2KF5A

Barnase bound to d(cgac), low pressure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf5A00
2BU4A 5GSPA 1TRPA 3AHWA 1YGWA 1A2PA 1RCKA 1LOVA 3URPA 8RNTA 1BSDA 1YNVX 3AHSA 9RNTA 1B3SA 1AY7A 7GSPA 2C4BA 1DETA 1BRGA 5BU4A 1LNIA 2AAEA 1C54A 2RBIA 2F5WA 1I2GA 4GSPA 1GMQA 1BAOA 1I0VA 2KF4A 1UCJA 1BNEA 1RGFA 1AQZA 1YVSA 1BSEA 3SYUA 1GMRA 1I3FA 3AGOA 1HZ1A 1HYFA 2SARA 3BIRA 3AGNA 3Q3FA 1MGRA 1BSCA 1G02A 1RGKA 2GSPA 2KF3A 1RGAA 1RDSA 1X1XA 1UCKA 1X1WA 2KF6A 6RNTA 3A5EA 3DH2A 1ZGXA 1BSAA 1FW7A 1FYSA 1BOXA 1BNGA 1BSBA 1BU4A 1RGLA 3HOHA 1GMPA 1GOUA 3D4AA 1T2HA 3DGYA 1BGSA 4GHOA 4J5KA 4BU4A 2KAAA 5HOHA 3D5IA 1RGHA 2BIRA 1BNJA 1B27A 1Q9EA 3D5GA 1BRHA 1LOWA 1PY3A 1UCLA 1B2XA 3BU4A 1LOYA 2RNTA 1I8VA 5BIRA 1R4YA 4J5GA 1BRSA 1BRNL 1I2FA 1BVIA 1BNIA 1RLSA 1RCLA 1DE3A 1RN4A 1LRAA 1BRJA 6GSPA 1BRIA 4BIRA 1B2MA 1GOYA 1TRQA 1BNSA 4HOHA 1X1YA 1JBSA 1RNTA 1I70A 1B2UA 1B21A 1FUTA 1RHLA 1JBRA 1IYYA 2AADA 2KF5A 1BRKA 1X1UA 1RGCA 1RGGA 1RGEA 1RSNA 1BNRA 1I2EA 1MGWA 1I0XA 1BANA 1TTOA 2F4YA 3WHOA 1T2IA 1B2SA 1GSPA 1B20A 1CH0A 2F5MA 3KCHA 1B2ZA 1BNFA 1JBTA 5RNTA 3GSPA 1UCIA 1BUJA 4HAAA 1BIRA 1FUSA 1RTUA 1RMSA 2ZA4A 1RN1A 2F56A 1I3IA 1RNBA 4RNTA 1FZUA 2HOHA 3WR2A 1SARA 1GOVA 1PYLA 7RNTA 3RNTA
chains in the Genus database with same CATH superfamily
1TRPA 1DVDA 2XF3A 1A2PA 1LOVA 2BNGA 1IVWA 2H0GA 3FZWA 4JF8A 3S5CA 3URPA 1BSDA 3CCL3 1YNVX 4R9LA 2CG1A 2BHMA 3DGNA 3ECFA 4LMIA 1KQS2 1B3SA 1JJ22 4OUQA 1YVBI 4HM5B 2E2TA 2F86B 1WMNA 1LNIA 1MWSA 1C54A 2F98A 2P09A 4GSPA 1ULJB 2GBXB 5AYSC 1SIIA 1US1A 1W6GA 1VQ93 3SYUA 1NU3A 1RN7A 1VZZA 1YGEA 3GZBA 2INXA 3BIRA 2QEX3 1JKGB 3Q3FA 2CFLA 1EUIC 1BSCA 1G02A 1RGKA 2GSPA 2ZL8A 1VQ63 1N5PA 1RGAA 3DXOA 1KD14 3LTDA 3X40A 2STDA 1ASKA 3A5EA 1HU9A 4MMZB 1JNQA 1R4CA 1BSAA 2W9QA 3FLJA 3CD63 1AV4A 1FYSA 4RNYA 4MJDA 2LQVA 1BU4A 1V58A 4RNZA 4RBNA 3K9MC 4JRFA 2F99A 3SXXA 4J5KA 2E2VA 3MSOA 1VQN3 1Q824 1WTHA 2IYJA 3FG4A 2Z6BA 1IV7A 4N6V0 1ROAA 3D5IA 3G8ZA 1M1K4 3X3YA 2WOFA 1LVNA 2O3OA 3IPTA 2OQEA 5G1LA 1PY3A 1UUGB 1UCLA 5I97A 3FH1A 1B2XA 1STDA 3OW22 3LT8A 1LOYA 3KE7A 5IF6A 5BIRA 3NBBA 5IG5A 1DVCA 3FG3A 2HMOB 2P38A 1DMMA 4K61A 1HKXA 1OHSA 2OOVA 1IU7A 2CFGA 3EN1B 4FCJA 4IPBA 1KC84 1BVIA 1BRNL 1CYVA 1U5OA 1Q864 3RGAA 4STDA 2W56A 3LZAA 3PS8A 1L5GB 1K734 1IVVA 1W01A 4N6LA 3PCRA 3TDGA 2CFWA 4KFFA 1EEJA 3WOFB 6GSPA 3CC23 3O8YA 5M18A 3SLUA 1OGZA 4MEIA 1W2B2 1RRHA 1B2MA 5HGRA 8CHOA 1JBSA 3EBTA 1QVG2 3MPHA 1RNTA 3CCE3 1KWIA 1QMAA 3I0YA 3NQZA 4HM0B 4J9AA 4O02B 1T3BA 1RHLA 4FMCA 2CK3H 3CPOA 3T0UA 2KF5A 4R4KA 3S29A 1MWRA 3H51A 3LTAA 3HIGA 1BNRA 1I2EA 1MGWA 1TFOA 1V57A 3F8HA 2OQEC 5LC7A 3CC43 3Q1CA 4N6UA 3WHOA 1T2IA 5AIFA 3K7CA 1TFKA 1YI23 2Y73A 2BMOB 3F8XA 1B2ZA 5D83A 1OGXA 5RNTA 1JZDA 3FCSB 2OOVC 3GSPA 