2KF5A

Barnase bound to d(cgac), low pressure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf5A00
1BGSA 1RCLA 1RGEA 2BU4A 1RCKA 2F56A 1JBRA 4GHOA 2KAAA 3AGOA 3HOHA 1G02A 2F4YA 1DE3A 1RNBA 4RNTA 1BSEA 8RNTA 1I0XA 3D5IA 1FW7A 1BNIA 1B2SA 9RNTA 1I8VA 1X1UA 1IYYA 4HOHA 2AAEA 1MGRA 1GOVA 1BSBA 1RNTA 1YNVX 1GOYA 1X1YA 2KF4A 1LRAA 1RGLA 1HZ1A 1CH0A 1B2ZA 3DGYA 1BRGA 5GSPA 1X1WA 1FUTA 1BSCA 1BNEA 1TRQA 1BU4A 3AHWA 1GSPA 1I3FA 1RGGA 2C4BA 3SYUA 1RMSA 3WHOA 1B20A 3RNTA 1BRHA 1TRPA 1GMPA 1TTOA 3KCHA 1BNSA 2GSPA 1HYFA 1BRSA 4BIRA 1BSDA 1BNRA 1BNJA 1YVSA 1BVIA 1BNFA 1I2EA 1RGKA 1RLSA 1B3SA 1LNIA 1RHLA 1UCLA 1SARA 2KF6A 1BUJA 1GMQA 4HAAA 1I70A 6RNTA 1JBTA 1AQZA 3GSPA 1JBSA 2BIRA 2RBIA 1I0VA 7RNTA 1ZGXA 3DH2A 1GMRA 4J5GA 1B21A 4BU4A 3D5GA 5RNTA 1C54A 1PY3A 1PYLA 1B2XA 1UCIA 1X1XA 1RGAA 1RN1A 1BIRA 3BU4A 2SARA 2AADA 1RN4A 1T2HA 6GSPA 5HOHA 1FYSA 3WR2A 1MGWA 1I3IA 1BRJA 1FUSA 1B27A 1BSAA 1RDSA 1T2IA 1LOVA 1UCKA 2F5MA 3BIRA 1B2MA 1BANA 1B2UA 1LOWA 1YGWA 1BAOA 4J5KA 1DETA 3AGNA 2ZA4A 1A2PA 1R4YA 1Q9EA 1BNGA 1BOXA 1I2FA 1RGCA 1BRIA 2KF3A 3URPA 3Q3FA 5BU4A 1RTUA 2RNTA 1RGHA 1RSNA 5BIRA 1LOYA 1BRKA 1AY7A 1I2GA 2HOHA 4GSPA 1RGFA 1UCJA 2KF5A 2F5WA 1FZUA 1GOUA 7GSPA 1BRNL 3A5EA 3AHSA 3D4AA
chains in the Genus database with same CATH superfamily
3FZWA 1UI8A 2ZHXB 3HK4A 3VF1A 2IY2A 2BU4A 2XSOB 5TGNA 1GY7A 3MWZA 3LMLA 1K8A4 1VQ73 1G0TA 1YJN3 3CPOA 2OCTA 3DM8A 1KQS2 4MMYB 2BMQB 2CFGA 1IV9A 3CCJ3 1BSEA 3NV0A 1OF5B 2CW9A 1MWRA 1B2SA 1A2VA 2BT3A 1I8VA 5IF6A 1W7CA 3F9SA 4HOHA 1JRQA 2AAEA 1VQ43 1MGRA 1ZO2A 1BSBA 3M8CA 3AMOA 1JN5A 2KF4A 3B7CA 3GZBA 5HGRA 3F8XA 3LTCA 3LTDA 4MMXB 2QIYA 2GU3A 1VQN3 5M18A 3L0RA 4J8TA 3V98A 1N8QA 1M1XB 5IG5A 3WHOA 1B20A 1QAFA 1SIIA 1PU4A 3K63A 1M1K4 4N6LA 2UGIA 1EEJA 2C10A 3KCHA 2QGUA 3BNDA 4O3VA 3T0UA 1QVF2 2V1LA 1YGEA 2XGNA 4CDLA 4MJDA 3HZPA 3N8BA 3HI7A 3BLZA 3LT9A 5AIFA 5DREA 2Z76A 1NDOB 3X3ZA 2RGQA 3PGBA 4IIAA 1BVIA 3IPTA 1W2B2 2PNCA 1LQMB 4AKYA 4EYCA 1B3SA 3CCE3 3NQZA 1W02A 2KF6A 3G8ZA 2E2UA 4HAAA 3CU3A 2E2TA 5I97A 2GBWB 1O7PB 3LH4A 1AQZA 3N54B 3NBRA 5AEUB 3D79A 2RBIA 1LNHA 3S27A 1S723 5LC7A 3X3XA 1GMRA 1Q7HA 2SBLA 1OGZA 3K0ZA 2OQEC 3WA3A 1JB4A 6STDA 3NM2A 1V58A 4R9KA 1NO3A 1D6ZA 4MMZB 4N6OB 3FLJA 3G16A 3OX9A 1RGAA 3LXUX 2Z6BA 2K0MA 3BU4A 2PZVA 1IQ8A 3F14A 3NX0A 1K9M4 4FCZA 3EBYA 1ROAA 1W5ZA 3LOYA 4RNZA 6GSPA 5HOHA 1FYSA 3BB9A 4L7KA 1G96A 3GRDA 3CMA3 1K41A 4O8SA 4HM8B 1J2BA 1RDSA 2XFTA 1UCKA 3MSOA 5IG0A 3G0KA 1GY6A 3DY5A 3S29A 1BANA 1LOWA 3H51A 1RRLA 3QRDA 4R9LA 2HMKB 1FGTA 4FR9A 2ZA4A 2YX9A 1KSIA 4XDVA 3CCU3 2B1XB 2LYXA 5D83A 3DMCA 1YIJ3 1BRIA 1WMNA 2WOHA 3GZYB 4GL6A 5M19A 5BU4A 3I0YA 2W6JH 1AR0A 4X2HA 4HM6B 5AIHA 2W56A 2OQEA 3WOEB 1IT8A 4X2OA 1I2GA 1WNHA 4GSPA 3IMAB 2WGQA 1TJDA 