ECF A;  3G8Z A;  4BTY A;  4OVM A;  1OPY A;  3CME 3;  2B1X B;  1ZX2 A;  2GU1 A;  2O9U X;  1LNI A;  3VGN A;  3LT8 A;  1IVV A;  2IMJ A;  3UJM A;  3NXJ A;  3FCS B;  3WA2 X;  3MYT A;  1GD4 A;  4BTW A;  1U5O A;  5STD A;  2STD A;  4CDL A;  3LZA A;  1ROA A;  1RGH A;  1VQQ A;  2F56 A;  5AEW B;  1O7G B;  2W9Q A;  4XM4 A;  5G2G A;  2F98 A;  3BIR A;  2BMQ B;  2F5M A;  3DH2 A;  8CHO A;  1LNH A;  3F9S A;  1S5A A;  1DET A;  2E2U A;  4FCM A;  4J5G A;  4CPK A;  1N5H A;  4MMX B;  5IEN A;  3FGY A;  1GOV A;  1X1W A;  1E3R A;  1TJD A;  1CH0 A;  1DMQ A;  1OGX A;  2D1W A;  5AIF A;  1K9M 4;  2QA4 3;  3RNT A;  1OUN A;  1GY6 A;  4J9A A;  3WOE B;  1QVG 2;  3V99 A;  3SED A;  1JN5 A;  4EBG A;  4AKY A;  4NHF A;  4PEJ A;  1VQO 3;  2CFL A;  1VQ4 3;  2KF3 A;  3K63 A;  1DMN A;  2CWV A;  4FCJ A;  3T8U A;  1Q81 4;  1D6Z A;  3AHW A;  1ZGX A;  3DUK A;  1BOX A;  1NO3 A;  4ZM8 A;  3HI7 A;  3OXA A;  3BLZ A;  1UCL A;  1DMM A;  1NWW A;  2HMJ B;  4XBX A;  1IDP A;  1CYU A;  1BSC A;  1A90 A;  1K41 A;  1STF I;  5AYR B;  4NPB A;  1UUW B;  4HZ9 B;  1FYS A;  1RDS A;  1Q7Y 4;  3F7X A;  3NQZ A;  1GSP A;  1MOL A;  3K9M C;  1I2G A;  1V74 A;  5CF2 A;  2CG0 A;  1SII A;  3JUQ A;  3URP A;  1B21 A;  5IEP A;  2CIU A;  3EX9 A;  4KVH A;  1JV2 B;  7STD A;  1HZ1 A;  1G96 A;  3EBY A;  3CCS 3;  1T2I A;  1UCI A;  3SXX A;  3VF1 A;  4H61 A;  1FUS A;  3D3L A;  3KCH A;  1B2Z A;  1RNT A;  1EKM A;  2GXF A;  3SYU A;  1IT7 A;  1VQ9 3;  3MG1 A;  4OUQ A;  1IVW A;  1W5Z A;  1D6U A;  2INX A;  5AEU B;  5G1L A;  1LQG C;  5EQL A;  5FW5 A;  1LOY A;  2XGN A;  1Q82 4;  3S27 A;  1D6Y A;  1B3S A;  4R80 A;  3GZY B;  3WA3 A;  1MWS A;  2W2C A;  3IJE B;  3I56 3;  2F5W A;  2HOH A;  1AVL A;  2RGQ A;  1F8N A;  1JKG B;  1JB2 A;  2KRT A;  2BMO B;  2SBL A;  4FMD A;  3L0R A;  1L5G B;  1I8V A;  4NRE A;  1BAN A;  5EVH A;  2W03 A;  1LVN A;  4G1M B;  4LEH A;  5BXQ A;  1E97 A;  1GY7 A;  4RBN A;  1DVC A;  4KFF A;  1BAO A;  3S28 A;  6RNT A;  1AR0 A;  2XR8 B;  5AI1 A;  1X1X A;  4HM7 B;  1TFO A;  2YFJ B;  4RNZ A;  4MEI A;  1NB3 I;  1O7H B;  3LTA A;  1JKG A;  1B20 A;  3KII A;  1YVS A;  2CX0 A;  1WMN A;  2XH9 A;  1BRJ A;  2UGI A;  2ZHX B;  5IG5 A;  1B2U A;  3OW2 2;  3D9R A;  1YJN 3;  1ISK A;  1PY3 A;  1Q42 A;  2YFI B;  1FGQ A;  3F40 A;  3LTD A;  3QRD A;  4OK0 A;  1YI2 3;  2XRX B;  2W04 A;  7RNT A;  5IG3 A;  3FSD A;  1BRK A;  1BRS A;  1I2E A;  1RGK A;  2L1S A;  3AGO A;  4H3U A;  2AAE A;  2KXG A;  5D81 A;  2CFK A;  2Z6B A;  3H3H A;  4RNT A;  1UGH I;  1UGI A;  5I97 A;  1C7H A;  3G6E 3;  1UCK A;  1RGA A;  2CFD A;  1RNB A;  4N6U A;  5AIH A;  1J2B A;  3MPH A;  3IMA B;  1QMA A;  2BIR A;  1GOU A;  2CHC A;  