2KF5A

Barnase bound to d(cgac), low pressure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
molecule keywords Ribonuclease
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf5A00
1X1WA 1BRNL 1BNFA 3SYUA 1T2IA 1YNVX 1BVIA 1B2MA 1FUTA 2KF6A 1BNEA 2F56A 3KCHA 1UCKA 3AGNA 1JBRA 1GSPA 1RGFA 2BU4A 4BU4A 1B2ZA 1GOUA 2F4YA 1RGKA 1RGLA 1AY7A 4BIRA 1RCKA 1B2UA 3AHWA 3RNTA 4GSPA 1RTUA 1I3FA 1T2HA 1ZGXA 4HOHA 1I2EA 3BIRA 3D5GA 2ZA4A 1BRGA 1AQZA 2KF4A 1I2GA 1BSDA 2C4BA 1BNRA 1I0VA 9RNTA 1BSCA 1X1YA 2HOHA 2KAAA 1PY3A 1RGAA 1A2PA 1RGGA 4GHOA 1R4YA 1CH0A 3A5EA 1MGWA 6GSPA 1B21A 1HZ1A 1GMPA 1C54A 1BANA 4J5KA 1BNJA 2AADA 5RNTA 1JBSA 4HAAA 1GOVA 1DETA 5BU4A 1BRKA 1B3SA 1BSAA 1I70A 4RNTA 1RDSA 1FZUA 2F5WA 2RBIA 7GSPA 1UCLA 1BUJA 1BSEA 1X1UA 1GMRA 3Q3FA 3D4AA 5HOHA 1RN4A 3D5IA 2RNTA 1PYLA 1LOWA 1HYFA 3WHOA 2SARA 4J5GA 1RMSA 1BSBA 1I3IA 5GSPA 1G02A 1UCJA 1BRIA 1B2SA 1RGHA 2KF3A 1YGWA 1YVSA 1JBTA 1SARA 3AHSA 1BRHA 1GMQA 1B27A 1RGEA 1B2XA 3DH2A 3HOHA 1DE3A 8RNTA 7RNTA 1RNBA 1LNIA 1BU4A 1TTOA 2AAEA 1RCLA 1BAOA 1BRSA 2KF5A 1LRAA 1LOVA 1I2FA 3BU4A 1BNIA 3DGYA 1BRJA 6RNTA 1MGRA 1BIRA 1RHLA 1BNGA 1LOYA 1RNTA 1IYYA 1FUSA 3GSPA 1I0XA 1GOYA 1BNSA 1BGSA 1Q9EA 1B20A 2BIRA 2F5MA 3AGOA 3WR2A 5BIRA 1TRQA 1BOXA 1I8VA 1RN1A 1UCIA 3URPA 1RSNA 2GSPA 1FW7A 1TRPA 1RGCA 1X1XA 1FYSA 1RLSA
chains in the Genus database with same CATH superfamily
2OTJ3 2E2VA 1X1WA 2CFDA 3X3ZA 3CXC2 3I0YA 5IF6A 4BTYA 5TGNA 2YFLB 3SYUA 3ALAA 3CPW2 4HKVB 2W9PA 1YNVX 4J8TA 2CFLA 3NX0A 4LEHA 1BNEA 1ROAA 3OWUA 1Q7HA 4IPBA 1VQQA 1MWSA 3X42A 1RGFA 5IERA 3H51A 2OOVC 1JN5A 5M1AA 2IUJA 4IT7A 1D6UA 3MG1A 1KSIA 1RGKA 1FGQA 3OX9A 2W2CA 1AY7A 1EEJA 1US1A 3BLZA 1ZGXA 3DGNA 4HOHA 1NJI4 4WWUC 3CC43 1BRGA 1AQZA 2KF4A 3JUPA 3MSOA 2KRTA 3DY5A 1E3RA 3H3HA 3OWSA 2XSOB 1STDA 3MKIA 3ROBA 2YX9A 1X1YA 3HX8A 1W2ZA 1PY3A 3IPTA 1UGHI 2HMKB 2BMRB 2E2UA 1EKMA 2CX0A 3K7CA 4GHOA 1YJW3 1W6YA 4CCVA 1CH0A 2D42A 4G1MB 4HYZA 4I4KA 4EBGA 1Y4KA 1VQL3 2YFJB 2IMJA 3NHXA 2WOHA 4KFDA 1EUIC 1GMPA 1C54A 1LXEA 2CC3A 1O7PB 1UI8A 3ER7A 3DXOA 4ILFA 4EW5A 6STDA 2Z6BA 2AADA 1IT8A 5FW5A 1ZO2A 1W6GA 1GOVA 2W56A 3U97A 2Y73A 2CFKA 1QVG2 2ML6A 1VQ93 1VZZA 4XB5A 5DRVA 3K0ZA 1FZUA 7GSPA 2QIYA 1VQ63 1KWIA 2WGOA 2CG0A 1QALA 1UCLA 3AMOB 1BSEA 1PFPA 1IDPA 1OPYA 3MWZA 3OWYA 1Q824 5HOHA 4N6V0 1RN4A 3AMOA 1JKGA 2YFIB 3WHOA 3BNBA 5LC6A 2SARA 1GY7A 1RMSA 1OHPA 3PZWA 1ULIB 1CEWI 1ROVA 1ULJB 1LOXA 1C7HA 1FGMA 2Y74A 1W4NA 2LQVA 4OK0A 3OV4A 4HM8B 1WNHA 2RGQA 3EX9A 3BNEA 1GMQA 4EV5A 2FNQA 3DH2A 3HOHA 2WGQA 1RJOA 1SIIA 4HM0B 1O7HB 1OACA 3CPOA 1DMNA 4HM6B 1U5OA 2AAEA 3G16A 2CWVA 1UUWB 1W00A 1AV4A 2JQ5A 4HZ9B 3JUOA 5AEWB 4KFEA 5AIFA 3T8NA 1UUVB 3Q90A 1BRJA 2H0HA 2Z76A 1DVDA 1FGOA 2Z77A 1NO3A 1RHLA 2ZHXB 1LOYA 3GZXB 3MHEA 