4CDLA

Crystal structure of retro-aldolase ra110.4-6 complexed with inhibitor 1-(6-methoxy-2-naphthalenyl)-1,3-butanedione
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATIESPFGQPPIHGREQIAAHYRKWLGGGKLRVYLTGPVRANHNGCGTMLLRKEWVWNGQPCATDVILVMRFDEQGRIQTEQRYWSEVNLCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Active Site Plasticity of a Computationally Designed Retro-Aldolase Enzyme
rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 126
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4cdlA00
1OHSA 3BB9A 1O7GB 3A76A 3SOYA 1C7HA 1E3VA 3EJVA 1O7MB 2BMQB 4HM5B 3FZWA 4STDA 3K0ZA 1Q40A 3EC9A 3EBTA 3LYGA 3G8ZA 3B8LA 1O7WB 1SJWA 1JN5A 4HKVB 1IDPA 3F8HA 3G16A 2XSOB 3ER7A 3NV0B 3EBYA 3LZAA 3CNXA 1OCVA 1OHOA 1TP6A 2Z77A 3NXJA 4R1KA 3OXAA 5IG3A 3VGNA 5FW5A 4FCJA 3MYTA 3FLJA 2RGQA 1W01A 5AIHA 1GY7A 1K41A 2GEXA 2I9WA 5D83A 3GZBA 3GWRA 4FCMA 3NBRA 3T8NA 4KVHA 2GEYA 2F98A 3B7CA 3T8UA 1ULJB 1QMAA 3CPOA 3EF8A 1ISKA 3F8XA 3DMCA 4WYKA 3M8CA 2HMNB 2YFLB 5JPUA 4WWUC 5AIGA 5CF2A 1ULIB 5IG4A 3FF0A 5AEUB 2XSHB 3FGYA 5DRVA 4MJDA 3UNLA 2QGUA 2CHCA 1DMNA 1TUHA 4OUQA 5D81A 4XB5A 4OVMA 1QJGA 3F9SA 1JN5B 1BUQA 1DMMA 5AIIA 3FSDA 5HGRA 2W2CA 5IF6A 4K1VA 3MG3A 5BXQA 2BMOB 4HM6B 8CHOA 1O7NB 4L7KA 2XR8B 3OWYA 5AIFA 1ZX2A 1O7HB 1ZO2A 4H3UA 3DZLA 3UJMA 4J8TA 3F7SA 3KKGA 3Q90A 3MG2A 1CQSA 1GY5A 3KZTA 1W00A 3MKIA 2XRXB 3OX9A 5IEOA 4PEJA 1OGXA 4XBXA 1UUWB 3KSPA 3F7XA 4WYKB 4HM8B 3GZXB 4XDWA 4L8OA 3EX9A 1OH0A 2YFIB 3JUNA 4X2OA 2RFRA 1Z1SA 4J9AA 1GY6A 3FKAA 1Q42A 1ASKA 1OGZA 3B4OA 4U13A 4XBYA 1HKXA 5CLKA 2PZVA 1JB5A 2B1XB 3G0KA 3E99A 3GZYB 4XBTA 1JKGA 4R9LA 4ORLA 2QIYA 1E97A 3HK4A 2Z76A 2B24B 4Q53A 2HMOB 4X2HA 2HMLB 2YFJB 7STDA 4HZBB 4HM2B 4WP5A 5IENA 3NV0A 3SOAA 5BVBA 1Q40B 3CNMA 3OV4A 1U5OA 3DM8A 1JB2A 2HMMB 4I4KA 2UX0A 5AI1A 2HMJB 1OF5A 3NUVA 3FH1A 5TGNA 3HZPA 3JUMA 4L8PA 5EVHA 5IERA 2Z7AA 4CDLA 2STDA 4HZ9B 3FF2A 3NM2A 3HX8A 2GBWB 3ROBA 4GB5A 4HM3B 3GRDA 5CK6A 3H3HA 5IEPA 3MG1A 4HM7B 3F40A 2BMRB 3RGAA 5JPPA 1AR0A 4LEHA 3EHCA 1NDOB 1JKGB 1NU3A 3EN8A 2INXA 3K7CA 2GXFA 2CKFB 3MSOA 3I0YA 2GBXB 5D82A 5DREA 5CF1A 1NWWA 4IIAA 5G2GA 5STDA 2F99A 1EG9B 3EQQB 2K54A 3DUKA 4HM4B 5IG5A 1JB4A 1W6YA 5CXOA 1OHPA 2HMKB 3CU3A 1OUNA 3F14A 2R4IA 1GYBA 4R9KA 4HJLB 1VZZA 2A15A 1GS3A 1OF5B 1WQLB 2IMJA 3JUPA 5KP1A 3SEDA 1A2KA 3KE7A 2RCDA 1O7PB 1W02A 1EA2A 5KP3A 5KP4A 3RGRA 3DXOA 3OWSA 3MHEA 3EN1B 4K1UA 3NHXA 4HVNA 2OWPA 4XDVA 4XM4A 1UUVB 1E3RA 1S5AA 1STDA 4N3VA 3WMDA 2BNGA 3JUQA 1OPYA 6STDA 3BLZA 4HM1B 3D9RA 3IPTA 4RZMA 3STDA 3VSYA 3H51A 3B4PA 3ECFA 3S5CA 2F86B 5IG0A 1DMQA 2JQ5A 3GZRA 4LMIA 3OWUA 4LGQA 3JUOA 5AEWB 4HM0B
chains in the Genus database with same CATH superfamily
3BNCA 1VQ73 1MWUA 1OHSA 1BNSA 2P0MA 4KFDA 3AGOA 5LC7A 4ILFA 4EC6A 3DH2A 1W4NA 3BB9A 3FCSB 1BNRA 2XEPA 1RJOA 1US1A 1LNHA 1N9EA 4H61A 2KF6A 1GOVA 3ZG5A 1OACA 1O7GB 3A76A 1RHLA 3SOYA 1R4CA 4QWTA 3K63A 3U97A 1X1XA 2IUJA 1C7HA 1E3VA 3EJVA 1WMOA 1Y4KA 3V99A 1I2FA 3N8BA 1W6GA 4EV2A 1O7MB 1B2XA 2F56A 3MPHA 6RNTA 2BMQB 1IT8A 2PNCA 2KF3A 4HM5B 3FZWA 2KRTA 3K5TA 4RNYA 4STDA 3K0ZA 1Q40A 3EC9A 3EBTA 3LYGA 3G8ZA 1FA3A 3B8LA 4K61A 4RNTA 4BL3A 1O7WB 1SJWA 2WOHA 1JN5A 4NPBA 2KF5A 1IVXA 1CYVA 1M904 1G0TA 4HKVB 1I2EA 1IDPA 3F8HA 3G16A 1A2PA 1RNBA 1VQL3 2XSOB 4FMCA 3ER7A 4BIRA 3NV0B 3EBYA 1FGRA 1C54A 1LOWA 1BNEA 3LZAA 3CNXA 3DY5A 1RGEA 1UUGB 2OQEC 1VQK3 1AQZA 1RN4A 1YVSA 1OCVA 2CX1A 3UL5A 1FGMA 2K3DA 2W9PA 2MC8A 4GSPA 1IVUA 1AVKA 1OHOA 2O9UX 3S29A 1TP6A 2SBLA 2Z77A 3NXJA 4R1KA 1K734 2K0MA 1VQN3 2ZHXB 1UGIA 3X40A 2OOVA 1LVNA 3OXAA 1IV9A 1FUSA 5IG3A 3VGNA 1T2HA 5FW5A 2CFWA 2V1LA 1NB3I 4FCJA 3MYTA 1AV4A 1MWRA 3FLJA 3S28A 2RGQA 1W01A 4AKYA 5AIHA 1GY7A 1LRAA 1M9GA 1U8CB 1K41A 4FMBA 1RRHA 2GEXA 2I9WA 1LXEA 4O8SA 5D83A 1RMSA 3N9HA 3GZBA 3GWRA 1FGQA 2YX9A 1JBSA 3D4AA 2F4YA 1LOXA 3IJEB 3NBRA 4FCMA 1DVCA 1UW1A 4RNZA 4KVHA 1SPUA 3T8NA 1W5ZA 1YIT3 2GEYA 4RBNA 1YGEA 2F98A 1N8QA 3B7CA 3T8UA 2D1WA 5EQLA 3LOYA 1ULJB 1V57A 3HIIA 1NB5I 2P05A 4FMDA 1QMAA 3CPOA 1RNTA 3EF8A 3CCV3 1K9M4 1ISKA 1FUWA 3F8XA 3DMCA 4WYKA 2WGOA 3M8CA 2HMNB 2YFLB 3J7Yd 2FNQA 5JPUA 2CG0A 3MWZA 4WWUC 7GSPA 1YHQ3 5AIGA 2ZDJA 3G6E3 5CF2A 5EEOA 1JBTA 1I0XA 3WOFB 1VQ93 1ULIB 5IG4A 3FF0A 5AEUB 2M7OA 2XSHB 4KT3B 1EKMA 3FGYA 3NBBA 5DRVA 3KIIA 1RLSA 1I0VA 