2KF5A

Barnase bound to d(cgac), low pressure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDAYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
molecule tags Hydrolase
source organism Bacillus amyloliquefaciens
publication title Pressure-dependent structure changes in barnase on ligand binding reveal intermediate rate fluctuations.
pubmed doi rcsb
total genus 26
structure length 108
sequence length 108
ec nomenclature ec 3.1.27.-:
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2kf5A00
2AADA 1YNVX 2KF3A 3GSPA 4RNTA 1RGLA 1A2PA 2GSPA 1RN4A 1MGWA 1T2IA 3D4AA 1UCJA 1R4YA 1BOXA 1BRSA 2ZA4A 3D5GA 1G02A 1GSPA 1LOYA 1PY3A 1RDSA 1B2UA 1AY7A 1RGEA 1UCKA 1HZ1A 1RNTA 1DE3A 1B27A 1BNJA 1BNRA 2F4YA 3AHSA 3KCHA 7RNTA 2KAAA 1BNGA 4BU4A 1JBRA 1BIRA 1HYFA 1RGCA 1RMSA 2RNTA 1GOUA 1TRQA 1I3IA 1RLSA 4HAAA 2HOHA 1GMRA 2RBIA 3D5IA 3URPA 5HOHA 1JBTA 1RGFA 1BSDA 1FYSA 2F5WA 1YGWA 1B2XA 1B2ZA 1FUSA 2BIRA 1B3SA 1BRGA 6RNTA 1FUTA 1X1XA 1X1YA 1GMQA 4J5GA 1BRHA 1RNBA 1UCIA 1RGAA 3WR2A 1BNFA 1RCLA 1YVSA 1TRPA 1IYYA 1RGHA 1I0VA 1Q9EA 1GOVA 1T2HA 4J5KA 1B2MA 3DGYA 5BU4A 1C54A 2SARA 1GOYA 1BNIA 1I2EA 1RTUA 3AGNA 1FW7A 1DETA 5GSPA 9RNTA 1FZUA 1I3FA 7GSPA 1B20A 1I0XA 3BIRA 1BGSA 5RNTA 3RNTA 1RGGA 1TTOA 1BU4A 3SYUA 1X1UA 4BIRA 1B2SA 1I8VA 1BSCA 1BRJA 4HOHA 1SARA 1BNSA 1ZGXA 2KF4A 4GSPA 1LNIA 1BSEA 3A5EA 1BVIA 1RGKA 3BU4A 1RSNA 1LRAA 1BANA 1BRNL 3Q3FA 8RNTA 1RHLA 1BSBA 2BU4A 3HOHA 1X1WA 1JBSA 1BSAA 1BRKA 5BIRA 3WHOA 3DH2A 1AQZA 4GHOA 1UCLA 1GMPA 1CH0A 2KF5A 1BNEA 2C4BA 3AHWA 2KF6A 6GSPA 1LOWA 2AAEA 1PYLA 2F5MA 2F56A 1I2GA 1BUJA 1I2FA 1LOVA 1RN1A 1I70A 1BAOA 1MGRA 1BRIA 3AGOA 1B21A 1RCKA
chains in the Genus database with same CATH superfamily
2CW9A 2W2CA 2CFDA 2CWTA 2KF3A 1TP6A 1KWIA 3FG1A 3GSPA 1A2VA 3IPTA 5EEOA 1QVG2 1A90A 3ER7A 1DVDA 1OHSA 3F9SA 1V57A 3ROBA 3DMCA 2HMJB 1R4YA 2O9UX 1BOXA 1DMMA 2ZA4A 3TDGA 1PY3A 2IA7A 2ML5A 4N6LA 1DVCA 3MG3A 4HBRA 3I0YA 4WWUC 1K41A 3ALAA 3T8UA 1BNRA 4FMBA 1STFI 1UUVB 2HMMB 1YJW3 1K8A4 2UUGC 1OH0A 2HMLB 3S5CA 3NUVA 7RNTA 2KAAA 2K0MA 1FGQA 5IG5A 4RNZA 3K0ZA 1JBRA 1TIJA 1Q40B 3BLZA 4OVMA 3WA3A 3ZG5A 1SQWA 1RGCA 2BHMA 4KT3B 1MWSA 2SBLA 3SXXA 1ULJB 1GOUA 1TRQA 1RLSA 2LQVA 1VQP3 4EV2A 2H0GA 1JKGB 2P09A 1Q7Y4 5FW5A 4WYKA 3X42A 1D6UA 1BSDA 1EA2A 4CCVA 2ZL8A 1Q824 3MPHA 3FGYA 2I9WA 5IG4A 2CC3A 1ROVA 4EV5A 8CHOA 5EQLA 3X3YA 1JN5A 1IT7A 1NNVA 1FUTA 2MF7A 1X1YA 1BRHA 3PXMA 1SJWA 1UDII 1UCIA 1RGAA 3EJVA 3S28A 1S723 1NO3A 1BNFA 3WA2X 1DYUA 1VQK3 5AIHA 2W9PA 3EX9A 4LSOA 1VQL3 3EBTA 4XM4A 1IYYA 3LTDA 2XEPA 4BTWA 4WHAA 2R4IA 1I0VA 3RGRA 2ZHXB 1YIT3 3VF1A 2OOVC 2XSOB 1W02A 1NDOB 1FGOA 4J5KA 1M904 1W6CA 3DGYA 4HJLB 5DRVA 3CC23 4NREA 3HZPA 2OWPA 2SARA 5D81A 5FGOA 1DETA 3UNLA 5M1AA 1RKYA 1FZUA 1I3FA 1YJ93 1B20A 5IG0A 1ZS7A 3CNMA 1YGEA 1BGSA 