1GOYA 2GBWB 2HMLB 1Q9EA 1B20A 1W02A 2BIRA 3NBBA 1JRQA 3VGNA 1QAFA 4MEIA 1TRQA 1BOXA 3HK4A 1RN1A 3FLJA 4NHFA 3CCU3 2CFGA 1IVVA 1O7MB 4GL6A 5AIGA 3A76A 3GAXA 1BRNL 4OVMA 4HM3B 1J2BA 3UJMA 1GYBA 1BVIA 4L8PA 4EYCA 1B2MA 1FUTA 3FKAA 2F56A 3KCHA 5D83A 3DUKA 1GSPA 3DGOA 4JF8A 4BU4A 1TFKA 4WYKB 1B2ZA 3KZTA 4EV2A 4R80A 2F4YA 1RGLA 3EQQB 4BIRA 1K734 1CYVA 1RCKA 3AHWA 3ZG0A 1T2HA 3UL5A 3TDGA 5M19A 3CC73 1I2EA 2P0MA 4R4KA 3D5GA 4WP5A 5LC7A 2W6JH 2W03A 4FR9A 1N8QA 3CCS3 4HM2B 1MNLA 3CME3 1WQLB 3WDGB 5AI1A 3D9RA 3CCJ3 3K9MC 1NB5I 9RNTA 1PU4A 4O2HA 1BSCA 3M8CA 4NREA 4WHAA 4FMCA 5JPPA 1JZOA 4N6UA 4WYKA 1RKYA 1Q814 2UGIA 3EN8A 3F8XA 3NXJA 2MF7A 4O3VA 1K28A 1OHSA 1RGGA 1EQKA 3N8BA 5EEOA 2BMOB 2I9WA 1YI23 1ISKA 2HMNB 1FA3A 4CJNA 2CH9A 4ORLA 7STDA 2PNCA 3MG2A 5IW9A 1AR0A 1JB2A 4L8OA 5IG4A 3EBYA 3S29A 3QRDA 3NBRA 3JUNA 2B24B 2K3DA 4QWTA 1BANA 1VQK3 3PS8A 3GZYB 1BNJA 3DM8A 5G1KA 3UNLA 3J7Yd 2P09A 1DETA 2O9UX 1B3SA 2XGNA 2P05A 3B8LA 3NM7A 4H3UA 2XRXB 4MMXB 4MMYB 3EBTA 2F5WA 1IK3A 1VQ43 3CC23 3KFQC 2E2TA 4EC6A 5IG0A 2P0XA 4TX4A 5A0OB 3DMCA 4K1UA 1GMRA 3Q3FA 2H0IA 2L4VA 2BMQB 1YHQ3 1N5PA 1M904 2RNTA 3ECFA 3HIIA 1YVBI 2C10A 3FGYA 3IJEB 1BSBA 1G02A 1UCJA 2HMOB 1B2SA 4KZ1A 3SOAA 3U1WA 3KE7A 1YJN3 3CU3A 1QJGA 1UDII 1BRHA 1B27A 3WA3A 1DE3A 3EJVA 4I5QA 1RNBA 1LNIA 5STDA 3LTAA 3B4OA 5DREA 2ZDJA 3FG3A 1RCLA 1BAOA 1DYUA 1OHOA 4FCMA 3BU4A 2GU1A 1I2FA 1LQGC 1ZS7A 2B1XB 3DGYA 3MYTA 1D6ZA 1Q42A 3Q1CA 2CK3H 2CHCA 1BIRA 1BNGA 2CFWA 4HVNA 2A15A 4IIAA 1U8CB 1BNSA 1RN7A 3LXUX 1AVLA 2F5MA 1R4CA 3VSYA 1UW1A 1WTHA 5KP1A 2WOFA 5CF2A 4JRFA 2GSPA 3CCL3 3PXMA 1FW7A 1NU3A 3EE1A 2CWUA 1RGCA 5CXOA 4XBTA 3LTDA 3RGAA 1W6CA 1JB5A 3N9HA 3O8YA 3CCV3 1T5YA 3PGBA 3CCE3 2CIUA 3S67A 4EXRA 5KP4A 3G6E3 1ZX2A 4N6MA 3JUMA 1T2IA 4HJLB 1UI7A 3CNMA 2W9QA 1TP6A 5D82A 1UCKA 1FUWA 4O02B 1RRLA 3AGNA 2OCTA 2BU4A 4HBRA 1QVF2 1A67A 1IV9A 3LMLA 1JZDA 4AKZA 3GRDA 1B2UA 1GD4A 1E3VA 2UUGC 3LZAA 1RTUA 5EVHA 3RNTA 3WMDA 2CG1A 1N8R4 2QGUA 3UB1A 5IEPA 1Q40B 2OQEA 2ZA4A 1F8NA 3IMAB 1S723 5AYRB 1V58A 3SEDA 4FMDA 3FG1A 3L0RA 1I2GA 1WMOA 3V98A 1TU5A 4XM4A 5FGOA 1M1K4 2C4BA 1KD14 5AIIA 3KSED 1I0VA 3BNCA 2BT3A 4LMIA 1MOLA 4FMAA 2HOHA 1IQYA 4CPKA 3B4PA 1OGXA 3PCSA 4R1KA 5CF1A 1RGAA 2M7OA 3DGLA 1UUGB 4R9KA 4MJDA 1OGZA 3SXXA 1YIT3 1R4YA 1TJDA 1JV2B 3A5EA 1MGWA 3WOEB 1FGRA 2C11A 4GB5A 1HZ1A 5KP3A 4HM7B 3NQZA 4OUQA 5JBSA 3I563 4O8SA 4FMBA 4J5KA 3NBJA 3BB9A 3PYJA 4BTXA 1EG9B 1NB3I 3LH4A 3SVAA 1JBSA 3G8ZA 3KSPA 5BU4A 1I70A 1IVUA 1V74A 2LYXA 1G0TA 3GZRA 1HU9A 3F40A 2RBIA 3S5CA 1IQ8A 1G96A 5IG5A 4HM1B 4X2OA 3LYGA 3MPHA 1BUJA 5IENA 1X1UA 2HMJB 4N3VA 5BVBA 2K54A 3B7CA 3KKGA 1QMAA 1A2KA 3D5IA 3PCRA 1PYLA 4HM5B 4STDA 1AVKA 5AYSC 4L7KA 4LSOA 3HI7A 4J5GA 3K5TA 4Q53A 3G4S3 1D6YA 1I3IA 5GSPA 1LVNA 8CHOA 