3QRDA 1PU4A 4MJDA 3UNLA 3D3LA 3HIGA 4EBGA 3BU4A 1GOUA 2QGUA 4HYZA 1BSEA 2CHCA 4LSOA 3PS8A 1DMNA 1TUHA 2CFLA 4GL6A 4OUQA 3PXMA 5D81A 4XB5A 4BTWA 1GD3A 3DGYA 2QEX3 1RDSA 4OVMA 1BRKA 4O2HA 4DKIA 1QJGA 3F9SA 1B3SA 1JN5B 1BUQA 1SIIA 1UI8A 1TRPA 1TRQA 3SYUA 1BGSA 1B20A 1DMMA 5AIIA 1UCKA 3FSDA 5HGRA 2W2CA 3WODG 5IF6A 4K1VA 5LC6A 2CC3A 4R80A 2P0XA 5IW9A 3MG3A 5BXQA 1BSCA 2W04A 2BMOB 4HM6B 1BAOA 3O8YA 3S67A 2W0QA 2OCTA 3D5IA 3LMLA 8CHOA 1O7NB 1EUIC 1GOYA 2C4BA 3BNDA 3Q2PA 4L7KA 2IUKA 5G1LA 2UGIA 1TIJA 1IK3A 2XR8B 1FGOA 2CFDA 3OWYA 1ZX2A 2IYJA 5AIFA 1NJI4 1O7HB 1I3FA 3X3YA 1ZO2A 3CCQ3 2CW9A 4NHFA 1CEWI 1A67A 2RBIA 1L5GB 1T5YA 3T0UA 4J5KA 4N6MA 3CCM3 2HOHA 4H3UA 3DZLA 5HOHA 1CYUA 3UJMA 1M1K4 4KFFA 1JZOA 1YGWA 1RTUA 1RGKA 4J8TA 5BU4A 4CPKA 1GD4A 3F7SA 2R41A 3HI7A 3KKGA 1IVWA 2OTJ3 1N9JA 2L4VA 3BIRA 1TU5A 1UCLA 3Q90A 1VQO3 7RNTA 3MG2A 1CQSA 2IA7A 4LYLB 1I70A 1V74A 2W9QA 3D5GA 1BRNL 1UCJA 4JF8A 1MNLA 4EV5A 4CCVA 1QALA 1PY3A 1FW7A 2XF3A 1GY5A 3KZTA 1I8VA 1F8NA 1W00A 1WMPA 2BU4A 3MKIA 3AHWA 2XRXB 3OX9A 3D79A 4N6NB 4FCZA 4N6LA 3AMOA 5IEOA 2H0IA 4PEJA 4GHOA 2OQEA 5AYSC 1BUJA 1OGXA 2BT3A 2CK3H 1WMNA 2GSPA 4XBXA 5FGOA 1UUWB 3KSPA 3F7XA 4WYKB 1BSDA 5ELJA 3CCJ3 4HM8B 9RNTA 3GZXB 4XDWA 4L8OA 1PYLA 1ZGXA 3EX9A 1Q7Y4 1BRSA 1OH0A 3BNBA 2YFIB 3SLUA 1JNQA 3DGOA 3JUNA 2CX0A 4JRFA 2AAEA 2Z6BA 2WO0A 4X2OA 1Q824 2RFRA 5I97A 1Z1SA 4J9AA 4EW5A 3CCS3 1LNIA 1GY6A 3FKAA 3CCU3 1Q42A 1YVBI 3IMAB 1ASKA 3X42A 1S723 1OGZA 3CME3 1J2BA 3PZWA 3GSPA 3B4OA 4U13A 4XBYA 1HZ1A 4EXRA 1TFKA 1HKXA 4O3VA 1RRLA 2Q07A 4MMZB 5CLKA 1IU7A 2PZVA 1QAKA 1RGGA 1RGFA 1JB5A 1I2GA 3RNTA 2B1XB 1JJ22 3G0KA 1KWIA 1T3BA 3QK9A 1G96A 1LOVA 2Y73A 3E99A 2W03A 3GZYB 1SARA 1JZDA 1I3IA 1WNHA 4XBTA 1JKGA 4R9LA 3EE1A 4ORLA 1D6UA 4MEIA 2WOFA 3CCL3 2QIYA 4BTYA 1E97A 2F5MA 2XH9A 1YJN3 3HK4A 3X3XA 1UDII 1YNVX 2Z76A 1W7CA 2B24B 3KN4A 1B2MA 1QVF2 1X1YA 3Q1CA 4J5GA 2QA43 2GU1A 3CD63 2CWUA 4Q53A 2HMOB 2WGQA 3KFQC 4X2HA 1IQYA 1RGAA 3X3ZA 2HMLB 1BNJA 1RGCA 4N6UA 2YFJB 4MMXB 3WA2X 1LQGC 1STFI 1VQQA 7STDA 4HZBB 4HM2B 3CXC2 4WP5A 1YI23 1BSBA 1R4YA 5IENA 3NV0A 2C10A 1MGRA 4BTXA 1UGHI 2BIRA 5M1AA 3SOAA 5BVBA 1Q40B 3CNMA 2LQVA 3OV4A 1U5OA 3DM8A 2H0GA 4N6OB 1JB2A 2HMMB 4I4KA 1JBRA 2CIUA 2P38A 3A5EA 2GU3A 1VQ83 3V92A 1RGHA 2UX0A 3PGBA 1D6YA 2ML5A 1YJ93 3AMOB 2BHMA 2KF4A 1JV2B 5AI1A 1FZUA 1GMQA 2HMJB 3BNEA 4IPBA 1OF5A 3KCHA 3L0RA 1DE3A 3NUVA 1G02A 3FH1A 5TGNA 3HZPA 3JUMA 4L8PA 8RNTA 5EVHA 5IERA 2Z7AA 2H0HA 1AVLA 1WTHA 3UB1A 2STDA 1CH0A 1RN1A 3LT8A 4CDLA 1Q9EA 3FG3A 3NM7A 4HZ9B 3FF2A 4WHAA 3LTAA 3NM2A 1VQM3 3HX8A 2GBWB 3ROBA 3VF1A 5RNTA 1KD14 4BL2A 4GB5A 5M19A 1HYFA 1RCKA 4HM3B 2ZL8A 1IQXA 3GRDA 5CK6A 2XGNA 2C11A 3H3HA 3NBJA 3MG1A 4HM7B 3FG1A 3F40A 5IEPA 2BMRB 1GMPA 2UUGC 4TX4A 1EQKA 1B2SA 1SQWA 3WA3A 1TFOA 4N6V0 1A2VA 1W2B2 3Q3FA 2W56A 1K28A 2Y74A 3RGAA 4IT7A 4EYCA 5JPPA 1AR0A 3NX0A 3NQYA 4LEHA 1NO3A 3EHCA 1A90A 1NDOB 4KZ1A 1JKGB 1NU3A 2CWTA 4OK0A 3SX1A 3X41A 4ZM8A 3LH4A 3EN8A 2INXA 1M1XB 1TTOA 1ZS7A 1BRGA 3K7CA 3GAXA 2GXFA 1VQ43 5JBSA 2XGLA 1W2ZA 2CKFB 1IQ8A 2FGTA 3MSOA 1MOLA 3I0YA 2GBXB 5D82A 1B27A 2RNTA 2RSXA 1NWWA 4IIAA 5DREA 5CF1A 5G2GA 5STDA 2BO9B 1GMRA 2F99A 3CC73 1EG9B 3PYJA 1MWSA 4KFEA 1MWTA 4FMAA 1VQ53 1RSNA 3EQQB 1KQS2 1BNGA 3WDGB 1VQP3 3PCSA 1B2UA 1GSPA 2XFTA 3I553 4WFOA 2K54A 1EEJA 3DUKA 1D6ZA 2CFGA 1Q7HA 4HM4B 5IG5A 3S27A 1BANA 1JB4A 1W6YA 1RN7A 1N8R4 1TJDA 2E2TA 1OHPA 2HMKB 4O02B 3AGNA 3CU3A 1BRJA 1NNVA 5CXOA 5BIRA 1K8A4 2OTL3 3I563 1OUNA 3FG4A 3NQZA 3WOEB 3F14A 1T2IA 1HU9A 3AHSA 1IYYA 2AADA 4FR9A 2R4IA 3CC43 2XFSA 1GYBA 2F5WA 5AYRB 4R9KA 6GSPA 4HJLB 2ML6A 1BVIA 1BSAA 1YIJ3 1VZZA 1X1UA 1ROVA 1V58A 2A15A 3G4S3 1GS3A 3LTCA 1OF5B 1KC84 3SVAA 2W6JH 1IVVA 3URPA 2OOVC 1UI7A 1WQLB 2IMJA 1LQMB 3JUPA 1BNIA 5G1KA 4AKZA 2JDIH 5A0OB 3CC23 1Q814 3DGNA 3V98A 5ELUA 2MF7A 1BRHA 2P09A 3SEDA 5KP1A 1A2KA 3CPW2 3KE7A 2LYXA 3UL6A 1DYUA 1RKYA 2RCDA 1O7PB 1W02A 1EA2A 2L1SA 5KP3A 1PFPA 2IY2A 5KP4A 3RGRA 3WR2A 1QVG2 2SARA 1UCIA 1ROAA 3DXOA 1YJW3 1FGTA 3K9MC 2O3OA 3OWSA 3MHEA 3EN1B 3G713 1IT7A 3CCE3 4K1UA 3ZFZA 1DVDA 4MMYB 4NREA 3NHXA 2KAAA 1FUTA 4HVNA 2OWPA 4XDVA 4XM4A 3OW22 3HOHA 5GSPA 2KXGA 4AEQA 1UUVB 1E3RA 4CJNA 2ZA4A 1S5AA 1STDA 4I5QA 2KCDA 4LZIA 3CMA3 3RDEA 1B21A 4N3VA 1SIHA 2W56B 3WMDA 2BNGA 3U1WA 3JUQA 1Q864 1OPYA 3EB8A 3SXXA 6STDA 3WHOA 1IV7A 3ALAA 2J8XB 3BLZA 4BU4A 3N54B 1B2ZA 2E2UA 4HAAA 4HM1B 1AY7A 1DETA 3KSED 4G1MB 1KSIA 3CCR3 3LXUX 1W6CA 5M18A 1N5HA 3D9RA 3PCRA 4N6TA 1RGLA 2D42A 4R4KA 2CG1A 1MGWA 3IPTA 4RZMA 3STDA 1QAFA 3VSYA 3H51A 3LTBA 3B4PA 1LOYA 3ECFA 2E2VA 3S5CA 2CH9A 2CWVA 2F86B 1N5PA 1BOXA 3LT9A 4HOHA 1JRQA 3TDGA 3ZG0A 5IG0A 3DGMA 1RCLA 3LTDA 1DMQA 1FYSA 2JQ5A 3GZRA 4LMIA 1BU4A 3DGLA 4HBRA 3JVCA 3OWUA 2FXTA 2CFKA 1VQ63 1BIRA 1BNFA 4LGQA 1X1WA 3JUOA 1BRIA 5AEWB 4HM0B 4K90B