5DRVA 1J2BA 4HM3B 1YIJ3 2I9WA 2ML5A 1BIRA 3B4OA 4HM1B 3BNDA 1RMSA 3F7SA 1DMQA 1RJOA 3BNEA 3EX9A 1I3IA 4HZ9B 5JPPA 4FMBA 1JB5A 2L4VA 4XB5A 2BU4A 3FG1A 1W02A 3AHWA 2XH9A 4L8PA 1JN5B 3WA3A 3CMA3 2OWPA 8RNTA 1YJN3 1JRQA 1OF5A 3AHSA 9RNTA 5AEWB 2K54A 1LOXA 3NUVA 1FUWA 2P0MA 2E2UA 1DETA 4KVHA 3X3XA 5BU4A 4DKIA 2AAEA 1VQO3 1O7PB 3G713 2F5WA 3JUMA 3D9RA 1GMQA 1F8NA 1SPUA 4R1KA 1UCJA 3D3LA 4WFOA 3GWRA 4X2OA 2XEPA 3K5TA 1YHQ3 3AGOA 1W2ZA 3PGBA 2MC8A 3RDEA 2KF3A 1N9JA 4FCZA 3DUKA 3L0RA 3LXUX 2KF6A 4EXRA 6RNTA 3DH2A 3AMOB 1TIJA 2LYXA 5BVBA 1BNGA 2XFTA 3D4AA 3EHCA 2XSHB 4G1MB 3MWZA 4GHOA 1O7GB 4HZBB 2KRTA 5KP3A 3SVAA 1VQ53 3UJMA 4FMDA 5HOHA 1O7HB 2M7OA 2W9PA 1OPYA 1LNHA 3D79A 1W7CA 1OACA 4K1VA 4EYCA 3D5GA 1A2KA 1E3RA 1Q7HA 4KT3B 3DZLA 4LGQA 3E99A 1WNHA 4KZ1A 5CF1A 4CPKA 3V98A 2OTL3 1ZS7A 3HK4A 2R4IA 3NV0A 4LYLB 2RNTA 1I8VA 3NBJA 4J5GA 4CCVA 2MF7A 2P0XA 1K28A 2C10A 2GU3A 1IVUA 1ZO2A 1OHPA 1WMPA 1VQK3 4HYZA 2ML6A 3WODG 1GY7A 1K9M4 4WHAA 1A67A 3F7XA 1MWUA 1BNIA 1RLSA 1U8CB 2YFLB 3CXC2 4NPBA 1G0TA 3SOAA 3MYTA 3N9HA 1CQSA 1BRIA 3V92A 1Q40B 2H0IA 4ZM8A 1GD4A 2D1WA 2W04A 3QK9A 1O7WB 1X1YA 3M8CA 4U13A 3T8UA 3WOEB 1B21A 1W6CA 3JUNA 3PYJA 5AIHA 3KKGA 2XSOB 4ILFA 1EQKA 2B24B 2J8XB 1IQ8A 1FA3A 3WDGB 1BRKA 5TGNA 3LOYA 1RGCA 1RGGA 3N54B 1RGEA 2K3DA 3WMDA 4QWTA 2CX0A 4EBGA 1Q814 3GZRA 1ZX2A 4J8TA 1NWWA 4CDLA 2CG0A 3GZYB 3GRDA 5IG4A 1IV9A 4TX4A 3AMOA 2CFDA 3J7Yd 2CW9A 2XGLA 3DMCA 4X2HA 2SBLA 4H3UA 3STDA 1JBTA 2ZDJA 1N9EA 4O3VA 1S723 1BUJA 5ELUA 3BNBA 2YX9A 1FGTA 1RTUA 1LQGC 7STDA 4HM2B 1W00A 1Z1SA 2ZA4A 3UL5A 2UUGC 1RN1A 3G6E3 1QJGA 1ISKA 3CCS3 2QGUA 2HOHA 4XBYA 1GY6A 1QALA 1SARA 3UL6A 7RNTA 4N6OB 3PZWA 1PU4A 5GSPA 1WQLB 3SEDA 1JKGA 3CC73 3CU3A 1VQM3 1CYUA 1N5HA 2Q07A 1VQ83 1IQYA 5IEOA 3ER7A 1FGRA 3DGLA 1AY7A 5D82A 7GSPA 2Z77A 1JZOA 5FGOA 2B1XB 4FCMA 2W0QA 2RBIA 5KP4A 1BAOA 1I0VA 2KF4A 3HX8A 5KP1A 2RCDA 4LEHA 1STFI 4WWUC 1UI8A 3NM2A 1ROVA 3EN8A 1YVSA 3H3HA 2HMKB 1YJW3 2BO9B 2W03A 1OHOA 1WMOA 4N6TA 1Q7Y4 3AGNA 3JVCA 1MGRA 4HM6B 1RDSA 3ALAA 1X1WA 3EB8A 2IUJA 4I5QA 1UGHI 2BMQB 1ZGXA 3F40A 3VGNA 3CCR3 1Y4KA 3LH4A 1BOXA 3FSDA 1OH0A 4XDWA 1BSBA 1O7NB 4AEQA 1MOLA 1GMPA 2A15A 2C11A 4EC6A 3DGOA 1T2HA 2R41A 4EV2A 1BGSA 4BU4A 3EQQB 5M19A 2GBWB 1BNJA 1B27A 4AKZA 5IG3A 5FW5A 3CME3 1Q9EA 4K90B 3CCQ3 1BRHA 1TP6A 4N6NB 2CWVA 4H61A 4PEJA 1LOWA 4KFEA 3I553 3VSYA 3CCJ3 1S5AA 1NB5I 3OWSA 5IEPA 3BU4A 3X41A 5BXQA 2JDIH 4BTYA 3OXAA 2OCTA 1IT7A 3DY5A 3NHXA 1R4YA 4HKVB 3FGYA 4BL2A 2XFSA 1JB2A 3VF1A 2CC3A 2Z7AA 3IMAB 5LC6A 1YJ93 3KSED 3G0KA 5A0OB 1RCLA 1DE3A 1FGMA 3U97A 1LRAA 3CCV3 1VQL3 4BIRA 4LZIA 1TRQA 1AVKA 1IQXA 1IVXA 4R9KA 1BNSA 1E3VA 3F9SA 4HOHA 5AIIA 4GL6A 3MG2A 3F14A 1GS3A 1OUNA 2KCDA 1UUWB 4WP5A 5AIGA 1RRLA 1FUTA 1W6YA 1MNLA 