4MMZB 1RGHA 4N6NB 2XSHB 1VQ53 1DVCA 4RZMA 1STFI 1YGWA 1YIJ3 3SX1A 1TFOA 1A2VA 2F86B 3LTBA 1JBTA 2R41A 3AHSA 3EN1B 3BNDA 2OOVA 1O7GB 1SQWA 3EF8A 1B2XA 5IEOA 1JKGB 8RNTA 4XDVA 2IA7A 4KVHA 1A90A 2BNGA 2RFRA 3F14A 4KT3B 1Z1SA 1M1XB 1RRHA 4BL3A 2F99A 1BRSA 3CNXA 1GS3A 2IYJA 1Q7Y4 3SLUA 1BNIA 6RNTA 3F9SA 1LQMB 3WOFB 2FXTA 1DMMA 1MGRA 5AEUB 3X3XA 2IY2A 3VF1A 1IYYA 1JN5B 1FUSA 3GSPA 1I0XA 1L5GB 2L1SA 2XH9A 5CK6A 4ZM8A 4PEJA 2JDIH 3D3LA 3AGOA 2CX1A 3WR2A 1UCIA 1I8VA 2J8XB 3URPA 2CKFB 1RSNA 1VQ83 1OF5A 2W04A 1TRPA 2CW9A 3E99A 3LOYA 1RLSA 1S5AA 1CQSA 3KIIA 3S27A 1BNFA 4RNYA 5ELJA 3OW22 1VQM3 1Q864 1V57A 4NPBA 3V92A 1VQN3 1M9GA 1SPUA 3G713 1JNQA 5ELUA 3T0UA 4BTWA 4H61A 1IVXA 2KF6A 2ZL8A 3LT8A 3KN4A 1VQP3 1KC84 4R9LA 1EA2A 3Q2PA 3EB8A 1IQXA 3HZPA 3STDA 1JBRA 1YJ93 4LGQA 1HKXA 2HMMB 3HIGA 1VQ73 2GU3A 2PZVA 3GZBA 4LZIA 1LNHA 3MG3A 3UL6A 1IVWA 2IUKA 1GOUA 1DMQA 1TUHA 3DZLA 2BHMA 4AKYA 1OH0A 3FH1A 2RSXA 2R4IA 4U13A 1KQS2 1FGTA 4GSPA 1I3FA 3S28A 3N54B 5G2GA 3BIRA 1JB4A 2GBXB 3FG4A 2GEXA 1JJ22 3RGRA 1BSDA 2BO9B 3G0KA 3NQYA 5EQLA 1SJWA 1BNRA 3FCSB 5BXQA 2ML5A 1ASKA 2MC8A 2KAAA 1W5ZA 2OQEC 3CCR3 4HM4B 5I97A 1A2PA 1NWWA 1MWTA 2K0MA 3NUVA 2W0QA 6GSPA 1B21A 3DGMA 3FF2A 1GY5A 2OTL3 3D79A 3JVCA 5D81A 1W01A 1OF5B 2V1LA 1GD3A 2XEPA 2XR8B 3LT9A 4K90B 4RBNA 2F98A 3FZWA 4X2HA 5HGRA 5RNTA 4HAAA 1BRKA 2OWPA 1N5HA 1BSAA 2O3OA 3NV0B 3QK9A 4K61A 4N6LA 4RNTA 2UX0A 1RDSA 3FF0A 3CCM3 2XF3A 1BUQA 2QA43 3K63A 1IT7A 2CWTA 3EHCA 2P38A 4XBXA 1IV7A 3LTCA 1CYUA 4BL2A 5CLKA 3D4AA 5JPUA 1N9JA 2RCDA 4K1VA 1LOWA 1HYFA 3F7SA 2KXGA 2GEYA 3V99A 1MWUA 3F7XA 2STDA 4HZBB 2GXFA 1VQO3 3FSDA 1OCVA 5IG3A 1NNVA 1BRIA 1MWRA 4N6TA 1K9M4 2KCDA 3CCQ3 2KF3A 3ZG5A 3F8HA 4FCZA 3ZFZA 1W2B2 2WO0A 1YVSA 4XDWA 1K8A4 1SARA 1OUNA 1O7NB 3JUQA 1WMNA 2W56B 4DKIA 1O7WB 1RGEA 3X40A 1SIHA 7RNTA 3CD63 2QEX3 1YGEA 2INXA 4XBYA 1BU4A 1TTOA 4N6OB 1E97A 1NDOB 4WFOA 1WMPA 1Q40A 2XFSA 3NM2A 1W7CA 2SBLA 3CMA3 3OXAA 2KF5A 4J9AA 1LRAA 1LOVA 4RNZA 3NV0A 3X3YA 3RDEA 4CDLA 4KFFA 5M18A 3EC9A 2XGLA 1N9EA 5G1LA 1GY6A 3SOYA 3WODG 2Q07A 1RNTA 2D1WA 2XFTA 1T3BA 1BGSA 3GWRA 1UGIA 4AEQA 2FGTA 3X41A 3I553 5BIRA 3T8UA 5AIHA 2H0GA 4LYLB 1QAKA 1K41A 2Z7AA 3WA2X 1X1XA 1FYSA 1TIJA 4FCJA 1IU7A
chains in the Genus database with same CATH topology
1X1WA 1BRNL 1BNFA 3SYUA 1T2IA 1YNVX 1BVIA 1B2MA 1FUTA 2KF6A 1BNEA 2F56A 3KCHA 1UCKA 3AGNA 1JBRA 1GSPA 1RGFA 2BU4A 4BU4A 1B2ZA 1GOUA 2F4YA 1RGKA 1RGLA 1AY7A 4BIRA 1RCKA 1B2UA 3AHWA 3RNTA 4GSPA 1RTUA 1I3FA 1T2HA 1ZGXA 4HOHA 1I2EA 3BIRA 3D5GA 2ZA4A 1BRGA 1AQZA 2KF4A 1I2GA 1BSDA 2C4BA 1BNRA 1I0VA 9RNTA 1BSCA 1X1YA 2HOHA 2KAAA 1PY3A 1RGAA 1A2PA 1RGGA 4GHOA 1R4YA 1CH0A 3A5EA 1MGWA 6GSPA 1B21A 1HZ1A 1GMPA 1C54A 1BANA 4J5KA 1BNJA 2AADA 5RNTA 1JBSA 4HAAA 1GOVA 1DETA 