4CDLA

Crystal structure of retro-aldolase ra110.4-6 complexed with inhibitor 1-(6-methoxy-2-naphthalenyl)-1,3-butanedione
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
b'NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATIESPFGQPPIHGREQIAAHYRKWLGGGKLRVYLTGPVRANHNGCGTMLLRKEWVWNGQPCATDVILVMRFDEQGRIQTEQRYWSEVNLCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
molecule tags Isomerase
source organism Pseudomonas putida
publication title Active Site Plasticity of a Computationally Designed Retro-Aldolase Enzyme
rcsb
total genus 30
structure length 126
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4cdlA00
4WYKB 5FW5A 2A15A 2OWPA 3EQQB 3JUOA 5DREA 4HKVB 3RGRA 1TUHA 3IPTA 5JPPA 2RGQA 3NUVA 2R4IA 1JKGA 4HVNA 5IERA 5EVHA 1OUNA 4HM8B 4LEHA 2F99A 2B1XB 3F7XA 4L8PA 4N3VA 2INXA 1O7PB 1DMQA 1E3RA 3CNXA 3EHCA 1EG9B 1W02A 1GY7A 1AR0A 1WQLB 6STDA 1Q42A 3H51A 1HKXA 2IMJA 5JPUA 1O7NB 3K7CA 4HM5B 5IF6A 1OCVA 4HM6B 4STDA 1OF5A 2GBXB 5AEWB 5D83A 1ULIB 3Q90A 3G8ZA 1GY5A 3FLJA 1JN5A 2Z77A 3NM2A 2W2CA 4HZ9B 3EN1B 2GEYA 1W01A 3B4PA 1JB4A 2Z76A 3GRDA 2Z7AA 1OPYA 1Q40A 4WP5A 3JUQA 3M8CA 3ROBA 3VGNA 3B7CA 1NU3A 3DZLA 1OGXA 1E3VA 3F40A 3FSDA 2BMQB 3OV4A 3SOAA 3T8NA 3SOYA 2HMOB 4PEJA 3JUMA 1QMAA 2UX0A 3EF8A 3FF0A 1OHPA 3I0YA 3F9SA 5CK6A 1NWWA 2RCDA 3FKAA 3OXAA 4H3UA 4J9AA 3HK4A 4HZBB 4L8OA 1A2KA 4R9KA 3UJMA 2GEXA 5CF2A 3EJVA 1DMMA 1TP6A 2PZVA 3NV0A 3MG3A 1ISKA 4FCMA 1ZO2A 1Q40B 3CNMA 3G16A 3GZBA 1O7GB 3OWYA 4HM3B 4I4KA 2HMNB 2XSOB 4HJLB 3CU3A 4L7KA 3F7SA 4FCJA 4X2HA 5BVBA 5KP1A 4X2OA 1BUQA 3MKIA 2GXFA 2CHCA 3OWUA 4HM0B 3JUNA 3OX9A 3GZXB 5DRVA 3UNLA 1OGZA 3NXJA 2XSHB 3MSOA 2F98A 4LMIA 5AIHA 1O7MB 1GS3A 3FH1A 1W00A 1Z1SA 1QJGA 2JQ5A 1OF5B 1STDA 1UUVB 1VZZA 1U5OA 5AEUB 3S5CA 1DMNA 2BMOB 1JB5A 2RFRA 3KKGA 3G0KA 2HMKB 3EX9A 3GZRA 4HM1B 5KP3A 5IG3A 3EC9A 1EA2A 4ORLA 2CKFB 3T8UA 4K1UA 1ZX2A 1GYBA 4Q53A 2YFIB 5CLKA 2YFJB 1JB2A 5IG5A 5D82A 3VSYA 3BB9A 1S5AA 3HX8A 3NHXA 5IG0A 3RGAA 3JUPA 3EBTA 4LGQA 4HM4B 3D9RA 5HGRA 3EN8A 1ASKA 1CQSA 2HMLB 3B8LA 3E99A 4HM2B 4XDWA 5KP4A 1UUWB 3A76A 1OH0A 3KZTA 4HM7B 2B24B 3K0ZA 2BMRB 5G2GA 3F8XA 3EBYA 3H3HA 3LYGA 3HZPA 4WWUC 2QIYA 3LZAA 5IEOA 5AIGA 5IEPA 4R1KA 1O7WB 3F14A 4OUQA 4MJDA 5AIFA 1OHOA 2K54A 3KSPA 3BLZA 4XBTA 4XB5A 1JKGB 1C7HA 2GBWB 2I9WA 3DUKA 3DXOA 4GB5A 7STDA 3MYTA 5STDA 3NV0B 1W6YA 2HMJB 3DMCA 2XRXB 2F86B 2STDA 1O7HB 4KVHA 3MG2A 5D81A 3KE7A 3CPOA 4XDVA 5CF1A 1GY6A 1ULJB 3GWRA 3OWSA 3B4OA 2HMMB 5IG4A 3FGYA 1OHSA 4IIAA 3MG1A 5AIIA 1NDOB 4CDLA 2QGUA 3FZWA 5AI1A 2YFLB 5IENA 4R9LA 3MHEA 2XR8B 3SEDA 3WMDA 1SJWA 3DM8A 3ECFA 4OVMA 4J8TA 5BXQA 1E97A 4XBYA 3ER7A 2BNGA 3GZYB 1JN5B 3NBRA 3FF2A 4RZMA 4XBXA 4U13A 4WYKA 3STDA 5CXOA 1K41A 5TGNA 3F8HA 1IDPA 4XM4A 4K1VA 8CHOA
chains in the Genus database with same CATH superfamily
2MF7A 4WYKB 1B2XA 1MOLA 2A15A 3AHWA 5FW5A 1BRNL 2C10A 2FXTA 2XFSA 5ELJA 1RDSA 5JPPA 1AY7A 4N6LA 5EVHA 2CFDA 2V1LA 1VQ53 4R80A 4LEHA 1W02A 1Q42A 3H51A 3K7CA 4J5GA 1X1XA 1ROAA 4EYCA 3PGBA 5AEWB 3Q90A 3G8ZA 1GY5A 3FLJA 1BSCA 2Z77A 3IMAB 3NM2A 1KQS2 2O9UX 3LTBA 1VQL3 1RHLA 3G4S3 3B4PA 2P0XA 1LVNA 4MMZB 3WR2A 2XH9A 1VQ43 1IV9A 1RGAA 2W9PA 3ROBA 4O02B 3X3ZA 2L4VA 3SOAA 3DZLA 3U1WA 1K8A4 5EQLA 2W6JH 5BU4A 2HMOB 1GMPA 2GU1A 4PEJA 1B3SA 3JUMA 1QMAA 3CCU3 2OTJ3 4GSPA 2H0IA 1K28A 3F9SA 2BIRA 1BANA 2RCDA 3FKAA 4J9AA 3G6E3 3HK4A 3KN4A 4L8OA 1A2KA 4R9KA 3EJVA 2XGNA 2P05A 1T2HA 1ZO2A 1MWSA 2CK3H 1BRGA 1O7GB 3GZBA 4KFFA 2HMNB 4X2HA 3CU3A 5BVBA 3F7SA 2CX1A 4X2OA 2WGOA 1CYVA 1UUGB 1FGQA 2CHCA 3OWUA 1A2VA 1TJDA 1GMQA 3FCSB 1MWTA 1OGZA 3CC43 1V74A 3MSOA 1BNEA 1US1A 1IYYA 1O7MB 1GS3A 2J8XB 1QJGA 3FG3A 1BNFA 7GSPA 1SIHA 1UUVB 1RGCA 1VZZA 1VQQA 4J5KA 5AEUB 2RFRA 4HM1B 1IT8A 3GZRA 1FA3A 1UI8A 5IG3A 3CCL3 4EW5A 3L0RA 1EA2A 1RGFA 1SIIA 1ZX2A 2W56A 5IG5A 1WNHA 2E2TA 1D6YA 1JB2A 1BNRA 3BB9A 5AYRB 3NHXA 1W6GA 1A2PA 1BOXA 1X1UA 2BO9B 2W04A 3N54B 4HM4B 3TDGA 5IW9A 1RMSA 2QA43 1BRSA 1G0TA 1CQSA 3B8LA 1W4NA 3MPHA 4TX4A 1JZOA 5KP4A 1V58A 1I8VA 3A76A 3BNDA 1M1K4 1G02A 2BMRB 3BNEA 2W9QA 3H3HA 3HI7A 2RSXA 4WWUC 2QIYA 4EC6A 3DGOA 1EEJA 1W5ZA 2F56A 4OUQA 1SQWA 5AIFA 3LXUX 2UUGC 3KSPA 1LXEA 1RGKA 3BLZA 2OQEA 1TFKA 2GBWB 2I9WA 3DXOA 1LOWA 3MYTA 3AGOA 2XRXB 2F86B 4RBNA 2FNQA 4FMBA 4BTXA 3CC73 1UCKA 3MG2A 4BL2A 1RLSA 2QEX3 