2OOVA 3KN4A 3NM7A 2GEXA 2F98A 1RGGA 1TTOA 3I563 4R9LA 4I5QA 1X1UA 1STDA 1U8CB 3F14A 3CPW2 1IQ8A 1GY6A 1BSCA 1N5HA 5AYRB 3T0UA 4CDLA 2BMQB 3CCJ3 1SARA 2KCDA 3LZAA 1ZGXA 1LNIA 2F86B 3K5TA 4MMZB 3BNDA 1LRAA 1W4NA 1SIHA 1W7CA 4NPBA 5AI1A 4EW5A 3LMLA 1ISKA 3PYJA 1SPUA 2FGTA 4N3VA 2P38A 4QWTA 2P0MA 4WFOA 1UUGB 5BIRA 3WHOA 2WOHA 1KC84 4HM2B 2IMJA 3FZWA 1UCLA 2KF5A 3QRDA 4N6UA 1Z1SA 2Y74A 1GY7A 3DGNA 3AHWA 4CPKA 2GXFA 2P0XA 6GSPA 1VZZA 2XR8B 2JDIH 3GZRA 2P05A 1ULIB 1FGRA 1T3BA 3STDA 1LOVA 1RN1A 1I70A 2HMKB 1ROAA 1KSIA 3AMOB 2ML6A 1JV2B 2CFKA 1IVWA 5HGRA 3EF8A 4XB5A 1FGTA 1ZO2A 3JUNA 4HM4B 1GD4A 1E3VA 4RNTA 2IUJA 1RGLA 3CMA3 1YHQ3 1L5GB 2GSPA 1RN4A 3EQQB 4RZMA 1MGWA 5G2GA 4FMCA 2D1WA 3H3HA 1N9EA 4L8OA 3PS8A 1HKXA 4BL3A 1JB4A 3HIGA 2WGOA 1JRQA 4N6MA 4H61A 1NB5I 3DGOA 4KFEA 1UCKA 4X2HA 4MMYB 1TFOA 1DE3A 3AHSA 5AEWB 1CYUA 1LVNA 3LTAA 4HM0B 4R9KA 2IY2A 1BIRA 3LT8A 3LOYA 3NX0A 3SVAA 3NV0B 5JPPA 2E2TA 1VQ83 5IW9A 3DM8A 3U1WA 3D5IA 3FF2A 3URPA 1JBTA 2OTJ3 3CCQ3 3ZG0A 3DUKA 5IERA 4HM6B 1LQMB 3DZLA 1IDPA 2F5WA 3JUQA 3WDGB 1B2XA 3KKGA 3CCR3 3S29A 5KP4A 4LMIA 3K9MC 1US1A 1B3SA 2UX0A 5AIFA 2L4VA 2PZVA 3MSOA 5BXQA 1W5ZA 2CG1A 1VQ73 3K7CA 4N6TA 1K9M4 1GMQA 2BMOB 2H0IA 3FCSB 2CK3H 3S67A 4NHFA 4L8PA 4EXRA 4FCJA 2RSXA 1YVSA 1U5OA 1RRHA 3MWZA 3F40A 1O7NB 3S27A 3BB9A 2XFTA 2WO0A 3OWSA 4HYZA 4MEIA 3MG2A 2CX0A 3EB8A 3GRDA 4FMDA 1M1K4 1B2MA 3NXJA 2QEX3 4HZ9B 4AKZA 3CCV3 2BT3A 2GEYA 5BU4A 2BMRB 3NQZA 4K1UA 4IT7A 1GOYA 1BNIA 4HM1B 3VSYA 3AGNA 1OACA 2JQ5A 3U97A 3D9RA 2IUKA 3NBJA 1IVXA 1FA3A 4HM3B 7GSPA 5M19A 1I0XA 3BIRA 1VQ53 3LTBA 4IPBA 1BU4A 2W04A 3SYUA 4LZIA 1I8VA 1EUIC 1T5YA 3FF0A 5ELUA 1IVUA 1OGXA 1BNSA 4N6V0 3SEDA 4EYCA 3UB1A 2C11A 2Z76A 3BU4A 5STDA 1NU3A 2Z7AA 1BANA 1GYBA 3FSDA 5AEUB 2UGIA 3CCM3 3Q3FA 1TUHA 3LYGA 2HMOB 3SX1A 3LH4A 3WOFB 2PNCA 2CH9A 3FG3A 2OCTA 2Q07A 1BSAA 1BRKA 1UUWB 3DH2A 3EHCA 2K3DA 1JN5B 1GMPA 1OUNA 4CJNA 3J7Yd 1JJ22 1WQLB 1W6YA 2KF6A 3NV0A 4RBNA 4JF8A 3NBBA 1Q864 5IEPA 2AAEA 1PYLA 2W6JH 4LGQA 1NB3I 5KP1A 3G16A 2F5MA 4XBXA 3WMDA 3G4S3 6STDA 3OWYA 1VQ43 3EC9A 1JB5A 1M9GA 4BTXA 5IG3A 1MGRA 1D6YA 4GL6A 1TU5A 4IIAA 1YGWA 2CHCA 3LTCA 3CCE3 2AADA 1YNVX 1OHOA 1LQGC 1Q42A 2QIYA 1GY5A 3I553 1A2PA 4OUQA 4O3VA 2GU3A 3OV4A 2J8XB 3D4AA 2E2UA 3EE1A 1RN7A 1N8QA 1G02A 1GSPA 1LOYA 5JPUA 1Q40A 1VQO3 1VQ63 5TGNA 4PEJA 1AY7A 3N8BA 1HZ1A 1B27A 1Q814 4R80A 2ZDJA 3KCHA 4Q53A 5KP3A 2QA43 1YI23 1V58A 3FKAA 3MYTA 1BNGA 4OK0A 5IF6A 3F8XA 3D79A 1MWUA 3CC73 1J2BA 4LYLB 1YVBI 4BTYA 4HAAA 2RFRA 2WOFA 5HOHA 1RRLA 2RBIA 1S5AA 1KD14 2XGNA 1RGFA 3KE7A 5D82A 2A15A 1WMNA 1D6ZA 2YFIB 3BNBA 2CWVA 5M18A 2YFLB 1IVVA 2F99A 2R41A 3HI7A 1OGZA 2BIRA 2D42A 3MHEA 4R1KA 1BRGA 3CCL3 1TFKA 4R4KA 3DY5A 3KSPA 3HIIA 1LNHA 4J5GA 4L7KA 1OPYA 3CCU3 1IK3A 1E3RA 3BNEA 3WR2A 4K1VA 4EC6A 1RCLA 1TRPA 