5BU4A 1BRKA 1B3SA 1BSAA 1I70A 4RNTA 1RDSA 1FZUA 2F5WA 2RBIA 7GSPA 1UCLA 1BUJA 1BSEA 1X1UA 1GMRA 3Q3FA 3D4AA 5HOHA 1RN4A 3D5IA 2RNTA 1PYLA 1LOWA 1HYFA 3WHOA 2SARA 4J5GA 1RMSA 1BSBA 1I3IA 5GSPA 1G02A 1UCJA 1BRIA 1B2SA 1RGHA 2KF3A 1YGWA 1YVSA 1JBTA 1SARA 3AHSA 1BRHA 1GMQA 1B27A 1RGEA 1B2XA 3DH2A 3HOHA 1DE3A 8RNTA 7RNTA 1RNBA 1LNIA 1BU4A 1TTOA 2AAEA 1RCLA 1BAOA 1BRSA 2KF5A 1LRAA 1LOVA 1I2FA 3BU4A 1BNIA 3DGYA 1BRJA 6RNTA 1MGRA 1BIRA 1RHLA 1BNGA 1LOYA 1RNTA 1IYYA 1FUSA 3GSPA 1I0XA 1GOYA 1BNSA 1BGSA 1Q9EA 1B20A 2BIRA 2F5MA 3AGOA 3WR2A 5BIRA 1TRQA 1BOXA 1I8VA 1RN1A 1UCIA 3URPA 1RSNA 2GSPA 1FW7A 1TRPA 1RGCA 1X1XA 1FYSA 1RLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1W A;  1BRN L;  1BNF A;  3SYU A;  1T2I A;  1YNV X;  1BVI A;  1B2M A;  1FUT A;  2KF6 A;  1BNE A;  2F56 A;  3KCH A;  1UCK A;  3AGN A;  1JBR A;  1GSP A;  1RGF A;  2BU4 A;  4BU4 A;  1B2Z A;  1GOU A;  2F4Y A;  1RGK A;  1RGL A;  1AY7 A;  4BIR A;  1RCK A;  1B2U A;  3AHW A;  3RNT A;  4GSP A;  1RTU A;  1I3F A;  1T2H A;  1ZGX A;  4HOH A;  1I2E A;  3BIR A;  3D5G A;  2ZA4 A;  1BRG A;  1AQZ A;  2KF4 A;  1I2G A;  1BSD A;  2C4B A;  1BNR A;  1I0V A;  9RNT A;  1BSC A;  1X1Y A;  2HOH A;  2KAA A;  1PY3 A;  1RGA A;  1A2P A;  1RGG A;  4GHO A;  1R4Y A;  1CH0 A;  3A5E A;  1MGW A;  6GSP A;  1B21 A;  1HZ1 A;  1GMP A;  1C54 A;  1BAN A;  4J5K A;  1BNJ A;  2AAD A;  5RNT A;  1JBS A;  4HAA A;  1GOV A;  1DET A;  5BU4 A;  1BRK A;  1B3S A;  1BSA A;  1I70 A;  4RNT A;  1RDS A;  1FZU A;  2F5W A;  2RBI A;  7GSP A;  1UCL A;  1BUJ A;  1BSE A;  1X1U A;  1GMR A;  3Q3F A;  3D4A A;  5HOH A;  1RN4 A;  3D5I A;  2RNT A;  1PYL A;  1LOW A;  1HYF A;  3WHO A;  2SAR A;  4J5G A;  1RMS A;  1BSB A;  1I3I A;  5GSP A;  1G02 A;  1UCJ A;  1BRI A;  1B2S A;  1RGH A;  2KF3 A;  1YGW A;  1YVS A;  1JBT A;  1SAR A;  3AHS A;  1BRH A;  1GMQ A;  1B27 A;  1RGE A;  1B2X A;  3DH2 A;  3HOH A;  1DE3 A;  8RNT A;  7RNT A;  1RNB A;  1LNI A;  1BU4 A;  1TTO A;  2AAE A;  1RCL A;  1BAO A;  1BRS A;  2KF5 A;  1LRA A;  1LOV A;  1I2F A;  3BU4 A;  1BNI A;  3DGY A;  1BRJ A;  6RNT A;  1MGR A;  1BIR A;  1RHL A;  1BNG A;  1LOY A;  1RNT A;  1IYY A;  1FUS A;  3GSP A;  1I0X A;  1GOY A;  1BNS A;  1BGS A;  1Q9E A;  1B20 A;  2BIR A;  2F5M A;  3AGO A;  3WR2 A;  5BIR A;  1TRQ A;  1BOX A;  1I8V A;  1RN1 A;  1UCI A;  3URP A;  1RSN A;  2GSP A;  1FW7 A;  1TRP A;  1RGC A;  1X1X A;  1FYS A;  1RLS A; 
#chains in the Genus database with same CATH topology
