2KF5A

Barnase bound to d(cgac), low pressure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf5A00
5GSPA 1BAOA 1RGFA 1X1UA 1BRHA 1FUTA 1BNJA 1BNEA 1B2XA 1BSDA 6RNTA 4GSPA 1C54A 1HYFA 1UCLA 3WHOA 2F4YA 3KCHA 1GOVA 1TRQA 1GMPA 1RGAA 2AADA 2ZA4A 1BU4A 4HAAA 1I0XA 4GHOA 1LRAA 2KF4A 5RNTA 1I2FA 1BNRA 1RGKA 2KAAA 1RGGA 3URPA 1RDSA 1BANA 1BRIA 1BNIA 1GMRA 1I0VA 1X1WA 1BRSA 3D5IA 1B21A 3WR2A 4J5GA 1LOVA 1RGHA 1RSNA 2KF5A 1B3SA 1JBRA 2RBIA 3DH2A 1Q9EA 1RN1A 3AHWA 1BRJA 1BRGA 9RNTA 1BUJA 1UCIA 1I3IA 1MGRA 1RLSA 7GSPA 7RNTA 1RGEA 1BSEA 1I3FA 1BSBA 1IYYA 3BU4A 1HZ1A 1RN4A 1BRNL 1SARA 4RNTA 2GSPA 3AGOA 1G02A 1FYSA 1T2HA 3AHSA 1BOXA 2AAEA 1GMQA 3D5GA 3DGYA 6GSPA 1JBTA 1MGWA 1RMSA 1YGWA 1A2PA 2F5WA 2KF6A 1LNIA 1B2MA 1RCLA 3GSPA 1T2IA 1RCKA 1GOYA 3Q3FA 1CH0A 2KF3A 1GOUA 1PY3A 4BIRA 1X1XA 5BIRA 1B27A 1RGCA 1BNFA 1TTOA 1UCKA 3SYUA 1BNGA 1DE3A 2BU4A 2RNTA 1JBSA 1BIRA 3HOHA 4J5KA 1BVIA 1PYLA 1GSPA 1B20A 3RNTA 1UCJA 1BGSA 1FZUA 1AQZA 1LOWA 8RNTA 1FUSA 1I2GA 1I2EA 1ZGXA 2F5MA 3BIRA 1RNTA 1B2SA 1I70A 1LOYA 1BSCA 1AY7A 1BNSA 3AGNA 1RTUA 2F56A 3A5EA 1YVSA 2BIRA 1BRKA 2C4BA 3D4AA 1YNVX 5BU4A 1RNBA 1B2UA 1R4YA 2HOHA 4BU4A 5HOHA 1B2ZA 2SARA 1BSAA 1RGLA 1FW7A 1TRPA 1X1YA 1DETA 1I8VA 1RHLA 4HOHA
chains in the Genus database with same CATH superfamily
1BAOA 1JNQA 1YIJ3 4EV5A 1FUTA 5IW9A 2XGLA 1YJW3 3G0KA 1BNJA 1LQMB 2JDIH 1A2KA 2W0QA 4EC6A 3WOEB 1JZDA 4HZ9B 3CCS3 3EN8A 1LNHA 2W03A 2BMQB 1BUQA 4GHOA 4N6OB 4JRFA 1OHOA 1BNRA 1RGKA 1W6GA 1JKGA 4EW5A 3URPA 3HIGA 1AR0A 5AEUB 2FGTA 2GU3A 3WA2X 1I0VA 3X3ZA 5BVBA 3SEDA 1B21A 2P09A 4RNYA 3ALAA 1S5AA 3WR2A 1W00A 1GD4A 2BNGA 3G6E3 2QGUA 2F98A 1UUVB 3N54B 3CMA3 2RBIA 1O7PB 4WYKB 4FMCA 3NM7A 3HI7A 2INXA 1Q9EA 1BRGA 3EC9A 1GY7A 1K28A 1QAFA 4IPBA 5M19A 1UCIA 4WFOA 5FW5A 4O02B 1RN7A 2GXFA 4EV2A 1D6YA 2QIYA 3BU4A 3UNLA 1VQK3 1JZOA 4NREA 1NDOB 1A90A 1OUNA 1UGHI 3ZG0A 1SARA 3F9SA 1ISKA 2W9QA 3MG1A 1JB5A 1JN5B 3LTBA 4J8TA 1G02A 1ZS7A 3FSDA 3STDA 1NB5I 3PYJA 5M18A 3FF2A 3D3LA 1DVCA 2IY2A 1M9GA 3EBTA 3LTDA 1LXEA 3OWYA 1G96A 4BL3A 1FGTA 2XSOB 3GSPA 1UDII 3LMLA 5JPPA 3EHCA 1GOYA 1GY6A 1CH0A 2XSHB 1K41A 3CPOA 2GBWB 5BIRA 2IA7A 4N6UA 1V74A 4HZBB 3OWUA 3S5CA 2L4VA 1IVWA 5KP3A 1UCKA 2YFJB 3SYUA 1NB3I 4R80A 1MWUA 1QALA 4MMYB 5AYRB 1A2VA 4X2HA 3DGOA 1BVIA 1PYLA 5IEOA 2OQEC 4LEHA 2UX0A 1VQ93 1BGSA 1MWTA 1LOWA 3HK4A 2O9UX 3T8NA 1EKMA 3B4PA 3V92A 3WODG 1FUSA 1I2EA 3V99A 1O7MB 5EQLA 2E2VA 5IG5A 1TUHA 2YX9A 4K61A 3QRDA 1DMMA 1V58A 3B7CA 2F86B 4L8OA 4KVHA 5CK6A 5LC6A 4DKIA 3CCR3 4KZ1A 1M1K4 3K7CA 2CFKA 2M7OA 5IEPA 2RFRA 3CD63 3ZFZA 2H0GA 3FG1A 3LYGA 5DREA 1FGMA 1D6ZA 2BMOB 3IJEB 4I4KA 4WHAA 1JB2A 4HKVB 1O7GB 3H51A 3OXAA 1IVVA 3KZTA 1WMOA 2W9PA 5IENA 1RNBA 3HIIA 8CHOA 2HOHA 3FZWA 2IUJA 4BU4A 3AMOA 