4ILFA 1OHSA 1Q864 1DVDA 2QGUA 1UW1A 3FZWA 2PNCA 3MHEA 2R41A 3DY5A 3KCHA 1SJWA 1E97A 4FMAA 1Q7HA 2BNGA 4XBXA 3N9HA 1A90A 4U13A 1AVKA 5CXOA 1TU5A 1TRPA 3I553 1RN1A 3F8HA 4RZMA 4XM4A 3UNLA 4K1VA 1VQK3 1BSEA 2IUKA 3LTCA 1X1YA 1RGEA 3CCS3 1SARA 1LOVA 3NUVA 1QVG2 1JKGA 1DYUA 1FUTA 1OUNA 4BTYA 3KFQC 2RBIA 4NREA 2FGTA 4N3VA 2INXA 1MWRA 1O7PB 1X1WA 1DE3A 4EBGA 1EG9B 1LNIA 6STDA 1AR0A 4AKYA 1M904 2LYXA 1NB5I 3NBBA 1KSIA 5GSPA 1O7NB 5IF6A 2IYJA 1LQGC 1ZS7A 1RGHA 1FYSA 2CFLA 3BNBA 4HM6B 3CCJ3 1B2MA 4MEIA 5D83A 2K3DA 3LOYA 1C54A 1Q7Y4 5A0OB 3EN1B 2GEYA 2M7OA 3WODG 5ELUA 1W01A 1T5YA 4EV5A 2ZHXB 1RCKA 2IY2A 2L1SA 4ZM8A 1VQP3 2Z76A 1W7CA 1I2FA 2Z7AA 1OPYA 3X41A 2AADA 1BRIA 1BRKA 1LNHA 1W6CA 1B21A 2MC8A 1OGXA 1VQ93 4MMYB 2BMQB 2ML5A 4LZIA 1BU4A 5G1LA 1NO3A 1N9JA 4CPKA 1I0VA 1HZ1A 3FF0A 4NPBA 3BNCA 2CW9A 1NWWA 2KRTA 3OXAA 1YNVX 4HBRA 1RJOA 1T3BA 2SBLA 4HZBB 3CCM3 1N8R4 1VQ63 2GEXA 2BU4A 1TP6A 3T0UA 3RNTA 1K9M4 3NV0A 3MG3A 1ISKA 3CNMA 2XF3A 3OWYA 2LQVA 4L7KA 4I4KA 5JPUA 4HJLB 3S27A 3SVAA 3LMLA 4FCJA 2CWVA 1RRLA 3SLUA 3WHOA 2GXFA 1LOXA 4HM0B 1SPUA 3OX9A 3GZXB 2XSHB 1Z1SA 3D5GA 2JQ5A 5M18A 1D6UA 1STDA 4BIRA 1IQXA 3S5CA 2OQEC 3KKGA 5KP3A 3EX9A 1YGEA 2KCDA 1B2ZA 3D3LA 4AEQA 1OACA 1JBRA 3HX8A 5M19A 1GOVA 5IG0A 3J7Yd 2CFGA 4LGQA 3EBTA 1NNVA 3CPW2 5EEOA 3D9RA 2YX9A 4HM2B 4HYZA 2HMLB 4XDWA 1BNSA 3KZTA 1IU7A 1N8QA 2ZL8A 5I97A 3V92A 1YHQ3 3EBYA 3AHSA 1ROVA 3LZAA 4EV2A 1I2GA 1RN7A 1JBTA 1FZUA 3WOFB 1F8NA 4K61A 1YJW3 1YGWA 1OHOA 4LSOA 1JKGB 1I3IA 2CFWA 3DH2A 5STDA 3DMCA 3LH4A 2STDA 1QVF2 3KE7A 2W03A 1QALA 3QK9A 4XDVA 1N5PA 1GY6A 1ULJB 2KF4A 1U8CB 3LT8A 4IIAA 1CYUA 4NHFA 4CDLA 1VQN3 4FMDA 2YFLB 3GAXA 4R9LA 5AI1A 2XR8B 3SEDA 2SARA 5BXQA 3N8BA 3Q3FA 1I2EA 3GZYB 3NBRA 1KC84 4WYKA 1STFI 1GSPA 4DKIA 2Y74A 1MGWA 4EXRA 2OWPA 1UGHI 5DREA 4HKVB 1UI7A 3RGRA 2AAEA 3CME3 1WMOA 3QRDA 3IPTA 2WGQA 2R4IA 2C4BA 2GU3A 1BNJA 4HVNA 3FG1A 3LT9A 4HM8B 3HIGA 3F7XA 3NBJA 4L8PA 3VF1A 2OCTA 1NJI4 1RGGA 1GD4A 1DMQA 1E3RA 2C11A 2F5MA 3AMOB 3I563 3CMA3 1EKMA 1WQLB 3CC23 4I5QA 4CJNA 1HKXA 2IMJA 1GMRA 4HM5B 1OCVA 1JZDA 1OF5A 1JN5A 1RNTA 1B27A 3PCRA 4HZ9B 1D6ZA 4K90B 3UB1A 3UL6A 1RNBA 1JB4A 3U97A 2CFKA 5FGOA 1KD14 3GRDA 1JV2B 1KWIA 7RNTA 3Q2PA 4G1MB 2F4YA 3JUQA 3M8CA 3X42A 4OK0A 1IVXA 3WOEB 3B7CA 3EE1A 1YVSA 4KZ1A 1E3VA 3T8NA 4R4KA 4H61A 3SOYA 2D42A 1IVVA 3EF8A 4BTWA 6RNTA 1BUQA 2XFTA 1YI23 1JNQA 3CCR3 4MMXB 1I3FA 3UJMA 5CF2A 2E2VA 4CCVA 1EUIC 1DMMA 3NQZA 2PZVA 1IVWA 4FCMA 5JBSA 2UGIA 3G16A 1TRQA 4BL3A 2XSOB 5KP1A 1CH0A 1BSDA 3SX1A 1B2SA 2KF3A 5AYSC 2F98A 3MWZA 4LMIA 1W00A 4FCZA 2KF5A 1U5OA 3IJEB 1DMNA 1LQMB 2BMOB 3G0KA 2HMKB 4N6TA 1L5GB 4GHOA 3EC9A 4BU4A 1R4YA 3PS8A 1PU4A 1RCLA 2CKFB 2D1WA 4RNYA 1GYBA 3T8UA 2YFIB 3BU4A 2YFJB 3NM7A 3VSYA 1QAKA 1T2IA 1GD3A 1S5AA 3BIRA 1IQ8A 3RGAA 2OTL3 7STDA 4JF8A 1BAOA 3E99A 1RKYA 1K734 1VQ73 1HYFA 2XEPA 1IV7A 1V57A 4N6NB 3S67A 1FGRA 1OH0A 1A67A 1R4CA 2BHMA 4FMCA 4HM7B 1UCLA 4N6V0 3O8YA 5G2GA 2ZDJA 3F8XA 3RDEA 1YIJ3 1UGIA 4KFEA 3AGNA 3D5IA 3Q1CA 3SXXA 3ZG5A 1BIRA 1LOYA 2IUJA 1O7WB 3F14A 4RNZA 3S28A 1YIT3 1W2B2 5LC7A 1RTUA 3CD63 1UCJA 3DUKA 4GB5A 4QWTA 1FUWA 2GSPA 3NV0B 1JRQA 1ZGXA 1DVCA 1O7HB 3PYJA 3AMOA 5RNTA 5D81A 2WO0A 2P09A 4KFDA 4N6MA 4AKZA 1LRAA 1M1XB 2HMMB 3B4OA 1IQYA 5LC6A 3X40A 1B2UA 5IENA 3V99A 2CC3A 2Q07A 3WMDA 3ECFA 5IEPA 1HU9A 4J8TA 4OVMA 4XBYA 2CIUA 1JN5B 1I0XA 3JVCA 3S29A 1PFPA 3DGYA 3STDA 4LYLB 1K41A 3K63A 5TGNA 1FUSA 3PCSA 3LTAA 8CHOA 8RNTA 2K0MA 3DGNA 3EQQB 3JUOA 1GOYA 2E2UA 4WHAA 1TUHA 2H0GA 1FW7A 2JDIH 4WFOA 2RGQA 2KAAA 1BSAA 1FGMA 4RNTA 1AV4A 2CG1A 2F99A 2B1XB 4HAAA 3CNXA 3EHCA 1J2BA 1IVUA 1GY7A 1Y4KA 2KF6A 1B20A 2WOFA 4O2HA 1VQM3 4STDA 1NB3I 2ML6A 2GBXB 3K9MC 1N5HA 1ULIB 1GOUA 1WMPA 2W2CA 2P0MA 2XGLA 2CH9A 3CXC2 3WA3A 1I70A 1Q40A 4WP5A 1YVBI 1RN4A 3VGNA 1BGSA 1MWUA 1NU3A 3F40A 2HOHA 3FSDA 3DGMA 1UCIA 4N6OB 3OV4A 1QAFA 1MGRA 4IT7A 6GSPA 3PXMA 2UX0A 3I0YA 5CK6A 1BVIA 1OHPA 3D4AA 3SYUA 4H3UA 5IERA 1BRJA 1Q9EA 2CWUA 1WTHA 3LTDA 3OW22 3EB8A 2W0QA 1Q40B 1W2ZA 3URPA 2CX0A 1Q814 4HM3B 1BRHA 2H0HA 3ALAA 1FGTA 1RGLA 4KT3B 3MKIA 1JBSA 3JUNA 1FGOA 3HIIA 5DRVA 1N9EA 1AQZA 2P38A 3NX0A 3NXJA 5AIHA 1RSNA 3FH1A 1M9GA 2CG0A 3WA2X 1OF5B 1WMNA 1PYLA 1CEWI 1JB5A 2F5WA 2OOVA 3K5TA 4IPBA 3X3XA 4O8SA 1VQO3 1MNLA 4N6UA 4JRFA 3KSED 4FR9A 1TTOA 4GL6A 4ORLA 2CWTA 3CCE3 4K1UA 4Q53A 5CLKA 3UL5A 2RNTA 2IA7A 1BNIA 1JJ22 3JUPA 1S723 5HOHA 1UDII 3EN8A 1ASKA 1TIJA 5HGRA 1VQ83 1YJ93 2BT3A 1UUWB 3G713 2OOVC 5M1AA 3ZFZA 1RRHA 2B24B 3K0ZA 3GSPA 3CCQ3 3D79A 3LYGA 3HZPA 5IEOA 5AIGA 4R1KA 3DGLA 1YJN3 1IT7A 4O3VA 4MJDA 1AVLA 1BNGA 2K54A 2WOHA 1EQKA 4XBTA 4XB5A 1C7HA 1PY3A 3CCV3 1Q824 1W6YA 2HMJB 2W56B 4KVHA 3NQYA 3CPOA 3X3YA 5CF1A 3GWRA 5IG4A 3OWSA 3FGYA 2KXGA 5AIIA 3MG1A 5G1KA 1NDOB 9RNTA 2Y73A 3PZWA 1IK3A 1DETA 1BUJA 1TFOA 2Z6BA 3V98A 2ZA4A 3KIIA 3DM8A 3ZG0A 3ER7A 3WDGB 5BIRA 2O3OA 3FF2A 3HOHA 4HOHA 3FG4A 1G96A 1IDPA 3A5EA 5D82A 1BSBA