 2OTJ 3;  2E2V A;  1X1W A;  2CFD A;  3X3Z A;  3CXC 2;  3I0Y A;  5IF6 A;  4BTY A;  5TGN A;  2YFL B;  3SYU A;  3ALA A;  3CPW 2;  4HKV B;  2W9P A;  1YNV X;  4J8T A;  2CFL A;  3NX0 A;  4LEH A;  1BNE A;  1ROA A;  3OWU A;  1Q7H A;  4IPB A;  1VQQ A;  1MWS A;  3X42 A;  1RGF A;  5IER A;  3H51 A;  2OOV C;  1JN5 A;  5M1A A;  2IUJ A;  4IT7 A;  1D6U A;  3MG1 A;  1KSI A;  1RGK A;  1FGQ A;  3OX9 A;  2W2C A;  1AY7 A;  1EEJ A;  1US1 A;  3BLZ A;  1ZGX A;  3DGN A;  4HOH A;  1NJI 4;  4WWU C;  3CC4 3;  1BRG A;  1AQZ A;  2KF4 A;  3JUP A;  3MSO A;  2KRT A;  3DY5 A;  1E3R A;  3H3H A;  3OWS A;  2XSO B;  1STD A;  3MKI A;  3ROB A;  2YX9 A;  1X1Y A;  3HX8 A;  1W2Z A;  1PY3 A;  3IPT A;  1UGH I;  2HMK B;  2BMR B;  2E2U A;  1EKM A;  2CX0 A;  3K7C A;  4GHO A;  1YJW 3;  1W6Y A;  4CCV A;  1CH0 A;  2D42 A;  4G1M B;  4HYZ A;  4I4K A;  4EBG A;  1Y4K A;  1VQL 3;  2YFJ B;  2IMJ A;  3NHX A;  2WOH A;  4KFD A;  1EUI C;  1GMP A;  1C54 A;  1LXE A;  2CC3 A;  1O7P B;  1UI8 A;  3ER7 A;  3DXO A;  4ILF A;  4EW5 A;  6STD A;  2Z6B A;  2AAD A;  1IT8 A;  5FW5 A;  1ZO2 A;  1W6G A;  1GOV A;  2W56 A;  3U97 A;  2Y73 A;  2CFK A;  1QVG 2;  2ML6 A;  1VQ9 3;  1VZZ A;  4XB5 A;  5DRV A;  3K0Z A;  1FZU A;  7GSP A;  2QIY A;  1VQ6 3;  1KWI A;  2WGO A;  2CG0 A;  1QAL A;  1UCL A;  3AMO B;  1BSE A;  1PFP A;  1IDP A;  1OPY A;  3MWZ A;  3OWY A;  1Q82 4;  5HOH A;  4N6V 0;  1RN4 A;  3AMO A;  1JKG A;  2YFI B;  3WHO A;  3BNB A;  5LC6 A;  2SAR A;  1GY7 A;  1RMS A;  1OHP A;  3PZW A;  1ULI B;  1CEW I;  1ROV A;  1ULJ B;  1LOX A;  1C7H A;  1FGM A;  2Y74 A;  1W4N A;  2LQV A;  4OK0 A;  3OV4 A;  4HM8 B;  1WNH A;  2RGQ A;  3EX9 A;  3BNE A;  1GMQ A;  4EV5 A;  2FNQ A;  3DH2 A;  3HOH A;  2WGQ A;  1RJO A;  1SII A;  4HM0 B;  1O7H B;  1OAC A;  3CPO A;  1DMN A;  4HM6 B;  1U5O A;  2AAE A;  3G16 A;  2CWV A;  1UUW B;  1W00 A;  1AV4 A;  2JQ5 A;  4HZ9 B;  3JUO A;  5AEW B;  4KFE A;  5AIF A;  3T8N A;  1UUV B;  3Q90 A;  1BRJ A;  2H0H A;  2Z76 A;  1DVD A;  1FGO A;  2Z77 A;  1NO3 A;  1RHL A;  2ZHX B;  1LOY A;  3GZX B;  3MHE A;  1GOY A;  2GBW B;  2HML B;  1Q9E A;  1B20 A;  1W02 A;  2BIR A;  3NBB A;  1JRQ A;  3VGN A;  1QAF A;  4MEI A;  1TRQ A;  1BOX A;  3HK4 A;  1RN1 A;  3FLJ A;  4NHF A;  3CCU 3;  2CFG A;  1IVV A;  1O7M B;  4GL6 A;  5AIG A;  3A76 A;  3GAX A;  1BRN L;  4OVM A;  4HM3 B;  1J2B A;  3UJM A;  1GYB A;  1BVI A;  4L8P A;  4EYC A;  1B2M A;  1FUT A;  3FKA A;  2F56 A;  3KCH A;  5D83 A;  3DUK A;  1GSP A;  3DGO A;  4JF8 A;  4BU4 A;  1TFK A;  4WYK B;  1B2Z A;  3KZT A;  4EV2 A;  4R80 A;  2F4Y A;  1RGL A;  3EQQ B;  4BIR A;  1K73 4;  1CYV A;  1RCK A;  3AHW A;  3ZG0 A;  1T2H A;  3UL5 A;  3TDG A;  5M19 A;  3CC7 3;  1I2E A;  2P0M A;  4R4K A;  3D5G A;  4WP5 A;  5LC7 A;  2W6J H;  2W03 A;  4FR9 A;  1N8Q A;  3CCS 3;  4HM2 B;  1MNL A;  3CME 3;  1WQL B;  3WDG B;  5AI1 A;  3D9R A;  3CCJ 3;  3K9M C;  1NB5 I;  9RNT A;  1PU4 A;  4O2H A;  1BSC A;  3M8C A;  4NRE A;  4WHA A;  4FMC A;  5JPP A;  1JZO A;  4N6U A;  4WYK A;  1RKY A;  1Q81 4;  2UGI A;  3EN8 A;  3F8X A;  3NXJ A;  2MF7 A;  4O3V A;  