2WOHA 2Z76A 2AADA 3FF0A 4R80A 1JBRA 4OVMA 1TU5A 1TJDA 3X42A 1NO3A 3LTCA 2O9UX 3OWUA 5IERA 2WGOA 3KIIA 3OX9A 2W56B 4AKYA 1VQ43 2F4YA 3GAXA 2YFJB 1M9GA 2RGQA 1JN5A 1C7HA 4LSOA 1B2SA 2Y74A 3FKAA 4OK0A 1FGOA 1B20A 1CH0A 4L7KA 2XRXB 1W4NA 3KCHA 5CK6A 2OTJ3 1EA2A 4GB5A 3LMLA 3JUPA 3G4S3 5CXOA 1UCIA 2RSXA 1D6ZA 2CH9A 3MG1A 4XBXA 4HAAA 5M1AA 4BTWA 3MHEA 3ROBA 5G2GA 1VQ73 2F56A 3BNCA 4BTXA 3IJEB 1E97A 2WO0A 3ZG5A 1RNBA 1FZUA 1DYUA 5AEUB 1UGIA 2HMNB 4XDVA 5AI1A 3KSPA 1QAKA 2PZVA 3EC9A 3RNTA 1OCVA 1YGWA 1RCKA 1UUVB 3NM7A 3B8LA 4CJNA 4O8SA 2BMRB 1BUQA 5JBSA 1EKMA 1AR0A 5IG0A 2C4BA 4XBTA 1PFPA 3T8NA 3UB1A 5D81A 1BRGA 3ZG0A 2CX1A 3HIIA 2JQ5A 1VQP3 1I2GA 4NREA 2GEYA 5JPUA 1GYBA 4HM7B 2CKFB 1AVLA 1BNEA 1RGFA 1AQZA 4HJLB 2W6JH 4WYKB 4XM4A 1BSEA 3KFQC 3K0ZA 1GMRA 4MMXB 1I3FA 5G1KA 4Q53A 3S28A 1HZ1A 1HYFA 2SARA 2L1SA 3HZPA 5EQLA 1QAFA 3LT9A 3B4PA 2HMMB 1JB4A 1OF5B 1X1XA 1UCKA 3U1WA 5IW9A 1M1XB 1SIHA 4FMAA 3SX1A 2BT3A 4L8OA 2K0MA 1O7MB 3S67A 1FW7A 2QA43 3FF2A 1EG9B 2H0HA 1T5YA 3RGRA 3CNXA 1RGLA 3LYGA 3HOHA 1FGQA 1GOUA 2CWTA 1CEWI 3BB9A 4N3VA 5DREA 1SQWA 3DGYA 1V74A 3EF8A 1ULIB 1NDOB 2RFRA 1YIT3 1A90A 2CHCA 3MKIA 2KAAA 3G16A 3NX0A 3WA2X 1RGHA 2BIRA 3ZFZA 2D42A 1IDPA 3JUOA 3EE1A 3B7CA 1Q40A 4I4KA 3V99A 1RKYA 4NHFA 3DGMA 5EEOA 2CIUA 3JUQA 4HBRA 1NJI4 1N8QA 2FXTA 2IMJA 3N8BA 4HM4B 1NB3I 1QVF2 1UW1A 3NQYA 3GZXB 2CWUA 3KN4A 3BLZA 1GY5A 3SOYA 1BRSA 1I2FA 5EVHA 4K1UA 1JV2B 1W5ZA 2HMLB 1RN4A 5AYRB 2FGTA 5IENA 1K41A 1BRJA 4IIAA 1GD3A 3I563 1UDII 1MWTA 3A76A 4MMYB 1GOYA 5ELJA 2QIYA 3Q2PA 3S27A 2IUKA 2WGQA 2W2CA 1VQQA 2ZHXB 1LXEA 1D6YA 1I70A 3EBYA 3KZTA 1B2UA 3NV0B 3CCM3 4WYKA 3UNLA 5CLKA 2P05A 2KXGA 3EJVA 3PCSA 5STDA 1IYYA 1LQMB 4O2HA 3Q90A 4FR9A 1X1UA 2V1LA 1IT8A 1RSNA 3QRDA 4EV5A 3OV4A 1TUHA 2CFKA 1NNVA 1I0XA 2IY2A 2XGNA 1BANA 1TTOA 3CNMA 2PNCA 3NXJA 4RZMA 4BL3A 1Q42A 3DM8A 1IK3A 1N8R4 1GSPA 2GU1A 2F5MA 4KFDA 3CCU3 4N6MA 4EW5A 2YFIB 1KSIA 1UI7A 2IA7A 3LTBA 3NBRA 1BNFA 3PXMA 4HM8B 1K8A4 1M904 1G96A 4HVNA 2GEXA 2FNQA 1A2VA 1FUSA 3OWYA 2GXFA 1DMNA 3X3ZA 2UGIA 3K63A 3CPW2 2UX0A 5CF2A 3HI7A 6STDA 4RNTA 1SJWA 2HMJB 4IT7A 4ORLA 3WR2A 1D6UA 1GOVA 1PYLA 2XR8B 3MG3A
chains in the Genus database with same CATH topology
2BU4A 5GSPA 1TRPA 3AHWA 1YGWA 1A2PA 1RCKA 1LOVA 3URPA 8RNTA 1BSDA 1YNVX 3AHSA 9RNTA 1B3SA 1AY7A 7GSPA 2C4BA 1DETA 1BRGA 5BU4A 1LNIA 2AAEA 1C54A 2RBIA 2F5WA 1I2GA 4GSPA 1GMQA 1BAOA 1I0VA 2KF4A 1UCJA 1BNEA 1RGFA 1AQZA 1YVSA 1BSEA 3SYUA 1GMRA 1I3FA 3AGOA 1HZ1A 1HYFA 2SARA 3BIRA 3AGNA 3Q3FA 1MGRA 1BSCA 1G02A 1RGKA 2GSPA 2KF3A 1RGAA 1RDSA 1X1XA 1UCKA 1X1WA 2KF6A 6RNTA 3A5EA 3DH2A 1ZGXA 1BSAA 1FW7A 1FYSA 1BOXA 1BNGA 1BSBA 1BU4A 1RGLA 3HOHA 1GMPA 1GOUA 3D4AA 1T2HA 3DGYA 1BGSA 4GHOA 4J5KA 4BU4A 2KAAA 5HOHA 3D5IA 1RGHA 