3WDGB 1FZUA 4KT3B 5AI1A 4EW5A 1YJ93 3CD63 1HKXA 3SVAA 1LOXA 1LVNA 3AHSA 3D4AA 3EF8A 2BMOB 3PCSA 2UUGC 3EJVA 1RRHA 2H0HA 3CCR3 2BNGA 1GD4A 5D82A 1SQWA 2IUKA 5KP4A 1FGOA 1ASKA 2W0QA 1D6UA 3NV0B 4K90B 2KAAA 1YVBI 4N6UA 1E3RA 1G02A 1UUVB 2F4YA 5CXOA 1DE3A 8RNTA 3CXC2 2Q07A 9RNTA 1SJWA 1V74A 1IYYA 3QK9A 2HMLB 2IMJA 2HMJB 4IPBA 1JJ22 1YNVX 3CNMA 4ILFA 1O7WB 1LRAA 3KIIA 1CH0A 4KFDA 1B2ZA 5IERA 3DGYA 1BRGA 2E2VA 1QJGA 1X1WA 2GEYA 1JV2B 1BNEA 2Z77A 1M904 4XDWA 4HBRA 3V99A 5KP1A 3A76A 3HIIA 2ZDJA 1I3FA 2C4BA 3BNCA 5BVBA 4WP5A 3DXOA 1GYBA 1RMSA 3EQQB 4RBNA 5M1AA 3S28A 3PXMA 2QEX3 1QAKA 1IVXA 3ZG5A 4RZMA 3UL5A 3VGNA 1HYFA 1BRSA 1OUNA 1RKYA 2XH9A 3OWYA 5A0OB 3NQYA 2XSHB 4OK0A 4HM7B 3CPW2 3G713 1FUWA 3B8LA 2CH9A 1S5AA 1YVSA 1YHQ3 2JQ5A 1VQQA 3J7Yd 1BNFA 4H3UA 1RLSA 3EX9A 2QA43 3STDA 1SARA 4NHFA 5DRVA 1BUJA 2CIUA 2W9QA 4NREA 4NPBA 1OPYA 2H0GA 1I70A 2W04A 1AVLA 3JUOA 3B4OA 3Q2PA 4LSOA 3GZRA 4GB5A 3BNBA 4N6MA 1ZX2A 2BIRA 3FSDA 7RNTA 1V57A 5G2GA 1YIT3 4J5GA 1Q7Y4 5IEOA 4CJNA 2CWTA 1B2XA 1AVKA 2WOFA 3U97A 1Q864 1OHPA 4OVMA 1DVCA 4OUQA 3WODG 2L1SA 4WYKB 1RN4A 3UJMA 3CCL3 2K3DA 2STDA 4XM4A 4IT7A 4LZIA 1BSAA 2Y74A 1JKGB 2W2CA 5G1LA 2XF3A 1TFOA 2CWUA 1Q42A 1NB3I 1US1A 1B2UA 1UI7A 3F7XA 3SXXA 1UGHI 3JUNA 2ZL8A 4R80A 1Q9EA 3X41A 2OTL3 3EHCA 1DVDA 1IVWA 1QVG2 4EXRA 1JB2A 1QMAA 2KF3A 3EBTA 3URPA 3WMDA 1TU5A 1M9GA 2IA7A 2OOVA 3MYTA 2GU1A 2JDIH 3GWRA 5BIRA 1A90A 1NNVA 3CCV3 4FCMA 4LYLB 1W6GA 3SX1A 2F99A 1BRKA 1AY7A 2HOHA 4FMDA 4LMIA 4XBTA 3UNLA 1STFI 1MOLA 2CFLA 2CWVA 4FMBA 3E99A 1ULJB 4HM5B 1NU3A 1F8NA 2H0IA 3IJEB 3JVCA 1STDA 3OWUA 3CCM3 3DZLA 3FKAA 2B24B 2I9WA 4WFOA 2KXGA 3X3YA 1ISKA 3EE1A 1EQKA 2IUJA 1IU7A 3JUMA 2XR8B 3MG2A 1O7MB 4LGQA 4BL3A 2WGOA 4EV5A 2D42A 3D3LA 1W6CA 1RNBA 2UX0A 3X40A 1I0XA 3KN4A 5AYSC 1BNIA 1EG9B 2FGTA 1L5GB 3S67A 1FGRA 1N5HA 4DKIA 1VQM3 2W9PA 1DMMA 1U5OA 1ULIB 4G1MB 1GOVA 3V92A 1DMNA 1RNTA 1RJOA 3DGNA 1GOYA 4L8OA 1N5PA 1X1YA 3CC23 1VQ83 4RNYA 1WMOA 3ALAA 3LZAA 3NHXA 1C7HA 4XBYA 3K7CA 2OWPA 1W6YA 3F7SA 3CC43 1TRQA 3JUPA 1BU4A 1OF5A 2J8XB 4EC6A 1RGGA 1U8CB 4ZM8A 3SYUA 5CF2A 5ELUA 2XRXB 5AIGA 3RNTA 1MWTA 1W2ZA 1TRPA 3VSYA 1VQO3 4HYZA 2CFDA 1SIHA 1TTOA 2CFKA 2GSPA 2YFLB 4BIRA 1VQP3 5BXQA 1ROVA 3LTAA 1N9EA 1UDII 3F8HA 1EKMA 1CEWI 3RDEA 1VQK3 1BNRA 2P09A 1VQ93 2F98A 2BMRB 3CCS3 1RGKA 1I2EA 1EA2A 1R4CA 1LNIA 1AV4A 1GMQA 1OCVA 2L4VA 2HMOB 5AEWB 4BTXA 3CC73 1IQXA 4KFEA 3LT8A 1DMQA 1OGXA 2HMMB 1JBTA 3OV4A 1JBSA 1WMPA 3FG3A 4FMAA 1JB5A 1NWWA 2MF7A 1I0VA 3G4S3 4K1UA 1JNQA 3MPHA 5CK6A 4HM3B 1OHSA 3ROBA 4CCVA 3CCQ3 5RNTA 5JBSA 1GD3A 1PY3A 1PYLA 1WQLB 3FG4A 2XGLA 4HJLB 4TX4A 4K61A 3I553 1N8R4 1BIRA 1OACA 1O7NB 1RN7A 3K5TA 2K54A 2P05A 4HZ9B 3G6E3 3WR2A 5KP3A 2OTJ3 1B27A 1EUIC 1KWIA 2LQVA 1LOVA 1TP6A 