2W03A 2CG0A 1RGHA 4X2OA 4HZBB 3F8HA 1JB2A 3V98A 5JBSA 3CD63 1NWWA 1UI7A 1N5PA 4ZM8A 4AEQA 1YJN3 5A0OB 4HM8B 2L1SA 1Q9EA 1R4CA 1T2HA 5CK6A 2E2VA 2CFLA 2O3OA 1EKMA 3SOYA 4N6OB 2XFSA 3OWUA 1C54A 1W01A 3RGAA 1I2EA 3GZXB 1RTUA 3B8LA 9RNTA 1GS3A 1UW1A 5AIIA 5EVHA 3ECFA 5CXOA 5LC6A 4GB5A 3B4PA 4K90B 3UJMA 1PFPA 3JUOA 4ILFA 3VGNA 3KSED 1B2SA 4HM5B 2KXGA 1BRJA 4HOHA 3LXUX 1K734 2RGQA 2B24B 4GSPA 1BSEA 2OQEA 2FXTA 5AYSC 1ASKA 1C7HA 5CF2A 5IENA 1BVIA 3NM2A 3FH1A 4STDA 3D3LA 3X3ZA 2CX1A 8RNTA 2XH9A 1CQSA 1BSBA 1CYVA 2BU4A 2XGLA 3K63A 4O8SA 5CLKA 1X1WA 2OQEC 1UGHI 3GZYB 1BUQA 1IV7A 1JZDA 1O7PB 3AMOA 1AQZA 3CNXA 1IQXA 4KVHA 1W2B2 1WTHA 2HMNB 3JUPA 2KRTA 1EQKA 1E97A 1BNEA 4G1MB 1LOWA 1O7MB 1GD3A 1QAKA 1I2GA 2F56A 4RNYA 1BUJA 1UI8A 3UL5A 3F7XA 4KFFA 1I2FA 1MOLA 2Z77A 4I4KA 3PCRA 3PCSA 4J8TA 3AGOA 1VQQA 3V92A 1NJI4 4AKYA 2W56A 3BNCA 2INXA 1KQS2 3E99A 1OF5A 3CPOA 4FR9A 4XBTA 5BVBA 5DREA 3LT9A 2Z6BA 1MWTA 1TJDA 3DXOA 5G1LA 1O7HB 1T2IA 3Q90A 1WMOA 1UCJA 2W9QA 3H51A 3JUMA 4LEHA 1BRSA 4KZ1A 3D5GA 1AV4A 2CWUA 1MNLA 1IT8A 2YFJB 3OX9A 3WOEB 1RDSA 1B2UA 2CKFB 1RGEA 3N54B 1RNTA 4EBGA 1BNJA 2F4YA 4O2HA 1JNQA 2C10A 1RJOA 2QGUA 5IEOA 2K54A 1QVF2 1VQN3 4BU4A 1F8NA 4H3UA 3OW22 3ZFZA 1UGIA 1OCVA 5ELJA 1HYFA 1RMSA 3HK4A 3X3XA 5G1KA 3CU3A 1MWRA 4HVNA 2RNTA 4XDVA 1AR0A 1I3IA 2W56B 2HOHA 5AIGA 1GMRA 3X40A 2H0HA 1QJGA 4HM7B 4K61A 1G96A 1AVKA 1FYSA 1LOXA 1FUWA 1B2ZA 1FUSA 1HU9A 6RNTA 1QMAA 1FGMA 1V74A 4N6NB 1X1XA 3G713 1W2ZA 3X41A 1SIIA 4O02B 3V99A 5LC7A 7STDA 1RNBA 1M1XB 4FCMA 1OHPA 5CF1A 1N9JA 1WMPA 1EG9B 2STDA 2W0QA 1ZX2A 3G8ZA 3HX8A 3F7SA 3MG1A 4HKVB 4MMXB 3G0KA 3NHXA 4TX4A 2XSHB 3MKIA 3CCS3 1G0TA 1YIJ3 1QAFA 1OF5B 1GOVA 3M8CA 1IQYA 1O7GB 3B7CA 1EEJA 2YX9A 1K28A 4KFDA 5GSPA 1AVLA 3EN8A 2BNGA 1PU4A 1FW7A 2BO9B 1CEWI 1A67A 2IYJA 3N9HA 1LXEA 2B1XB 1VQ93 5RNTA 3DGMA 3RNTA 3CC43 5D83A 3FLJA 3T8NA 3EN1B 4MJDA 3CME3 3NQYA 3QK9A 4BIRA 3KIIA 3KZTA 2GBXB 3GZBA 3O8YA 2MC8A 1VQM3 1WNHA 3PZWA 1W6GA 2KF4A 3G6E3 2V1LA 3A5EA 3GWRA 4U13A 1W00A 3SOAA 4DKIA 3CXC2 3Q1CA 3DGLA 2XF3A 1RGKA 2CIUA 4XDWA 4BL2A 1RSNA 4XBYA 3FG4A 1BRNL 5I97A 3SLUA 2FNQA 1RHLA 4WP5A 1Y4KA 4WYKB 3GAXA 3HOHA 1DMNA 1JKGA 3Q2PA 1IU7A 1JBSA 3IJEB 1QALA 2GBWB 2GU1A 3WODG 2CFWA 3JVCA 1JZOA 3PGBA 1DMQA 3IMAB 4J9AA 4GHOA 1Q7HA 2M7OA 1CH0A 3KFQC 2CFGA 2C4BA 4FMAA 2WGQA 3UL6A 3EBYA 1A2KA 3RDEA 4JRFA 2RCDA 3OXAA 2OTL3 3NBRA 1O7WB 1BAOA 2LYXA 3A76A 3B4OA 1N8R4 1BRIA 2Y73A 3L0RA 4FCZA 1IV9A 2XRXB 1B21A 4ORLA 1RCKA
chains in the Genus database with same CATH topology