2BIRA 1BNJA 1B27A 1Q9EA 3D5GA 1BRHA 1LOWA 1PY3A 1UCLA 1B2XA 3BU4A 1LOYA 2RNTA 1I8VA 5BIRA 1R4YA 4J5GA 1BRSA 1BRNL 1I2FA 1BVIA 1BNIA 1RLSA 1RCLA 1DE3A 1RN4A 1LRAA 1BRJA 6GSPA 1BRIA 4BIRA 1B2MA 1GOYA 1TRQA 1BNSA 4HOHA 1X1YA 1JBSA 1RNTA 1I70A 1B2UA 1B21A 1FUTA 1RHLA 1JBRA 1IYYA 2AADA 2KF5A 1BRKA 1X1UA 1RGCA 1RGGA 1RGEA 1RSNA 1BNRA 1I2EA 1MGWA 1I0XA 1BANA 1TTOA 2F4YA 3WHOA 1T2IA 1B2SA 1GSPA 1B20A 1CH0A 2F5MA 3KCHA 1B2ZA 1BNFA 1JBTA 5RNTA 3GSPA 1UCIA 1BUJA 4HAAA 1BIRA 1FUSA 1RTUA 1RMSA 2ZA4A 1RN1A 2F56A 1I3IA 1RNBA 4RNTA 1FZUA 2HOHA 3WR2A 1SARA 1GOVA 1PYLA 7RNTA 3RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU4 A;  5GSP A;  1TRP A;  3AHW A;  1YGW A;  1A2P A;  1RCK A;  1LOV A;  3URP A;  8RNT A;  1BSD A;  1YNV X;  3AHS A;  9RNT A;  1B3S A;  1AY7 A;  7GSP A;  2C4B A;  1DET A;  1BRG A;  5BU4 A;  1LNI A;  2AAE A;  1C54 A;  2RBI A;  2F5W A;  1I2G A;  4GSP A;  1GMQ A;  1BAO A;  1I0V A;  2KF4 A;  1UCJ A;  1BNE A;  1RGF A;  1AQZ A;  1YVS A;  1BSE A;  3SYU A;  1GMR A;  1I3F A;  3AGO A;  1HZ1 A;  1HYF A;  2SAR A;  3BIR A;  3AGN A;  3Q3F A;  1MGR A;  1BSC A;  1G02 A;  1RGK A;  2GSP A;  2KF3 A;  1RGA A;  1RDS A;  1X1X A;  1UCK A;  1X1W A;  2KF6 A;  6RNT A;  3A5E A;  3DH2 A;  1ZGX A;  1BSA A;  1FW7 A;  1FYS A;  1BOX A;  1BNG A;  1BSB A;  1BU4 A;  1RGL A;  3HOH A;  1GMP A;  1GOU A;  3D4A A;  1T2H A;  3DGY A;  1BGS A;  4GHO A;  4J5K A;  4BU4 A;  2KAA A;  5HOH A;  3D5I A;  1RGH A;  2BIR A;  1BNJ A;  1B27 A;  1Q9E A;  3D5G A;  1BRH A;  1LOW A;  1PY3 A;  1UCL A;  1B2X A;  3BU4 A;  1LOY A;  2RNT A;  1I8V A;  5BIR A;  1R4Y A;  4J5G A;  1BRS A;  1BRN L;  1I2F A;  1BVI A;  1BNI A;  1RLS A;  1RCL A;  1DE3 A;  1RN4 A;  1LRA A;  1BRJ A;  6GSP A;  1BRI A;  4BIR A;  1B2M A;  1GOY A;  1TRQ A;  1BNS A;  4HOH A;  1X1Y A;  1JBS A;  1RNT A;  1I70 A;  1B2U A;  1B21 A;  1FUT A;  1RHL A;  1JBR A;  1IYY A;  2AAD A;  2KF5 A;  1BRK A;  1X1U A;  1RGC A;  1RGG A;  1RGE A;  1RSN A;  1BNR A;  1I2E A;  1MGW A;  1I0X A;  1BAN A;  1TTO A;  2F4Y A;  3WHO A;  1T2I A;  1B2S A;  1GSP A;  1B20 A;  1CH0 A;  2F5M A;  3KCH A;  1B2Z A;  1BNF A;  1JBT A;  5RNT A;  3GSP A;  1UCI A;  1BUJ A;  4HAA A;  1BIR A;  1FUS A;  1RTU A;  1RMS A;  2ZA4 A;  1RN1 A;  2F56 A;  1I3I A;  1RNB A;  4RNT A;  1FZU A;  2HOH A;  3WR2 A;  1SAR A;  1GOV A;  1PYL A;  7RNT A;  3RNT A; 
#chains in the Genus database with same CATH topology