3DGMA 1JKGA 2IYJA 4I4KA 4HM0B 3S5CA 2F5MA 1GS3A 3BIRA 3CME3 1E97A 1B2MA 1FA3A 3MKIA 1YGWA 5AIIA 4WYKA 1DETA 1A2PA 1R4YA 3EC9A 3N9HA 4HM2B 1BNGA 2MC8A 4H61A 1IQYA 1K28A 1RGCA 5LC6A 1OHOA 1SPUA 3KE7A 1HU9A 1WTHA 1Z1SA 1VZZA 2CK3H 4HM4B 4WWUC 4AEQA 3HX8A 3D9RA 1RGHA 1RSNA 2CG0A 3FCSB 3RGRA 5IG4A 5ELJA 3FG1A 3DGOA 3HIGA 3MG3A 1UGIA 2XEPA 3UL6A 1RGFA 1UCJA 2KF5A 3EB8A 3EN1B 4FCJA 1GOUA 4N6V0 1Y4KA 1BRNL 2M7OA 3A5EA 4MEIA 1BGSA 5IW9A 1RCLA 1RGEA 3AMOB 3NXJA 3O8YA 2F56A 1RCKA 3ZFZA 1JBRA 3PCRA 3JUQA 1GY5A 2YFJB 3EN8A 4GHOA 4QWTA 1W01A 4KFFA 3Q90A 7STDA 1QALA 3GZXB 4PEJA 3AGOA 1Q40B 2CC3A 3HOHA 4KZ1A 4AKZA 5EEOA 5CF1A 1TFKA 4RNTA 1MWSA 1UW1A 5JPUA 3KSPA 3D5IA 1FW7A 3MHEA 3I563 1IV7A 2BO9B 1X1UA 2YFIB 2RFRA 2O3OA 3SEDA 8CHOA 5JPPA 2RCDA 3H3HA 2ML6A 1K734 4U13A 1RGLA 3SLUA 1MWUA 1HZ1A 2XFSA 4EV2A 2FXTA 4Q53A 3NBJA 1TUHA 4EBGA 1UUGB 5GSPA 4HM1B 1FUTA 1BSCA 3LYGA 4N6NB 1PFPA 1LXEA 3AHWA 5D81A 1VQL3 1IT7A 1GSPA 2R4IA 2Y73A 1FGMA 1O7GB 2GXFA 3CNXA 4KVHA 5CLKA 3SOAA 1IVVA 3BNEA 4LEHA 3T8NA 1BRHA 1Q40A 5IEPA 5EVHA 3FGYA 1E3VA 2KCDA 3FF0A 3KFQC 3ER7A 1GMPA 3FF2A 3KZTA 4FMCA 4BL2A 1BNSA 1D6YA 4ORLA 4BTYA 3PYJA 1YJW3 5IENA 1T3BA 1W00A 1DYUA 2HMNB 5STDA 1BSDA 2WO0A 4K1VA 2F86B 1BUQA 1BNJA 3KKGA 4R1KA 2R41A 3FH1A 2P0MA 1RHLA 4XBXA 1UCLA 1YI23 3T8UA 2CKFB 2INXA 2P0XA 4HVNA 4JRFA 2CX0A 4O2HA 2O9UX 2W03A 2RSXA 3B4PA 4R4KA 1A2KA 2CX1A 3SOYA 6RNTA 3OXAA 1VQ53 3GSPA 2C11A 1LQGC 4I5QA 3UB1A 2W56B 1KC84 1A67A 3Q1CA 1ZGXA 4N3VA 3DH2A 2BHMA 1B21A 4L8PA 4BU4A 3D5GA 1C54A 1ZS7A 1UCIA 3DGLA 1IK3A 1X1XA 4J9AA 1RN1A 3MG1A 5FW5A 2CHCA 2AADA 2SARA 2FNQA 3DUKA 3U1WA 3NM7A 1IDPA 5AYRB 1NJI4 1T2HA 2Z7AA 1MGWA 5IG3A 1I3IA 3TDGA 1BRJA 1UUWB 1FUSA 2GEXA 3GAXA 1T2IA 3WOFB 2CFWA 4BTWA 3OW22 2D1WA 3PS8A 3PZWA 3WA2X 1NB5I 1BAOA 1CQSA 1MNLA 4J5KA 1IVUA 3AGNA 5FGOA 2ML5A 1TIJA 1BOXA 1I2FA 4JF8A 4O02B 1O7HB 1OH0A 1FGQA 2KRTA 3NBBA 3ZG0A 1CYUA 3ECFA 3KSED 3NUVA 5G1KA 1JN5B 1T5YA 3Q3FA 1RTUA 4STDA 2RNTA 3X42A 3RGAA 4HZBB 1W4NA 2CG1A 1JZOA 1LOYA 1Q814 1JZDA 2P38A 1KD14 1Q824 1VQ63 4CPKA 3LTBA 3OWSA 3F40A 1N9JA 2F5WA 3K9MC 4N6TA 4WHAA 2OOVC 2GBXB 5EQLA 7GSPA 4XB5A 1CYVA 2A15A 4HKVB
chains in the Genus database with same CATH topology
1BGSA 1RCLA 1RGEA 2BU4A 1RCKA 2F56A 1JBRA 4GHOA 2KAAA 3AGOA 3HOHA 1G02A 2F4YA 1DE3A 1RNBA 4RNTA 1BSEA 8RNTA 1I0XA 3D5IA 1FW7A 1BNIA 1B2SA 9RNTA 1I8VA 1X1UA 1IYYA 4HOHA 2AAEA 1MGRA 1GOVA 1BSBA 1RNTA 1YNVX 1GOYA 1X1YA 2KF4A 1LRAA 1RGLA 1HZ1A 1CH0A 1B2ZA 3DGYA 1BRGA 5GSPA 1X1WA 1FUTA 1BSCA 1BNEA 1TRQA 1BU4A 3AHWA 1GSPA 1I3FA 1RGGA 2C4BA 3SYUA 1RMSA 3WHOA 1B20A 3RNTA 1BRHA 1TRPA 1GMPA 1TTOA 3KCHA 1BNSA 2GSPA 1HYFA 1BRSA 4BIRA 1BSDA 1BNRA 1BNJA 1YVSA 1BVIA 1BNFA 1I2EA 1RGKA 1RLSA 1B3SA 1LNIA 1RHLA 1UCLA 1SARA 2KF6A 