2AADA 1YNVX 2KF3A 3GSPA 4RNTA 1RGLA 1A2PA 2GSPA 1RN4A 1MGWA 1T2IA 3D4AA 1UCJA 1R4YA 1BOXA 1BRSA 2ZA4A 3D5GA 1G02A 1GSPA 1LOYA 1PY3A 1RDSA 1B2UA 1AY7A 1RGEA 1UCKA 1HZ1A 1RNTA 1DE3A 1B27A 1BNJA 1BNRA 2F4YA 3AHSA 3KCHA 7RNTA 2KAAA 1BNGA 4BU4A 1JBRA 1BIRA 1HYFA 1RGCA 1RMSA 2RNTA 1GOUA 1TRQA 1I3IA 1RLSA 4HAAA 2HOHA 1GMRA 2RBIA 3D5IA 3URPA 5HOHA 1JBTA 1RGFA 1BSDA 1FYSA 2F5WA 1YGWA 1B2XA 1B2ZA 1FUSA 2BIRA 1B3SA 1BRGA 6RNTA 1FUTA 1X1XA 1X1YA 1GMQA 4J5GA 1BRHA 1RNBA 1UCIA 1RGAA 3WR2A 1BNFA 1RCLA 1YVSA 1TRPA 1IYYA 1RGHA 1I0VA 1Q9EA 1GOVA 1T2HA 4J5KA 1B2MA 3DGYA 5BU4A 1C54A 2SARA 1GOYA 1BNIA 1I2EA 1RTUA 3AGNA 1FW7A 1DETA 5GSPA 9RNTA 1FZUA 1I3FA 7GSPA 1B20A 1I0XA 3BIRA 1BGSA 5RNTA 3RNTA 1RGGA 1TTOA 1BU4A 3SYUA 1X1UA 4BIRA 1B2SA 1I8VA 1BSCA 1BRJA 4HOHA 1SARA 1BNSA 1ZGXA 2KF4A 4GSPA 1LNIA 1BSEA 3A5EA 1BVIA 1RGKA 3BU4A 1RSNA 1LRAA 1BANA 1BRNL 3Q3FA 8RNTA 1RHLA 1BSBA 2BU4A 3HOHA 1X1WA 1JBSA 1BSAA 1BRKA 5BIRA 3WHOA 3DH2A 1AQZA 4GHOA 1UCLA 1GMPA 1CH0A 2KF5A 1BNEA 2C4BA 3AHWA 2KF6A 6GSPA 1LOWA 2AAEA 1PYLA 2F5MA 2F56A 1I2GA 1BUJA 1I2FA 1LOVA 1RN1A 1I70A 1BAOA 1MGRA 1BRIA 3AGOA 1B21A 1RCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAD A;  1YNV X;  2KF3 A;  3GSP A;  4RNT A;  1RGL A;  1A2P A;  2GSP A;  1RN4 A;  1MGW A;  1T2I A;  3D4A A;  1UCJ A;  1R4Y A;  1BOX A;  1BRS A;  2ZA4 A;  3D5G A;  1G02 A;  1GSP A;  1LOY A;  1PY3 A;  1RDS A;  1B2U A;  1AY7 A;  1RGE A;  1UCK A;  1HZ1 A;  1RNT A;  1DE3 A;  1B27 A;  1BNJ A;  1BNR A;  2F4Y A;  3AHS A;  3KCH A;  7RNT A;  2KAA A;  1BNG A;  4BU4 A;  1JBR A;  1BIR A;  1HYF A;  1RGC A;  1RMS A;  2RNT A;  1GOU A;  1TRQ A;  1I3I A;  1RLS A;  4HAA A;  2HOH A;  1GMR A;  2RBI A;  3D5I A;  3URP A;  5HOH A;  1JBT A;  1RGF A;  1BSD A;  1FYS A;  2F5W A;  1YGW A;  1B2X A;  1B2Z A;  1FUS A;  2BIR A;  1B3S A;  1BRG A;  6RNT A;  1FUT A;  1X1X A;  1X1Y A;  1GMQ A;  4J5G A;  1BRH A;  1RNB A;  1UCI A;  1RGA A;  3WR2 A;  1BNF A;  1RCL A;  1YVS A;  1TRP A;  1IYY A;  1RGH A;  1I0V A;  1Q9E A;  1GOV A;  1T2H A;  4J5K A;  1B2M A;  3DGY A;  5BU4 A;  1C54 A;  2SAR A;  1GOY A;  1BNI A;  1I2E A;  1RTU A;  3AGN A;  1FW7 A;  1DET A;  5GSP A;  9RNT A;  1FZU A;  1I3F A;  7GSP A;  1B20 A;  1I0X A;  3BIR A;  1BGS A;  5RNT A;  3RNT A;  1RGG A;  1TTO A;  1BU4 A;  3SYU A;  1X1U A;  4BIR A;  1B2S A;  1I8V A;  1BSC A;  1BRJ A;  4HOH A;  1SAR A;  1BNS A;  1ZGX A;  2KF4 A;  4GSP A;  1LNI A;  1BSE A;  3A5E A;  1BVI A;  1RGK A;  3BU4 A;  1RSN A;  1LRA A;  1BAN A;  1BRN L;  3Q3F A;  8RNT A;  1RHL A;  1BSB A;  2BU4 A;  3HOH A;  1X1W A;  1JBS A;  1BSA A;  1BRK A;  5BIR A;  3WHO A;  3DH2 A;  1AQZ A;  4GHO A;  1UCL A;  1GMP A;  1CH0 A;  2KF5 A;  1BNE A;  2C4B A;  3AHW A;  2KF6 A;  6GSP A;  1LOW A;  2AAE A;  1PYL A;  2F5M A;  2F56 A;  1I2G A;  1BUJ A;  1I2F A;  1LOV A;  1RN1 A;  1I70 A;  1BAO A;  1MGR A;  1BRI A;  3AGO A;  1B21 A;  1RCK A; 
#chains in the Genus database with same CATH topology