1K28 A;  1OHS A;  1RGG A;  1EQK A;  3N8B A;  5EEO A;  2BMO B;  2I9W A;  1YI2 3;  1ISK A;  2HMN B;  1FA3 A;  4CJN A;  2CH9 A;  4ORL A;  7STD A;  2PNC A;  3MG2 A;  5IW9 A;  1AR0 A;  1JB2 A;  4L8O A;  5IG4 A;  3EBY A;  3S29 A;  3QRD A;  3NBR A;  3JUN A;  2B24 B;  2K3D A;  4QWT A;  1BAN A;  1VQK 3;  3PS8 A;  3GZY B;  1BNJ A;  3DM8 A;  5G1K A;  3UNL A;  3J7Y d;  2P09 A;  1DET A;  2O9U X;  1B3S A;  2XGN A;  2P05 A;  3B8L A;  3NM7 A;  4H3U A;  2XRX B;  4MMX B;  4MMY B;  3EBT A;  2F5W A;  1IK3 A;  1VQ4 3;  3CC2 3;  3KFQ C;  2E2T A;  4EC6 A;  5IG0 A;  2P0X A;  4TX4 A;  5A0O B;  3DMC A;  4K1U A;  1GMR A;  3Q3F A;  2H0I A;  2L4V A;  2BMQ B;  1YHQ 3;  1N5P A;  1M90 4;  2RNT A;  3ECF A;  3HII A;  1YVB I;  2C10 A;  3FGY A;  3IJE B;  1BSB A;  1G02 A;  1UCJ A;  2HMO B;  1B2S A;  4KZ1 A;  3SOA A;  3U1W A;  3KE7 A;  1YJN 3;  3CU3 A;  1QJG A;  1UDI I;  1BRH A;  1B27 A;  3WA3 A;  1DE3 A;  3EJV A;  4I5Q A;  1RNB A;  1LNI A;  5STD A;  3LTA A;  3B4O A;  5DRE A;  2ZDJ A;  3FG3 A;  1RCL A;  1BAO A;  1DYU A;  1OHO A;  4FCM A;  3BU4 A;  2GU1 A;  1I2F A;  1LQG C;  1ZS7 A;  2B1X B;  3DGY A;  3MYT A;  1D6Z A;  1Q42 A;  3Q1C A;  2CK3 H;  2CHC A;  1BIR A;  1BNG A;  2CFW A;  4HVN A;  2A15 A;  4IIA A;  1U8C B;  1BNS A;  1RN7 A;  3LXU X;  1AVL A;  2F5M A;  1R4C A;  3VSY A;  1UW1 A;  1WTH A;  5KP1 A;  2WOF A;  5CF2 A;  4JRF A;  2GSP A;  3CCL 3;  3PXM A;  1FW7 A;  1NU3 A;  3EE1 A;  2CWU A;  1RGC A;  5CXO A;  4XBT A;  3LTD A;  3RGA A;  1W6C A;  1JB5 A;  3N9H A;  3O8Y A;  3CCV 3;  1T5Y A;  3PGB A;  3CCE 3;  2CIU A;  3S67 A;  4EXR A;  5KP4 A;  3G6E 3;  1ZX2 A;  4N6M A;  3JUM A;  1T2I A;  4HJL B;  1UI7 A;  3CNM A;  2W9Q A;  1TP6 A;  5D82 A;  1UCK A;  1FUW A;  4O02 B;  1RRL A;  3AGN A;  2OCT A;  2BU4 A;  4HBR A;  1QVF 2;  1A67 A;  1IV9 A;  3LML A;  1JZD A;  4AKZ A;  3GRD A;  1B2U A;  1GD4 A;  1E3V A;  2UUG C;  3LZA A;  1RTU A;  5EVH A;  3RNT A;  3WMD A;  2CG1 A;  1N8R 4;  2QGU A;  3UB1 A;  5IEP A;  1Q40 B;  2OQE A;  2ZA4 A;  1F8N A;  3IMA B;  1S72 3;  5AYR B;  1V58 A;  3SED A;  4FMD A;  3FG1 A;  3L0R A;  1I2G A;  1WMO A;  3V98 A;  1TU5 A;  4XM4 A;  5FGO A;  1M1K 4;  2C4B A;  1KD1 4;  5AII A;  3KSE D;  1I0V A;  3BNC A;  2BT3 A;  4LMI A;  1MOL A;  4FMA A;  2HOH A;  1IQY A;  4CPK A;  3B4P A;  1OGX A;  3PCS A;  4R1K A;  5CF1 A;  1RGA A;  2M7O A;  3DGL A;  1UUG B;  4R9K A;  4MJD A;  1OGZ A;  3SXX A;  1YIT 3;  1R4Y A;  1TJD A;  1JV2 B;  3A5E A;  1MGW A;  3WOE B;  1FGR A;  2C11 A;  4GB5 A;  1HZ1 A;  5KP3 A;  4HM7 B;  3NQZ A;  4OUQ A;  5JBS A;  3I56 3;  4O8S A;  4FMB A;  4J5K A;  3NBJ A;  3BB9 A;  3PYJ A;  4BTX A;  1EG9 B;  1NB3 I;  3LH4 A;  3SVA A;  1JBS A;  3G8Z A;  3KSP A;  5BU4 A;  1I70 A;  1IVU A;  1V74 A;  2LYX A;  1G0T A;  3GZR A;  1HU9 