 1TRP A;  1DVD A;  2XF3 A;  1A2P A;  1LOV A;  2BNG A;  1IVW A;  2H0G A;  3FZW A;  4JF8 A;  3S5C A;  3URP A;  1BSD A;  3CCL 3;  1YNV X;  4R9L A;  2CG1 A;  2BHM A;  3DGN A;  3ECF A;  4LMI A;  1KQS 2;  1B3S A;  1JJ2 2;  4OUQ A;  1YVB I;  4HM5 B;  2E2T A;  2F86 B;  1WMN A;  1LNI A;  1MWS A;  1C54 A;  2F98 A;  2P09 A;  4GSP A;  1ULJ B;  2GBX B;  5AYS C;  1SII A;  1US1 A;  1W6G A;  1VQ9 3;  3SYU A;  1NU3 A;  1RN7 A;  1VZZ A;  1YGE A;  3GZB A;  2INX A;  3BIR A;  2QEX 3;  1JKG B;  3Q3F A;  2CFL A;  1EUI C;  1BSC A;  1G02 A;  1RGK A;  2GSP A;  2ZL8 A;  1VQ6 3;  1N5P A;  1RGA A;  3DXO A;  1KD1 4;  3LTD A;  3X40 A;  2STD A;  1ASK A;  3A5E A;  1HU9 A;  4MMZ B;  1JNQ A;  1R4C A;  1BSA A;  2W9Q A;  3FLJ A;  3CD6 3;  1AV4 A;  1FYS A;  4RNY A;  4MJD A;  2LQV A;  1BU4 A;  1V58 A;  4RNZ A;  4RBN A;  3K9M C;  4JRF A;  2F99 A;  3SXX A;  4J5K A;  2E2V A;  3MSO A;  1VQN 3;  1Q82 4;  1WTH A;  2IYJ A;  3FG4 A;  2Z6B A;  1IV7 A;  4N6V 0;  1ROA A;  3D5I A;  3G8Z A;  1M1K 4;  3X3Y A;  2WOF A;  1LVN A;  2O3O A;  3IPT A;  2OQE A;  5G1L A;  1PY3 A;  1UUG B;  1UCL A;  5I97 A;  3FH1 A;  1B2X A;  1STD A;  3OW2 2;  3LT8 A;  1LOY A;  3KE7 A;  5IF6 A;  5BIR A;  3NBB A;  5IG5 A;  1DVC A;  3FG3 A;  2HMO B;  2P38 A;  1DMM A;  4K61 A;  1HKX A;  1OHS A;  2OOV A;  1IU7 A;  2CFG A;  3EN1 B;  4FCJ A;  4IPB A;  1KC8 4;  1BVI A;  1BRN L;  1CYV A;  1U5O A;  1Q86 4;  3RGA A;  4STD A;  2W56 A;  3LZA A;  3PS8 A;  1L5G B;  1K73 4;  1IVV A;  1W01 A;  4N6L A;  3PCR A;  3TDG A;  2CFW A;  4KFF A;  1EEJ A;  3WOF B;  6GSP A;  3CC2 3;  3O8Y A;  5M18 A;  3SLU A;  1OGZ A;  4MEI A;  1W2B 2;  1RRH A;  1B2M A;  5HGR A;  8CHO A;  1JBS A;  3EBT A;  1QVG 2;  3MPH A;  1RNT A;  3CCE 3;  1KWI A;  1QMA A;  3I0Y A;  3NQZ A;  4HM0 B;  4J9A A;  4O02 B;  1T3B A;  1RHL A;  4FMC A;  2CK3 H;  3CPO A;  3T0U A;  2KF5 A;  4R4K A;  3S29 A;  1MWR A;  3H51 A;  3LTA A;  3HIG A;  1BNR A;  1I2E A;  1MGW A;  1TFO A;  1V57 A;  3F8H A;  2OQE C;  5LC7 A;  3CC4 3;  3Q1C A;  4N6U A;  3WHO A;  1T2I A;  5AIF A;  3K7C A;  1TFK A;  1YI2 3;  2Y73 A;  2BMO B;  3F8X A;  1B2Z A;  5D83 A;  1OGX A;  5RNT A;  1JZD A;  3FCS B;  2OOV C;  3GSP A;  5DRV A;  1J2B A;  4HM3 B;  1YIJ 3;  2I9W A;  2ML5 A;  1BIR A;  3B4O A;  4HM1 B;  3BND A;  1RMS A;  3F7S A;  1DMQ A;  1RJO A;  3BNE A;  3EX9 A;  1I3I A;  4HZ9 B;  5JPP A;  4FMB A;  1JB5 A;  2L4V A;  4XB5 A;  2BU4 A;  3FG1 A;  1W02 A;  3AHW A;  2XH9 A;  4L8P A;  1JN5 B;  3WA3 A;  3CMA 3;  2OWP A;  8RNT A;  1YJN 3;  1JRQ A;  1OF5 A;  3AHS A;  9RNT A;  5AEW B;  2K54 A;  1LOX A;  3NUV A;  1FUW A;  2P0M A;  2E2U A;  1DET A;  4KVH A;  3X3X A;  5BU4 A;  4DKI A;  2AAE A;  1VQO 3;  1O7P B;  3G71 3;  2F5W A;  3JUM A;  3D9R A;  1GMQ A;  1F8N A;  1SPU A;  4R1K A;  1UCJ A;  3D3L A;  4WFO A;  3GWR A;  4X2O A;  2XEP A;  3K5T A;  1YHQ 3;  3AGO A;  1W2Z A;  3PGB A;  2MC8 A;  3RDE A;  2KF3 A;  1N9J A;  4FCZ A;  3DUK A;  3L0R A;  3LXU X;  2KF6 A;  4EXR A;  6RNT A;  3DH2 A;  3AMO B;  1TIJ A;  2LYX A;  5BVB A;  1BNG A;  2XFT A;  3D4A A;  3EHC A;  2XSH B;  4G1M B;  3MWZ A;  4GHO A;  1O7G