 2CW9 A;  2W2C A;  2CFD A;  2CWT A;  2KF3 A;  1TP6 A;  1KWI A;  3FG1 A;  3GSP A;  1A2V A;  3IPT A;  5EEO A;  1QVG 2;  1A90 A;  3ER7 A;  1DVD A;  1OHS A;  3F9S A;  1V57 A;  3ROB A;  3DMC A;  2HMJ B;  1R4Y A;  2O9U X;  1BOX A;  1DMM A;  2ZA4 A;  3TDG A;  1PY3 A;  2IA7 A;  2ML5 A;  4N6L A;  1DVC A;  3MG3 A;  4HBR A;  3I0Y A;  4WWU C;  1K41 A;  3ALA A;  3T8U A;  1BNR A;  4FMB A;  1STF I;  1UUV B;  2HMM B;  1YJW 3;  1K8A 4;  2UUG C;  1OH0 A;  2HML B;  3S5C A;  3NUV A;  7RNT A;  2KAA A;  2K0M A;  1FGQ A;  5IG5 A;  4RNZ A;  3K0Z A;  1JBR A;  1TIJ A;  1Q40 B;  3BLZ A;  4OVM A;  3WA3 A;  3ZG5 A;  1SQW A;  1RGC A;  2BHM A;  4KT3 B;  1MWS A;  2SBL A;  3SXX A;  1ULJ B;  1GOU A;  1TRQ A;  1RLS A;  2LQV A;  1VQP 3;  4EV2 A;  2H0G A;  1JKG B;  2P09 A;  1Q7Y 4;  5FW5 A;  4WYK A;  3X42 A;  1D6U A;  1BSD A;  1EA2 A;  4CCV A;  2ZL8 A;  1Q82 4;  3MPH A;  3FGY A;  2I9W A;  5IG4 A;  2CC3 A;  1ROV A;  4EV5 A;  8CHO A;  5EQL A;  3X3Y A;  1JN5 A;  1IT7 A;  1NNV A;  1FUT A;  2MF7 A;  1X1Y A;  1BRH A;  3PXM A;  1SJW A;  1UDI I;  1UCI A;  1RGA A;  3EJV A;  3S28 A;  1S72 3;  1NO3 A;  1BNF A;  3WA2 X;  1DYU A;  1VQK 3;  5AIH A;  2W9P A;  3EX9 A;  4LSO A;  1VQL 3;  3EBT A;  4XM4 A;  1IYY A;  3LTD A;  2XEP A;  4BTW A;  4WHA A;  2R4I A;  1I0V A;  3RGR A;  2ZHX B;  1YIT 3;  3VF1 A;  2OOV C;  2XSO B;  1W02 A;  1NDO B;  1FGO A;  4J5K A;  1M90 4;  1W6C A;  3DGY A;  4HJL B;  5DRV A;  3CC2 3;  4NRE A;  3HZP A;  2OWP A;  2SAR A;  5D81 A;  5FGO A;  1DET A;  3UNL A;  5M1A A;  1RKY A;  1FZU A;  1I3F A;  1YJ9 3;  1B20 A;  5IG0 A;  1ZS7 A;  3CNM A;  1YGE A;  1BGS A;  2OOV A;  3KN4 A;  3NM7 A;  2GEX A;  2F98 A;  1RGG A;  1TTO A;  3I56 3;  4R9L A;  4I5Q A;  1X1U A;  1STD A;  1U8C B;  3F14 A;  3CPW 2;  1IQ8 A;  1GY6 A;  1BSC A;  1N5H A;  5AYR B;  3T0U A;  4CDL A;  2BMQ B;  3CCJ 3;  1SAR A;  2KCD A;  3LZA A;  1ZGX A;  1LNI A;  2F86 B;  3K5T A;  4MMZ B;  3BND A;  1LRA A;  1W4N A;  1SIH A;  1W7C A;  4NPB A;  5AI1 A;  4EW5 A;  3LML A;  1ISK A;  3PYJ A;  1SPU A;  2FGT A;  4N3V A;  2P38 A;  4QWT A;  2P0M A;  4WFO A;  1UUG B;  5BIR A;  3WHO A;  2WOH A;  1KC8 4;  4HM2 B;  2IMJ A;  3FZW A;  1UCL A;  2KF5 A;  3QRD A;  4N6U A;  1Z1S A;  2Y74 A;  1GY7 A;  3DGN A;  3AHW A;  4CPK A;  2GXF A;  2P0X A;  6GSP A;  1VZZ A;  2XR8 B;  2JDI H;  3GZR A;  2P05 A;  1ULI B;  1FGR A;  1T3B A;  3STD A;  1LOV A;  1RN1 A;  1I70 A;  2HMK B;  1ROA A;  1KSI A;  3AMO B;  2ML6 A;  1JV2 B;  2CFK A;  1IVW A;  5HGR A;  3EF8 A;  4XB5 A;  1FGT A;  1ZO2 A;  3JUN A;  4HM4 B;  1GD4 A;  1E3V A;  4RNT A;  2IUJ A;  1RGL A;  3CMA 3;  1YHQ 3;  1L5G B;  2GSP A;  1RN4 A;  3EQQ B;  4RZM A;  1MGW A;  5G2G A;  4FMC A;  2D1W A;  3H3H A;  1N9E A;  4L8O A;  3PS8 A;  1HKX A;  4BL3 A;  1JB4 A;  3HIG A;  2WGO A;  1JRQ A;  4N6M A;  4H61 A;  1NB5 I;  3DGO A;  4KFE A;  1UCK A;  4X2H A;  4MMY B;  1TFO A;  1DE3 A;  3AHS A;  5AEW B;  1CYU A;  1LVN A;  3LTA A;  4HM0 B;  