3UL5 A;  3OX9 A;  4N6L A;  4BL3 A;  3JUN A;  9RNT A;  6GSP A;  1GMQ A;  4R1K A;  3KSP A;  1BUQ A;  2IY2 A;  3PZW A;  4LZI A;  5M18 A;  1SJW A;  2OTL 3;  1QAL A;  3DXO A;  2A15 A;  5AYS C;  1M1K 4;  1AV4 A;  3G4S 3;  3NBJ A;  1OGZ A;  1WQL B;  4L8O A;  1AY7 A;  1O7M B;  3LML A;  4O2H A;  4EV2 A;  3DMC A;  3LXU X;  2L4V A;  4L7K A;  3CCL 3;  4BTX A;  4J8T A;  4U13 A;  3F14 A;  1IV7 A;  4WHA A;  2K0M A;  2IUJ A;  2CFG A;  1NB5 I;  3WMD A;  2B24 B;  3EC9 A;  5EEO A;  2V1L A;  1OF5 A;  1WNH A;  4BU4 A;  2BMR B;  1VQP 3;  3B4P A;  4XBT A;  5JPU A;  4HM6 B;  3OV4 A;  1SAR A;  2HMM B;  2RBI A;  3LTB A;  4XDV A;  2OTJ 3;  1TRQ A;  4STD A;  1RRL A;  3DM8 A;  1RLS A;  1TIJ A;  3CCR 3;  1RGG A;  4O3V A;  1WMP A;  3A76 A;  1KC8 4;  1OHS A;  1OHO A;  3PCR A;  4FMB A;  3CC2 3;  1UI7 A;  5ELJ A;  2MC8 A;  1M1X B;  1W6G A;  3S5C A;  3CCU 3;  2JQ5 A;  2SAR A;  3CCJ 3;  1G0T A;  2WOF A;  1CQS A;  1ZO2 A;  4HM5 B;  1VQN 3;  3PS8 A;  1NJI 4;  4R9K A;  1BNJ A;  3FLJ A;  1MWR A;  4HM1 B;  1KWI A;  2CWT A;  1RSN A;  3NX0 A;  3CCM 3;  4MMZ B;  2OOV C;  4EV5 A;  1FGT A;  2M7O A;  2OOV A;  3DGM A;  3CPW 2;  1BGS A;  1PYL A;  2C4B A;  1IQX A;  4CCV A;  2KF6 A;  2Y73 A;  4I4K A;  2AAD A;  1B2S A;  2P09 A;  5M1A A;  3NBR A;  3NV0 B;  3EE1 A;  5AIG A;  3NUV A;  4XB5 A;  1YIT 3;  2UUG C;  3KZT A;  1BIR A;  3CXC 2;  1BRG A;  4AKZ A;  1MWT A;  4ORL A;  3M8C A;  2QEX 3;  2Q07 A;  3TDG A;  1I0X A;  1G02 A;  2XSH B;  1NNV A;  2BT3 A;  3BNB A;  2CK3 H;  1A2K A;  3FKA A;  3ZG0 A;  4EC6 A;  4BL2 A;  3IPT A;  3BNE A;  1GYB A;  3K7C A;  1W2B 2;  1ULI B;  3NM2 A;  1RMS A;  1KSI A;  2KF4 A;  1FGM A;  1RRH A;  2I9W A;  1BU4 A;  1RN4 A;  4Q53 A;  5KP1 A;  1JBR A;  2C11 A;  1BNF A;  2HMK B;  3DGY A;  1IQY A;  5G1K A;  1EG9 B;  4O02 B;  1JZO A;  1FZU A;  1IQ8 A;  3EQQ B;  3NM7 A;  4QWT A;  1MGR A;  5LC6 A;  3T8N A;  4EW5 A;  1U8C B;  3LH4 A;  4JRF A;  3HZP A;  3HOH A;  2PZV A;  3FF0 A;  4I5Q A;  3MHE A;  1Z1S A;  3B7C A;  5CLK A;  3DGO A;  1STD A;  1UUG B;  3EJV A;  1EUI C;  2YFL B;  4N6T A;  3SLU A;  4WFO A;  1VQL 3;  1PFP A;  1UW1 A;  5DRE A;  2P05 A;  1Q86 4;  1B2X A;  5LC7 A;  1SQW A;  4HKV B;  3RDE A;  1IK3 A;  2O3O A;  1M90 4;  3FG3 A;  5BVB A;  1YGW A;  1BSD A;  3LTC A;  5CK6 A;  3WOD G;  2IA7 A;  2KAA A;  3BNC A;  3ER7 A;  1AQZ A;  1YGE A;  5IF6 A;  4BIR A;  2OQE C;  2OQE A;  1Q7H A;  1BSE A;  2YX9 A;  1BUJ A;  1IU7 A;  3DY5 A;  4GSP A;  1RN1 A;  4AEQ A;  3CD6 3;  1IT8 A;  1QAF A;  4KFE A;  3CC4 3;  1TRP A;  4WYK B;  3N54 B;  4HM2 B;  1YIJ 3;  1E3V A;  1T3B A;  3H51 A;  1UUV B;  1YNV X;  3HK4 A;  3JUM A;  3J7Y d;  3CC7 3;  2XF3 A;  