B;  4HZB B;  2KRT A;  5KP3 A;  3SVA A;  1VQ5 3;  3UJM A;  4FMD A;  5HOH A;  1O7H B;  2M7O A;  2W9P A;  1OPY A;  1LNH A;  3D79 A;  1W7C A;  1OAC A;  4K1V A;  4EYC A;  3D5G A;  1A2K A;  1E3R A;  1Q7H A;  4KT3 B;  3DZL A;  4LGQ A;  3E99 A;  1WNH A;  4KZ1 A;  5CF1 A;  4CPK A;  3V98 A;  2OTL 3;  1ZS7 A;  3HK4 A;  2R4I A;  3NV0 A;  4LYL B;  2RNT A;  1I8V A;  3NBJ A;  4J5G A;  4CCV A;  2MF7 A;  2P0X A;  1K28 A;  2C10 A;  2GU3 A;  1IVU A;  1ZO2 A;  1OHP A;  1WMP A;  1VQK 3;  4HYZ A;  2ML6 A;  3WOD G;  1GY7 A;  1K9M 4;  4WHA A;  1A67 A;  3F7X A;  1MWU A;  1BNI A;  1RLS A;  1U8C B;  2YFL B;  3CXC 2;  4NPB A;  1G0T A;  3SOA A;  3MYT A;  3N9H A;  1CQS A;  1BRI A;  3V92 A;  1Q40 B;  2H0I A;  4ZM8 A;  1GD4 A;  2D1W A;  2W04 A;  3QK9 A;  1O7W B;  1X1Y A;  3M8C A;  4U13 A;  3T8U A;  3WOE B;  1B21 A;  1W6C A;  3JUN A;  3PYJ A;  5AIH A;  3KKG A;  2XSO B;  4ILF A;  1EQK A;  2B24 B;  2J8X B;  1IQ8 A;  1FA3 A;  3WDG B;  1BRK A;  5TGN A;  3LOY A;  1RGC A;  1RGG A;  3N54 B;  1RGE A;  2K3D A;  3WMD A;  4QWT A;  2CX0 A;  4EBG A;  1Q81 4;  3GZR A;  1ZX2 A;  4J8T A;  1NWW A;  4CDL A;  2CG0 A;  3GZY B;  3GRD A;  5IG4 A;  1IV9 A;  4TX4 A;  3AMO A;  2CFD A;  3J7Y d;  2CW9 A;  2XGL A;  3DMC A;  4X2H A;  2SBL A;  4H3U A;  3STD A;  1JBT A;  2ZDJ A;  1N9E A;  4O3V A;  1S72 3;  1BUJ A;  5ELU A;  3BNB A;  2YX9 A;  1FGT A;  1RTU A;  1LQG C;  7STD A;  4HM2 B;  1W00 A;  1Z1S A;  2ZA4 A;  3UL5 A;  2UUG C;  1RN1 A;  3G6E 3;  1QJG A;  1ISK A;  3CCS 3;  2QGU A;  2HOH A;  4XBY A;  1GY6 A;  1QAL A;  1SAR A;  3UL6 A;  7RNT A;  4N6O B;  3PZW A;  1PU4 A;  5GSP A;  1WQL B;  3SED A;  1JKG A;  3CC7 3;  3CU3 A;  1VQM 3;  1CYU A;  1N5H A;  2Q07 A;  1VQ8 3;  1IQY A;  5IEO A;  3ER7 A;  1FGR A;  3DGL A;  1AY7 A;  5D82 A;  7GSP A;  2Z77 A;  1JZO A;  5FGO A;  2B1X B;  4FCM A;  2W0Q A;  2RBI A;  5KP4 A;  1BAO A;  1I0V A;  2KF4 A;  3HX8 A;  5KP1 A;  2RCD A;  4LEH A;  1STF I;  4WWU C;  1UI8 A;  3NM2 A;  1ROV A;  3EN8 A;  1YVS A;  3H3H A;  2HMK B;  1YJW 3;  2BO9 B;  2W03 A;  1OHO A;  1WMO A;  4N6T A;  1Q7Y 4;  3AGN A;  3JVC A;  1MGR A;  4HM6 B;  1RDS A;  3ALA A;  1X1W A;  3EB8 A;  2IUJ A;  4I5Q A;  1UGH I;  2BMQ B;  1ZGX A;  3F40 A;  3VGN A;  3CCR 3;  1Y4K A;  3LH4 A;  1BOX A;  3FSD A;  1OH0 A;  4XDW A;  1BSB A;  1O7N B;  4AEQ A;  1MOL A;  1GMP A;  2A15 A;  2C11 A;  4EC6 A;  3DGO A;  1T2H A;  2R41 A;  4EV2 A;  1BGS A;  4BU4 A;  3EQQ B;  5M19 A;  2GBW B;  1BNJ A;  1B27 A;  4AKZ A;  5IG3 A;  5FW5 A;  3CME 3;  1Q9E A;  4K90 B;  3CCQ 3;  1BRH A;  1TP6 A;  4N6N B;  2CWV A;  4H61 A;  4PEJ A;  1LOW A;  4KFE A;  3I55 3;  3VSY A;  3CCJ 3;  1S5A A;  1NB5 I;  3OWS A;  5IEP A;  3BU4 A;  3X41 A;  5BXQ A;  2JDI H;  4BTY A;  3OXA A;  2OCT A;  1IT7 A;  3DY5 A;  