4R9K A;  2IY2 A;  1BIR A;  3LT8 A;  3LOY A;  3NX0 A;  3SVA A;  3NV0 B;  5JPP A;  2E2T A;  1VQ8 3;  5IW9 A;  3DM8 A;  3U1W A;  3D5I A;  3FF2 A;  3URP A;  1JBT A;  2OTJ 3;  3CCQ 3;  3ZG0 A;  3DUK A;  5IER A;  4HM6 B;  1LQM B;  3DZL A;  1IDP A;  2F5W A;  3JUQ A;  3WDG B;  1B2X A;  3KKG A;  3CCR 3;  3S29 A;  5KP4 A;  4LMI A;  3K9M C;  1US1 A;  1B3S A;  2UX0 A;  5AIF A;  2L4V A;  2PZV A;  3MSO A;  5BXQ A;  1W5Z A;  2CG1 A;  1VQ7 3;  3K7C A;  4N6T A;  1K9M 4;  1GMQ A;  2BMO B;  2H0I A;  3FCS B;  2CK3 H;  3S67 A;  4NHF A;  4L8P A;  4EXR A;  4FCJ A;  2RSX A;  1YVS A;  1U5O A;  1RRH A;  3MWZ A;  3F40 A;  1O7N B;  3S27 A;  3BB9 A;  2XFT A;  2WO0 A;  3OWS A;  4HYZ A;  4MEI A;  3MG2 A;  2CX0 A;  3EB8 A;  3GRD A;  4FMD A;  1M1K 4;  1B2M A;  3NXJ A;  2QEX 3;  4HZ9 B;  4AKZ A;  3CCV 3;  2BT3 A;  2GEY A;  5BU4 A;  2BMR B;  3NQZ A;  4K1U A;  4IT7 A;  1GOY A;  1BNI A;  4HM1 B;  3VSY A;  3AGN A;  1OAC A;  2JQ5 A;  3U97 A;  3D9R A;  2IUK A;  3NBJ A;  1IVX A;  1FA3 A;  4HM3 B;  7GSP A;  5M19 A;  1I0X A;  3BIR A;  1VQ5 3;  3LTB A;  4IPB A;  1BU4 A;  2W04 A;  3SYU A;  4LZI A;  1I8V A;  1EUI C;  1T5Y A;  3FF0 A;  5ELU A;  1IVU A;  1OGX A;  1BNS A;  4N6V 0;  3SED A;  4EYC A;  3UB1 A;  2C11 A;  2Z76 A;  3BU4 A;  5STD A;  1NU3 A;  2Z7A A;  1BAN A;  1GYB A;  3FSD A;  5AEU B;  2UGI A;  3CCM 3;  3Q3F A;  1TUH A;  3LYG A;  2HMO B;  3SX1 A;  3LH4 A;  3WOF B;  2PNC A;  2CH9 A;  3FG3 A;  2OCT A;  2Q07 A;  1BSA A;  1BRK A;  1UUW B;  3DH2 A;  3EHC A;  2K3D A;  1JN5 B;  1GMP A;  1OUN A;  4CJN A;  3J7Y d;  1JJ2 2;  1WQL B;  1W6Y A;  2KF6 A;  3NV0 A;  4RBN A;  4JF8 A;  3NBB A;  1Q86 4;  5IEP A;  2AAE A;  1PYL A;  2W6J H;  4LGQ A;  1NB3 I;  5KP1 A;  3G16 A;  2F5M A;  4XBX A;  3WMD A;  3G4S 3;  6STD A;  3OWY A;  1VQ4 3;  3EC9 A;  1JB5 A;  1M9G A;  4BTX A;  5IG3 A;  1MGR A;  1D6Y A;  4GL6 A;  1TU5 A;  4IIA A;  1YGW A;  2CHC A;  3LTC A;  3CCE 3;  2AAD A;  1YNV X;  1OHO A;  1LQG C;  1Q42 A;  2QIY A;  1GY5 A;  3I55 3;  1A2P A;  4OUQ A;  4O3V A;  2GU3 A;  3OV4 A;  2J8X B;  3D4A A;  2E2U A;  3EE1 A;  1RN7 A;  1N8Q A;  1G02 A;  1GSP A;  1LOY A;  5JPU A;  1Q40 A;  1VQO 3;  1VQ6 3;  5TGN A;  4PEJ A;  1AY7 A;  3N8B A;  1HZ1 A;  1B27 A;  1Q81 4;  4R80 A;  2ZDJ A;  3KCH A;  4Q53 A;  5KP3 A;  2QA4 3;  1YI2 3;  1V58 A;  3FKA A;  3MYT A;  1BNG A;  4OK0 A;  5IF6 A;  3F8X A;  3D79 A;  1MWU A;  3CC7 3;  1J2B A;  4LYL B;  1YVB I;  4BTY A;  4HAA A;  2RFR A;  2WOF A;  5HOH A;  1RRL A;  2RBI A;  1S5A A;  1KD1 4;  2XGN A;  1RGF A;  3KE7 A;  5D82 A;  2A15 A;  1WMN A;  1D6Z A;  2YFI B;  3BNB A;  2CWV A;  5M18 A;  2YFL B;  1IVV A;  2F99 A;  2R41 A;  3HI7 A;  1OGZ A;  2BIR A;  2D42 A;  3MHE A;  4R1K A;  1BRG A;  3CCL 3;  1TFK A;  4R4K A;  3DY5 A;  3KSP A;  3HII A;  1LNH A;  4J5G A;  4L7K A;  1OPY A;  