chains in the Genus database with same CATH topology
2MF7A 4WYKB 5FW5A 1MOLA 2A15A 2C10A 2FXTA 2XFSA 5ELJA 5JPPA 4N6LA 5EVHA 2CFDA 2V1LA 1VQ53 4R80A 4LEHA 1W02A 1Q42A 3H51A 3K7CA 1ROAA 4EYCA 3PGBA 5AEWB 3Q90A 3G8ZA 1GY5A 3FLJA 2Z77A 3IMAB 3NM2A 1KQS2 2O9UX 3LTBA 1VQL3 3G4S3 3B4PA 2P0XA 1LVNA 4MMZB 2XH9A 1VQ43 1IV9A 2W9PA 3ROBA 4O02B 3X3ZA 2L4VA 3SOAA 3DZLA 3U1WA 1K8A4 5EQLA 2W6JH 2HMOB 2GU1A 4PEJA 3JUMA 1QMAA 3CCU3 2OTJ3 1K28A 3F9SA 3G6E3 2RCDA 3FKAA 4J9AA 3HK4A 3KN4A 4L8OA 1A2KA 4R9KA 3EJVA 2XGNA 2P05A 1ZO2A 3GZBA 2CK3H 1O7GB 4KFFA 2HMNB 4X2HA 3CU3A 5BVBA 3F7SA 4X2OA 2WGOA 1CYVA 1FGQA 2CHCA 3OWUA 1A2VA 3FCSB 1OGZA 3CC43 1V74A 3MSOA 1US1A 1O7MB 1GS3A 1QJGA 3FG3A 1SIHA 1UUVB 1VZZA 5AEUB 2RFRA 4HM1B 1IT8A 3GZRA 1FA3A 1UI8A 5IG3A 3CCL3 3L0RA 1EA2A 1SIIA 1ZX2A 2W56A 5IG5A 1WNHA 2E2TA 1D6YA 1JB2A 3BB9A 5AYRB 3NHXA 1W6GA 3N54B 2BO9B 2W04A 4HM4B 3TDGA 5IW9A 2QA43 1A67A 3B8LA 1CQSA 3MPHA 1W4NA 4TX4A 5KP4A 3A76A 3BNDA 1M1K4 2BMRB 3BNEA 2W9QA 3H3HA 3HI7A 2RSXA 4WWUC 2QIYA 4EC6A 3DGOA 1W5ZA 4OUQA 1SQWA 5AIFA 3LXUX 3KSPA 1LXEA 3BLZA 2OQEA 1TFKA 2GBWB 2I9WA 3DXOA 3MYTA 2XRXB 2F86B 4RBNA 2FNQA 4FMBA 4BTXA 3CC73 3MG2A 2QEX3 1OHSA 1Q864 1DVDA 2QGUA 1UW1A 3FZWA 2PNCA 3MHEA 3DY5A 1SJWA 1E97A 4FMAA 2BNGA 4XBXA 1A90A 3N9HA 4U13A 1AVKA 5CXOA 1TU5A 3I553 3F8HA 4RZMA 4XM4A 3UNLA 4K1VA 1VQK3 2IUKA 3LTCA 3CCS3 3NUVA 1QVG2 1JKGA 1DYUA 1OUNA 4BTYA 3KFQC 4NREA 2FGTA 4N3VA 2INXA 1O7PB 4EBGA 1EG9B 6STDA 1M904 1AR0A 4AKYA 2LYXA 1NB5I 3NBBA 1KSIA 1O7NB 5IF6A 3BNBA 2CFLA 4HM6B 3CCJ3 4MEIA 5D83A 3LOYA 1Q7Y4 5A0OB 3EN1B 2GEYA 2M7OA 3WODG 5ELUA 1W01A 1T5YA 4EV5A 4ZM8A 1VQP3 2Z76A 1W7CA 2Z7AA 3X41A 1OPYA 1LNHA 1W6CA 2MC8A 1OGXA 1VQ93 4MMYB 2BMQB 2ML5A 4LZIA 1NO3A 1N9JA 3FF0A 3BNCA 2CW9A 1NWWA 2KRTA 3OXAA 4HBRA 3CCM3 1RJOA 4HZBB 2SBLA 1N8R4 1VQ63 2GEXA 1K9M4 1TP6A 3T0UA 3NV0A 3MG3A 1ISKA 3CNMA 2XF3A 3OWYA 2LQVA 4L7KA 4I4KA 5JPUA 4HJLB 3S27A 3SVAA 3LMLA 4FCJA 2CWVA 1RRLA 3SLUA 2GXFA 1LOXA 4HM0B 1SPUA 3OX9A 3GZXB 2XSHB 1Z1SA 2JQ5A 1D6UA 1STDA 1IQXA 3S5CA 2OQEC 3KKGA 5KP3A 3EX9A 1YGEA 2KCDA 3D3LA 4AEQA 1OACA 3HX8A 5IG0A 3J7Yd 2CFGA 4LGQA 3EBTA 3CPW2 5EEOA 3D9RA 2YX9A 4HM2B 4HYZA 2HMLB 4XDWA 3KZTA 1IU7A 1N8QA 2ZL8A 5I97A 3V92A 1YHQ3 3EBYA 1ROVA 3LZAA 4EV2A 1RN7A 3WOFB 1F8NA 4K61A 1YJW3 1OHOA 4LSOA 1JKGB 2CFWA 5STDA 3DMCA 3LH4A 2STDA 1QVF2 3KE7A 2W03A 1QALA 3QK9A 4XDVA 1N5PA 1GY6A 1ULJB 1U8CB 3LT8A 4IIAA 1CYUA 4NHFA 4CDLA 1VQN3 4FMDA 2YFLB 3GAXA 4R9LA 5AI1A 2XR8B 3SEDA 5BXQA 3N8BA 3GZYB 3NBRA 1KC84 4WYKA 1STFI 2Y74A 4EXRA 2OWPA 5DREA 4HKVB 1UI7A 3RGRA 3CME3 1WMOA 3QRDA 3IPTA 2WGQA 2R4IA 2GU3A 4HVNA 3FG1A 3LT9A 4HM8B 3HIGA 3F7XA 3NBJA 4L8PA 3VF1A 2OCTA 1NJI4 1GD4A 1DMQA 1E3RA 2C11A 3CMA3 3AMOB 3I563 1EKMA 1WQLB 3CC23 1HKXA 2IMJA 4HM5B 1OCVA 1OF5A 1JN5A 3PCRA 4HZ9B 1D6ZA 4K90B 3UB1A 3UL6A 1JB4A 3U97A 2CFKA 5FGOA 1KD14 3GRDA 1JV2B 1KWIA 3Q2PA 4G1MB 3X42A 3JUQA 3M8CA 4OK0A 1IVXA 3WOEB 3B7CA 3EE1A 4KZ1A 1E3VA 3T8NA 4R4KA 4H61A 3SOYA 2D42A 1IVVA 3EF8A 4BTWA 1BUQA 2XFTA 1YI23 1JNQA 3CCR3 4MMXB 3UJMA 5CF2A 2E2VA 4CCVA 1DMMA 3NQZA 2PZVA 1IVWA 4FCMA 5JBSA 3G16A 2XSOB 5KP1A 3SX1A 5AYSC 2F98A 3MWZA 4LMIA 1W00A 4FCZA 1U5OA 3IJEB 1DMNA 2BMOB 3G0KA 2HMKB 4N6TA 1L5GB 3EC9A 3PS8A 1PU4A 2CKFB 2D1WA 4RNYA 3T8UA 1GYBA 2YFIB 3NM7A 2YFJB 3VSYA 1QAKA 1GD3A 1S5AA 1IQ8A 3RGAA 2OTL3 7STDA 4JF8A 3E99A 1RKYA 1K734 1VQ73 2XEPA 1IV7A 4N6NB 3S67A 1FGRA 1OH0A 1R4CA 2BHMA 4FMCA 4HM7B 4N6V0 3O8YA 5G2GA 2ZDJA 3F8XA 3RDEA 1YIJ3 4KFEA 3SXXA 3Q1CA 2IUJA 1O7WB 3F14A 4RNZA 3S28A 1YIT3 1W2B2 5LC7A 3CD63 4QWTA 3DUKA 4GB5A 1FUWA 3NV0B 1JRQA 1DVCA 1O7HB 3PYJA 3AMOA 5D81A 2WO0A 2P09A 4KFDA 4N6MA 4AKZA 3B4OA 1M1XB 2HMMB 5LC6A 1IQYA 1Q824 3X40A 