A;  3F40 A;  2RBI A;  3S5C A;  1IQ8 A;  1G96 A;  5IG5 A;  4HM1 B;  4X2O A;  3LYG A;  3MPH A;  1BUJ A;  5IEN A;  1X1U A;  2HMJ B;  4N3V A;  5BVB A;  2K54 A;  3B7C A;  3KKG A;  1QMA A;  1A2K A;  3D5I A;  3PCR A;  1PYL A;  4HM5 B;  4STD A;  1AVK A;  5AYS C;  4L7K A;  4LSO A;  3HI7 A;  4J5G A;  3K5T A;  4Q53 A;  3G4S 3;  1D6Y A;  1I3I A;  5GSP A;  1LVN A;  8CHO A;  4MMZ B;  1RGH A;  4N6N B;  2XSH B;  1VQ5 3;  1DVC A;  4RZM A;  1STF I;  1YGW A;  1YIJ 3;  3SX1 A;  1TFO A;  1A2V A;  2F86 B;  3LTB A;  1JBT A;  2R41 A;  3AHS A;  3EN1 B;  3BND A;  2OOV A;  1O7G B;  1SQW A;  3EF8 A;  1B2X A;  5IEO A;  1JKG B;  8RNT A;  4XDV A;  2IA7 A;  4KVH A;  1A90 A;  2BNG A;  2RFR A;  3F14 A;  4KT3 B;  1Z1S A;  1M1X B;  1RRH A;  4BL3 A;  2F99 A;  1BRS A;  3CNX A;  1GS3 A;  2IYJ A;  1Q7Y 4;  3SLU A;  1BNI A;  6RNT A;  3F9S A;  1LQM B;  3WOF B;  2FXT A;  1DMM A;  1MGR A;  5AEU B;  3X3X A;  2IY2 A;  3VF1 A;  1IYY A;  1JN5 B;  1FUS A;  3GSP A;  1I0X A;  1L5G B;  2L1S A;  2XH9 A;  5CK6 A;  4ZM8 A;  4PEJ A;  2JDI H;  3D3L A;  3AGO A;  2CX1 A;  3WR2 A;  1UCI A;  1I8V A;  2J8X B;  3URP A;  2CKF B;  1RSN A;  1VQ8 3;  1OF5 A;  2W04 A;  1TRP A;  2CW9 A;  3E99 A;  3LOY A;  1RLS A;  1S5A A;  1CQS A;  3KII A;  3S27 A;  1BNF A;  4RNY A;  5ELJ A;  3OW2 2;  1VQM 3;  1Q86 4;  1V57 A;  4NPB A;  3V92 A;  1VQN 3;  1M9G A;  1SPU A;  3G71 3;  1JNQ A;  5ELU A;  3T0U A;  4BTW A;  4H61 A;  1IVX A;  2KF6 A;  2ZL8 A;  3LT8 A;  3KN4 A;  1VQP 3;  1KC8 4;  4R9L A;  1EA2 A;  3Q2P A;  3EB8 A;  1IQX A;  3HZP A;  3STD A;  1JBR A;  1YJ9 3;  4LGQ A;  1HKX A;  2HMM B;  3HIG A;  1VQ7 3;  2GU3 A;  2PZV A;  3GZB A;  4LZI A;  1LNH A;  3MG3 A;  3UL6 A;  1IVW A;  2IUK A;  1GOU A;  1DMQ A;  1TUH A;  3DZL A;  2BHM A;  4AKY A;  1OH0 A;  3FH1 A;  2RSX A;  2R4I A;  4U13 A;  1KQS 2;  1FGT A;  4GSP A;  1I3F A;  3S28 A;  3N54 B;  5G2G A;  3BIR A;  1JB4 A;  2GBX B;  3FG4 A;  2GEX A;  1JJ2 2;  3RGR A;  1BSD A;  2BO9 B;  3G0K A;  3NQY A;  5EQL A;  1SJW A;  1BNR A;  3FCS B;  5BXQ A;  2ML5 A;  1ASK A;  2MC8 A;  2KAA A;  1W5Z A;  2OQE C;  3CCR 3;  4HM4 B;  5I97 A;  1A2P A;  1NWW A;  1MWT A;  2K0M A;  3NUV A;  2W0Q A;  6GSP A;  1B21 A;  3DGM A;  3FF2 A;  1GY5 A;  2OTL 3;  3D79 A;  3JVC A;  5D81 A;  1W01 A;  1OF5 B;  2V1L A;  1GD3 A;  2XEP A;  2XR8 B;  3LT9 A;  4K90 B;  4RBN A;  2F98 A;  3FZW A;  4X2H A;  5HGR A;  5RNT A;  4HAA A;  1BRK A;  2OWP A;  1N5H A;  1BSA A;  2O3O A;  3NV0 B;  3QK9 A;  4K61 A;  4N6L A;  4RNT A;  2UX0 A;  1RDS A;  3FF0 A;  3CCM 3;  2XF3 A;  1BUQ A;  2QA4 3;  3K63 A;  1IT7 A;  2CWT A;  3EHC A;  2P38 A;  4XBX A;  1IV7 A;  3LTC A;  1CYU A;  4BL2 A;  5CLK A;  3D4A A;  5JPU A;  1N9J A;  2RCD A;  4K1V A;  1LOW A;  1HYF A;  3F7S A;  2KXG A;  2GEY A;  3V99 A;  