chains in the Genus database with same CATH topology
3BNCA 1VQ73 1OHSA 2P0MA 4KFDA 5LC7A 4EC6A 1W4NA 3BB9A 3FCSB 2XEPA 1RJOA 1US1A 1LNHA 1N9EA 4H61A 1OACA 1O7GB 3A76A 3SOYA 1R4CA 4QWTA 3K63A 3U97A 2IUJA 1C7HA 1E3VA 3EJVA 1WMOA 1Y4KA 3V99A 3N8BA 1W6GA 4EV2A 1O7MB 3MPHA 2BMQB 1IT8A 2PNCA 4HM5B 3FZWA 2KRTA 3K5TA 4RNYA 4STDA 3K0ZA 1Q40A 3EC9A 3EBTA 3LYGA 3G8ZA 1FA3A 3B8LA 4K61A 1O7WB 1SJWA 2WOHA 1JN5A 1IVXA 1CYVA 1M904 4HKVB 1IDPA 3F8HA 3G16A 1VQL3 2XSOB 4FMCA 3ER7A 3NV0B 3EBYA 1FGRA 3LZAA 3CNXA 3DY5A 2OQEC 1VQK3 1OCVA 3UL5A 1FGMA 2W9PA 2MC8A 1IVUA 1AVKA 1OHOA 2O9UX 3S29A 1TP6A 2SBLA 2Z77A 3NXJA 4R1KA 1K734 2K0MA 1VQN3 3X40A 2OOVA 1LVNA 3OXAA 1IV9A 5IG3A 3VGNA 5FW5A 2CFWA 2V1LA 1NB3I 4FCJA 3MYTA 1AV4A 3S28A 3FLJA 2RGQA 1W01A 4AKYA 5AIHA 1GY7A 1M9GA 1U8CB 4FMBA 1K41A 1RRHA 2GEXA 2I9WA 1LXEA 4O8SA 5D83A 3N9HA 3GZBA 3GWRA 1FGQA 2YX9A 3IJEB 4FCMA 1LOXA 3NBRA 4RNZA 1DVCA 1UW1A 3T8NA 4KVHA 1SPUA 1YIT3 1W5ZA 2GEYA 4RBNA 1YGEA 2F98A 1N8QA 3B7CA 3T8UA 2D1WA 5EQLA 3LOYA 1ULJB 1NB5I 3HIIA 2P05A 4FMDA 1QMAA 3CPOA 3EF8A 3CCV3 1ISKA 1K9M4 1FUWA 3F8XA 3DMCA 4WYKA 2WGOA 3M8CA 2HMNB 2YFLB 3J7Yd 2FNQA 5JPUA 2CG0A 3MWZA 4WWUC 1YHQ3 5AIGA 2ZDJA 3G6E3 5CF2A 5EEOA 3WOFB 1VQ93 1ULIB 5IG4A 3FF0A 5AEUB 2M7OA 2XSHB 1EKMA 3FGYA 3NBBA 5DRVA 3KIIA 3QRDA 1PU4A 4MJDA 3UNLA 3D3LA 3HIGA 4EBGA 2QGUA 4HYZA 2CHCA 4LSOA 3PS8A 1DMNA 1TUHA 2CFLA 4GL6A 4OUQA 3PXMA 5D81A 4XB5A 4BTWA 1GD3A 2QEX3 4OVMA 4O2HA 1QJGA 3F9SA 1JN5B 1BUQA 1SIIA 1UI8A 1DMMA 5AIIA 3FSDA 5HGRA 2W2CA 3WODG 5IF6A 4K1VA 5LC6A 2CC3A 4R80A 2P0XA 5IW9A 3MG3A 5BXQA 2W04A 2BMOB 4HM6B 3O8YA 3S67A 2W0QA 2OCTA 3LMLA 8CHOA 1O7NB 3BNDA 4L7KA 3Q2PA 2IUKA 1TIJA 1IK3A 2XR8B 1FGOA 2CFDA 3OWYA 1ZX2A 5AIFA 1NJI4 1O7HB 3X3YA 1ZO2A 3CCQ3 2CW9A 4NHFA 1CEWI 1A67A 1L5GB 1T5YA 3T0UA 4N6MA 3CCM3 4H3UA 3DZLA 1CYUA 3UJMA 1M1K4 4KFFA 4J8TA 1GD4A 3F7SA 3HI7A 3KKGA 1IVWA 2OTJ3 1N9JA 2L4VA 1TU5A 3Q90A 1VQO3 3MG2A 1CQSA 2IA7A 2W9QA 1V74A 4JF8A 1MNLA 4EV5A 4CCVA 1QALA 2XF3A 1GY5A 3KZTA 1W00A 1F8NA 1WMPA 3MKIA 2XRXB 3OX9A 4N6NB 4FCZA 4N6LA 3AMOA 5IEOA 4PEJA 2OQEA 5AYSC 1OGXA 2BT3A 2CK3H 1WMNA 4XBXA 5FGOA 1UUWB 3KSPA 3F7XA 4WYKB 5ELJA 3CCJ3 4HM8B 3GZXB 4XDWA 4L8OA 3EX9A 1Q7Y4 1OH0A 3BNBA 2YFIB 3SLUA 1JNQA 3DGOA 3JUNA 4JRFA 2Z6BA 4X2OA 2WO0A 1Q824 2RFRA 5I97A 1Z1SA 4J9AA 3CCS3 3CCU3 1GY6A 3FKAA 1Q42A 1YVBI 3IMAB 1ASKA 3X42A 1S723 1OGZA 3CME3 1J2BA 3PZWA 3B4OA 4U13A 4XBYA 4EXRA 1TFKA 1HKXA 4O3VA 1RRLA 2Q07A 4MMZB 5CLKA 1IU7A 2PZVA 1QAKA 1JB5A 2B1XB 1JJ22 3G0KA 1KWIA 3QK9A 1G96A 2Y73A 3E99A 2W03A 3GZYB 4XBTA 1WNHA 1JKGA 4R9LA 3EE1A 4ORLA 1D6UA 4MEIA 2WOFA 3CCL3 2QIYA 4BTYA 1E97A 2XH9A 1YJN3 3HK4A 3X3XA 2Z76A 1W7CA 2B24B 3KN4A 1QVF2 3Q1CA 3CD63 2QA43 2GU1A 2CWUA 4Q53A 2HMOB 2WGQA 3KFQC 4X2HA 1IQYA 3X3ZA 2HMLB 4N6UA 2YFJB 4MMXB 3WA2X 1STFI 7STDA 4HZBB 4HM2B 3CXC2 4WP5A 1YI23 5IENA 3NV0A 2C10A 4BTXA 3SOAA 5BVBA 1Q40B 3CNMA 2LQVA 3OV4A 1U5OA 3DM8A 4N6OB 1JB2A 2HMMB 4I4KA 2CIUA 2P38A 2GU3A 1VQ83 3V92A 2UX0A 3PGBA 1D6YA 2ML5A 1YJ93 3AMOB 2BHMA 1JV2B 5AI1A 2HMJB 3BNEA 4IPBA 1OF5A 3L0RA 3NUVA 3FH1A 5TGNA 3HZPA 3JUMA 4L8PA 5EVHA 5IERA 2Z7AA 1AVLA 1WTHA 3UB1A 2STDA 4CDLA 3LT8A 3FG3A 3NM7A 4HZ9B 3FF2A 4WHAA 3LTAA 3NM2A 1VQM3 3HX8A 2GBWB 3ROBA 3VF1A 1KD14 4GB5A 4HM3B 2ZL8A 1IQXA 3GRDA 5CK6A 2XGNA 2C11A 3H3HA 3NBJA 3MG1A 4HM7B 3FG1A 3F40A 5IEPA 2BMRB 4TX4A 1EQKA 1SQWA 3WA3A 1TFOA 4N6V0 1A2VA 1W2B2 2W56A 1K28A 2Y74A 3RGAA 4IT7A 4EYCA 5JPPA 1AR0A 3NX0A 3NQYA 4LEHA 1NO3A 3EHCA 1A90A 1NDOB 4KZ1A 1JKGB 1NU3A 2CWTA 4OK0A 3SX1A 3X41A 4ZM8A 3LH4A 3EN8A 2INXA 1M1XB 3K7CA 3GAXA 2GXFA 1VQ43 5JBSA 2XGLA 1W2ZA 2CKFB 1IQ8A 2FGTA 3MSOA 1MOLA 3I0YA 2GBXB 5D82A 2RSXA 5DREA 5CF1A 1NWWA 4IIAA 5G2GA 5STDA 2BO9B 2F99A 3CC73 1EG9B 3PYJA 4KFEA 4FMAA 1VQ53 3EQQB 1KQS2 3WDGB 1VQP3 