3I0YA 5CXOA 1TRPA 4HM7B 1Q824 1I8VA 1RHLA 2I9WA 3RGRA 3EE1A 3PS8A 3EX9A 1VQO3 3GAXA 1Q814 1X1UA 2ZL8A 3OX9A 1Q40B 5AIFA 1B2XA 3F8XA 1STFI 1KWIA 1C7HA 1HYFA 1DMQA 1SIHA 5CF1A 2F4YA 2CG1A 2W04A 1OGXA 1GOVA 2GEXA 3F7XA 3MWZA 3PXMA 3SXXA 3CU3A 2OCTA 2AADA 2ZA4A 1N9JA 2CK3H 2SBLA 2CG0A 3D9RA 4HAAA 4ORLA 2KF4A 3BNDA 1I2FA 3FLJA 1GS3A 1BANA 3DUKA 4LSOA 3S67A 3T8UA 3SOYA 4HYZA 3LOYA 1S723 4J5GA 1LOVA 4U13A 3NQYA 2KF5A 1B3SA 5D82A 1EG9B 1JBRA 1RKYA 1UI7A 2YFLB 3K63A 2BT3A 3KE7A 4HM2B 3ROBA 3VSYA 3AHWA 5G2GA 3T0UA 1VQP3 1BUJA 1Q7HA 1Q7Y4 3MYTA 1RGEA 1BSEA 4STDA 3G4S3 1GYBA 4KFFA 1U5OA 1HZ1A 1RN4A 3EQQB 4FR9A 3NHXA 2XFTA 2CKFB 2D1WA 3K5TA 1GD3A 4JF8A 4RNTA 1YJ93 3BLZA 2GEYA 1ZX2A 1FYSA 1OCVA 2OOVC 3GZYB 2AAEA 3D5GA 6GSPA 1EQKA 1GY5A 1OF5B 2Z6BA 5KP4A 2ML6A 2WGOA 4WWUC 3I553 1RMSA 3CPW2 2F5WA 1A2PA 4X2OA 1AVLA 2CWTA 4Q53A 1VZZA 6STDA 1RCKA 1N9EA 4GB5A 3SX1A 1IT7A 3KFQC 3LTCA 2CFLA 1HKXA 4O8SA 1X1XA 4BIRA 2L1SA 2CH9A 3CNXA 3O8YA 2XF3A 2CFWA 3GZRA 3NM2A 1RGCA 4FMBA 2CC3A 1MWRA 3KSED 1TTOA 3CC43 2MC8A 2BHMA 2ZHXB 3NBRA 1KC84 3IMAB 1BIRA 3MG3A 3DMCA 2A15A 4BTXA 1NU3A 4L7KA 3DGNA 3N8BA 3NXJA 3LH4A 1ULJB 5ELUA 3OW22 1UCJA 2CHCA 4N6V0 3WOFB 1W2B2 2H0IA 2W2CA 1DVDA 3RDEA 1M904 1AQZA 2O3OA 2XFSA 4NPBA 3UB1A 3FGYA 1UI8A 3NV0B 2P0MA 4XBXA 2F5MA 3FH1A 3BIRA 1RNTA 1B2SA 1BSCA 1BNSA 3DM8A 3EN1B 1K9M4 5TGNA 4FCZA 2Q07A 1Q42A 1IK3A 1J2BA 1CQSA 1QMAA 1YI23 2OTL3 3B4OA 4OK0A 1FUWA 1BRKA 3BNBA 1EA2A 3CCQ3 3EJVA 1KD14 5EEOA 3CCU3 2XGNA 3I563 2P05A 5ELJA 2IYJA 2GBXB 1B2UA 1RRHA 1Q864 4LMIA 5IG0A 5HOHA 5IERA 1B2ZA 1X1YA 1DETA 3CXC2 2K3DA 2F99A 4HJLB 1DMNA 2P38A 5G1LA 5GSPA 4HVNA 4L8PA 1RGFA 1W2ZA 1F8NA 2W56B 1RRLA 3LT8A 6RNTA 2OWPA 5AIGA 1IVUA 1UCLA 1UUWB 2WOHA 1C54A 2E2TA 2XR8B 4N6NB 4G1MB 4O2HA 4RNZA 3WHOA 3KCHA 3NBBA 2QEX3 2R4IA 1W6CA 1FGQA 1RGAA 4XDWA 1BU4A 5AIHA 4FCMA 1D6UA 5HGRA 1AV4A 1L5GB 1LRAA 2KCDA 5RNTA 2XH9A 4R9KA 4XM4A 1RGGA 4IT7A 1RDSA 1BRIA 2WOFA 4CJNA 3S27A 3U1WA 4N3VA 1UW1A 1X1WA 1QJGA 1BRSA 1Y4KA 3LTAA 1VQ73 3ER7A 2BMRB 4EBGA 1RSNA 1K8A4 4KFEA 7STDA 3MPHA 2UUGC 2YFIB 5LC7A 3WA3A 3JUPA 5D81A 4BTWA 3CCL3 1BRJA 2RSXA 2XEPA 1I3IA 3LT9A 2Y74A 7GSPA 2RCDA 4XBTA 3UL5A 4CDLA 1I3FA 1IQ8A 5KP1A 1IYYA 4XBYA 3DGLA 3MKIA 1FGRA 4LGQA 4GL6A 4BL2A 3BNCA 3U97A 3H3HA 2CWVA 3PZWA 1N8QA 3Q2PA 1IQYA 1STDA 1NO3A 3CME3 2HMJB 1N8R4 4O3VA 1T2HA 2CIUA 1VQQA 3LZAA 2P0XA 1CYUA 1BOXA 2KRTA 3DGYA 3IPTA 5M1AA 1NNVA 3F14A 1MGWA 1MNLA 2B1XB 1ULIB 1W5ZA 4K1VA 2LQVA 3FCSB 2KF6A 1LNIA 3M8CA 3B8LA 1B2MA 1TJDA 1SIIA 3G713 4HM0B 4BTYA 3V98A 3Q3FA 1QVF2 2KF3A 4ZM8A 2HMKB 3AMOB 1FA3A 2J8XB 4QWTA 4EYCA 4OUQA 1OPYA 1AVKA 3UL6A 1YJN3 3FF0A 1BNFA 1IU7A 1VQ53 1VQL3 1OF5A 1JJ22 1OGZA 3DY5A 3GZBA 2CFDA 1IDPA 3HOHA 1TIJA 3DXOA 1E97A 4WYKA 2D42A 