5IENA 3V99A 2CC3A 2Q07A 3WMDA 3ECFA 5IEPA 1HU9A 4J8TA 4OVMA 4XBYA 2CIUA 1JN5B 3JVCA 3S29A 1PFPA 3STDA 1K41A 3K63A 5TGNA 3PCSA 3LTAA 8CHOA 2K0MA 3DGNA 3EQQB 3JUOA 2E2UA 4WHAA 1TUHA 2JDIH 4WFOA 2RGQA 1FGMA 1AV4A 2CG1A 2F99A 2B1XB 3CNXA 3EHCA 1J2BA 1IVUA 1GY7A 1Y4KA 2WOFA 4O2HA 1VQM3 4STDA 1NB3I 2ML6A 2GBXB 3K9MC 1N5HA 1ULIB 1WMPA 2W2CA 2P0MA 2XGLA 2CH9A 3CXC2 3WA3A 1Q40A 4WP5A 1YVBI 3VGNA 1NU3A 3F40A 3FSDA 3DGMA 4N6OB 3OV4A 1QAFA 4IT7A 3PXMA 2UX0A 3I0YA 5CK6A 1OHPA 4H3UA 5IERA 2CWUA 1WTHA 3LTDA 3OW22 3EB8A 2W0QA 1Q40B 1W2ZA 1Q814 4HM3B 3ALAA 1FGTA 3MKIA 3JUNA 1FGOA 3HIIA 5DRVA 1N9EA 2P38A 3NXJA 3NX0A 5AIHA 3FH1A 1M9GA 2CG0A 3WA2X 1OF5B 1WMNA 1CEWI 1JB5A 2OOVA 3K5TA 4IPBA 3X3XA 4O8SA 1VQO3 1MNLA 4N6UA 4JRFA 3KSED 4FR9A 4GL6A 4ORLA 2CWTA 3CCE3 4K1UA 4Q53A 5CLKA 3UL5A 2IA7A 1JJ22 3JUPA 1S723 5HGRA 3EN8A 1ASKA 1TIJA 1VQ83 1YJ93 2BT3A 1UUWB 3G713 2OOVC 1RRHA 2B24B 3K0ZA 3CCQ3 3LYGA 3HZPA 5IEOA 5AIGA 4R1KA 3DGLA 1YJN3 1IT7A 4O3VA 4MJDA 1AVLA 2WOHA 2K54A 1EQKA 4XBTA 4XB5A 1C7HA 3CCV3 1W6YA 2HMJB 2W56B 4KVHA 3NQYA 3CPOA 3X3YA 5CF1A 3GWRA 5IG4A 3OWSA 3FGYA 2KXGA 5AIIA 3MG1A 1NDOB 2Y73A 3PZWA 1IK3A 1TFOA 2Z6BA 3V98A 3KIIA 3DM8A 3ER7A 3WDGB 2O3OA 3FF2A 3FG4A 1G96A 1IDPA 5D82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYK B;  5FW5 A;  2A15 A;  2OWP A;  3EQQ B;  3JUO A;  5DRE A;  4HKV B;  3RGR A;  1TUH A;  3IPT A;  5JPP A;  2RGQ A;  3NUV A;  2R4I A;  1JKG A;  4HVN A;  5IER A;  5EVH A;  1OUN A;  4HM8 B;  4LEH A;  2F99 A;  2B1X B;  3F7X A;  4L8P A;  4N3V A;  2INX A;  1O7P B;  1DMQ A;  1E3R A;  3CNX A;  3EHC A;  1EG9 B;  1W02 A;  1GY7 A;  1AR0 A;  1WQL B;  6STD A;  1Q42 A;  3H51 A;  1HKX A;  2IMJ A;  5JPU A;  1O7N B;  3K7C A;  4HM5 B;  5IF6 A;  1OCV A;  4HM6 B;  4STD A;  1OF5 A;  2GBX B;  5AEW B;  5D83 A;  1ULI B;  3Q90 A;  3G8Z A;  1GY5 A;  3FLJ A;  1JN5 A;  2Z77 A;  3NM2 A;  2W2C A;  4HZ9 B;  3EN1 B;  2GEY A;  1W01 A;  3B4P A;  1JB4 A;  2Z76 A;  3GRD A;  2Z7A A;  1OPY A;  1Q40 A;  4WP5 A;  3JUQ A;  3M8C A;  3ROB A;  3VGN A;  3B7C A;  1NU3 A;  3DZL A;  1OGX A;  1E3V A;  3F40 A;  3FSD A;  2BMQ B;  3OV4 A;  3SOA A;  3T8N A;  3SOY A;  2HMO B;  4PEJ A;  3JUM A;  1QMA A;  2UX0 A;  3EF8 A;  3FF0 A;  1OHP A;  3I0Y A;  3F9S A;  5CK6 A;  1NWW A;  2RCD A;  3FKA A;  3OXA A;  4H3U A;  4J9A A;  3HK4 A;  4HZB B;  4L8O A;  1A2K A;  4R9K A;  3UJM A;  2GEX A;  5CF2 A;  3EJV A;  1DMM A;  1TP6 A;  2PZV A;  3NV0 A;  3MG3 A;  1ISK A;  4FCM A;  1ZO2 A;  1Q40 B;  3CNM A;  3G16 A;  3GZB A;  1O7G B;  3OWY A;  4HM3 B;  4I4K A;  2HMN B;  2XSO B;  4HJL B;  3CU3 A;  4L7K A;  3F7S A;  4FCJ A;  4X2H A;  5BVB A;  5KP1 A;  4X2O A;  1BUQ A;  3MKI A;  2GXF A;  2CHC A;  3OWU A;  4HM0 B;  3JUN A;  3OX9 A;  3GZX B;  5DRV A;  3UNL A;  1OGZ A;  3NXJ A;  2XSH B;  3MSO A;  2F98 A;  4LMI A;  5AIH A;  1O7M B;  1GS3 A;  3FH1 A;  1W00 A;  1Z1S A;  1QJG A;  2JQ5 A;  1OF5 B;  1STD A;  1UUV B;  1VZZ A;  1U5O A;  5AEU B;  3S5C A;  1DMN A;  2BMO B;  1JB5 A;  2RFR A;  3KKG A;  3G0K A;  2HMK B;  3EX9 A;  3GZR A;  4HM1 B;  5KP3 A;  5IG3 A;  3EC9 A;  1EA2 A;  4ORL A;  2CKF B;  3T8U A;  4K1U A;  1ZX2 A;  1GYB A;  4Q53 A;  2YFI B;  5CLK A;  2YFJ B;  1JB2 A;  5IG5 A;  5D82 A;  3VSY A;  3BB9 A;  1S5A A;  3HX8 A;  3NHX A;  5IG0 A;  3RGA A;  3JUP A;  3EBT A;  4LGQ A;  4HM4 B;  3D9R A;  5HGR A;  3EN8 A;  1ASK A;  1CQS A;  2HML B;  3B8L A;  3E99 A;  4HM2 B;  4XDW A;  5KP4 A;  1UUW B;  3A76 A;  1OH0 A;  3KZT A;  4HM7 B;  2B24 B;  3K0Z A;  2BMR B;  5G2G A;  3F8X A;  3EBY A;  3H3H A;  3LYG A;  3HZP A;  4WWU C;  2QIY A;  3LZA A;  5IEO A;  5AIG A;  5IEP A;  4R1K A;  1O7W B;  3F14 A;  4OUQ A;  4MJD A;  5AIF A;  1OHO A;  2K54 A;  3KSP A;  3BLZ A;  4XBT A;  4XB5 A;  1JKG B;  1C7H A;  2GBW B;  2I9W A;  3DUK A;  3DXO A;  4GB5 A;  7STD A;  3MYT A;  5STD A;  3NV0 B;  1W6Y A;  2HMJ B;  3DMC A;  2XRX B;  2F86 B;  2STD A;  1O7H B;  4KVH A;  3MG2 A;  5D81 A;  3KE7 A;  3CPO A;  4XDV A;  5CF1 A;  1GY6 A;  1ULJ B;  3GWR A;  3OWS A;  3B4O A;  2HMM B;  5IG4 A;  3FGY A;  1OHS A;  4IIA A;  3MG1 A;  5AII A;  1NDO B;  4CDL A;  2QGU A;  3FZW A;  5AI1 A;  2YFL B;  5IEN A;  4R9L A;  3MHE A;  2XR8 B;  3SED A;  3WMD A;  1SJW A;  3DM8 A;  3ECF A;  4OVM A;  4J8T A;  5BXQ A;  1E97 A;  4XBY A;  3ER7 A;  2BNG A;  3GZY B;  1JN5 B;  3NBR A;  3FF2 A;  4RZM A;  4XBX A;  4U13 A;  4WYK A;  3STD A;  5CXO A;  1K41 A;  5TGN A;  3F8H A;  1IDP A;  4XM4 A;  4K1V A;  8CHO A; 