3PCSA 3I553 2XFTA 4WFOA 2K54A 3DUKA 1D6ZA 2CFGA 4HM4B 5IG5A 3S27A 1JB4A 1W6YA 1RN7A 1N8R4 2E2TA 1OHPA 2HMKB 4O02B 3CU3A 5CXOA 1K8A4 2OTL3 3I563 1OUNA 3FG4A 3NQZA 3WOEB 3F14A 1HU9A 4FR9A 2R4IA 3CC43 2XFSA 1GYBA 5AYRB 4R9KA 4HJLB 2ML6A 1YIJ3 1VZZA 1ROVA 2A15A 3G4S3 1GS3A 3LTCA 1OF5B 1KC84 3SVAA 2W6JH 1IVVA 2OOVC 1UI7A 1WQLB 2IMJA 3JUPA 3CC23 4AKZA 1Q814 2JDIH 5A0OB 3DGNA 3V98A 5ELUA 2MF7A 2P09A 5KP1A 3SEDA 1A2KA 3CPW2 3KE7A 2LYXA 3UL6A 1DYUA 1RKYA 2RCDA 1O7PB 1W02A 1EA2A 5KP3A 1PFPA 5KP4A 3RGRA 1QVG2 1ROAA 3DXOA 1YJW3 1FGTA 3K9MC 2O3OA 3OWSA 3MHEA 3EN1B 3G713 1IT7A 3CCE3 4K1UA 1DVDA 4MMYB 4NREA 3NHXA 4HVNA 2OWPA 4XDVA 4XM4A 3OW22 4AEQA 2KXGA 1UUVB 1E3RA 1S5AA 1STDA 2KCDA 4LZIA 3CMA3 3RDEA 4N3VA 1SIHA 2W56B 3WMDA 2BNGA 3U1WA 3JUQA 1Q864 1OPYA 3EB8A 3SXXA 6STDA 3ALAA 1IV7A 3BLZA 3N54B 2E2UA 4HM1B 3KSED 4G1MB 1KSIA 3CCR3 3LXUX 1W6CA 1N5HA 3D9RA 3PCRA 4N6TA 2D42A 2CG1A 4R4KA 3IPTA 4RZMA 3STDA 1QAFA 3VSYA 3H51A 3LTBA 3B4PA 3ECFA 2E2VA 3S5CA 2CH9A 2CWVA 2F86B 1N5PA 3LT9A 3TDGA 1JRQA 5IG0A 3DGMA 3LTDA 1DMQA 2JQ5A 3GZRA 4LMIA 3DGLA 4HBRA 3JVCA 3OWUA 2FXTA 2CFKA 1VQ63 4LGQA 3JUOA 5AEWB 4HM0B 4K90B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHS A;  3BB9 A;  1O7G B;  3A76 A;  3SOY A;  1C7H A;  1E3V A;  3EJV A;  1O7M B;  2BMQ B;  4HM5 B;  3FZW A;  4STD A;  3K0Z A;  1Q40 A;  3EC9 A;  3EBT A;  3LYG A;  3G8Z A;  3B8L A;  1O7W B;  1SJW A;  1JN5 A;  4HKV B;  1IDP A;  3F8H A;  3G16 A;  2XSO B;  3ER7 A;  3NV0 B;  3EBY A;  3LZA A;  3CNX A;  1OCV A;  1OHO A;  1TP6 A;  2Z77 A;  3NXJ A;  4R1K A;  3OXA A;  5IG3 A;  3VGN A;  5FW5 A;  4FCJ A;  3MYT A;  3FLJ A;  2RGQ A;  1W01 A;  5AIH A;  1GY7 A;  1K41 A;  2GEX A;  2I9W A;  5D83 A;  3GZB A;  3GWR A;  4FCM A;  3NBR A;  3T8N A;  4KVH A;  2GEY A;  2F98 A;  3B7C A;  3T8U A;  1ULJ B;  1QMA A;  3CPO A;  3EF8 A;  1ISK A;  3F8X A;  3DMC A;  4WYK A;  3M8C A;  2HMN B;  2YFL B;  5JPU A;  4WWU C;  5AIG A;  5CF2 A;  1ULI B;  5IG4 A;  3FF0 A;  5AEU B;  2XSH B;  3FGY A;  5DRV A;  4MJD A;  3UNL A;  2QGU A;  2CHC A;  1DMN A;  1TUH A;  4OUQ A;  5D81 A;  4XB5 A;  4OVM A;  1QJG A;  3F9S A;  1JN5 B;  1BUQ A;  1DMM A;  5AII A;  3FSD A;  5HGR A;  2W2C A;  5IF6 A;  4K1V A;  3MG3 A;  5BXQ A;  2BMO B;  4HM6 B;  8CHO A;  1O7N B;  4L7K A;  2XR8 B;  3OWY A;  5AIF A;  1ZX2 A;  1O7H B;  1ZO2 A;  4H3U A;  3DZL A;  3UJM A;  4J8T A;  3F7S A;  3KKG A;  3Q90 A;  3MG2 A;  1CQS A;  1GY5 A;  3KZT A;  1W00 A;  3MKI A;  2XRX B;  3OX9 A;  5IEO A;  4PEJ A;  1OGX A;  4XBX A;  1UUW B;  3KSP A;  3F7X A;  4WYK B;  4HM8 B;  3GZX B;  4XDW A;  4L8O A;  3EX9 A;  1OH0 A;  2YFI B;  3JUN A;  4X2O A;  2RFR A;  1Z1S A;  4J9A A;  1GY6 A;  3FKA A;  1Q42 A;  1ASK A;  1OGZ A;  3B4O A;  4U13 A;  4XBY A;  1HKX A;  5CLK A;  2PZV A;  1JB5 A;  2B1X B;  3G0K A;  3E99 A;  3GZY B;  4XBT A;  1JKG A;  4R9L A;  4ORL A;  2QIY A;  1E97 A;  3HK4 A;  2Z76 A;  2B24 B;  4Q53 A;  2HMO B;  4X2H A;  2HML B;  2YFJ B;  7STD A;  4HZB B;  4HM2 B;  4WP5 A;  5IEN A;  3NV0 A;  3SOA A;  5BVB A;  1Q40 B;  3CNM A;  3OV4 A;  1U5O A;  3DM8 A;  1JB2 A;  2HMM B;  4I4K A;  2UX0 A;  5AI1 A;  2HMJ B;  1OF5 A;  3NUV A;  3FH1 A;  5TGN A;  3HZP A;  3JUM A;  4L8P A;  5EVH A;  5IER A;  2Z7A A;  4CDL A;  2STD A;  4HZ9 B;  3FF2 A;  3NM2 A;  3HX8 A;  2GBW B;  3ROB A;  4GB5 A;  4HM3 B;  3GRD A;  5CK6 A;  3H3H A;  5IEP A;  3MG1 A;  4HM7 B;  3F40 A;  2BMR B;  3RGA A;  5JPP A;  1AR0 A;  4LEH A;  3EHC A;  1NDO B;  1JKG B;  1NU3 A;  3EN8 A;  2INX A;  3K7C A;  2GXF A;  2CKF B;  3MSO A;  3I0Y A;  2GBX B;  5D82 A;  5DRE A;  5CF1 A;  1NWW A;  4IIA A;  5G2G A;  5STD A;  2F99 A;  1EG9 B;  3EQQ B;  2K54 A;  3DUK A;  4HM4 B;  5IG5 A;  1JB4 A;  1W6Y A;  5CXO A;  1OHP A;  2HMK B;  3CU3 A;  1OUN A;  3F14 A;  2R4I A;  1GYB A;  4R9K A;  4HJL B;  1VZZ A;  2A15 A;  1GS3 A;  1OF5 B;  1WQL B;  2IMJ A;  3JUP A;  5KP1 A;  3SED A;  1A2K A;  3KE7 A;  2RCD A;  1O7P B;  1W02 A;  1EA2 A;  5KP3 A;  5KP4 A;  3RGR A;  3DXO A;  3OWS A;  3MHE A;  3EN1 B;  4K1U A;  3NHX A;  4HVN A;  2OWP A;  4XDV A;  4XM4 A;  1UUV B;  1E3R A;  1S5A A;  1STD A;  4N3V A;  3WMD A;  2BNG A;  3JUQ A;  1OPY A;  6STD A;  3BLZ A;  4HM1 B;  3D9R A;  3IPT A;  4RZM A;  3STD A;  3VSY A;  3H51 A;  3B4P A;  3ECF A;  3S5C A;  2F86 B;  5IG0 A;  1DMQ A;  2JQ5 A;  3GZR A;  4LMI A;  3OWU A;  4LGQ A;  3JUO A;  5AEW B;  4HM0 B; 