1TFOA 4TX4A 2PZVA 1JRQA 3RNTA 1W6YA 3CC23 1WTHA 3OV4A 3TDGA 3QK9A 2UGIA 2E2UA 2PNCA 1VQM3 1UGIA 4KT3B 3MSOA 1OH0A 1KSIA 3VGNA 5A0OB 2XRXB 3ECFA 5AEWB 3GWRA 3J7Yd 2WGQA 4RZMA 5JPUA 3F40A 1T3BA 1O7HB 1IT8A 3X42A 5I97A 2OOVA 1NWWA 1E3RA 1A67A 4LZIA 3JUQA 1K734 1AY7A 1JN5A 1YIT3 3AGNA 1RTUA 3K9MC 2QA43 1LOXA 1TFKA 3NBJA 2BO9B 1MWSA 4FMDA 4HM3B 3RGAA 3CCM3 2ZDJA 1YVSA 2BIRA 4R1KA 5JBSA 1CEWI 2C11A 2FXTA 3Q1CA 2W6JH 3NV0A 1YNVX 3JUOA 5BU4A 4K1UA 1PU4A 1YHQ3 1V57A 3HZPA 3CC73 1O7WB 3BNEA 3PCSA 4CPKA 2SARA 5DRVA 2HMLB 1RGLA 3DGMA 3F8HA 1FW7A 4MMZB 1JKGB 3SVAA 3S29A 3KSPA 1WQLB 1BRHA 4XDVA 1E3VA 3UJMA 1SJWA 1ROAA 1ASKA 1BNEA 1PFPA 3E99A 1BSDA 2KXGA 3OWSA 2IMJA 4GSPA 1IV9A 2JQ5A 4H3UA 3S28A 1UUGB 1NJI4 1VQN3 5EVHA 1TRQA 1GMPA 4HM5B 1QVG2 3NX0A 3F7SA 1I0XA 3L0RA 3SLUA 3PGBA 3SOAA 2HMOB 4N6TA 2KAAA 1VQ43 2CFGA 5AYSC 1BNIA 1EUIC 1GMRA 4FCJA 4HBRA 1W02A 1OHSA 2W56A 5G1KA 1N5HA 4FMAA 1LVNA 3D5IA 1VQ83 3K0ZA 1JV2B 4HM8B 5STDA 2K0MA 4R9LA 3G16A 1FGOA 1RGHA 1RJOA 1W7CA 5AIIA 3DH2A 4J9AA 1SQWA 5CLKA 3VF1A 3PCRA 1RN1A 4HM4B 3NUVA 4K90B 2CW9A 9RNTA 3WDGB 1MGRA 1RLSA 2OQEA 7RNTA 3D79A 1LQGC 1BSBA 3A76A 4LYLB 2HMMB 3FKAA 3X3XA 3ZG5A 5D83A 2STDA 4RBNA 5BXQA 1BRNL 1MOLA 1ROVA 3N9HA 3KIIA 4XB5A 2GSPA 3AGOA 1G0TA 5IG3A 2Z77A 3AHSA 1ZO2A 1GMQA 1Q40A 2GU1A 3MHEA 1TU5A 1JBTA 3JUNA 2FNQA 3BB9A 3MG2A 3FG3A 1EEJA 4PEJA 1YGWA 1TP6A 1N5PA 4EXRA 1RCLA 2R41A 2Z76A 4I5QA 4IIAA 1T2IA 4MEIA 4AKYA 5IF6A 3KKGA 3Q90A 1GOUA 1DYUA 1PY3A 2B24B 1WNHA 2H0HA 5CF2A 4R4KA 1B27A 1CYVA 2CWUA 3EF8A 2ML5A 3G8ZA 4AKZA 2Z7AA 1WMNA 4NHFA 1BNGA 5IG4A 1DE3A 2BU4A 1VQ63 1O7NB 2K54A 2RNTA 1JBSA 4MJDA 5FGOA 1R4CA 4J5KA 2WO0A 3JVCA 1W01A 2HMNB 3FG4A 1IV7A 1JB4A 1GSPA 1B20A 1OACA 2CX1A 4WP5A 4CCVA 2Y73A 2V1LA 3GZXB 1FZUA 2C10A 3CCV3 4ILFA 8RNTA 3GRDA 1I2GA 1U8CB 2MF7A 4HM6B 1YGEA 3LXUX 4HM1B 3CCE3 5AI1A 1HU9A 1ZGXA 3EBYA 4AEQA 1OHPA 3X3YA 1I70A 4H61A 1LOYA 4N6LA 1KQS2 2LYXA 3CNMA 3X41A 4N6MA 2F56A 2CX0A 3A5EA 3KN4A 3WMDA 3X40A 4KFDA 1QAKA 3DZLA 1M1XB 1US1A 2C4BA 3JUMA 3D4AA 1IVXA 1WMPA 1SPUA 1Z1SA 1T5YA 1YVBI 2IUKA 2RGQA 1W4NA 4MMXB 3HX8A 3CCJ3 3NQZA 1R4YA 4OVMA 1BSAA 3EB8A 2OTJ3 1IQXA 4HOHA
chains in the Genus database with same CATH topology
5GSPA 1BAOA 1RGFA 1X1UA 1BRHA 1FUTA 1BNJA 1BNEA 1B2XA 1BSDA 6RNTA 4GSPA 1C54A 1HYFA 1UCLA 3WHOA 2F4YA 3KCHA 1GOVA 1TRQA 1GMPA 1RGAA 2AADA 2ZA4A 1BU4A 4HAAA 1I0XA 4GHOA 1LRAA 2KF4A 5RNTA 1I2FA 1BNRA 1RGKA 2KAAA 1RGGA 3URPA 1RDSA 1BANA 1BRIA 1BNIA 1GMRA 1I0VA 1X1WA 1BRSA 3D5IA 1B21A 3WR2A 4J5GA 1LOVA 1RGHA 1RSNA 2KF5A 1B3SA 1JBRA 2RBIA 3DH2A 1Q9EA 1RN1A 3AHWA 1BRJA 1BRGA 9RNTA 1BUJA 1UCIA 1I3IA 1MGRA 1RLSA 7GSPA 7RNTA 1RGEA 1BSEA 1I3FA 1BSBA 1IYYA 3BU4A 1HZ1A 1RN4A 1BRNL 1SARA 4RNTA 2GSPA 3AGOA 1G02A 1FYSA 1T2HA 