1BUJA 1GMQA 4HAAA 1I70A 6RNTA 1JBTA 1AQZA 3GSPA 1JBSA 2BIRA 2RBIA 1I0VA 7RNTA 1ZGXA 3DH2A 1GMRA 4J5GA 1B21A 4BU4A 3D5GA 5RNTA 1C54A 1PY3A 1PYLA 1B2XA 1UCIA 1X1XA 1RGAA 1RN1A 1BIRA 3BU4A 2SARA 2AADA 1RN4A 1T2HA 6GSPA 5HOHA 1FYSA 3WR2A 1MGWA 1I3IA 1BRJA 1FUSA 1B27A 1BSAA 1RDSA 1T2IA 1LOVA 1UCKA 2F5MA 3BIRA 1B2MA 1BANA 1B2UA 1LOWA 1YGWA 1BAOA 4J5KA 1DETA 3AGNA 2ZA4A 1A2PA 1R4YA 1Q9EA 1BNGA 1BOXA 1I2FA 1RGCA 1BRIA 2KF3A 3URPA 3Q3FA 5BU4A 1RTUA 2RNTA 1RGHA 1RSNA 5BIRA 1LOYA 1BRKA 1AY7A 1I2GA 2HOHA 4GSPA 1RGFA 1UCJA 2KF5A 2F5WA 1FZUA 1GOUA 7GSPA 1BRNL 3A5EA 3AHSA 3D4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGS A;  1RCL A;  1RGE A;  2BU4 A;  1RCK A;  2F56 A;  1JBR A;  4GHO A;  2KAA A;  3AGO A;  3HOH A;  1G02 A;  2F4Y A;  1DE3 A;  1RNB A;  4RNT A;  1BSE A;  8RNT A;  1I0X A;  3D5I A;  1FW7 A;  1BNI A;  1B2S A;  9RNT A;  1I8V A;  1X1U A;  1IYY A;  4HOH A;  2AAE A;  1MGR A;  1GOV A;  1BSB A;  1RNT A;  1YNV X;  1GOY A;  1X1Y A;  2KF4 A;  1LRA A;  1RGL A;  1HZ1 A;  1CH0 A;  1B2Z A;  3DGY A;  1BRG A;  5GSP A;  1X1W A;  1FUT A;  1BSC A;  1BNE A;  1TRQ A;  1BU4 A;  3AHW A;  1GSP A;  1I3F A;  1RGG A;  2C4B A;  3SYU A;  1RMS A;  3WHO A;  1B20 A;  3RNT A;  1BRH A;  1TRP A;  1GMP A;  1TTO A;  3KCH A;  1BNS A;  2GSP A;  1HYF A;  1BRS A;  4BIR A;  1BSD A;  1BNR A;  1BNJ A;  1YVS A;  1BVI A;  1BNF A;  1I2E A;  1RGK A;  1RLS A;  1B3S A;  1LNI A;  1RHL A;  1UCL A;  1SAR A;  2KF6 A;  1BUJ A;  1GMQ A;  4HAA A;  1I70 A;  6RNT A;  1JBT A;  1AQZ A;  3GSP A;  1JBS A;  2BIR A;  2RBI A;  1I0V A;  7RNT A;  1ZGX A;  3DH2 A;  1GMR A;  4J5G A;  1B21 A;  4BU4 A;  3D5G A;  5RNT A;  1C54 A;  1PY3 A;  1PYL A;  1B2X A;  1UCI A;  1X1X A;  1RGA A;  1RN1 A;  1BIR A;  3BU4 A;  2SAR A;  2AAD A;  1RN4 A;  1T2H A;  6GSP A;  5HOH A;  1FYS A;  3WR2 A;  1MGW A;  1I3I A;  1BRJ A;  1FUS A;  1B27 A;  1BSA A;  1RDS A;  1T2I A;  1LOV A;  1UCK A;  2F5M A;  3BIR A;  1B2M A;  1BAN A;  1B2U A;  1LOW A;  1YGW A;  1BAO A;  4J5K A;  1DET A;  3AGN A;  2ZA4 A;  1A2P A;  1R4Y A;  1Q9E A;  1BNG A;  1BOX A;  1I2F A;  1RGC A;  1BRI A;  2KF3 A;  3URP A;  3Q3F A;  5BU4 A;  1RTU A;  2RNT A;  1RGH A;  1RSN A;  5BIR A;  1LOY A;  1BRK A;  1AY7 A;  1I2G A;  2HOH A;  4GSP A;  1RGF A;  1UCJ A;  2KF5 A;  2F5W A;  1FZU A;  1GOU A;  7GSP A;  1BRN L;  3A5E A;  3AHS A;  3D4A A; 
#chains in the Genus database with same CATH topology