3NHX A;  1R4Y A;  4HKV B;  3FGY A;  4BL2 A;  2XFS A;  1JB2 A;  3VF1 A;  2CC3 A;  2Z7A A;  3IMA B;  5LC6 A;  1YJ9 3;  3KSE D;  3G0K A;  5A0O B;  1RCL A;  1DE3 A;  1FGM A;  3U97 A;  1LRA A;  3CCV 3;  1VQL 3;  4BIR A;  4LZI A;  1TRQ A;  1AVK A;  1IQX A;  1IVX A;  4R9K A;  1BNS A;  1E3V A;  3F9S A;  4HOH A;  5AII A;  4GL6 A;  3MG2 A;  3F14 A;  1GS3 A;  1OUN A;  2KCD A;  1UUW B;  4WP5 A;  5AIG A;  1RRL A;  1FUT A;  1W6Y A;  1MNL A;  2WOH A;  2Z76 A;  2AAD A;  3FF0 A;  4R80 A;  1JBR A;  4OVM A;  1TU5 A;  1TJD A;  3X42 A;  1NO3 A;  3LTC A;  2O9U X;  3OWU A;  5IER A;  2WGO A;  3KII A;  3OX9 A;  2W56 B;  4AKY A;  1VQ4 3;  2F4Y A;  3GAX A;  2YFJ B;  1M9G A;  2RGQ A;  1JN5 A;  1C7H A;  4LSO A;  1B2S A;  2Y74 A;  3FKA A;  4OK0 A;  1FGO A;  1B20 A;  1CH0 A;  4L7K A;  2XRX B;  1W4N A;  3KCH A;  5CK6 A;  2OTJ 3;  1EA2 A;  4GB5 A;  3LML A;  3JUP A;  3G4S 3;  5CXO A;  1UCI A;  2RSX A;  1D6Z A;  2CH9 A;  3MG1 A;  4XBX A;  4HAA A;  5M1A A;  4BTW A;  3MHE A;  3ROB A;  5G2G A;  1VQ7 3;  2F56 A;  3BNC A;  4BTX A;  3IJE B;  1E97 A;  2WO0 A;  3ZG5 A;  1RNB A;  1FZU A;  1DYU A;  5AEU B;  1UGI A;  2HMN B;  4XDV A;  5AI1 A;  3KSP A;  1QAK A;  2PZV A;  3EC9 A;  3RNT A;  1OCV A;  1YGW A;  1RCK A;  1UUV B;  3NM7 A;  3B8L A;  4CJN A;  4O8S A;  2BMR B;  1BUQ A;  5JBS A;  1EKM A;  1AR0 A;  5IG0 A;  2C4B A;  4XBT A;  1PFP A;  3T8N A;  3UB1 A;  5D81 A;  1BRG A;  3ZG0 A;  2CX1 A;  3HII A;  2JQ5 A;  1VQP 3;  1I2G A;  4NRE A;  2GEY A;  5JPU A;  1GYB A;  4HM7 B;  2CKF B;  1AVL A;  1BNE A;  1RGF A;  1AQZ A;  4HJL B;  2W6J H;  4WYK B;  4XM4 A;  1BSE A;  3KFQ C;  3K0Z A;  1GMR A;  4MMX B;  1I3F A;  5G1K A;  4Q53 A;  3S28 A;  1HZ1 A;  1HYF A;  2SAR A;  2L1S A;  3HZP A;  5EQL A;  1QAF A;  3LT9 A;  3B4P A;  2HMM B;  1JB4 A;  1OF5 B;  1X1X A;  1UCK A;  3U1W A;  5IW9 A;  1M1X B;  1SIH A;  4FMA A;  3SX1 A;  2BT3 A;  4L8O A;  2K0M A;  1O7M B;  3S67 A;  1FW7 A;  2QA4 3;  3FF2 A;  1EG9 B;  2H0H A;  1T5Y A;  3RGR A;  3CNX A;  1RGL A;  3LYG A;  3HOH A;  1FGQ A;  1GOU A;  2CWT A;  1CEW I;  3BB9 A;  4N3V A;  5DRE A;  1SQW A;  3DGY A;  1V74 A;  3EF8 A;  1ULI B;  1NDO B;  2RFR A;  1YIT 3;  1A90 A;  2CHC A;  3MKI A;  2KAA A;  3G16 A;  3NX0 A;  3WA2 X;  1RGH A;  2BIR A;  3ZFZ A;  2D42 A;  1IDP A;  3JUO A;  3EE1 A;  3B7C A;  1Q40 A;  4I4K A;  3V99 A;  1RKY A;  4NHF A;  3DGM A;  5EEO A;  2CIU A;  3JUQ A;  4HBR A;  1NJI 4;  1N8Q A;  2FXT A;  2IMJ A;  3N8B A;  4HM4 B;  1NB3 I;  1QVF 2;  1UW1 A;  3NQY A;  3GZX B;  2CWU A;  3KN4 A;  3BLZ A;  1GY5 A;  3SOY A;  1BRS A;  1I2F A;  5EVH A;  4K1U A;  1JV2 B;  1W5Z A;  2HML B;  1RN4 A;  5AYR B;  2FGT A;  5IEN A;  1K41 A;  1BRJ A;  4IIA A;  1GD3 A;  3I56 3;  1UDI I;  1MWT A;  3A76 A;  4MMY B;  1GOY A;  