3AHSA 1BOXA 2AAEA 1GMQA 3D5GA 3DGYA 6GSPA 1JBTA 1MGWA 1RMSA 1YGWA 1A2PA 2F5WA 2KF6A 1LNIA 1B2MA 1RCLA 3GSPA 1T2IA 1RCKA 1GOYA 3Q3FA 1CH0A 2KF3A 1GOUA 1PY3A 4BIRA 1X1XA 5BIRA 1B27A 1RGCA 1BNFA 1TTOA 1UCKA 3SYUA 1BNGA 1DE3A 2BU4A 2RNTA 1JBSA 1BIRA 3HOHA 4J5KA 1BVIA 1PYLA 1GSPA 1B20A 3RNTA 1UCJA 1BGSA 1FZUA 1AQZA 1LOWA 8RNTA 1FUSA 1I2GA 1I2EA 1ZGXA 2F5MA 3BIRA 1RNTA 1B2SA 1I70A 1LOYA 1BSCA 1AY7A 1BNSA 3AGNA 1RTUA 2F56A 3A5EA 1YVSA 2BIRA 1BRKA 2C4BA 3D4AA 1YNVX 5BU4A 1RNBA 1B2UA 1R4YA 2HOHA 4BU4A 5HOHA 1B2ZA 2SARA 1BSAA 1RGLA 1FW7A 1TRPA 1X1YA 1DETA 1I8VA 1RHLA 4HOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSP A;  1BAO A;  1RGF A;  1X1U A;  1BRH A;  1FUT A;  1BNJ A;  1BNE A;  1B2X A;  1BSD A;  6RNT A;  4GSP A;  1C54 A;  1HYF A;  1UCL A;  3WHO A;  2F4Y A;  3KCH A;  1GOV A;  1TRQ A;  1GMP A;  1RGA A;  2AAD A;  2ZA4 A;  1BU4 A;  4HAA A;  1I0X A;  4GHO A;  1LRA A;  2KF4 A;  5RNT A;  1I2F A;  1BNR A;  1RGK A;  2KAA A;  1RGG A;  3URP A;  1RDS A;  1BAN A;  1BRI A;  1BNI A;  1GMR A;  1I0V A;  1X1W A;  1BRS A;  3D5I A;  1B21 A;  3WR2 A;  4J5G A;  1LOV A;  1RGH A;  1RSN A;  2KF5 A;  1B3S A;  1JBR A;  2RBI A;  3DH2 A;  1Q9E A;  1RN1 A;  3AHW A;  1BRJ A;  1BRG A;  9RNT A;  1BUJ A;  1UCI A;  1I3I A;  1MGR A;  1RLS A;  7GSP A;  7RNT A;  1RGE A;  1BSE A;  1I3F A;  1BSB A;  1IYY A;  3BU4 A;  1HZ1 A;  1RN4 A;  1BRN L;  1SAR A;  4RNT A;  2GSP A;  3AGO A;  1G02 A;  1FYS A;  1T2H A;  3AHS A;  1BOX A;  2AAE A;  1GMQ A;  3D5G A;  3DGY A;  6GSP A;  1JBT A;  1MGW A;  1RMS A;  1YGW A;  1A2P A;  2F5W A;  2KF6 A;  1LNI A;  1B2M A;  1RCL A;  3GSP A;  1T2I A;  1RCK A;  1GOY A;  3Q3F A;  1CH0 A;  2KF3 A;  1GOU A;  1PY3 A;  4BIR A;  1X1X A;  5BIR A;  1B27 A;  1RGC A;  1BNF A;  1TTO A;  1UCK A;  3SYU A;  1BNG A;  1DE3 A;  2BU4 A;  2RNT A;  1JBS A;  1BIR A;  3HOH A;  4J5K A;  1BVI A;  1PYL A;  1GSP A;  1B20 A;  3RNT A;  1UCJ A;  1BGS A;  1FZU A;  1AQZ A;  1LOW A;  8RNT A;  1FUS A;  1I2G A;  1I2E A;  1ZGX A;  2F5M A;  3BIR A;  1RNT A;  1B2S A;  1I70 A;  1LOY A;  1BSC A;  1AY7 A;  1BNS A;  3AGN A;  1RTU A;  2F56 A;  3A5E A;  1YVS A;  2BIR A;  1BRK A;  2C4B A;  3D4A A;  1YNV X;  5BU4 A;  1RNB A;  1B2U A;  1R4Y A;  2HOH A;  4BU4 A;  5HOH A;  1B2Z A;  2SAR A;  1BSA A;  1RGL A;  1FW7 A;  1TRP A;  1X1Y A;  1DET A;  1I8V A;  1RHL A;  4HOH A; 
#chains in the Genus database with same CATH topology