2F86 B;  3SOA A;  2CX1 A;  4HM3 B;  1LXE A;  5A0O B;  4IT7 A;  1HU9 A;  1RJO A;  5KP3 A;  3WR2 A;  5ELU A;  3CCQ 3;  1BNR A;  1I3F A;  2W56 B;  3UL6 A;  1EEJ A;  2BU4 A;  5GSP A;  2QGU A;  1O7N B;  2OCT A;  3DGN A;  4HVN A;  1US1 A;  3MG3 A;  3S67 A;  2WO0 A;  5DRV A;  2WOH A;  1BSB A;  3PGB A;  1TU5 A;  3D5I A;  3ROB A;  1TFK A;  4LGQ A;  1TTO A;  3EF8 A;  1DE3 A;  4LYL B;  2E2T A;  2GSP A;  3FH1 A;  2ML5 A;  2QIY A;  1N5P A;  1B27 A;  1FW7 A;  2HMN B;  1LQM B;  4LSO A;  1YHQ 3;  1GY5 A;  2LYX A;  3EBT A;  5BU4 A;  1BVI A;  1N9J A;  1W6Y A;  3Q2P A;  1K28 A;  4J5K A;  4KZ1 A;  3V92 A;  1UI8 A;  1R4C A;  4N6M A;  1LRA A;  2D42 A;  2GEY A;  2P0X A;  2ZA4 A;  4HBR A;  1A2P A;  1CEW I;  3NQY A;  3Q90 A;  1KD1 4;  1LOX A;  4FMA A;  2HMO B;  3G16 A;  1FGR A;  2BHM A;  1R4Y A;  3MWZ A;  3GSP A; 
#chains in the Genus database with same CATH homology
 3D5G A;  2KF6 A;  4HOH A;  2AAD A;  1BRN L;  1B2S A;  3BU4 A;  1BIR A;  1LOY A;  1T2H A;  1BRG A;  1B2M A;  1BNI A;  1RGF A;  1MGW A;  1I0X A;  1G02 A;  1B3S A;  1I70 A;  1GMR A;  1GMP A;  2F5W A;  2HOH A;  1RGE A;  1JBT A;  8RNT A;  1BSA A;  1BNS A;  3AGN A;  1RMS A;  1I8V A;  1FUT A;  1I0V A;  2KF4 A;  1BAN A;  1X1U A;  2C4B A;  3D4A A;  1BU4 A;  1RN4 A;  5RNT A;  1JBR A;  1BNF A;  2KF5 A;  3DGY A;  6RNT A;  1BAO A;  4GHO A;  1FZU A;  1RGL A;  1X1X A;  1MGR A;  1X1Y A;  1BNE A;  1B20 A;  1RHL A;  3HOH A;  1YVS A;  1LOW A;  1BRJ A;  1B2U A;  1I3I A;  1PY3 A;  3A5E A;  4HAA A;  7RNT A;  1B2X A;  1BRK A;  1BRS A;  1I2E A;  1RGK A;  1RGC A;  3AGO A;  2AAE A;  1YGW A;  4RNT A;  1BSD A;  1LNI A;  1UCK A;  1RGA A;  2F4Y A;  2KAA A;  1RNB A;  1AQZ A;  1BRH A;  3WHO A;  3GSP A;  4BIR A;  2BIR A;  1GOU A;  2RNT A;  1BSE A;  9RNT A;  1BUJ A;  1RGH A;  1GMQ A;  2F56 A;  1RN1 A;  4GSP A;  6GSP A;  5HOH A;  3BIR A;  3DH2 A;  2F5M A;  1TRP A;  1DET A;  1YNV X;  4J5G A;  3Q3F A;  1GOV A;  1X1W A;  1AY7 A;  1BRI A;  1CH0 A;  3WR2 A;  3RNT A;  1BNR A;  1I3F A;  2BU4 A;  5GSP A;  1RTU A;  1RCL A;  2KF3 A;  4BU4 A;  1BSB A;  3AHS A;  1SAR A;  1Q9E A;  2RBI A;  1ZGX A;  3AHW A;  1BOX A;  3D5I A;  5BIR A;  1TRQ A;  1RCK A;  1TTO A;  1UCL A;  1LOV A;  1RLS A;  7GSP A;  1C54 A;  1DE3 A;  1BSC A;  2GSP A;  1RGG A;  1JBS A;  1HYF A;  1BNG A;  1B27 A;  1FYS A;  1RDS A;  1UCJ A;  1FW7 A;  2SAR A;  1GSP A;  1I2G A;  1GOY A;  1I2F A;  3URP A;  5BU4 A;  1B21 A;  1BVI A;  1BNJ A;  4J5K A;  1IYY A;  1HZ1 A;  1LRA A;  2ZA4 A;  1T2I A;  1A2P A;  1RSN A;  1UCI A;  1FUS A;  3KCH A;  1B2Z A;  1RNT A;  1R4Y A;  3SYU A;  1BGS A;  1PYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...