#chains in the Genus database with same CATH topology
 2MF7 A;  4WYK B;  1B2X A;  1MOL A;  2A15 A;  3AHW A;  5FW5 A;  1BRN L;  2C10 A;  2FXT A;  2XFS A;  5ELJ A;  1RDS A;  5JPP A;  1AY7 A;  4N6L A;  5EVH A;  2CFD A;  2V1L A;  1VQ5 3;  4R80 A;  4LEH A;  1W02 A;  1Q42 A;  3H51 A;  3K7C A;  4J5G A;  1X1X A;  1ROA A;  4EYC A;  3PGB A;  5AEW B;  3Q90 A;  3G8Z A;  1GY5 A;  3FLJ A;  1BSC A;  2Z77 A;  3IMA B;  3NM2 A;  1KQS 2;  2O9U X;  3LTB A;  1VQL 3;  1RHL A;  3G4S 3;  3B4P A;  2P0X A;  1LVN A;  4MMZ B;  3WR2 A;  2XH9 A;  1VQ4 3;  1IV9 A;  1RGA A;  2W9P A;  3ROB A;  4O02 B;  3X3Z A;  2L4V A;  3SOA A;  3DZL A;  3U1W A;  1K8A 4;  5EQL A;  2W6J H;  5BU4 A;  2HMO B;  1GMP A;  2GU1 A;  4PEJ A;  1B3S A;  3JUM A;  1QMA A;  3CCU 3;  2OTJ 3;  4GSP A;  2H0I A;  1K28 A;  3F9S A;  2BIR A;  1BAN A;  2RCD A;  3FKA A;  4J9A A;  3G6E 3;  3HK4 A;  3KN4 A;  4L8O A;  1A2K A;  4R9K A;  3EJV A;  2XGN A;  2P05 A;  1T2H A;  1ZO2 A;  1MWS A;  2CK3 H;  1BRG A;  1O7G B;  3GZB A;  4KFF A;  2HMN B;  4X2H A;  3CU3 A;  5BVB A;  3F7S A;  2CX1 A;  4X2O A;  2WGO A;  1CYV A;  1UUG B;  1FGQ A;  2CHC A;  3OWU A;  1A2V A;  1TJD A;  1GMQ A;  3FCS B;  1MWT A;  1OGZ A;  3CC4 3;  1V74 A;  3MSO A;  1BNE A;  1US1 A;  1IYY A;  1O7M B;  1GS3 A;  2J8X B;  1QJG A;  3FG3 A;  1BNF A;  7GSP A;  1SIH A;  1UUV B;  1RGC A;  1VZZ A;  1VQQ A;  4J5K A;  5AEU B;  2RFR A;  4HM1 B;  1IT8 A;  3GZR A;  1FA3 A;  1UI8 A;  5IG3 A;  3CCL 3;  4EW5 A;  3L0R A;  1EA2 A;  1RGF A;  1SII A;  1ZX2 A;  2W56 A;  5IG5 A;  1WNH A;  2E2T A;  1D6Y A;  1JB2 A;  1BNR A;  3BB9 A;  5AYR B;  3NHX A;  1W6G A;  1A2P A;  1BOX A;  1X1U A;  2BO9 B;  2W04 A;  3N54 B;  4HM4 B;  3TDG A;  5IW9 A;  1RMS A;  2QA4 3;  1BRS A;  1G0T A;  1CQS A;  3B8L A;  1W4N A;  3MPH A;  4TX4 A;  1JZO A;  5KP4 A;  1V58 A;  1I8V A;  3A76 A;  3BND A;  1M1K 4;  1G02 A;  2BMR B;  3BNE A;  2W9Q A;  3H3H A;  3HI7 A;  2RSX A;  4WWU C;  2QIY A;  4EC6 A;  3DGO A;  1EEJ A;  1W5Z A;  2F56 A;  4OUQ A;  1SQW A;  5AIF A;  3LXU X;  2UUG C;  3KSP A;  1LXE A;  1RGK A;  3BLZ A;  2OQE A;  1TFK A;  2GBW B;  2I9W A;  3DXO A;  1LOW A;  3MYT A;  3AGO A;  2XRX B;  2F86 B;  4RBN A;  2FNQ A;  4FMB A;  4BTX A;  3CC7 3;  1UCK A;  3MG2 A;  4BL2 A;  1RLS A;  2QEX 3;  4ILF A;  1OHS A;  1Q86 4;  1DVD A;  2QGU A;  1UW1 A;  3FZW A;  2PNC A;  3MHE A;  2R41 A;  3DY5 A;  3KCH A;  1SJW A;  1E97 A;  4FMA A;  1Q7H A;  2BNG A;  4XBX A;  3N9H A;  1A90 A;  4U13 A;  1AVK A;  5CXO A;  1TU5 A;  1TRP A;  3I55 3;  1RN1 A;  3F8H A;  4RZM A;  4XM4 A;  3UNL A;  4K1V A;  1VQK 3;  1BSE A;  2IUK A;  3LTC A;  1X1Y A;  1RGE A;  3CCS 3;  1SAR A;  1LOV A;  3NUV A;  1QVG 2;  1JKG A;  1DYU A;  1FUT A;  1OUN A;  4BTY A;  3KFQ C;  2RBI A;  4NRE A;  2FGT A;  4N3V A;  2INX A;  1MWR A;  1O7P B;  1X1W A;  1DE3 A;  4EBG A;  1EG9 B;  1LNI A;  6STD A;  1AR0 A;  4AKY A;  1M90 4;  2LYX A;  1NB5 I;  3NBB A;  1KSI A;  5GSP A;  1O7N B;  5IF6 A;  2IYJ A;  1LQG C;  1ZS7 A;  1RGH A;  1FYS A;  2CFL A;  3BNB A;  4HM6 B;  3CCJ 3;  1B2M A;  4MEI A;  5D83 A;  2K3D A;  3LOY A;  1C54 A;  1Q7Y 4;  5A0O B;  3EN1 B;  2GEY A;  2M7O A;  3WOD G;  5ELU A;  1W01 A;  1T5Y A;  4EV5 A;  2ZHX B;  1RCK A;  2IY2 A;  2L1S A;  4ZM8 A;  1VQP 3;  2Z76 A;  1W7C A;  1I2F A;  2Z7A A;  1OPY A;  3X41 A;  2AAD A;  1BRI A;  1BRK A;  1LNH A;  1W6C A;  1B21 A;  2MC8 A;  1OGX A;  1VQ9 3;  4MMY B;  2BMQ B;  2ML5 A;  4LZI A;  1BU4 A;  5G1L A;  1NO3 A;  1N9J A;  4CPK A;  1I0V A;  1HZ1 A;  3FF0 A;  4NPB A;  3BNC A;  2CW9 A;  1NWW A;  2KRT A;  3OXA A;  1YNV X;  4HBR A;  1RJO A;  1T3B A;  2SBL A;  4HZB B;  3CCM 3;  1N8R 4;  1VQ6 3;  2GEX A;  2BU4 A;  1TP6 A;  3T0U A;  3RNT A;  1K9M 4;  3NV0 A;  3MG3 A;  1ISK A;  3CNM A;  2XF3 A;  3OWY A;  2LQV A;  4L7K A;  4I4K A;  5JPU A;  4HJL B;  3S27 A;  3SVA A;  3LML A;  4FCJ A;  2CWV A;  1RRL A;  3SLU A;  3WHO A;  2GXF A;  1LOX A;  4HM0 B;  1SPU A;  3OX9 A;  3GZX B;  2XSH B;  1Z1S A;  3D5G A;  2JQ5 A;  5M18 A;  1D6U A;  1STD A;  4BIR A;  1IQX A;  3S5C A;  2OQE C;  3KKG A;  5KP3 A;  3EX9 A;  1YGE A;  2KCD A;  1B2Z A;  3D3L A;  4AEQ A;  1OAC A;  1JBR A;  3HX8 A;  5M19 A;  1GOV A;  