5ELJ A;  2QIY A;  3Q2P A;  3S27 A;  2IUK A;  2WGQ A;  2W2C A;  1VQQ A;  2ZHX B;  1LXE A;  1D6Y A;  1I70 A;  3EBY A;  3KZT A;  1B2U A;  3NV0 B;  3CCM 3;  4WYK A;  3UNL A;  5CLK A;  2P05 A;  2KXG A;  3EJV A;  3PCS A;  5STD A;  1IYY A;  1LQM B;  4O2H A;  3Q90 A;  4FR9 A;  1X1U A;  2V1L A;  1IT8 A;  1RSN A;  3QRD A;  4EV5 A;  3OV4 A;  1TUH A;  2CFK A;  1NNV A;  1I0X A;  2IY2 A;  2XGN A;  1BAN A;  1TTO A;  3CNM A;  2PNC A;  3NXJ A;  4RZM A;  4BL3 A;  1Q42 A;  3DM8 A;  1IK3 A;  1N8R 4;  1GSP A;  2GU1 A;  2F5M A;  4KFD A;  3CCU 3;  4N6M A;  4EW5 A;  2YFI B;  1KSI A;  1UI7 A;  2IA7 A;  3LTB A;  3NBR A;  1BNF A;  3PXM A;  4HM8 B;  1K8A 4;  1M90 4;  1G96 A;  4HVN A;  2GEX A;  2FNQ A;  1A2V A;  1FUS A;  3OWY A;  2GXF A;  1DMN A;  3X3Z A;  2UGI A;  3K63 A;  3CPW 2;  2UX0 A;  5CF2 A;  3HI7 A;  6STD A;  4RNT A;  1SJW A;  2HMJ B;  4IT7 A;  4ORL A;  3WR2 A;  1D6U A;  1GOV A;  1PYL A;  2XR8 B;  3MG3 A; 
#chains in the Genus database with same CATH homology
 2BU4 A;  5GSP A;  1TRP A;  3AHW A;  1YGW A;  1A2P A;  1RCK A;  1LOV A;  3URP A;  8RNT A;  1BSD A;  1YNV X;  3AHS A;  9RNT A;  1B3S A;  1AY7 A;  7GSP A;  2C4B A;  1DET A;  1BRG A;  5BU4 A;  1LNI A;  2AAE A;  1C54 A;  2RBI A;  2F5W A;  1I2G A;  4GSP A;  1GMQ A;  1BAO A;  1I0V A;  2KF4 A;  1UCJ A;  1BNE A;  1RGF A;  1AQZ A;  1YVS A;  1BSE A;  3SYU A;  1GMR A;  1I3F A;  3AGO A;  1HZ1 A;  1HYF A;  2SAR A;  3BIR A;  3AGN A;  3Q3F A;  1MGR A;  1BSC A;  1G02 A;  1RGK A;  2GSP A;  2KF3 A;  1RGA A;  1RDS A;  1X1X A;  1UCK A;  1X1W A;  2KF6 A;  6RNT A;  3A5E A;  3DH2 A;  1ZGX A;  1BSA A;  1FW7 A;  1FYS A;  1BOX A;  1BNG A;  1BSB A;  1BU4 A;  1RGL A;  3HOH A;  1GMP A;  1GOU A;  3D4A A;  1T2H A;  3DGY A;  1BGS A;  4GHO A;  4J5K A;  4BU4 A;  2KAA A;  5HOH A;  3D5I A;  1RGH A;  2BIR A;  1BNJ A;  1B27 A;  1Q9E A;  3D5G A;  1BRH A;  1LOW A;  1PY3 A;  1UCL A;  1B2X A;  3BU4 A;  1LOY A;  2RNT A;  1I8V A;  5BIR A;  1R4Y A;  4J5G A;  1BRS A;  1BRN L;  1I2F A;  1BVI A;  1BNI A;  1RLS A;  1RCL A;  1DE3 A;  1RN4 A;  1LRA A;  1BRJ A;  6GSP A;  1BRI A;  4BIR A;  1B2M A;  1GOY A;  1TRQ A;  1BNS A;  4HOH A;  1X1Y A;  1JBS A;  1RNT A;  1I70 A;  1B2U A;  1B21 A;  1FUT A;  1RHL A;  1JBR A;  1IYY A;  2AAD A;  2KF5 A;  1BRK A;  1X1U A;  1RGC A;  1RGG A;  1RGE A;  1RSN A;  1BNR A;  1I2E A;  1MGW A;  1I0X A;  1BAN A;  1TTO A;  2F4Y A;  3WHO A;  1T2I A;  1B2S A;  1GSP A;  1B20 A;  1CH0 A;  2F5M A;  3KCH A;  1B2Z A;  1BNF A;  1JBT A;  5RNT A;  3GSP A;  1UCI A;  1BUJ A;  4HAA A;  1BIR A;  1FUS A;  1RTU A;  1RMS A;  2ZA4 A;  1RN1 A;  2F56 A;  1I3I A;  1RNB A;  4RNT A;  1FZU A;  2HOH A;  3WR2 A;  1SAR A;  1GOV A;  1PYL A;  7RNT A;  3RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...