 1BAO A;  1JNQ A;  1YIJ 3;  4EV5 A;  1FUT A;  5IW9 A;  2XGL A;  1YJW 3;  3G0K A;  1BNJ A;  1LQM B;  2JDI H;  1A2K A;  2W0Q A;  4EC6 A;  3WOE B;  1JZD A;  4HZ9 B;  3CCS 3;  3EN8 A;  1LNH A;  2W03 A;  2BMQ B;  1BUQ A;  4GHO A;  4N6O B;  4JRF A;  1OHO A;  1BNR A;  1RGK A;  1W6G A;  1JKG A;  4EW5 A;  3URP A;  3HIG A;  1AR0 A;  5AEU B;  2FGT A;  2GU3 A;  3WA2 X;  1I0V A;  3X3Z A;  5BVB A;  3SED A;  1B21 A;  2P09 A;  4RNY A;  3ALA A;  1S5A A;  3WR2 A;  1W00 A;  1GD4 A;  2BNG A;  3G6E 3;  2QGU A;  2F98 A;  1UUV B;  3N54 B;  3CMA 3;  2RBI A;  1O7P B;  4WYK B;  4FMC A;  3NM7 A;  3HI7 A;  2INX A;  1Q9E A;  1BRG A;  3EC9 A;  1GY7 A;  1K28 A;  1QAF A;  4IPB A;  5M19 A;  1UCI A;  4WFO A;  5FW5 A;  4O02 B;  1RN7 A;  2GXF A;  4EV2 A;  1D6Y A;  2QIY A;  3BU4 A;  3UNL A;  1VQK 3;  1JZO A;  4NRE A;  1NDO B;  1A90 A;  1OUN A;  1UGH I;  3ZG0 A;  1SAR A;  3F9S A;  1ISK A;  2W9Q A;  3MG1 A;  1JB5 A;  1JN5 B;  3LTB A;  4J8T A;  1G02 A;  1ZS7 A;  3FSD A;  3STD A;  1NB5 I;  3PYJ A;  5M18 A;  3FF2 A;  3D3L A;  1DVC A;  2IY2 A;  1M9G A;  3EBT A;  3LTD A;  1LXE A;  3OWY A;  1G96 A;  4BL3 A;  1FGT A;  2XSO B;  3GSP A;  1UDI I;  3LML A;  5JPP A;  3EHC A;  1GOY A;  1GY6 A;  1CH0 A;  2XSH B;  1K41 A;  3CPO A;  2GBW B;  5BIR A;  2IA7 A;  4N6U A;  1V74 A;  4HZB B;  3OWU A;  3S5C A;  2L4V A;  1IVW A;  5KP3 A;  1UCK A;  2YFJ B;  3SYU A;  1NB3 I;  4R80 A;  1MWU A;  1QAL A;  4MMY B;  5AYR B;  1A2V A;  4X2H A;  3DGO A;  1BVI A;  1PYL A;  5IEO A;  2OQE C;  4LEH A;  2UX0 A;  1VQ9 3;  1BGS A;  1MWT A;  1LOW A;  3HK4 A;  2O9U X;  3T8N A;  1EKM A;  3B4P A;  3V92 A;  3WOD G;  1FUS A;  1I2E A;  3V99 A;  1O7M B;  5EQL A;  2E2V A;  5IG5 A;  1TUH A;  2YX9 A;  4K61 A;  3QRD A;  1DMM A;  1V58 A;  3B7C A;  2F86 B;  4L8O A;  4KVH A;  5CK6 A;  5LC6 A;  4DKI A;  3CCR 3;  4KZ1 A;  1M1K 4;  3K7C A;  2CFK A;  2M7O A;  5IEP A;  2RFR A;  3CD6 3;  3ZFZ A;  2H0G A;  3FG1 A;  3LYG A;  5DRE A;  1FGM A;  1D6Z A;  2BMO B;  3IJE B;  4I4K A;  4WHA A;  1JB2 A;  4HKV B;  1O7G B;  3H51 A;  3OXA A;  1IVV A;  3KZT A;  1WMO A;  2W9P A;  5IEN A;  1RNB A;  3HII A;  8CHO A;  2HOH A;  3FZW A;  2IUJ A;  4BU4 A;  3AMO A;  3I0Y A;  5CXO A;  1TRP A;  4HM7 B;  1Q82 4;  1I8V A;  1RHL A;  2I9W A;  3RGR A;  3EE1 A;  3PS8 A;  3EX9 A;  1VQO 3;  3GAX A;  1Q81 4;  1X1U A;  2ZL8 A;  3OX9 A;  1Q40 B;  5AIF A;  1B2X A;  3F8X A;  1STF I;  1KWI A;  1C7H A;  1HYF A;  1DMQ A;  1SIH A;  5CF1 A;  2F4Y A;  2CG1 A;  2W04 A;  1OGX A;  1GOV A;  2GEX A;  3F7X A;  3MWZ A;  3PXM A;  3SXX A;  3CU3 A;  2OCT A;  2AAD A;  2ZA4 A;  1N9J A;  2CK3 H;  2SBL A;  2CG0 A;  3D9R A;  4HAA A;  4ORL A;  2KF4 A;  3BND A;  1I2F A;  3FLJ A;  1GS3 A;  1BAN A;  3DUK A;  4LSO A;  3S67 A;  3T8U A;  3SOY A;  4HYZ A;  3LOY A;  1S72 3;  4J5G A;  1LOV A;  4U13 A;  3NQY A;  2KF5 A;  1B3S A;  5D82 A;  1EG9 B;  1JBR A;  1RKY A;  1UI7 A;  2YFL B;  3K63 A;  2BT3 A;  3KE7 A;  4HM2 B;  3ROB A;  3VSY A;  3AHW A;  5G2G A;  3T0U A;  1VQP 3;  1BUJ A;  1Q7H A;  1Q7Y 4;  3MYT A;  1RGE A;  1BSE A;  4STD A;  3G4S 3;  1GYB A;  4KFF A;  1U5O A;  1HZ1 