1MWU A;  3F7X A;  2STD A;  4HZB B;  2GXF A;  1VQO 3;  3FSD A;  1OCV A;  5IG3 A;  1NNV A;  1BRI A;  1MWR A;  4N6T A;  1K9M 4;  2KCD A;  3CCQ 3;  2KF3 A;  3ZG5 A;  3F8H A;  4FCZ A;  3ZFZ A;  1W2B 2;  2WO0 A;  1YVS A;  4XDW A;  1K8A 4;  1SAR A;  1OUN A;  1O7N B;  3JUQ A;  1WMN A;  2W56 B;  4DKI A;  1O7W B;  1RGE A;  3X40 A;  1SIH A;  7RNT A;  3CD6 3;  2QEX 3;  1YGE A;  2INX A;  4XBY A;  1BU4 A;  1TTO A;  4N6O B;  1E97 A;  1NDO B;  4WFO A;  1WMP A;  1Q40 A;  2XFS A;  3NM2 A;  1W7C A;  2SBL A;  3CMA 3;  3OXA A;  2KF5 A;  4J9A A;  1LRA A;  1LOV A;  4RNZ A;  3NV0 A;  3X3Y A;  3RDE A;  4CDL A;  4KFF A;  5M18 A;  3EC9 A;  2XGL A;  1N9E A;  5G1L A;  1GY6 A;  3SOY A;  3WOD G;  2Q07 A;  1RNT A;  2D1W A;  2XFT A;  1T3B A;  1BGS A;  3GWR A;  1UGI A;  4AEQ A;  2FGT A;  3X41 A;  3I55 3;  5BIR A;  3T8U A;  5AIH A;  2H0G A;  4LYL B;  1QAK A;  1K41 A;  2Z7A A;  3WA2 X;  1X1X A;  1FYS A;  1TIJ A;  4FCJ A;  1IU7 A; 
#chains in the Genus database with same CATH homology
 1X1W A;  1BRN L;  1BNF A;  3SYU A;  1T2I A;  1YNV X;  1BVI A;  1B2M A;  1FUT A;  2KF6 A;  1BNE A;  2F56 A;  3KCH A;  1UCK A;  3AGN A;  1JBR A;  1GSP A;  1RGF A;  2BU4 A;  4BU4 A;  1B2Z A;  1GOU A;  2F4Y A;  1RGK A;  1RGL A;  1AY7 A;  4BIR A;  1RCK A;  1B2U A;  3AHW A;  3RNT A;  4GSP A;  1RTU A;  1I3F A;  1T2H A;  1ZGX A;  4HOH A;  1I2E A;  3BIR A;  3D5G A;  2ZA4 A;  1BRG A;  1AQZ A;  2KF4 A;  1I2G A;  1BSD A;  2C4B A;  1BNR A;  1I0V A;  9RNT A;  1BSC A;  1X1Y A;  2HOH A;  2KAA A;  1PY3 A;  1RGA A;  1A2P A;  1RGG A;  4GHO A;  1R4Y A;  1CH0 A;  3A5E A;  1MGW A;  6GSP A;  1B21 A;  1HZ1 A;  1GMP A;  1C54 A;  1BAN A;  4J5K A;  1BNJ A;  2AAD A;  5RNT A;  1JBS A;  4HAA A;  1GOV A;  1DET A;  5BU4 A;  1BRK A;  1B3S A;  1BSA A;  1I70 A;  4RNT A;  1RDS A;  1FZU A;  2F5W A;  2RBI A;  7GSP A;  1UCL A;  1BUJ A;  1BSE A;  1X1U A;  1GMR A;  3Q3F A;  3D4A A;  5HOH A;  1RN4 A;  3D5I A;  2RNT A;  1PYL A;  1LOW A;  1HYF A;  3WHO A;  2SAR A;  4J5G A;  1RMS A;  1BSB A;  1I3I A;  5GSP A;  1G02 A;  1UCJ A;  1BRI A;  1B2S A;  1RGH A;  2KF3 A;  1YGW A;  1YVS A;  1JBT A;  1SAR A;  3AHS A;  1BRH A;  1GMQ A;  1B27 A;  1RGE A;  1B2X A;  3DH2 A;  3HOH A;  1DE3 A;  8RNT A;  7RNT A;  1RNB A;  1LNI A;  1BU4 A;  1TTO A;  2AAE A;  1RCL A;  1BAO A;  1BRS A;  2KF5 A;  1LRA A;  1LOV A;  1I2F A;  3BU4 A;  1BNI A;  3DGY A;  1BRJ A;  6RNT A;  1MGR A;  1BIR A;  1RHL A;  1BNG A;  1LOY A;  1RNT A;  1IYY A;  1FUS A;  3GSP A;  1I0X A;  1GOY A;  1BNS A;  1BGS A;  1Q9E A;  1B20 A;  2BIR A;  2F5M A;  3AGO A;  3WR2 A;  5BIR A;  1TRQ A;  1BOX A;  1I8V A;  1RN1 A;  1UCI A;  3URP A;  1RSN A;  2GSP A;  1FW7 A;  1TRP A;  1RGC A;  1X1X A;  1FYS A;  1RLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...