3CCU 3;  1IK3 A;  1E3R A;  3BNE A;  3WR2 A;  4K1V A;  4EC6 A;  1RCL A;  1TRP A;  2W03 A;  2CG0 A;  1RGH A;  4X2O A;  4HZB B;  3F8H A;  1JB2 A;  3V98 A;  5JBS A;  3CD6 3;  1NWW A;  1UI7 A;  1N5P A;  4ZM8 A;  4AEQ A;  1YJN 3;  5A0O B;  4HM8 B;  2L1S A;  1Q9E A;  1R4C A;  1T2H A;  5CK6 A;  2E2V A;  2CFL A;  2O3O A;  1EKM A;  3SOY A;  4N6O B;  2XFS A;  3OWU A;  1C54 A;  1W01 A;  3RGA A;  1I2E A;  3GZX B;  1RTU A;  3B8L A;  9RNT A;  1GS3 A;  1UW1 A;  5AII A;  5EVH A;  3ECF A;  5CXO A;  5LC6 A;  4GB5 A;  3B4P A;  4K90 B;  3UJM A;  1PFP A;  3JUO A;  4ILF A;  3VGN A;  3KSE D;  1B2S A;  4HM5 B;  2KXG A;  1BRJ A;  4HOH A;  3LXU X;  1K73 4;  2RGQ A;  2B24 B;  4GSP A;  1BSE A;  2OQE A;  2FXT A;  5AYS C;  1ASK A;  1C7H A;  5CF2 A;  5IEN A;  1BVI A;  3NM2 A;  3FH1 A;  4STD A;  3D3L A;  3X3Z A;  2CX1 A;  8RNT A;  2XH9 A;  1CQS A;  1BSB A;  1CYV A;  2BU4 A;  2XGL A;  3K63 A;  4O8S A;  5CLK A;  1X1W A;  2OQE C;  1UGH I;  3GZY B;  1BUQ A;  1IV7 A;  1JZD A;  1O7P B;  3AMO A;  1AQZ A;  3CNX A;  1IQX A;  4KVH A;  1W2B 2;  1WTH A;  2HMN B;  3JUP A;  2KRT A;  1EQK A;  1E97 A;  1BNE A;  4G1M B;  1LOW A;  1O7M B;  1GD3 A;  1QAK A;  1I2G A;  2F56 A;  4RNY A;  1BUJ A;  1UI8 A;  3UL5 A;  3F7X A;  4KFF A;  1I2F A;  1MOL A;  2Z77 A;  4I4K A;  3PCR A;  3PCS A;  4J8T A;  3AGO A;  1VQQ A;  3V92 A;  1NJI 4;  4AKY A;  2W56 A;  3BNC A;  2INX A;  1KQS 2;  3E99 A;  1OF5 A;  3CPO A;  4FR9 A;  4XBT A;  5BVB A;  5DRE A;  3LT9 A;  2Z6B A;  1MWT A;  1TJD A;  3DXO A;  5G1L A;  1O7H B;  1T2I A;  3Q90 A;  1WMO A;  1UCJ A;  2W9Q A;  3H51 A;  3JUM A;  4LEH A;  1BRS A;  4KZ1 A;  3D5G A;  1AV4 A;  2CWU A;  1MNL A;  1IT8 A;  2YFJ B;  3OX9 A;  3WOE B;  1RDS A;  1B2U A;  2CKF B;  1RGE A;  3N54 B;  1RNT A;  4EBG A;  1BNJ A;  2F4Y A;  4O2H A;  1JNQ A;  2C10 A;  1RJO A;  2QGU A;  5IEO A;  2K54 A;  1QVF 2;  1VQN 3;  4BU4 A;  1F8N A;  4H3U A;  3OW2 2;  3ZFZ A;  1UGI A;  1OCV A;  5ELJ A;  1HYF A;  1RMS A;  3HK4 A;  3X3X A;  5G1K A;  3CU3 A;  1MWR A;  4HVN A;  2RNT A;  4XDV A;  1AR0 A;  1I3I A;  2W56 B;  2HOH A;  5AIG A;  1GMR A;  3X40 A;  2H0H A;  1QJG A;  4HM7 B;  4K61 A;  1G96 A;  1AVK A;  1FYS A;  1LOX A;  1FUW A;  1B2Z A;  1FUS A;  1HU9 A;  6RNT A;  1QMA A;  1FGM A;  1V74 A;  4N6N B;  1X1X A;  3G71 3;  1W2Z A;  3X41 A;  1SII A;  4O02 B;  3V99 A;  5LC7 A;  7STD A;  1RNB A;  1M1X B;  4FCM A;  1OHP A;  5CF1 A;  1N9J A;  1WMP A;  1EG9 B;  2STD A;  2W0Q A;  1ZX2 A;  3G8Z A;  3HX8 A;  3F7S A;  3MG1 A;  4HKV B;  4MMX B;  3G0K A;  3NHX A;  4TX4 A;  2XSH B;  3MKI A;  3CCS 3;  1G0T A;  1YIJ 3;  1QAF A;  1OF5 B;  1GOV A;  3M8C A;  1IQY A;  1O7G B;  3B7C A;  1EEJ A;  2YX9 A;  1K28 A;  4KFD A;  5GSP A;  1AVL A;  3EN8 A;  2BNG A;  1PU4 A;  1FW7 A;  2BO9 B;  1CEW I;  1A67 A;  2IYJ A;  3N9H A;  1LXE