A;  1RN4 A;  3EQQ B;  4FR9 A;  3NHX A;  2XFT A;  2CKF B;  2D1W A;  3K5T A;  1GD3 A;  4JF8 A;  4RNT A;  1YJ9 3;  3BLZ A;  2GEY A;  1ZX2 A;  1FYS A;  1OCV A;  2OOV C;  3GZY B;  2AAE A;  3D5G A;  6GSP A;  1EQK A;  1GY5 A;  1OF5 B;  2Z6B A;  5KP4 A;  2ML6 A;  2WGO A;  4WWU C;  3I55 3;  1RMS A;  3CPW 2;  2F5W A;  1A2P A;  4X2O A;  1AVL A;  2CWT A;  4Q53 A;  1VZZ A;  6STD A;  1RCK A;  1N9E A;  4GB5 A;  3SX1 A;  1IT7 A;  3KFQ C;  3LTC A;  2CFL A;  1HKX A;  4O8S A;  1X1X A;  4BIR A;  2L1S A;  2CH9 A;  3CNX A;  3O8Y A;  2XF3 A;  2CFW A;  3GZR A;  3NM2 A;  1RGC A;  4FMB A;  2CC3 A;  1MWR A;  3KSE D;  1TTO A;  3CC4 3;  2MC8 A;  2BHM A;  2ZHX B;  3NBR A;  1KC8 4;  3IMA B;  1BIR A;  3MG3 A;  3DMC A;  2A15 A;  4BTX A;  1NU3 A;  4L7K A;  3DGN A;  3N8B A;  3NXJ A;  3LH4 A;  1ULJ B;  5ELU A;  3OW2 2;  1UCJ A;  2CHC A;  4N6V 0;  3WOF B;  1W2B 2;  2H0I A;  2W2C A;  1DVD A;  3RDE A;  1M90 4;  1AQZ A;  2O3O A;  2XFS A;  4NPB A;  3UB1 A;  3FGY A;  1UI8 A;  3NV0 B;  2P0M A;  4XBX A;  2F5M A;  3FH1 A;  3BIR A;  1RNT A;  1B2S A;  1BSC A;  1BNS A;  3DM8 A;  3EN1 B;  1K9M 4;  5TGN A;  4FCZ A;  2Q07 A;  1Q42 A;  1IK3 A;  1J2B A;  1CQS A;  1QMA A;  1YI2 3;  2OTL 3;  3B4O A;  4OK0 A;  1FUW A;  1BRK A;  3BNB A;  1EA2 A;  3CCQ 3;  3EJV A;  1KD1 4;  5EEO A;  3CCU 3;  2XGN A;  3I56 3;  2P05 A;  5ELJ A;  2IYJ A;  2GBX B;  1B2U A;  1RRH A;  1Q86 4;  4LMI A;  5IG0 A;  5HOH A;  5IER A;  1B2Z A;  1X1Y A;  1DET A;  3CXC 2;  2K3D A;  2F99 A;  4HJL B;  1DMN A;  2P38 A;  5G1L A;  5GSP A;  4HVN A;  4L8P A;  1RGF A;  1W2Z A;  1F8N A;  2W56 B;  1RRL A;  3LT8 A;  6RNT A;  2OWP A;  5AIG A;  1IVU A;  1UCL A;  1UUW B;  2WOH A;  1C54 A;  2E2T A;  2XR8 B;  4N6N B;  4G1M B;  4O2H A;  4RNZ A;  3WHO A;  3KCH A;  3NBB A;  2QEX 3;  2R4I A;  1W6C A;  1FGQ A;  1RGA A;  4XDW A;  1BU4 A;  5AIH A;  4FCM A;  1D6U A;  5HGR A;  1AV4 A;  1L5G B;  1LRA A;  2KCD A;  5RNT A;  2XH9 A;  4R9K A;  4XM4 A;  1RGG A;  4IT7 A;  1RDS A;  1BRI A;  2WOF A;  4CJN A;  3S27 A;  3U1W A;  4N3V A;  1UW1 A;  1X1W A;  1QJG A;  1BRS A;  1Y4K A;  3LTA A;  1VQ7 3;  3ER7 A;  2BMR B;  4EBG A;  1RSN A;  1K8A 4;  4KFE A;  7STD A;  3MPH A;  2UUG C;  2YFI B;  5LC7 A;  3WA3 A;  3JUP A;  5D81 A;  4BTW A;  3CCL 3;  1BRJ A;  2RSX A;  2XEP A;  1I3I A;  3LT9 A;  2Y74 A;  7GSP A;  2RCD A;  4XBT A;  3UL5 A;  4CDL A;  1I3F A;  1IQ8 A;  5KP1 A;  1IYY A;  4XBY A;  3DGL A;  3MKI A;  1FGR A;  4LGQ A;  4GL6 A;  4BL2 A;  3BNC A;  3U97 A;  3H3H A;  2CWV A;  3PZW A;  1N8Q A;  3Q2P A;  1IQY A;  1STD A;  1NO3 A;  3CME 3;  2HMJ B;  1N8R 4;  4O3V A;  1T2H A;  2CIU A;  1VQQ A;  3LZA A;  2P0X A;  1CYU A;  1BOX A;  2KRT A;  3DGY A;  3IPT A;  5M1A A;  1NNV A;  3F14 A;  1MGW A;  1MNL A;  2B1X B;  1ULI B;  