 3FZW A;  1UI8 A;  2ZHX B;  3HK4 A;  3VF1 A;  2IY2 A;  2BU4 A;  2XSO B;  5TGN A;  1GY7 A;  3MWZ A;  3LML A;  1K8A 4;  1VQ7 3;  1G0T A;  1YJN 3;  3CPO A;  2OCT A;  3DM8 A;  1KQS 2;  4MMY B;  2BMQ B;  2CFG A;  1IV9 A;  3CCJ 3;  1BSE A;  3NV0 A;  1OF5 B;  2CW9 A;  1MWR A;  1B2S A;  1A2V A;  2BT3 A;  1I8V A;  5IF6 A;  1W7C A;  3F9S A;  4HOH A;  1JRQ A;  2AAE A;  1VQ4 3;  1MGR A;  1ZO2 A;  1BSB A;  3M8C A;  3AMO A;  1JN5 A;  2KF4 A;  3B7C A;  3GZB A;  5HGR A;  3F8X A;  3LTC A;  3LTD A;  4MMX B;  2QIY A;  2GU3 A;  1VQN 3;  5M18 A;  3L0R A;  4J8T A;  3V98 A;  1N8Q A;  1M1X B;  5IG5 A;  3WHO A;  1B20 A;  1QAF A;  1SII A;  1PU4 A;  3K63 A;  1M1K 4;  4N6L A;  2UGI A;  1EEJ A;  2C10 A;  3KCH A;  2QGU A;  3BND A;  4O3V A;  3T0U A;  1QVF 2;  2V1L A;  1YGE A;  2XGN A;  4CDL A;  4MJD A;  3HZP A;  3N8B A;  3HI7 A;  3BLZ A;  3LT9 A;  5AIF A;  5DRE A;  2Z76 A;  1NDO B;  3X3Z A;  2RGQ A;  3PGB A;  4IIA A;  1BVI A;  3IPT A;  1W2B 2;  2PNC A;  1LQM B;  4AKY A;  4EYC A;  1B3S A;  3CCE 3;  3NQZ A;  1W02 A;  2KF6 A;  3G8Z A;  2E2U A;  4HAA A;  3CU3 A;  2E2T A;  5I97 A;  2GBW B;  1O7P B;  3LH4 A;  1AQZ A;  3N54 B;  3NBR A;  5AEU B;  3D79 A;  2RBI A;  1LNH A;  3S27 A;  1S72 3;  5LC7 A;  3X3X A;  1GMR A;  1Q7H A;  2SBL A;  1OGZ A;  3K0Z A;  2OQE C;  3WA3 A;  1JB4 A;  6STD A;  3NM2 A;  1V58 A;  4R9K A;  1NO3 A;  1D6Z A;  4MMZ B;  4N6O B;  3FLJ A;  3G16 A;  3OX9 A;  1RGA A;  3LXU X;  2Z6B A;  2K0M A;  3BU4 A;  2PZV A;  1IQ8 A;  3F14 A;  3NX0 A;  1K9M 4;  4FCZ A;  3EBY A;  1ROA A;  1W5Z A;  3LOY A;  4RNZ A;  6GSP A;  5HOH A;  1FYS A;  3BB9 A;  4L7K A;  1G96 A;  3GRD A;  3CMA 3;  1K41 A;  4O8S A;  4HM8 B;  1J2B A;  1RDS A;  2XFT A;  1UCK A;  3MSO A;  5IG0 A;  3G0K A;  1GY6 A;  3DY5 A;  3S29 A;  1BAN A;  1LOW A;  3H51 A;  1RRL A;  3QRD A;  4R9L A;  2HMK B;  1FGT A;  4FR9 A;  2ZA4 A;  2YX9 A;  1KSI A;  4XDV A;  3CCU 3;  2B1X B;  2LYX A;  5D83 A;  3DMC A;  1YIJ 3;  1BRI A;  1WMN A;  2WOH A;  3GZY B;  4GL6 A;  5M19 A;  5BU4 A;  3I0Y A;  2W6J H;  1AR0 A;  4X2H A;  4HM6 B;  5AIH A;  2W56 A;  2OQE A;  3WOE B;  1IT8 A;  4X2O A;  1I2G A;  1WNH A;  4GSP A;  3IMA B;  2WGQ A;  1TJD A;  3WDG B;  1FZU A;  4KT3 B;  5AI1 A;  4EW5 A;  1YJ9 3;  3CD6 3;  1HKX A;  3SVA A;  1LOX A;  1LVN A;  3AHS A;  3D4A A;  3EF8 A;  2BMO B;  3PCS A;  2UUG C;  3EJV A;  1RRH A;  2H0H A;  3CCR 3;  2BNG A;  1GD4 A;  5D82 A;  1SQW A;  2IUK A;  5KP4 A;  1FGO A;  1ASK A;  2W0Q A;  1D6U A;  3NV0 B;  4K90 B;  2KAA A;  1YVB I;  4N6U A;  1E3R A;  1G02 A;  1UUV B;  2F4Y A;  5CXO A;  1DE3 A;  8RNT A;  3CXC 2;  2Q07 A;  9RNT A;  1SJW A;  1V74 A;  1IYY A;  3QK9 A;  2HML B;  2IMJ A;  2HMJ B;  4IPB A;  1JJ2 2;  1YNV X;  3CNM A;  4ILF A;  1O7W B;  1LRA A;  3KII A;  1CH0 A;  4KFD A;  1B2Z A;  5IER A;  3DGY A;  1BRG A;  2E2V A;  1QJG A;  1X1W A;  2GEY A;  1JV2 B;  1BNE A;  2Z77 A;  1M90 4;  4XDW A;  4HBR A;  3V99 A;  5KP1 A;  3A76 A;  3HII A;  2ZDJ A;  1I3F A;  2C4B A;  3BNC A;  5BVB A;  4WP5 A;  3DXO A;  1GYB A;  1RMS A;  3EQQ B;  4RBN A;  5M1A A;  3S28 A;  3PXM A;  2QEX 3;  1QAK A;  1IVX