5IG0 A;  3J7Y d;  2CFG A;  4LGQ A;  3EBT A;  1NNV A;  3CPW 2;  5EEO A;  3D9R A;  2YX9 A;  4HM2 B;  4HYZ A;  2HML B;  4XDW A;  1BNS A;  3KZT A;  1IU7 A;  1N8Q A;  2ZL8 A;  5I97 A;  3V92 A;  1YHQ 3;  3EBY A;  3AHS A;  1ROV A;  3LZA A;  4EV2 A;  1I2G A;  1RN7 A;  1JBT A;  1FZU A;  3WOF B;  1F8N A;  4K61 A;  1YJW 3;  1YGW A;  1OHO A;  4LSO A;  1JKG B;  1I3I A;  2CFW A;  3DH2 A;  5STD A;  3DMC A;  3LH4 A;  2STD A;  1QVF 2;  3KE7 A;  2W03 A;  1QAL A;  3QK9 A;  4XDV A;  1N5P A;  1GY6 A;  1ULJ B;  2KF4 A;  1U8C B;  3LT8 A;  4IIA A;  1CYU A;  4NHF A;  4CDL A;  1VQN 3;  4FMD A;  2YFL B;  3GAX A;  4R9L A;  5AI1 A;  2XR8 B;  3SED A;  2SAR A;  5BXQ A;  3N8B A;  3Q3F A;  1I2E A;  3GZY B;  3NBR A;  1KC8 4;  4WYK A;  1STF I;  1GSP A;  4DKI A;  2Y74 A;  1MGW A;  4EXR A;  2OWP A;  1UGH I;  5DRE A;  4HKV B;  1UI7 A;  3RGR A;  2AAE A;  3CME 3;  1WMO A;  3QRD A;  3IPT A;  2WGQ A;  2R4I A;  2C4B A;  2GU3 A;  1BNJ A;  4HVN A;  3FG1 A;  3LT9 A;  4HM8 B;  3HIG A;  3F7X A;  3NBJ A;  4L8P A;  3VF1 A;  2OCT A;  1NJI 4;  1RGG A;  1GD4 A;  1DMQ A;  1E3R A;  2C11 A;  2F5M A;  3AMO B;  3I56 3;  3CMA 3;  1EKM A;  1WQL B;  3CC2 3;  4I5Q A;  4CJN A;  1HKX A;  2IMJ A;  1GMR A;  4HM5 B;  1OCV A;  1JZD A;  1OF5 A;  1JN5 A;  1RNT A;  1B27 A;  3PCR A;  4HZ9 B;  1D6Z A;  4K90 B;  3UB1 A;  3UL6 A;  1RNB A;  1JB4 A;  3U97 A;  2CFK A;  5FGO A;  1KD1 4;  3GRD A;  1JV2 B;  1KWI A;  7RNT A;  3Q2P A;  4G1M B;  2F4Y A;  3JUQ A;  3M8C A;  3X42 A;  4OK0 A;  1IVX A;  3WOE B;  3B7C A;  3EE1 A;  1YVS A;  4KZ1 A;  1E3V A;  3T8N A;  4R4K A;  4H61 A;  3SOY A;  2D42 A;  1IVV A;  3EF8 A;  4BTW A;  6RNT A;  1BUQ A;  2XFT A;  1YI2 3;  1JNQ A;  3CCR 3;  4MMX B;  1I3F A;  3UJM A;  5CF2 A;  2E2V A;  4CCV A;  1EUI C;  1DMM A;  3NQZ A;  2PZV A;  1IVW A;  4FCM A;  5JBS A;  2UGI A;  3G16 A;  1TRQ A;  4BL3 A;  2XSO B;  5KP1 A;  1CH0 A;  1BSD A;  3SX1 A;  1B2S A;  2KF3 A;  5AYS C;  2F98 A;  3MWZ A;  4LMI A;  1W00 A;  4FCZ A;  2KF5 A;  1U5O A;  3IJE B;  1DMN A;  1LQM B;  2BMO B;  3G0K A;  2HMK B;  4N6T A;  1L5G B;  4GHO A;  3EC9 A;  4BU4 A;  1R4Y A;  3PS8 A;  1PU4 A;  1RCL A;  2CKF B;  2D1W A;  4RNY A;  1GYB A;  3T8U A;  2YFI B;  3BU4 A;  2YFJ B;  3NM7 A;  3VSY A;  1QAK A;  1T2I A;  1GD3 A;  1S5A A;  3BIR A;  1IQ8 A;  3RGA A;  2OTL 3;  7STD A;  4JF8 A;  1BAO A;  3E99 A;  1RKY A;  1K73 4;  1VQ7 3;  1HYF A;  2XEP A;  1IV7 A;  1V57 A;  4N6N B;  3S67 A;  1FGR A;  1OH0 A;  1A67 A;  1R4C A;  2BHM A;  4FMC A;  4HM7 B;  1UCL A;  4N6V 0;  3O8Y A;  5G2G A;  2ZDJ A;  3F8X A;  3RDE A;  1YIJ 3;  1UGI A;  4KFE A;  3AGN A;  3D5I A;  3Q1C A;  3SXX A;  3ZG5 A;  1BIR A;  1LOY A;  2IUJ A;  1O7W B;  3F14 A;  4RNZ A;  3S28 A;  1YIT 3;  1W2B 2;  5LC7 A;  1RTU A;  3CD6 3;  1UCJ A;  3DUK A;  4GB5 A;  4QWT A;  1FUW A;  2GSP A;  3NV0 B;  1JRQ A;  1ZGX A;  1DVC A;  1O7H B;  3PYJ A;  3AMO A;  5RNT A;  5D81 A;  2WO0 A;  2P09 A;  4KFD A;  4N6M A;  4AKZ A;  1LRA A;  1M1X B;  2HMM B;  3B4O A;  1IQY A;  5LC6 A;  3X40 A;  1B2U A;  5IEN A;  3V99 A;  2CC3 A;  2Q07 A;  3WMD A;  3ECF A;  5IEP A;  1HU9 A;  4J8T A;  4OVM A;  4XBY A;  2CIU A;  1JN5 B;  1I0X A;  3JVC A;  3S29 A;  1PFP A;  3DGY A;  3STD A;  4LYL B;  1K41 A;  3K63 A;  5TGN A;  1FUS A;  3PCS A;  3LTA A;  8CHO A;  8RNT A;  2K0M A;  3DGN A;  3EQQ B;  3JUO A;  1GOY A;  2E2U A;  4WHA A;  1TUH A;  2H0G A;  1FW7 A;  2JDI H;  4WFO A;  2RGQ A;  2KAA A;  1BSA A;  1FGM A;  4RNT A;  1AV4 A;  2CG1 A;  2F99 A;  2B1X B;  4HAA A;  3CNX A;  3EHC A;  1J2B A;  1IVU A;  1GY7 A;  1Y4K A;  2KF6 A;  1B20 A;  2WOF A;  4O2H A;  1VQM 3;  4STD A;  1NB3 I;  2ML6 A;  2GBX B;  3K9M C;  1N5H A;  1ULI B;  1GOU A;  1WMP A;  2W2C A;  2P0M A;  2XGL A;  2CH9 A;  3CXC 2;  3WA3 A;  1I70 A;  1Q40 A;  4WP5 A;  1YVB I;  1RN4 A;  3VGN A;  1BGS A;  1MWU A;  1NU3 A;  3F40 A;  2HOH A;  3FSD A;  3DGM A;  1UCI A;  4N6O B;  3OV4 A;  1QAF A;  1MGR A;  4IT7 A;  6GSP A;  3PXM A;  2UX0 A;  3I0Y A;  5CK6 A;  1BVI A;  1OHP A;  3D4A A;  3SYU A;  4H3U A;  5IER A;  1BRJ A;  1Q9E A;  2CWU A;  1WTH A;  3LTD A;  3OW2 2;  3EB8 A;  2W0Q A;  1Q40 B;  1W2Z A;  3URP A;  2CX0 A;  1Q81 4;  4HM3 B;  1BRH A;  2H0H A;  3ALA A;  1FGT A;  1RGL A;  4KT3 B;  3MKI A;  1JBS A;  3JUN A;  1FGO A;  3HII A;  5DRV A;  1N9E A;  1AQZ A;  2P38 A;  