#chains in the Genus database with same CATH topology
 3BNC A;  1VQ7 3;  1MWU A;  1OHS A;  1BNS A;  2P0M A;  4KFD A;  3AGO A;  5LC7 A;  4ILF A;  4EC6 A;  3DH2 A;  1W4N A;  3BB9 A;  3FCS B;  1BNR A;  2XEP A;  1RJO A;  1US1 A;  1LNH A;  1N9E A;  4H61 A;  2KF6 A;  1GOV A;  3ZG5 A;  1OAC A;  1O7G B;  3A76 A;  1RHL A;  3SOY A;  1R4C A;  4QWT A;  3K63 A;  3U97 A;  1X1X A;  2IUJ A;  1C7H A;  1E3V A;  3EJV A;  1WMO A;  1Y4K A;  3V99 A;  1I2F A;  3N8B A;  1W6G A;  4EV2 A;  1O7M B;  1B2X A;  2F56 A;  3MPH A;  6RNT A;  2BMQ B;  1IT8 A;  2PNC A;  2KF3 A;  4HM5 B;  3FZW A;  2KRT A;  3K5T A;  4RNY A;  4STD A;  3K0Z A;  1Q40 A;  3EC9 A;  3EBT A;  3LYG A;  3G8Z A;  1FA3 A;  3B8L A;  4K61 A;  4RNT A;  4BL3 A;  1O7W B;  1SJW A;  2WOH A;  1JN5 A;  4NPB A;  2KF5 A;  1IVX A;  1CYV A;  1M90 4;  1G0T A;  4HKV B;  1I2E A;  1IDP A;  3F8H A;  3G16 A;  1A2P A;  1RNB A;  1VQL 3;  2XSO B;  4FMC A;  3ER7 A;  4BIR A;  3NV0 B;  3EBY A;  1FGR A;  1C54 A;  1LOW A;  1BNE A;  3LZA A;  3CNX A;  3DY5 A;  1RGE A;  1UUG B;  2OQE C;  1VQK 3;  1AQZ A;  1RN4 A;  1YVS A;  1OCV A;  2CX1 A;  3UL5 A;  1FGM A;  2K3D A;  2W9P A;  2MC8 A;  4GSP A;  1IVU A;  1AVK A;  1OHO A;  2O9U X;  3S29 A;  1TP6 A;  2SBL A;  2Z77 A;  3NXJ A;  4R1K A;  1K73 4;  2K0M A;  1VQN 3;  2ZHX B;  1UGI A;  3X40 A;  2OOV A;  1LVN A;  3OXA A;  1IV9 A;  1FUS A;  5IG3 A;  3VGN A;  1T2H A;  5FW5 A;  2CFW A;  2V1L A;  1NB3 I;  4FCJ A;  3MYT A;  1AV4 A;  1MWR A;  3FLJ A;  3S28 A;  2RGQ A;  1W01 A;  4AKY A;  5AIH A;  1GY7 A;  1LRA A;  1M9G A;  1U8C B;  1K41 A;  4FMB A;  1RRH A;  2GEX A;  2I9W A;  1LXE A;  4O8S A;  5D83 A;  1RMS A;  3N9H A;  3GZB A;  3GWR A;  1FGQ A;  2YX9 A;  1JBS A;  3D4A A;  2F4Y A;  1LOX A;  3IJE B;  3NBR A;  4FCM A;  1DVC A;  1UW1 A;  4RNZ A;  4KVH A;  1SPU A;  3T8N A;  1W5Z A;  1YIT 3;  2GEY A;  4RBN A;  1YGE A;  2F98 A;  1N8Q A;  3B7C A;  3T8U A;  2D1W A;  5EQL A;  3LOY A;  1ULJ B;  1V57 A;  3HII A;  1NB5 I;  2P05 A;  4FMD A;  1QMA A;  3CPO A;  1RNT A;  3EF8 A;  3CCV 3;  1K9M 4;  1ISK A;  1FUW A;  3F8X A;  3DMC A;  4WYK A;  2WGO A;  3M8C A;  2HMN B;  2YFL B;  3J7Y d;  2FNQ A;  5JPU A;  2CG0 A;  3MWZ A;  4WWU C;  7GSP A;  1YHQ 3;  5AIG A;  2ZDJ A;  3G6E 3;  5CF2 A;  5EEO A;  1JBT A;  1I0X A;  3WOF B;  1VQ9 3;  1ULI B;  5IG4 A;  3FF0 A;  5AEU B;  2M7O A;  2XSH B;  4KT3 B;  1EKM A;  3FGY A;  3NBB A;  5DRV A;  3KII A;  1RLS A;  1I0V A;  3QRD A;  1PU4 A;  4MJD A;  3UNL A;  3D3L A;  3HIG A;  4EBG A;  3BU4 A;  1GOU A;  2QGU A;  4HYZ A;  1BSE A;  2CHC A;  4LSO A;  3PS8 A;  1DMN A;  1TUH A;  2CFL A;  4GL6 A;  4OUQ A;  3PXM A;  5D81 A;  4XB5 A;  4BTW A;  1GD3 A;  3DGY A;  2QEX 3;  1RDS A;  4OVM A;  1BRK A;  4O2H A;  4DKI A;  1QJG A;  3F9S A;  1B3S A;  1JN5 B;  1BUQ A;  1SII A;  1UI8 A;  1TRP A;  1TRQ A;  3SYU A;  1BGS A;  1B20 A;  1DMM A;  5AII A;  1UCK A;  3FSD A;  5HGR A;  2W2C A;  3WOD G;  5IF6 A;  4K1V A;  5LC6 A;  2CC3 A;  4R80 A;  2P0X A;  5IW9 A;  3MG3 A;  5BXQ A;  1BSC A;  2W04 A;  2BMO B;  4HM6 B;  1BAO A;  3O8Y A;  3S67 A;  2W0Q A;  2OCT A;  3D5I A;  3LML A;  8CHO A;  1O7N B;  1EUI C;  1GOY A;  2C4B A;  3BND A;  3Q2P A;  4L7K A;  2IUK A;  5G1L A;  2UGI A;  1TIJ A;  1IK3 A;  2XR8 B;  1FGO A;  2CFD A;  3OWY A;  1ZX2 A;  2IYJ A;  5AIF A;  1NJI 4;  1O7H B;  1I3F A;  3X3Y A;  1ZO2 A;  3CCQ 3;  2CW9 A;  4NHF A;  1CEW I;  1A67 A;  2RBI A;  1L5G B;  1T5Y A;  3T0U A;  4J5K A;  4N6M A;  3CCM 3;  2HOH A;  4H3U A;  3DZL A;  5HOH A;  1CYU A;  3UJM A;  1M1K 4;  4KFF A;  1JZO A;  1YGW A;  1RTU A;  1RGK A;  4J8T A;  5BU4 A;  4CPK A;  1GD4 A;  3F7S A;  2R41 A;  3HI7 A;  3KKG A;  1IVW A;  2OTJ 3;  1N9J A;  2L4V A;  3BIR A;  1TU5 A;  1UCL A;  3Q90 A;  1VQO 3;  7RNT A;  3MG2 A;  1CQS A;  2IA7 A;  4LYL B;  1I70 A;  1V74 A;  2W9Q A;  3D5G A;  1BRN L;  1UCJ A;  4JF8 A;  1MNL A;  4EV5 A;  4CCV A;  1QAL A;  1PY3 A;  1FW7 A;  2XF3 A;  1GY5 A;  3KZT A;  1I8V A;  1F8N A;  1W00 A;  1WMP A;  2BU4 A;  3MKI A;  3AHW A;  2XRX B;  3OX9 A;  3D79 A;  4N6N B;  4FCZ A;  4N6L A;  3AMO A;  5IEO A;  2H0I A;  4PEJ A;  4GHO A;  2OQE A;  5AYS C;  1BUJ A;  1OGX A;  2BT3 A;  2CK3 H;  1WMN A;  2GSP A;  4XBX A;  5FGO A;  1UUW B;  3KSP A;  