A;  3ZG5 A;  4RZM A;  3UL5 A;  3VGN A;  1HYF A;  1BRS A;  1OUN A;  1RKY A;  2XH9 A;  3OWY A;  5A0O B;  3NQY A;  2XSH B;  4OK0 A;  4HM7 B;  3CPW 2;  3G71 3;  1FUW A;  3B8L A;  2CH9 A;  1S5A A;  1YVS A;  1YHQ 3;  2JQ5 A;  1VQQ A;  3J7Y d;  1BNF A;  4H3U A;  1RLS A;  3EX9 A;  2QA4 3;  3STD A;  1SAR A;  4NHF A;  5DRV A;  1BUJ A;  2CIU A;  2W9Q A;  4NRE A;  4NPB A;  1OPY A;  2H0G A;  1I70 A;  2W04 A;  1AVL A;  3JUO A;  3B4O A;  3Q2P A;  4LSO A;  3GZR A;  4GB5 A;  3BNB A;  4N6M A;  1ZX2 A;  2BIR A;  3FSD A;  7RNT A;  1V57 A;  5G2G A;  1YIT 3;  4J5G A;  1Q7Y 4;  5IEO A;  4CJN A;  2CWT A;  1B2X A;  1AVK A;  2WOF A;  3U97 A;  1Q86 4;  1OHP A;  4OVM A;  1DVC A;  4OUQ A;  3WOD G;  2L1S A;  4WYK B;  1RN4 A;  3UJM A;  3CCL 3;  2K3D A;  2STD A;  4XM4 A;  4IT7 A;  4LZI A;  1BSA A;  2Y74 A;  1JKG B;  2W2C A;  5G1L A;  2XF3 A;  1TFO A;  2CWU A;  1Q42 A;  1NB3 I;  1US1 A;  1B2U A;  1UI7 A;  3F7X A;  3SXX A;  1UGH I;  3JUN A;  2ZL8 A;  4R80 A;  1Q9E A;  3X41 A;  2OTL 3;  3EHC A;  1DVD A;  1IVW A;  1QVG 2;  4EXR A;  1JB2 A;  1QMA A;  2KF3 A;  3EBT A;  3URP A;  3WMD A;  1TU5 A;  1M9G A;  2IA7 A;  2OOV A;  3MYT A;  2GU1 A;  2JDI H;  3GWR A;  5BIR A;  1A90 A;  1NNV A;  3CCV 3;  4FCM A;  4LYL B;  1W6G A;  3SX1 A;  2F99 A;  1BRK A;  1AY7 A;  2HOH A;  4FMD A;  4LMI A;  4XBT A;  3UNL A;  1STF I;  1MOL A;  2CFL A;  2CWV A;  4FMB A;  3E99 A;  1ULJ B;  4HM5 B;  1NU3 A;  1F8N A;  2H0I A;  3IJE B;  3JVC A;  1STD A;  3OWU A;  3CCM 3;  3DZL A;  3FKA A;  2B24 B;  2I9W A;  4WFO A;  2KXG A;  3X3Y A;  1ISK A;  3EE1 A;  1EQK A;  2IUJ A;  1IU7 A;  3JUM A;  2XR8 B;  3MG2 A;  1O7M B;  4LGQ A;  4BL3 A;  2WGO A;  4EV5 A;  2D42 A;  3D3L A;  1W6C A;  1RNB A;  2UX0 A;  3X40 A;  1I0X A;  3KN4 A;  5AYS C;  1BNI A;  1EG9 B;  2FGT A;  1L5G B;  3S67 A;  1FGR A;  1N5H A;  4DKI A;  1VQM 3;  2W9P A;  1DMM A;  1U5O A;  1ULI B;  4G1M B;  1GOV A;  3V92 A;  1DMN A;  1RNT A;  1RJO A;  3DGN A;  1GOY A;  4L8O A;  1N5P A;  1X1Y A;  3CC2 3;  1VQ8 3;  4RNY A;  1WMO A;  3ALA A;  3LZA A;  3NHX A;  1C7H A;  4XBY A;  3K7C A;  2OWP A;  1W6Y A;  3F7S A;  3CC4 3;  1TRQ A;  3JUP A;  1BU4 A;  1OF5 A;  2J8X B;  4EC6 A;  1RGG A;  1U8C B;  4ZM8 A;  3SYU A;  5CF2 A;  5ELU A;  2XRX B;  5AIG A;  3RNT A;  1MWT A;  1W2Z A;  1TRP A;  3VSY A;  1VQO 3;  4HYZ A;  2CFD A;  1SIH A;  1TTO A;  2CFK A;  2GSP A;  2YFL B;  4BIR A;  1VQP 3;  5BXQ A;  1ROV A;  3LTA A;  1N9E A;  1UDI I;  3F8H A;  1EKM A;  1CEW I;  3RDE A;  1VQK 3;  1BNR A;  2P09 A;  1VQ9 3;  2F98 A;  2BMR B;  3CCS 3;  1RGK A;  1I2E A;  1EA2 A;  1R4C A;  1LNI A;  1AV4 A;  1GMQ A;  1OCV A;  2L4V A;  2HMO B;  5AEW B;  4BTX A;  3CC7 3;  1IQX A;  4KFE A;  3LT8 A;  1DMQ A;  1OGX A;  2HMM B;  1JBT A;  3OV4 A;  1JBS A;  