3NX0 A;  3NXJ A;  5AIH A;  1RSN A;  3FH1 A;  1M9G A;  2CG0 A;  3WA2 X;  1OF5 B;  1WMN A;  1PYL A;  1CEW I;  1JB5 A;  2F5W A;  2OOV A;  3K5T A;  4IPB A;  3X3X A;  4O8S A;  1VQO 3;  1MNL A;  4N6U A;  4JRF A;  3KSE D;  4FR9 A;  1TTO A;  4GL6 A;  4ORL A;  2CWT A;  3CCE 3;  4K1U A;  4Q53 A;  5CLK A;  3UL5 A;  2RNT A;  2IA7 A;  1BNI A;  1JJ2 2;  3JUP A;  1S72 3;  5HOH A;  1UDI I;  3EN8 A;  1ASK A;  1TIJ A;  5HGR A;  1VQ8 3;  1YJ9 3;  2BT3 A;  1UUW B;  3G71 3;  2OOV C;  5M1A A;  3ZFZ A;  1RRH A;  2B24 B;  3K0Z A;  3GSP A;  3CCQ 3;  3D79 A;  3LYG A;  3HZP A;  5IEO A;  5AIG A;  4R1K A;  3DGL A;  1YJN 3;  1IT7 A;  4O3V A;  4MJD A;  1AVL A;  1BNG A;  2K54 A;  2WOH A;  1EQK A;  4XBT A;  4XB5 A;  1C7H A;  1PY3 A;  3CCV 3;  1Q82 4;  1W6Y A;  2HMJ B;  2W56 B;  4KVH A;  3NQY A;  3CPO A;  3X3Y A;  5CF1 A;  3GWR A;  5IG4 A;  3OWS A;  3FGY A;  2KXG A;  5AII A;  3MG1 A;  5G1K A;  1NDO B;  9RNT A;  2Y73 A;  3PZW A;  1IK3 A;  1DET A;  1BUJ A;  1TFO A;  2Z6B A;  3V98 A;  2ZA4 A;  3KII A;  3DM8 A;  3ZG0 A;  3ER7 A;  3WDG B;  5BIR A;  2O3O A;  3FF2 A;  3HOH A;  4HOH A;  3FG4 A;  1G96 A;  1IDP A;  3A5E A;  5D82 A;  1BSB A; 
#chains in the Genus database with same CATH homology
 2MF7 A;  4WYK B;  5FW5 A;  1MOL A;  2A15 A;  2C10 A;  2FXT A;  2XFS A;  5ELJ A;  5JPP A;  4N6L A;  5EVH A;  2CFD A;  2V1L A;  1VQ5 3;  4R80 A;  4LEH A;  1W02 A;  1Q42 A;  3H51 A;  3K7C A;  1ROA A;  4EYC A;  3PGB A;  5AEW B;  3Q90 A;  3G8Z A;  1GY5 A;  3FLJ A;  2Z77 A;  3IMA B;  3NM2 A;  1KQS 2;  2O9U X;  3LTB A;  1VQL 3;  3G4S 3;  3B4P A;  2P0X A;  1LVN A;  4MMZ B;  2XH9 A;  1VQ4 3;  1IV9 A;  2W9P A;  3ROB A;  4O02 B;  3X3Z A;  2L4V A;  3SOA A;  3DZL A;  3U1W A;  1K8A 4;  5EQL A;  2W6J H;  2HMO B;  2GU1 A;  4PEJ A;  3JUM A;  1QMA A;  3CCU 3;  2OTJ 3;  1K28 A;  3F9S A;  3G6E 3;  2RCD A;  3FKA A;  4J9A A;  3HK4 A;  3KN4 A;  4L8O A;  1A2K A;  4R9K A;  3EJV A;  2XGN A;  2P05 A;  1ZO2 A;  3GZB A;  2CK3 H;  1O7G B;  4KFF A;  2HMN B;  4X2H A;  3CU3 A;  5BVB A;  3F7S A;  4X2O A;  2WGO A;  1CYV A;  1FGQ A;  2CHC A;  3OWU A;  1A2V A;  3FCS B;  1OGZ A;  3CC4 3;  1V74 A;  3MSO A;  1US1 A;  1O7M B;  1GS3 A;  1QJG A;  3FG3 A;  1SIH A;  1UUV B;  1VZZ A;  5AEU B;  2RFR A;  4HM1 B;  1IT8 A;  3GZR A;  1FA3 A;  1UI8 A;  5IG3 A;  3CCL 3;  3L0R A;  1EA2 A;  1SII A;  1ZX2 A;  2W56 A;  5IG5 A;  1WNH A;  2E2T A;  1D6Y A;  1JB2 A;  3BB9 A;  5AYR B;  3NHX A;  1W6G A;  3N54 B;  2BO9 B;  2W04 A;  4HM4 B;  3TDG A;  5IW9 A;  2QA4 3;  1A67 A;  3B8L A;  1CQS A;  3MPH A;  1W4N A;  4TX4 A;  5KP4 A;  3A76 A;  3BND A;  1M1K 4;  2BMR B;  3BNE A;  2W9Q A;  3H3H A;  3HI7 A;  2RSX A;  4WWU C;  2QIY A;  4EC6 A;  3DGO A;  1W5Z A;  4OUQ A;  1SQW A;  5AIF A;  3LXU X;  3KSP A;  1LXE A;  3BLZ A;  2OQE A;  1TFK A;  2GBW B;  2I9W A;  3DXO A;  3MYT A;  2XRX B;  2F86 B;  4RBN A;  2FNQ A;  4FMB A;  4BTX A;  3CC7 3;  3MG2 A;  2QEX 3;  1OHS A;  1Q86 4;  1DVD A;  2QGU A;  1UW1 A;  3FZW A;  2PNC A;  3MHE A;  3DY5 A;  1SJW A;  1E97 A;  4FMA A;  2BNG A;  4XBX A;  1A90 A;  3N9H A;  4U13 A;  1AVK A;  5CXO A;  1TU5 A;  3I55 3;  3F8H A;  4RZM A;  4XM4 A;  3UNL A;  4K1V A;  1VQK 3;  2IUK A;  3LTC A;  3CCS 3;  3NUV A;  1QVG 2;  1JKG A;  1DYU A;  1OUN A;  4BTY A;  3KFQ C;  4NRE A;  2FGT A;  4N3V A;  2INX A;  1O7P B;  4EBG A;  1EG9 B;  6STD A;  1M90 4;  1AR0 A;  4AKY A;  2LYX A;  1NB5 I;  3NBB A;  1KSI A;  1O7N B;  5IF6 A;  3BNB A;  2CFL A;  4HM6 B;  3CCJ 3;  4MEI A;  5D83 A;  3LOY A;  1Q7Y 4;  5A0O B;  3EN1 B;  2GEY A;  2M7O A;  3WOD G;  5ELU A;  1W01 A;  1T5Y A;  4EV5 A;  4ZM8 A;  1VQP 3;  2Z76 A;  1W7C A;  2Z7A A;  3X41 A;  1OPY A;  1LNH A;  1W6C A;  2MC8 A;  1OGX A;  1VQ9 3;  4MMY B;  2BMQ B;  2ML5 A;  4LZI A;  1NO3 A;  1N9J A;  3FF0 A;  3BNC A;  2CW9 A;  1NWW A;  2KRT A;  3OXA A;  4HBR A;  3CCM 3;  1RJO A;  4HZB B;  2SBL A;  1N8R 4;  1VQ6 3;  2GEX A;  1K9M 4;  1TP6 A;  3T0U A;  3NV0 A;  3MG3 A;  1ISK A;  3CNM A;  2XF3 A;  3OWY A;  2LQV A;  4L7K A;  4I4K A;  5JPU A;  4HJL B;  3S27 A;  3SVA A;  3LML A;  4FCJ A;  2CWV A;  1RRL A;  3SLU A;  2GXF A;  1LOX A;  4HM0 B;  1SPU A;  3OX9 A;  3GZX B;  2XSH B;  1Z1S A;  2JQ5 A;  1D6U A;  1STD A;  1IQX A;  3S5C A;  2OQE C;  3KKG A;  5KP3 A;  3EX9 A;  1YGE A;  2KCD A;  3D3L A;  4AEQ A;  1OAC A;  3HX8 