3F7X A;  4WYK B;  1BSD A;  5ELJ A;  3CCJ 3;  4HM8 B;  9RNT A;  3GZX B;  4XDW A;  4L8O A;  1PYL A;  1ZGX A;  3EX9 A;  1Q7Y 4;  1BRS A;  1OH0 A;  3BNB A;  2YFI B;  3SLU A;  1JNQ A;  3DGO A;  3JUN A;  2CX0 A;  4JRF A;  2AAE A;  2Z6B A;  2WO0 A;  4X2O A;  1Q82 4;  2RFR A;  5I97 A;  1Z1S A;  4J9A A;  4EW5 A;  3CCS 3;  1LNI A;  1GY6 A;  3FKA A;  3CCU 3;  1Q42 A;  1YVB I;  3IMA B;  1ASK A;  3X42 A;  1S72 3;  1OGZ A;  3CME 3;  1J2B A;  3PZW A;  3GSP A;  3B4O A;  4U13 A;  4XBY A;  1HZ1 A;  4EXR A;  1TFK A;  1HKX A;  4O3V A;  1RRL A;  2Q07 A;  4MMZ B;  5CLK A;  1IU7 A;  2PZV A;  1QAK A;  1RGG A;  1RGF A;  1JB5 A;  1I2G A;  3RNT A;  2B1X B;  1JJ2 2;  3G0K A;  1KWI A;  1T3B A;  3QK9 A;  1G96 A;  1LOV A;  2Y73 A;  3E99 A;  2W03 A;  3GZY B;  1SAR A;  1JZD A;  1I3I A;  1WNH A;  4XBT A;  1JKG A;  4R9L A;  3EE1 A;  4ORL A;  1D6U A;  4MEI A;  2WOF A;  3CCL 3;  2QIY A;  4BTY A;  1E97 A;  2F5M A;  2XH9 A;  1YJN 3;  3HK4 A;  3X3X A;  1UDI I;  1YNV X;  2Z76 A;  1W7C A;  2B24 B;  3KN4 A;  1B2M A;  1QVF 2;  1X1Y A;  3Q1C A;  4J5G A;  2QA4 3;  2GU1 A;  3CD6 3;  2CWU A;  4Q53 A;  2HMO B;  2WGQ A;  3KFQ C;  4X2H A;  1IQY A;  1RGA A;  3X3Z A;  2HML B;  1BNJ A;  1RGC A;  4N6U A;  2YFJ B;  4MMX B;  3WA2 X;  1LQG C;  1STF I;  1VQQ A;  7STD A;  4HZB B;  4HM2 B;  3CXC 2;  4WP5 A;  1YI2 3;  1BSB A;  1R4Y A;  5IEN A;  3NV0 A;  2C10 A;  1MGR A;  4BTX A;  1UGH I;  2BIR A;  5M1A A;  3SOA A;  5BVB A;  1Q40 B;  3CNM A;  2LQV A;  3OV4 A;  1U5O A;  3DM8 A;  2H0G A;  4N6O B;  1JB2 A;  2HMM B;  4I4K A;  1JBR A;  2CIU A;  2P38 A;  3A5E A;  2GU3 A;  1VQ8 3;  3V92 A;  1RGH A;  2UX0 A;  3PGB A;  1D6Y A;  2ML5 A;  1YJ9 3;  3AMO B;  2BHM A;  2KF4 A;  1JV2 B;  5AI1 A;  1FZU A;  1GMQ A;  2HMJ B;  3BNE A;  4IPB A;  1OF5 A;  3KCH A;  3L0R A;  1DE3 A;  3NUV A;  1G02 A;  3FH1 A;  5TGN A;  3HZP A;  3JUM A;  4L8P A;  8RNT A;  5EVH A;  5IER A;  2Z7A A;  2H0H A;  1AVL A;  1WTH A;  3UB1 A;  2STD A;  1CH0 A;  1RN1 A;  3LT8 A;  4CDL A;  1Q9E A;  3FG3 A;  3NM7 A;  4HZ9 B;  3FF2 A;  4WHA A;  3LTA A;  3NM2 A;  1VQM 3;  3HX8 A;  2GBW B;  3ROB A;  3VF1 A;  5RNT A;  1KD1 4;  4BL2 A;  4GB5 A;  5M19 A;  1HYF A;  1RCK A;  4HM3 B;  2ZL8 A;  1IQX A;  3GRD A;  5CK6 A;  2XGN A;  2C11 A;  3H3H A;  3NBJ A;  3MG1 A;  4HM7 B;  3FG1 A;  3F40 A;  5IEP A;  2BMR B;  1GMP A;  2UUG C;  4TX4 A;  1EQK A;  1B2S A;  1SQW A;  3WA3 A;  1TFO A;  4N6V 0;  1A2V A;  1W2B 2;  3Q3F A;  2W56 A;  1K28 A;  2Y74 A;  3RGA A;  4IT7 A;  4EYC A;  5JPP A;  1AR0 A;  3NX0 A;  3NQY A;  4LEH A;  1NO3 A;  3EHC A;  1A90 A;  1NDO B;  4KZ1 A;  1JKG B;  1NU3 A;  2CWT A;  4OK0 A;  3SX1 A;  3X41 A;  4ZM8 A;  3LH4 A;  3EN8 A;  2INX A;  1M1X B;  1TTO A;  1ZS7 A;  1BRG A;  3K7C A;  3GAX A;  2GXF A;  1VQ4 3;  5JBS A;  2XGL A;  1W2Z A;  2CKF B;  1IQ8 A;  2FGT A;  3MSO A;  1MOL A;  3I0Y A;  2GBX B;  5D82 A;  1B27 A;  2RNT A;  2RSX A;  1NWW A;  4IIA A;  5DRE A;  5CF1 A;  5G2G A;  5STD A;  2BO9 B;  1GMR A;  2F99 A;  3CC7 3;  1EG9 B;  3PYJ A;  1MWS A;  4KFE A;  1MWT A;  4FMA A;  1VQ5 3;  1RSN A;  3EQQ B;  1KQS 2;  1BNG A;  3WDG B;  1VQP 3;  3PCS A;  1B2U A;  1GSP A;  2XFT A;  3I55 3;  4WFO A;  2K54 A;  1EEJ A;  3DUK A;  1D6Z A;  2CFG A;  1Q7H A;  4HM4 B;  5IG5 A;  3S27 A;  1BAN A;  1JB4 A;  1W6Y A;  1RN7 A;  1N8R 4;  1TJD A;  2E2T A;  1OHP A;  2HMK B;  4O02 B;  3AGN A;  3CU3 A;  1BRJ A;  1NNV A;  5CXO A;  5BIR A;  1K8A 4;  2OTL 3;  3I56 3;  1OUN A;  3FG4 A;  3NQZ A;  3WOE B;  3F14 A;  1T2I A;  1HU9 A;  3AHS A;  1IYY A;  2AAD A;  4FR9 A;  2R4I A;  3CC4 3;  2XFS A;  1GYB A;  2F5W A;  5AYR B;  4R9K A;  6GSP A;  4HJL B;  2ML6 A;  1BVI A;  1BSA A;  1YIJ 3;  1VZZ A;  1X1U A;  1ROV A;  1V58 A;  2A15 A;  3G4S 3;  1GS3 A;  3LTC A;  1OF5 B;  1KC8 4;  3SVA A;  2W6J H;  1IVV A;  3URP A;  2OOV C;  1UI7 A;  1WQL B;  2IMJ A;  1LQM B;  3JUP A;  1BNI A;  5G1K A;  4AKZ A;  2JDI H;  5A0O B;  3CC2 3;  1Q81 4;  3DGN A;  3V98 A;  5ELU A;  2MF7 A;  1BRH A;  2P09 A;  3SED A;  5KP1 A;  1A2K A;  3CPW 2;  3KE7 A;  2LYX A;  3UL6 A;  1DYU A;  1RKY A;  2RCD A;  1O7P B;  1W02 A;  1EA2 A;  2L1S A;  5KP3 A;  1PFP A;  2IY2 A;  5KP4 A;  3RGR A;  3WR2 A;  1QVG 2;  2SAR A;  1UCI A;  1ROA A;  3DXO A;  1YJW 3;  1FGT A;  3K9M C;  2O3O A;  3OWS A;  3MHE A;  3EN1 B;  3G71 