1WMP A;  3FG3 A;  4FMA A;  1JB5 A;  1NWW A;  2MF7 A;  1I0V A;  3G4S 3;  4K1U A;  1JNQ A;  3MPH A;  5CK6 A;  4HM3 B;  1OHS A;  3ROB A;  4CCV A;  3CCQ 3;  5RNT A;  5JBS A;  1GD3 A;  1PY3 A;  1PYL A;  1WQL B;  3FG4 A;  2XGL A;  4HJL B;  4TX4 A;  4K61 A;  3I55 3;  1N8R 4;  1BIR A;  1OAC A;  1O7N B;  1RN7 A;  3K5T A;  2K54 A;  2P05 A;  4HZ9 B;  3G6E 3;  3WR2 A;  5KP3 A;  2OTJ 3;  1B27 A;  1EUI C;  1KWI A;  2LQV A;  1LOV A;  1TP6 A;  3DGM A;  1JKG A;  2IYJ A;  4I4K A;  4HM0 B;  3S5C A;  2F5M A;  1GS3 A;  3BIR A;  3CME 3;  1E97 A;  1B2M A;  1FA3 A;  3MKI A;  1YGW A;  5AII A;  4WYK A;  1DET A;  1A2P A;  1R4Y A;  3EC9 A;  3N9H A;  4HM2 B;  1BNG A;  2MC8 A;  4H61 A;  1IQY A;  1K28 A;  1RGC A;  5LC6 A;  1OHO A;  1SPU A;  3KE7 A;  1HU9 A;  1WTH A;  1Z1S A;  1VZZ A;  2CK3 H;  4HM4 B;  4WWU C;  4AEQ A;  3HX8 A;  3D9R A;  1RGH A;  1RSN A;  2CG0 A;  3FCS B;  3RGR A;  5IG4 A;  5ELJ A;  3FG1 A;  3DGO A;  3HIG A;  3MG3 A;  1UGI A;  2XEP A;  3UL6 A;  1RGF A;  1UCJ A;  2KF5 A;  3EB8 A;  3EN1 B;  4FCJ A;  1GOU A;  4N6V 0;  1Y4K A;  1BRN L;  2M7O A;  3A5E A;  4MEI A;  1BGS A;  5IW9 A;  1RCL A;  1RGE A;  3AMO B;  3NXJ A;  3O8Y A;  2F56 A;  1RCK A;  3ZFZ A;  1JBR A;  3PCR A;  3JUQ A;  1GY5 A;  2YFJ B;  3EN8 A;  4GHO A;  4QWT A;  1W01 A;  4KFF A;  3Q90 A;  7STD A;  1QAL A;  3GZX B;  4PEJ A;  3AGO A;  1Q40 B;  2CC3 A;  3HOH A;  4KZ1 A;  4AKZ A;  5EEO A;  5CF1 A;  1TFK A;  4RNT A;  1MWS A;  1UW1 A;  5JPU A;  3KSP A;  3D5I A;  1FW7 A;  3MHE A;  3I56 3;  1IV7 A;  2BO9 B;  1X1U A;  2YFI B;  2RFR A;  2O3O A;  3SED A;  8CHO A;  5JPP A;  2RCD A;  3H3H A;  2ML6 A;  1K73 4;  4U13 A;  1RGL A;  3SLU A;  1MWU A;  1HZ1 A;  2XFS A;  4EV2 A;  2FXT A;  4Q53 A;  3NBJ A;  1TUH A;  4EBG A;  1UUG B;  5GSP A;  4HM1 B;  1FUT A;  1BSC A;  3LYG A;  4N6N B;  1PFP A;  1LXE A;  3AHW A;  5D81 A;  1VQL 3;  1IT7 A;  1GSP A;  2R4I A;  2Y73 A;  1FGM A;  1O7G B;  2GXF A;  3CNX A;  4KVH A;  5CLK A;  3SOA A;  1IVV A;  3BNE A;  4LEH A;  3T8N A;  1BRH A;  1Q40 A;  5IEP A;  5EVH A;  3FGY A;  1E3V A;  2KCD A;  3FF0 A;  3KFQ C;  3ER7 A;  1GMP A;  3FF2 A;  3KZT A;  4FMC A;  4BL2 A;  1BNS A;  1D6Y A;  4ORL A;  4BTY A;  3PYJ A;  1YJW 3;  5IEN A;  1T3B A;  1W00 A;  1DYU A;  2HMN B;  5STD A;  1BSD A;  2WO0 A;  4K1V A;  2F86 B;  1BUQ A;  1BNJ A;  3KKG A;  4R1K A;  2R41 A;  3FH1 A;  2P0M A;  1RHL A;  4XBX A;  1UCL A;  1YI2 3;  3T8U A;  2CKF B;  2INX A;  2P0X A;  4HVN A;  4JRF A;  2CX0 A;  4O2H A;  2O9U X;  2W03 A;  2RSX A;  3B4P A;  4R4K A;  1A2K A;  2CX1 A;  3SOY A;  6RNT A;  3OXA A;  1VQ5 3;  3GSP A;  2C11 A;  1LQG C;  4I5Q A;  3UB1 A;  2W56 B;  1KC8 4;  1A67 A;  3Q1C A;  1ZGX A;  4N3V A;  3DH2 A;  2BHM A;  1B21 A;  4L8P A;  4BU4 A;  3D5G A;  1C54 A;  1ZS7 