A;  2B1X B;  1VQ9 3;  5RNT A;  3DGM A;  3RNT A;  3CC4 3;  5D83 A;  3FLJ A;  3T8N A;  3EN1 B;  4MJD A;  3CME 3;  3NQY A;  3QK9 A;  4BIR A;  3KII A;  3KZT A;  2GBX B;  3GZB A;  3O8Y A;  2MC8 A;  1VQM 3;  1WNH A;  3PZW A;  1W6G A;  2KF4 A;  3G6E 3;  2V1L A;  3A5E A;  3GWR A;  4U13 A;  1W00 A;  3SOA A;  4DKI A;  3CXC 2;  3Q1C A;  3DGL A;  2XF3 A;  1RGK A;  2CIU A;  4XDW A;  4BL2 A;  1RSN A;  4XBY A;  3FG4 A;  1BRN L;  5I97 A;  3SLU A;  2FNQ A;  1RHL A;  4WP5 A;  1Y4K A;  4WYK B;  3GAX A;  3HOH A;  1DMN A;  1JKG A;  3Q2P A;  1IU7 A;  1JBS A;  3IJE B;  1QAL A;  2GBW B;  2GU1 A;  3WOD G;  2CFW A;  3JVC A;  1JZO A;  3PGB A;  1DMQ A;  3IMA B;  4J9A A;  4GHO A;  1Q7H A;  2M7O A;  1CH0 A;  3KFQ C;  2CFG A;  2C4B A;  4FMA A;  2WGQ A;  3UL6 A;  3EBY A;  1A2K A;  3RDE A;  4JRF A;  2RCD A;  3OXA A;  2OTL 3;  3NBR A;  1O7W B;  1BAO A;  2LYX A;  3A76 A;  3B4O A;  1N8R 4;  1BRI A;  2Y73 A;  3L0R A;  4FCZ A;  1IV9 A;  2XRX B;  1B21 A;  4ORL A;  1RCK A; 
#chains in the Genus database with same CATH homology
 2AAD A;  1YNV X;  2KF3 A;  3GSP A;  4RNT A;  1RGL A;  1A2P A;  2GSP A;  1RN4 A;  1MGW A;  1T2I A;  3D4A A;  1UCJ A;  1R4Y A;  1BOX A;  1BRS A;  2ZA4 A;  3D5G A;  1G02 A;  1GSP A;  1LOY A;  1PY3 A;  1RDS A;  1B2U A;  1AY7 A;  1RGE A;  1UCK A;  1HZ1 A;  1RNT A;  1DE3 A;  1B27 A;  1BNJ A;  1BNR A;  2F4Y A;  3AHS A;  3KCH A;  7RNT A;  2KAA A;  1BNG A;  4BU4 A;  1JBR A;  1BIR A;  1HYF A;  1RGC A;  1RMS A;  2RNT A;  1GOU A;  1TRQ A;  1I3I A;  1RLS A;  4HAA A;  2HOH A;  1GMR A;  2RBI A;  3D5I A;  3URP A;  5HOH A;  1JBT A;  1RGF A;  1BSD A;  1FYS A;  2F5W A;  1YGW A;  1B2X A;  1B2Z A;  1FUS A;  2BIR A;  1B3S A;  1BRG A;  6RNT A;  1FUT A;  1X1X A;  1X1Y A;  1GMQ A;  4J5G A;  1BRH A;  1RNB A;  1UCI A;  1RGA A;  3WR2 A;  1BNF A;  1RCL A;  1YVS A;  1TRP A;  1IYY A;  1RGH A;  1I0V A;  1Q9E A;  1GOV A;  1T2H A;  4J5K A;  1B2M A;  3DGY A;  5BU4 A;  1C54 A;  2SAR A;  1GOY A;  1BNI A;  1I2E A;  1RTU A;  3AGN A;  1FW7 A;  1DET A;  5GSP A;  9RNT A;  1FZU A;  1I3F A;  7GSP A;  1B20 A;  1I0X A;  3BIR A;  1BGS A;  5RNT A;  3RNT A;  1RGG A;  1TTO A;  1BU4 A;  3SYU A;  1X1U A;  4BIR A;  1B2S A;  1I8V A;  1BSC A;  1BRJ A;  4HOH A;  1SAR A;  1BNS A;  1ZGX A;  2KF4 A;  4GSP A;  1LNI A;  1BSE A;  3A5E A;  1BVI A;  1RGK A;  3BU4 A;  1RSN A;  1LRA A;  1BAN A;  1BRN L;  3Q3F A;  8RNT A;  1RHL A;  1BSB A;  2BU4 A;  3HOH A;  1X1W A;  1JBS A;  1BSA A;  1BRK A;  5BIR A;  3WHO A;  3DH2 A;  1AQZ A;  4GHO A;  1UCL A;  1GMP A;  1CH0 A;  2KF5 A;  1BNE A;  2C4B A;  3AHW A;  2KF6 A;  6GSP A;  1LOW A;  2AAE A;  1PYL A;  2F5M A;  2F56 A;  1I2G A;  1BUJ A;  1I2F A;  1LOV A;  1RN1 A;  1I70 A;  1BAO A;  1MGR A;  1BRI A;  3AGO A;  1B21 A;  1RCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...