1W5Z A;  4K1V A;  2LQV A;  3FCS B;  2KF6 A;  1LNI A;  3M8C A;  3B8L A;  1B2M A;  1TJD A;  1SII A;  3G71 3;  4HM0 B;  4BTY A;  3V98 A;  3Q3F A;  1QVF 2;  2KF3 A;  4ZM8 A;  2HMK B;  3AMO B;  1FA3 A;  2J8X B;  4QWT A;  4EYC A;  4OUQ A;  1OPY A;  1AVK A;  3UL6 A;  1YJN 3;  3FF0 A;  1BNF A;  1IU7 A;  1VQ5 3;  1VQL 3;  1OF5 A;  1JJ2 2;  1OGZ A;  3DY5 A;  3GZB A;  2CFD A;  1IDP A;  3HOH A;  1TIJ A;  3DXO A;  1E97 A;  4WYK A;  2D42 A;  1TFO A;  4TX4 A;  2PZV A;  1JRQ A;  3RNT A;  1W6Y A;  3CC2 3;  1WTH A;  3OV4 A;  3TDG A;  3QK9 A;  2UGI A;  2E2U A;  2PNC A;  1VQM 3;  1UGI A;  4KT3 B;  3MSO A;  1OH0 A;  1KSI A;  3VGN A;  5A0O B;  2XRX B;  3ECF A;  5AEW B;  3GWR A;  3J7Y d;  2WGQ A;  4RZM A;  5JPU A;  3F40 A;  1T3B A;  1O7H B;  1IT8 A;  3X42 A;  5I97 A;  2OOV A;  1NWW A;  1E3R A;  1A67 A;  4LZI A;  3JUQ A;  1K73 4;  1AY7 A;  1JN5 A;  1YIT 3;  3AGN A;  1RTU A;  3K9M C;  2QA4 3;  1LOX A;  1TFK A;  3NBJ A;  2BO9 B;  1MWS A;  4FMD A;  4HM3 B;  3RGA A;  3CCM 3;  2ZDJ A;  1YVS A;  2BIR A;  4R1K A;  5JBS A;  1CEW I;  2C11 A;  2FXT A;  3Q1C A;  2W6J H;  3NV0 A;  1YNV X;  3JUO A;  5BU4 A;  4K1U A;  1PU4 A;  1YHQ 3;  1V57 A;  3HZP A;  3CC7 3;  1O7W B;  3BNE A;  3PCS A;  4CPK A;  2SAR A;  5DRV A;  2HML B;  1RGL A;  3DGM A;  3F8H A;  1FW7 A;  4MMZ B;  1JKG B;  3SVA A;  3S29 A;  3KSP A;  1WQL B;  1BRH A;  4XDV A;  1E3V A;  3UJM A;  1SJW A;  1ROA A;  1ASK A;  1BNE A;  1PFP A;  3E99 A;  1BSD A;  2KXG A;  3OWS A;  2IMJ A;  4GSP A;  1IV9 A;  2JQ5 A;  4H3U A;  3S28 A;  1UUG B;  1NJI 4;  1VQN 3;  5EVH A;  1TRQ A;  1GMP A;  4HM5 B;  1QVG 2;  3NX0 A;  3F7S A;  1I0X A;  3L0R A;  3SLU A;  3PGB A;  3SOA A;  2HMO B;  4N6T A;  2KAA A;  1VQ4 3;  2CFG A;  5AYS C;  1BNI A;  1EUI C;  1GMR A;  4FCJ A;  4HBR A;  1W02 A;  1OHS A;  2W56 A;  5G1K A;  1N5H A;  4FMA A;  1LVN A;  3D5I A;  1VQ8 3;  3K0Z A;  1JV2 B;  4HM8 B;  5STD A;  2K0M A;  4R9L A;  3G16 A;  1FGO A;  1RGH A;  1RJO A;  1W7C A;  5AII A;  3DH2 A;  4J9A A;  1SQW A;  5CLK A;  3VF1 A;  3PCR A;  1RN1 A;  4HM4 B;  3NUV A;  4K90 B;  2CW9 A;  9RNT A;  3WDG B;  1MGR A;  1RLS A;  2OQE A;  7RNT A;  3D79 A;  1LQG C;  1BSB A;  3A76 A;  4LYL B;  2HMM B;  3FKA A;  3X3X A;  3ZG5 A;  5D83 A;  2STD A;  4RBN A;  5BXQ A;  1BRN L;  1MOL A;  1ROV A;  3N9H A;  3KII A;  4XB5 A;  2GSP A;  3AGO A;  1G0T A;  5IG3 A;  2Z77 A;  3AHS A;  1ZO2 A;  1GMQ A;  1Q40 A;  2GU1 A;  3MHE A;  1TU5 A;  1JBT A;  3JUN A;  2FNQ A;  3BB9 A;  3MG2 A;  3FG3 A;  1EEJ A;  4PEJ A;  1YGW A;  1TP6 A;  1N5P A;  4EXR A;  1RCL A;  2R41 A;  2Z76 A;  4I5Q A;  4IIA A;  1T2I A;  4MEI A;  4AKY A;  5IF6 A;  3KKG A;  3Q90 A;  1GOU A;  1DYU A;  1PY3 A;  2B24 B;  1WNH A;  2H0H A;  5CF2 A;  4R4K A;  1B27 A;  1CYV A;  2CWU A;  3EF8 