A;  1UCI A;  3DGL A;  1IK3 A;  1X1X A;  4J9A A;  1RN1 A;  3MG1 A;  5FW5 A;  2CHC A;  2AAD A;  2SAR A;  2FNQ A;  3DUK A;  3U1W A;  3NM7 A;  1IDP A;  5AYR B;  1NJI 4;  1T2H A;  2Z7A A;  1MGW A;  5IG3 A;  1I3I A;  3TDG A;  1BRJ A;  1UUW B;  1FUS A;  2GEX A;  3GAX A;  1T2I A;  3WOF B;  2CFW A;  4BTW A;  3OW2 2;  2D1W A;  3PS8 A;  3PZW A;  3WA2 X;  1NB5 I;  1BAO A;  1CQS A;  1MNL A;  4J5K A;  1IVU A;  3AGN A;  5FGO A;  2ML5 A;  1TIJ A;  1BOX A;  1I2F A;  4JF8 A;  4O02 B;  1O7H B;  1OH0 A;  1FGQ A;  2KRT A;  3NBB A;  3ZG0 A;  1CYU A;  3ECF A;  3KSE D;  3NUV A;  5G1K A;  1JN5 B;  1T5Y A;  3Q3F A;  1RTU A;  4STD A;  2RNT A;  3X42 A;  3RGA A;  4HZB B;  1W4N A;  2CG1 A;  1JZO A;  1LOY A;  1Q81 4;  1JZD A;  2P38 A;  1KD1 4;  1Q82 4;  1VQ6 3;  4CPK A;  3LTB A;  3OWS A;  3F40 A;  1N9J A;  2F5W A;  3K9M C;  4N6T A;  4WHA A;  2OOV C;  2GBX B;  5EQL A;  7GSP A;  4XB5 A;  1CYV A;  2A15 A;  4HKV B; 
#chains in the Genus database with same CATH homology
 1BGS A;  1RCL A;  1RGE A;  2BU4 A;  1RCK A;  2F56 A;  1JBR A;  4GHO A;  2KAA A;  3AGO A;  3HOH A;  1G02 A;  2F4Y A;  1DE3 A;  1RNB A;  4RNT A;  1BSE A;  8RNT A;  1I0X A;  3D5I A;  1FW7 A;  1BNI A;  1B2S A;  9RNT A;  1I8V A;  1X1U A;  1IYY A;  4HOH A;  2AAE A;  1MGR A;  1GOV A;  1BSB A;  1RNT A;  1YNV X;  1GOY A;  1X1Y A;  2KF4 A;  1LRA A;  1RGL A;  1HZ1 A;  1CH0 A;  1B2Z A;  3DGY A;  1BRG A;  5GSP A;  1X1W A;  1FUT A;  1BSC A;  1BNE A;  1TRQ A;  1BU4 A;  3AHW A;  1GSP A;  1I3F A;  1RGG A;  2C4B A;  3SYU A;  1RMS A;  3WHO A;  1B20 A;  3RNT A;  1BRH A;  1TRP A;  1GMP A;  1TTO A;  3KCH A;  1BNS A;  2GSP A;  1HYF A;  1BRS A;  4BIR A;  1BSD A;  1BNR A;  1BNJ A;  1YVS A;  1BVI A;  1BNF A;  1I2E A;  1RGK A;  1RLS A;  1B3S A;  1LNI A;  1RHL A;  1UCL A;  1SAR A;  2KF6 A;  1BUJ A;  1GMQ A;  4HAA A;  1I70 A;  6RNT A;  1JBT A;  1AQZ A;  3GSP A;  1JBS A;  2BIR A;  2RBI A;  1I0V A;  7RNT A;  1ZGX A;  3DH2 A;  1GMR A;  4J5G A;  1B21 A;  4BU4 A;  3D5G A;  5RNT A;  1C54 A;  1PY3 A;  1PYL A;  1B2X A;  1UCI A;  1X1X A;  1RGA A;  1RN1 A;  1BIR A;  3BU4 A;  2SAR A;  2AAD A;  1RN4 A;  1T2H A;  6GSP A;  5HOH A;  1FYS A;  3WR2 A;  1MGW A;  1I3I A;  1BRJ A;  1FUS A;  1B27 A;  1BSA A;  1RDS A;  1T2I A;  1LOV A;  1UCK A;  2F5M A;  3BIR A;  1B2M A;  1BAN A;  1B2U A;  1LOW A;  1YGW A;  1BAO A;  4J5K A;  1DET A;  3AGN A;  2ZA4 A;  1A2P A;  1R4Y A;  1Q9E A;  1BNG A;  1BOX A;  1I2F A;  1RGC A;  1BRI A;  2KF3 A;  3URP A;  3Q3F A;  5BU4 A;  1RTU A;  2RNT A;  1RGH A;  1RSN A;  5BIR A;  1LOY A;  1BRK A;  1AY7 A;  1I2G A;  2HOH A;  4GSP A;  1RGF A;  1UCJ A;  2KF5 A;  2F5W A;  1FZU A;  1GOU A;  7GSP A;  1BRN L;  3A5E A;  3AHS A;  3D4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...