3;  1IT7 A;  3CCE 3;  4K1U A;  3ZFZ A;  1DVD A;  4MMY B;  4NRE A;  3NHX A;  2KAA A;  1FUT A;  4HVN A;  2OWP A;  4XDV A;  4XM4 A;  3OW2 2;  3HOH A;  5GSP A;  2KXG A;  4AEQ A;  1UUV B;  1E3R A;  4CJN A;  2ZA4 A;  1S5A A;  1STD A;  4I5Q A;  2KCD A;  4LZI A;  3CMA 3;  3RDE A;  1B21 A;  4N3V A;  1SIH A;  2W56 B;  3WMD A;  2BNG A;  3U1W A;  3JUQ A;  1Q86 4;  1OPY A;  3EB8 A;  3SXX A;  6STD A;  3WHO A;  1IV7 A;  3ALA A;  2J8X B;  3BLZ A;  4BU4 A;  3N54 B;  1B2Z A;  2E2U A;  4HAA A;  4HM1 B;  1AY7 A;  1DET A;  3KSE D;  4G1M B;  1KSI A;  3CCR 3;  3LXU X;  1W6C A;  5M18 A;  1N5H A;  3D9R A;  3PCR A;  4N6T A;  1RGL A;  2D42 A;  4R4K A;  2CG1 A;  1MGW A;  3IPT A;  4RZM A;  3STD A;  1QAF A;  3VSY A;  3H51 A;  3LTB A;  3B4P A;  1LOY A;  3ECF A;  2E2V A;  3S5C A;  2CH9 A;  2CWV A;  2F86 B;  1N5P A;  1BOX A;  3LT9 A;  4HOH A;  1JRQ A;  3TDG A;  3ZG0 A;  5IG0 A;  3DGM A;  1RCL A;  3LTD A;  1DMQ A;  1FYS A;  2JQ5 A;  3GZR A;  4LMI A;  1BU4 A;  3DGL A;  4HBR A;  3JVC A;  3OWU A;  2FXT A;  2CFK A;  1VQ6 3;  1BIR A;  1BNF A;  4LGQ A;  1X1W A;  3JUO A;  1BRI A;  5AEW B;  4HM0 B;  4K90 B; 
#chains in the Genus database with same CATH homology
 3BNC A;  1VQ7 3;  1OHS A;  2P0M A;  4KFD A;  5LC7 A;  4EC6 A;  1W4N A;  3BB9 A;  3FCS B;  2XEP A;  1RJO A;  1US1 A;  1LNH A;  1N9E A;  4H61 A;  1OAC A;  1O7G B;  3A76 A;  3SOY A;  1R4C A;  4QWT A;  3K63 A;  3U97 A;  2IUJ A;  1C7H A;  1E3V A;  3EJV A;  1WMO A;  1Y4K A;  3V99 A;  3N8B A;  1W6G A;  4EV2 A;  1O7M B;  3MPH A;  2BMQ B;  1IT8 A;  2PNC A;  4HM5 B;  3FZW A;  2KRT A;  3K5T A;  4RNY A;  4STD A;  3K0Z A;  1Q40 A;  3EC9 A;  3EBT A;  3LYG A;  3G8Z A;  1FA3 A;  3B8L A;  4K61 A;  1O7W B;  1SJW A;  2WOH A;  1JN5 A;  1IVX A;  1CYV A;  1M90 4;  4HKV B;  1IDP A;  3F8H A;  3G16 A;  1VQL 3;  2XSO B;  4FMC A;  3ER7 A;  3NV0 B;  3EBY A;  1FGR A;  3LZA A;  3CNX A;  3DY5 A;  2OQE C;  1VQK 3;  1OCV A;  3UL5 A;  1FGM A;  2W9P A;  2MC8 A;  1IVU A;  1AVK A;  1OHO A;  2O9U X;  3S29 A;  1TP6 A;  2SBL A;  2Z77 A;  3NXJ A;  4R1K A;  1K73 4;  2K0M A;  1VQN 3;  3X40 A;  2OOV A;  1LVN A;  3OXA A;  1IV9 A;  5IG3 A;  3VGN A;  5FW5 A;  2CFW A;  2V1L A;  1NB3 I;  4FCJ A;  3MYT A;  1AV4 A;  3S28 A;  3FLJ A;  2RGQ A;  1W01 A;  4AKY A;  5AIH A;  1GY7 A;  1M9G A;  1U8C B;  4FMB A;  1K41 A;  1RRH A;  2GEX A;  2I9W A;  1LXE A;  4O8S A;  5D83 A;  3N9H A;  3GZB A;  3GWR A;  1FGQ A;  2YX9 A;  3IJE B;  4FCM A;  1LOX A;  3NBR A;  4RNZ A;  1DVC A;  1UW1 A;  3T8N A;  4KVH A;  1SPU A;  1YIT 3;  1W5Z A;  2GEY A;  4RBN A;  1YGE A;  2F98 A;  1N8Q A;  3B7C A;  3T8U A;  2D1W A;  5EQL A;  3LOY A;  1ULJ B;  1NB5 I;  3HII A;  2P05 A;  4FMD A;  1QMA A;  3CPO A;  3EF8 A;  3CCV 3;  1ISK A;  1K9M 4;  1FUW A;  3F8X A;  3DMC A;  4WYK A;  2WGO A;  3M8C A;  2HMN B;  2YFL B;  3J7Y d;  2FNQ A;  5JPU A;  2CG0 A;  3MWZ A;  4WWU C;  1YHQ 3;  5AIG A;  2ZDJ A;  3G6E 3;  5CF2 A;  5EEO A;  3WOF B;  1VQ9 3;  1ULI B;  5IG4 A;  3FF0 A;  5AEU B;  2M7O A;  2XSH B;  1EKM A;  3FGY A;  3NBB A;  5DRV A;  3KII A;  3QRD A;  1PU4 A;  4MJD A;  3UNL A;  3D3L A;  3HIG A;  4EBG A;  2QGU A;  4HYZ A;  2CHC A;  4LSO A;  3PS8 A;  1DMN A;  1TUH A;  2CFL A;  4GL6 A;  4OUQ A;  3PXM A;  5D81 A;  4XB5 A;  4BTW A;  1GD3 A;  2QEX 3;  4OVM A;  4O2H A;  1QJG A;  3F9S A;  1JN5 B;  1BUQ A;  1SII A;  1UI8 A;  1DMM A;  5AII A;  3FSD A;  5HGR A;  2W2C A;  3WOD G;  5IF6 A;  4K1V A;  5LC6 A;  2CC3 A;  4R80 A;  2P0X A;  5IW9 A;  3MG3 A;  5BXQ A;  2W04 A;  2BMO B;  4HM6 B;  3O8Y A;  3S67 A;  2W0Q A;  2OCT A;  3LML A;  8CHO A;  1O7N B;  3BND A;  4L7K A;  3Q2P A;  2IUK A;  1TIJ A;  1IK3 A;  2XR8 B;  1FGO A;  2CFD A;  3OWY A;  1ZX2 A;  5AIF A;  1NJI 4;  1O7H B;  3X3Y A;  1ZO2 A;  3CCQ 3;  2CW9 A;  4NHF A;  1CEW I;  1A67 A;  1L5G B;  1T5Y A;  3T0U A;  4N6M A;  3CCM 3;  4H3U A;  3DZL A;  1CYU A;  3UJM A;  1M1K 4;  4KFF A;  4J8T A;  1GD4 A;  3F7S A;  3HI7 A;  3KKG A;  1IVW A;  2OTJ 3;  1N9J A;  2L4V A;  1TU5 A;  3Q90 A;  1VQO 3;  3MG2 A;  1CQS A;  2IA7 A;  2W9Q A;  1V74 A;  4JF8 A;  1MNL A;  4EV5 A;  4CCV A;  1QAL A;  2XF3 A;  1GY5 A;  3KZT A;  1W00 A;  1F8N A;  1WMP A;  3MKI A;  2XRX B;  3OX9 A;  4N6N B;  4FCZ A;  4N6L A;  3AMO A;  5IEO A;  4PEJ A;  2OQE A;  5AYS C;  1OGX A;  2BT3 A;  2CK3 H;  