A;  2ML5 A;  3G8Z A;  4AKZ A;  2Z7A A;  1WMN A;  4NHF A;  1BNG A;  5IG4 A;  1DE3 A;  2BU4 A;  1VQ6 3;  1O7N B;  2K54 A;  2RNT A;  1JBS A;  4MJD A;  5FGO A;  1R4C A;  4J5K A;  2WO0 A;  3JVC A;  1W01 A;  2HMN B;  3FG4 A;  1IV7 A;  1JB4 A;  1GSP A;  1B20 A;  1OAC A;  2CX1 A;  4WP5 A;  4CCV A;  2Y73 A;  2V1L A;  3GZX B;  1FZU A;  2C10 A;  3CCV 3;  4ILF A;  8RNT A;  3GRD A;  1I2G A;  1U8C B;  2MF7 A;  4HM6 B;  1YGE A;  3LXU X;  4HM1 B;  3CCE 3;  5AI1 A;  1HU9 A;  1ZGX A;  3EBY A;  4AEQ A;  1OHP A;  3X3Y A;  1I70 A;  4H61 A;  1LOY A;  4N6L A;  1KQS 2;  2LYX A;  3CNM A;  3X41 A;  4N6M A;  2F56 A;  2CX0 A;  3A5E A;  3KN4 A;  3WMD A;  3X40 A;  4KFD A;  1QAK A;  3DZL A;  1M1X B;  1US1 A;  2C4B A;  3JUM A;  3D4A A;  1IVX A;  1WMP A;  1SPU A;  1Z1S A;  1T5Y A;  1YVB I;  2IUK A;  2RGQ A;  1W4N A;  4MMX B;  3HX8 A;  3CCJ 3;  3NQZ A;  1R4Y A;  4OVM A;  1BSA A;  3EB8 A;  2OTJ 3;  1IQX A;  4HOH A; 
#chains in the Genus database with same CATH homology
 5GSP A;  1BAO A;  1RGF A;  1X1U A;  1BRH A;  1FUT A;  1BNJ A;  1BNE A;  1B2X A;  1BSD A;  6RNT A;  4GSP A;  1C54 A;  1HYF A;  1UCL A;  3WHO A;  2F4Y A;  3KCH A;  1GOV A;  1TRQ A;  1GMP A;  1RGA A;  2AAD A;  2ZA4 A;  1BU4 A;  4HAA A;  1I0X A;  4GHO A;  1LRA A;  2KF4 A;  5RNT A;  1I2F A;  1BNR A;  1RGK A;  2KAA A;  1RGG A;  3URP A;  1RDS A;  1BAN A;  1BRI A;  1BNI A;  1GMR A;  1I0V A;  1X1W A;  1BRS A;  3D5I A;  1B21 A;  3WR2 A;  4J5G A;  1LOV A;  1RGH A;  1RSN A;  2KF5 A;  1B3S A;  1JBR A;  2RBI A;  3DH2 A;  1Q9E A;  1RN1 A;  3AHW A;  1BRJ A;  1BRG A;  9RNT A;  1BUJ A;  1UCI A;  1I3I A;  1MGR A;  1RLS A;  7GSP A;  7RNT A;  1RGE A;  1BSE A;  1I3F A;  1BSB A;  1IYY A;  3BU4 A;  1HZ1 A;  1RN4 A;  1BRN L;  1SAR A;  4RNT A;  2GSP A;  3AGO A;  1G02 A;  1FYS A;  1T2H A;  3AHS A;  1BOX A;  2AAE A;  1GMQ A;  3D5G A;  3DGY A;  6GSP A;  1JBT A;  1MGW A;  1RMS A;  1YGW A;  1A2P A;  2F5W A;  2KF6 A;  1LNI A;  1B2M A;  1RCL A;  3GSP A;  1T2I A;  1RCK A;  1GOY A;  3Q3F A;  1CH0 A;  2KF3 A;  1GOU A;  1PY3 A;  4BIR A;  1X1X A;  5BIR A;  1B27 A;  1RGC A;  1BNF A;  1TTO A;  1UCK A;  3SYU A;  1BNG A;  1DE3 A;  2BU4 A;  2RNT A;  1JBS A;  1BIR A;  3HOH A;  4J5K A;  1BVI A;  1PYL A;  1GSP A;  1B20 A;  3RNT A;  1UCJ A;  1BGS A;  1FZU A;  1AQZ A;  1LOW A;  8RNT A;  1FUS A;  1I2G A;  1I2E A;  1ZGX A;  2F5M A;  3BIR A;  1RNT A;  1B2S A;  1I70 A;  1LOY A;  1BSC A;  1AY7 A;  1BNS A;  3AGN A;  1RTU A;  2F56 A;  3A5E A;  1YVS A;  2BIR A;  1BRK A;  2C4B A;  3D4A A;  1YNV X;  5BU4 A;  1RNB A;  1B2U A;  1R4Y A;  2HOH A;  4BU4 A;  5HOH A;  1B2Z A;  2SAR A;  1BSA A;  1RGL A;  1FW7 A;  1TRP A;  1X1Y A;  1DET A;  1I8V A;  1RHL A;  4HOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...