A;  5IG0 A;  3J7Y d;  2CFG A;  4LGQ A;  3EBT A;  3CPW 2;  5EEO A;  3D9R A;  2YX9 A;  4HM2 B;  4HYZ A;  2HML B;  4XDW A;  3KZT A;  1IU7 A;  1N8Q A;  2ZL8 A;  5I97 A;  3V92 A;  1YHQ 3;  3EBY A;  1ROV A;  3LZA A;  4EV2 A;  1RN7 A;  3WOF B;  1F8N A;  4K61 A;  1YJW 3;  1OHO A;  4LSO A;  1JKG B;  2CFW A;  5STD A;  3DMC A;  3LH4 A;  2STD A;  1QVF 2;  3KE7 A;  2W03 A;  1QAL A;  3QK9 A;  4XDV A;  1N5P A;  1GY6 A;  1ULJ B;  1U8C B;  3LT8 A;  4IIA A;  1CYU A;  4NHF A;  4CDL A;  1VQN 3;  4FMD A;  2YFL B;  3GAX A;  4R9L A;  5AI1 A;  2XR8 B;  3SED A;  5BXQ A;  3N8B A;  3GZY B;  3NBR A;  1KC8 4;  4WYK A;  1STF I;  2Y74 A;  4EXR A;  2OWP A;  5DRE A;  4HKV B;  1UI7 A;  3RGR A;  3CME 3;  1WMO A;  3QRD A;  3IPT A;  2WGQ A;  2R4I A;  2GU3 A;  4HVN A;  3FG1 A;  3LT9 A;  4HM8 B;  3HIG A;  3F7X A;  3NBJ A;  4L8P A;  3VF1 A;  2OCT A;  1NJI 4;  1GD4 A;  1DMQ A;  1E3R A;  2C11 A;  3CMA 3;  3AMO B;  3I56 3;  1EKM A;  1WQL B;  3CC2 3;  1HKX A;  2IMJ A;  4HM5 B;  1OCV A;  1OF5 A;  1JN5 A;  3PCR A;  4HZ9 B;  1D6Z A;  4K90 B;  3UB1 A;  3UL6 A;  1JB4 A;  3U97 A;  2CFK A;  5FGO A;  1KD1 4;  3GRD A;  1JV2 B;  1KWI A;  3Q2P A;  4G1M B;  3X42 A;  3JUQ A;  3M8C A;  4OK0 A;  1IVX A;  3WOE B;  3B7C A;  3EE1 A;  4KZ1 A;  1E3V A;  3T8N A;  4R4K A;  4H61 A;  3SOY A;  2D42 A;  1IVV A;  3EF8 A;  4BTW A;  1BUQ A;  2XFT A;  1YI2 3;  1JNQ A;  3CCR 3;  4MMX B;  3UJM A;  5CF2 A;  2E2V A;  4CCV A;  1DMM A;  3NQZ A;  2PZV A;  1IVW A;  4FCM A;  5JBS A;  3G16 A;  2XSO B;  5KP1 A;  3SX1 A;  5AYS C;  2F98 A;  3MWZ A;  4LMI A;  1W00 A;  4FCZ A;  1U5O A;  3IJE B;  1DMN A;  2BMO B;  3G0K A;  2HMK B;  4N6T A;  1L5G B;  3EC9 A;  3PS8 A;  1PU4 A;  2CKF B;  2D1W A;  4RNY A;  3T8U A;  1GYB A;  2YFI B;  3NM7 A;  2YFJ B;  3VSY A;  1QAK A;  1GD3 A;  1S5A A;  1IQ8 A;  3RGA A;  2OTL 3;  7STD A;  4JF8 A;  3E99 A;  1RKY A;  1K73 4;  1VQ7 3;  2XEP A;  1IV7 A;  4N6N B;  3S67 A;  1FGR A;  1OH0 A;  1R4C A;  2BHM A;  4FMC A;  4HM7 B;  4N6V 0;  3O8Y A;  5G2G A;  2ZDJ A;  3F8X A;  3RDE A;  1YIJ 3;  4KFE A;  3SXX A;  3Q1C A;  2IUJ A;  1O7W B;  3F14 A;  4RNZ A;  3S28 A;  1YIT 3;  1W2B 2;  5LC7 A;  3CD6 3;  4QWT A;  3DUK A;  4GB5 A;  1FUW A;  3NV0 B;  1JRQ A;  1DVC A;  1O7H B;  3PYJ A;  3AMO A;  5D81 A;  2WO0 A;  2P09 A;  4KFD A;  4N6M A;  4AKZ A;  3B4O A;  1M1X B;  2HMM B;  5LC6 A;  1IQY A;  1Q82 4;  3X40 A;  5IEN A;  3V99 A;  2CC3 A;  2Q07 A;  3WMD A;  3ECF A;  5IEP A;  1HU9 A;  4J8T A;  4OVM A;  4XBY A;  2CIU A;  1JN5 B;  3JVC A;  3S29 A;  1PFP A;  3STD A;  1K41 A;  3K63 A;  5TGN A;  3PCS A;  3LTA A;  8CHO A;  2K0M A;  3DGN A;  3EQQ B;  3JUO A;  2E2U A;  4WHA A;  1TUH A;  2JDI H;  4WFO A;  2RGQ A;  1FGM A;  1AV4 A;  2CG1 A;  2F99 A;  2B1X B;  3CNX A;  3EHC A;  1J2B A;  1IVU A;  1GY7 A;  1Y4K A;  2WOF A;  4O2H A;  1VQM 3;  4STD A;  1NB3 I;  2ML6 A;  2GBX B;  3K9M C;  1N5H A;  1ULI B;  1WMP A;  2W2C A;  2P0M A;  2XGL A;  2CH9 A;  3CXC 2;  3WA3 A;  1Q40 A;  4WP5 A;  1YVB I;  3VGN A;  1NU3 A;  3F40 A;  3FSD A;  3DGM A;  4N6O B;  3OV4 A;  1QAF A;  4IT7 A;  3PXM A;  2UX0 A;  3I0Y A;  5CK6 A;  1OHP A;  4H3U A;  5IER A;  2CWU A;  1WTH A;  3LTD A;  3OW2 2;  3EB8 A;  2W0Q A;  1Q40 B;  1W2Z A;  1Q81 4;  4HM3 B;  3ALA A;  1FGT A;  3MKI A;  3JUN A;  1FGO A;  3HII A;  5DRV A;  1N9E A;  2P38 A;  3NXJ A;  3NX0 A;  5AIH A;  3FH1 A;  1M9G A;  2CG0 A;  3WA2 X;  1OF5 B;  1WMN A;  1CEW I;  1JB5 A;  2OOV A;  3K5T A;  4IPB A;  3X3X A;  4O8S A;  1VQO 3;  1MNL A;  4N6U A;  4JRF A;  3KSE D;  4FR9 A;  4GL6 A;  4ORL A;  2CWT A;  3CCE 3;  4K1U A;  4Q53 A;  5CLK A;  3UL5 A;  2IA7 A;  1JJ2 2;  3JUP A;  1S72 3;  5HGR A;  3EN8 A;  1ASK A;  1TIJ A;  1VQ8 3;  1YJ9 3;  2BT3 A;  1UUW B;  3G71 3;  2OOV C;  1RRH A;  2B24 B;  3K0Z A;  3CCQ 3;  3LYG A;  3HZP A;  5IEO A;  5AIG A;  4R1K A;  3DGL A;  1YJN 3;  1IT7 A;  4O3V A;  4MJD A;  1AVL A;  2WOH A;  2K54 A;  1EQK A;  4XBT A;  4XB5 A;  1C7H A;  3CCV 3;  1W6Y A;  2HMJ B;  2W56 B;  4KVH A;  3NQY A;  3CPO A;  3X3Y A;  5CF1 A;  3GWR A;  5IG4 A;  3OWS A;  3FGY A;  2KXG A;  5AII A;  3MG1 A;  1NDO B;  2Y73 A;  3PZW A;  1IK3 A;  1TFO A;  2Z6B A;  3V98 A;  3KII A;  3DM8 A;  3ER7 A;  3WDG B;  2O3O A;  3FF2 A;  3FG4 A;  1G96 A;  1IDP A;  5D82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...