1WMN A;  4XBX A;  5FGO A;  1UUW B;  3KSP A;  3F7X A;  4WYK B;  5ELJ A;  3CCJ 3;  4HM8 B;  3GZX B;  4XDW A;  4L8O A;  3EX9 A;  1Q7Y 4;  1OH0 A;  3BNB A;  2YFI B;  3SLU A;  1JNQ A;  3DGO A;  3JUN A;  4JRF A;  2Z6B A;  4X2O A;  2WO0 A;  1Q82 4;  2RFR A;  5I97 A;  1Z1S A;  4J9A A;  3CCS 3;  3CCU 3;  1GY6 A;  3FKA A;  1Q42 A;  1YVB I;  3IMA B;  1ASK A;  3X42 A;  1S72 3;  1OGZ A;  3CME 3;  1J2B A;  3PZW A;  3B4O A;  4U13 A;  4XBY A;  4EXR A;  1TFK A;  1HKX A;  4O3V A;  1RRL A;  2Q07 A;  4MMZ B;  5CLK A;  1IU7 A;  2PZV A;  1QAK A;  1JB5 A;  2B1X B;  1JJ2 2;  3G0K A;  1KWI A;  3QK9 A;  1G96 A;  2Y73 A;  3E99 A;  2W03 A;  3GZY B;  4XBT A;  1WNH A;  1JKG A;  4R9L A;  3EE1 A;  4ORL A;  1D6U A;  4MEI A;  2WOF A;  3CCL 3;  2QIY A;  4BTY A;  1E97 A;  2XH9 A;  1YJN 3;  3HK4 A;  3X3X A;  2Z76 A;  1W7C A;  2B24 B;  3KN4 A;  1QVF 2;  3Q1C A;  3CD6 3;  2QA4 3;  2GU1 A;  2CWU A;  4Q53 A;  2HMO B;  2WGQ A;  3KFQ C;  4X2H A;  1IQY A;  3X3Z A;  2HML B;  4N6U A;  2YFJ B;  4MMX B;  3WA2 X;  1STF I;  7STD A;  4HZB B;  4HM2 B;  3CXC 2;  4WP5 A;  1YI2 3;  5IEN A;  3NV0 A;  2C10 A;  4BTX A;  3SOA A;  5BVB A;  1Q40 B;  3CNM A;  2LQV A;  3OV4 A;  1U5O A;  3DM8 A;  4N6O B;  1JB2 A;  2HMM B;  4I4K A;  2CIU A;  2P38 A;  2GU3 A;  1VQ8 3;  3V92 A;  2UX0 A;  3PGB A;  1D6Y A;  2ML5 A;  1YJ9 3;  3AMO B;  2BHM A;  1JV2 B;  5AI1 A;  2HMJ B;  3BNE A;  4IPB A;  1OF5 A;  3L0R A;  3NUV A;  3FH1 A;  5TGN A;  3HZP A;  3JUM A;  4L8P A;  5EVH A;  5IER A;  2Z7A A;  1AVL A;  1WTH A;  3UB1 A;  2STD A;  4CDL A;  3LT8 A;  3FG3 A;  3NM7 A;  4HZ9 B;  3FF2 A;  4WHA A;  3LTA A;  3NM2 A;  1VQM 3;  3HX8 A;  2GBW B;  3ROB A;  3VF1 A;  1KD1 4;  4GB5 A;  4HM3 B;  2ZL8 A;  1IQX A;  3GRD A;  5CK6 A;  2XGN A;  2C11 A;  3H3H A;  3NBJ A;  3MG1 A;  4HM7 B;  3FG1 A;  3F40 A;  5IEP A;  2BMR B;  4TX4 A;  1EQK A;  1SQW A;  3WA3 A;  1TFO A;  4N6V 0;  1A2V A;  1W2B 2;  2W56 A;  1K28 A;  2Y74 A;  3RGA A;  4IT7 A;  4EYC A;  5JPP A;  1AR0 A;  3NX0 A;  3NQY A;  4LEH A;  1NO3 A;  3EHC A;  1A90 A;  1NDO B;  4KZ1 A;  1JKG B;  1NU3 A;  2CWT A;  4OK0 A;  3SX1 A;  3X41 A;  4ZM8 A;  3LH4 A;  3EN8 A;  2INX A;  1M1X B;  3K7C A;  3GAX A;  2GXF A;  1VQ4 3;  5JBS A;  2XGL A;  1W2Z A;  2CKF B;  1IQ8 A;  2FGT A;  3MSO A;  1MOL A;  3I0Y A;  2GBX B;  5D82 A;  2RSX A;  5DRE A;  5CF1 A;  1NWW A;  4IIA A;  5G2G A;  5STD A;  2BO9 B;  2F99 A;  3CC7 3;  1EG9 B;  3PYJ A;  4KFE A;  4FMA A;  1VQ5 3;  3EQQ B;  1KQS 2;  3WDG B;  1VQP 3;  3PCS A;  3I55 3;  2XFT A;  4WFO A;  2K54 A;  3DUK A;  1D6Z A;  2CFG A;  4HM4 B;  5IG5 A;  3S27 A;  1JB4 A;  1W6Y A;  1RN7 A;  1N8R 4;  2E2T A;  1OHP A;  2HMK B;  4O02 B;  3CU3 A;  5CXO A;  1K8A 4;  2OTL 3;  3I56 3;  1OUN A;  3FG4 A;  3NQZ A;  3WOE B;  3F14 A;  1HU9 A;  4FR9 A;  2R4I A;  3CC4 3;  2XFS A;  1GYB A;  5AYR B;  4R9K A;  4HJL B;  2ML6 A;  1YIJ 3;  1VZZ A;  1ROV A;  2A15 A;  3G4S 3;  1GS3 A;  3LTC A;  1OF5 B;  1KC8 4;  3SVA A;  2W6J H;  1IVV A;  2OOV C;  1UI7 A;  1WQL B;  2IMJ A;  3JUP A;  3CC2 3;  4AKZ A;  1Q81 4;  2JDI H;  5A0O B;  3DGN A;  3V98 A;  5ELU A;  2MF7 A;  2P09 A;  5KP1 A;  3SED A;  1A2K A;  3CPW 2;  3KE7 A;  2LYX A;  3UL6 A;  1DYU A;  1RKY A;  2RCD A;  1O7P B;  1W02 A;  1EA2 A;  5KP3 A;  1PFP A;  5KP4 A;  3RGR A;  1QVG 2;  1ROA A;  3DXO A;  1YJW 3;  1FGT A;  3K9M C;  2O3O A;  3OWS A;  3MHE A;  3EN1 B;  3G71 3;  1IT7 A;  3CCE 3;  4K1U A;  1DVD A;  4MMY B;  4NRE A;  3NHX A;  4HVN A;  2OWP A;  4XDV A;  4XM4 A;  3OW2 2;  4AEQ A;  2KXG A;  1UUV B;  1E3R A;  1S5A A;  1STD A;  2KCD A;  4LZI A;  3CMA 3;  3RDE A;  4N3V A;  1SIH A;  2W56 B;  3WMD A;  2BNG A;  3U1W A;  3JUQ A;  1Q86 4;  1OPY A;  3EB8 A;  3SXX A;  6STD A;  3ALA A;  1IV7 A;  3BLZ A;  3N54 B;  2E2U A;  4HM1 B;  3KSE D;  4G1M B;  1KSI A;  3CCR 3;  3LXU X;  1W6C A;  1N5H A;  3D9R A;  3PCR A;  4N6T A;  2D42 A;  2CG1 A;  4R4K A;  3IPT A;  4RZM A;  3STD A;  1QAF A;  3VSY A;  3H51 A;  3LTB A;  3B4P A;  3ECF A;  2E2V A;  3S5C A;  2CH9 A;  2CWV A;  2F86 B;  1N5P A;  3LT9 A;  3TDG A;  1JRQ A;  5IG0 A;  3DGM A;  3LTD A;  1DMQ A;  2JQ5 A;  3GZR A;  4LMI A;  3DGL A;  4HBR A;  3JVC A;  3OWU A;  2FXT A;  2CFK A;  1VQ6 3;  4LGQ A;  3JUO A;  5AEW B;  4HM0 B;  4K90 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...