4CDLA

Crystal structure of retro-aldolase ra110.4-6 complexed with inhibitor 1-(6-methoxy-2-naphthalenyl)-1,3-butanedione
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATIESPFGQPPIHGREQIAAHYRKWLGGGKLRVYLTGPVRANHNGCGTMLLRKEWVWNGQPCATDVILVMRFDEQGRIQTEQRYWSEVNLCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Active Site Plasticity of a Computationally Designed Retro-Aldolase Enzyme
rcsb
source organism Pseudomonas putida
total genus 30
structure length 126
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4cdlA00
1AR0A 2HMMB 3DMCA 3FZWA 1JKGB 3BB9A 5G2GA 3MYTA 1NWWA 5IG4A 2STDA 3H51A 1UUVB 2Z76A 2RGQA 3H3HA 1JN5B 1E97A 5IEOA 7STDA 4HZ9B 2CHCA 3FKAA 4WYKB 5JPUA 5CK6A 2HMKB 3FGYA 4R1KA 3B7CA 1IDPA 2GBXB 3EHCA 4LMIA 4HM7B 1E3RA 1OF5B 5CF1A 1ULIB 3OXAA 1S5AA 2R4IA 2YFJB 4XBTA 5IG3A 3MKIA 1DMQA 1O7GB 1GY5A 2F86B 2XRXB 3FH1A 3E99A 4GB5A 4HM8B 3D9RA 3OX9A 3MG3A 3Q90A 2I9WA 2BNGA 1U5OA 4XDWA 3F8HA 5STDA 3UJMA 1OHPA 3F9SA 3JUOA 1TUHA 1Z1SA 5AEWB 1A2KA 4FCMA 3K0ZA 3ER7A 4K1VA 2A15A 1JKGA 4H3UA 2OWPA 1ISKA 4XB5A 3KZTA 3G8ZA 1JN5A 4OUQA 2GEXA 4LEHA 3GZXB 2Z77A 2HMLB 3T8NA 3CPOA 4U13A 1OF5A 3SEDA 5AI1A 3GZRA 3FF2A 2XSOB 3BLZA 1W02A 4J8TA 3NBRA 1K41A 1O7NB 5IG5A 2PZVA 4X2HA 4HM0B 2BMOB 3WMDA 3KSPA 3FF0A 1O7PB 5FW5A 4Q53A 4I4KA 1WQLB 4N3VA 3MG1A 3OWUA 2HMOB 4HM6B 3SOYA 2RFRA 1HKXA 1ASKA 3GWRA 4PEJA 4HJLB 4XDVA 1O7MB 1GY7A 5IENA 1GYBA 3JUPA 1ULJB 4FCJA 4MJDA 3NXJA 4L7KA 4HM1B 3OWYA 3EJVA 1OCVA 3UNLA 3NV0B 3F7XA 4ORLA 1Q40B 3DUKA 3GRDA 3VSYA 1GS3A 3GZYB 4X2OA 5BXQA 4XM4A 1QJGA 3S5CA 5BVBA 5DRVA 3F14A 2QIYA 4LGQA 3OV4A 4R9LA 3VGNA 2BMRB 3MSOA 1OHOA 4OVMA 1E3VA 5CXOA 1UUWB 3EX9A 2W2CA 1JB2A 5IF6A 3KE7A 5D81A 4WYKA 3GZBA 1JB5A 3M8CA 4WP5A 2B24B 3KKGA 1GY6A 5DREA 1SJWA 4KVHA 1JB4A 1OGXA 3DXOA 1DMMA 3IPTA 1W00A 4STDA 1EG9B 2RCDA 1C7HA 3NUVA 1OGZA 1VZZA 3RGAA 1EA2A 5HGRA 4XBYA 5EVHA 4RZMA 1Q40A 5AIIA 3F8XA 4HM4B 5CF2A 8CHOA 3MG2A 5D83A 2QGUA 2F99A 1DMNA 4HKVB 5KP1A 1ZX2A 1O7WB 3G16A 3ROBA 3ECFA 3EBYA 5D82A 2YFLB 1TP6A 1Q42A 3HZPA 3EBTA 1OUNA 3RGRA 3B4PA 4L8PA 3G0KA 3F40A 3EQQB 2HMJB 2BMQB 4J9AA 5IEPA 3B4OA 3LZAA 4WWUC 2IMJA 5AIHA 1O7HB 1CQSA 3FSDA 5CLKA 3DM8A 2B1XB 3CNMA 1STDA 3K7CA 5KP4A 3A76A 3NHXA 3JUQA 4XBXA 2GBWB 2INXA 2GEYA 3JUNA 3STDA 3EC9A 2Z7AA 3EN1B 2F98A 4R9KA 4HZBB 2XSHB 2K54A 5AEUB 5IERA 1NU3A 4HM5B 3B8LA 4HVNA 1NDOB 3I0YA 4HM2B 4CDLA 5AIFA 3HX8A 3DZLA 3OWSA 1W01A 3MHEA 3NM2A 1BUQA 3CNXA 2JQ5A 1OHSA 3CU3A 3SOAA 3HK4A 1ZO2A 2XR8B 5JPPA 2UX0A 1W6YA 1OPYA 3T8UA 2HMNB 1OH0A 3FLJA 4L8OA 3EN8A 3EF8A 5TGNA 5IG0A 2GXFA 3F7SA 5KP3A 2YFIB 4HM3B 5AIGA 6STDA 3NV0A 1QMAA 4IIAA 3LYGA 2CKFB 3JUMA 4K1UA
chains in the Genus database with same CATH superfamily
1AR0A 2HMMB 1QAFA 2P38A 3WOFB 3DMCA 2K0MA 3FZWA 3J7Yd 3UB1A 2CFLA 2H0GA 2ZL8A 2ML6A 1JKGB 3BB9A 5G2GA 1BRSA 3MYTA 3S29A 1NWWA 4NPBA 5IG4A 3NM7A 2STDA 2W0QA 3H51A 1UUVB 2YX9A 2Z76A 1GOUA 2AAEA 1JZOA 4IT7A 1SIIA 4RNTA 4CPKA 1HU9A 2RGQA 3H3HA 1JN5B 1JRQA 1E97A 5IEOA 7STDA 1Q814 4HZ9B 3SXXA 4MEIA 2CHCA 5M19A 6GSPA 3FKAA 3MPHA 4WYKB 5JPUA 2MC8A 1PY3A 1AY7A 5CK6A 2HMKB 4HAAA 1SPUA 1I3FA 3FGYA 3MWZA 2CW9A 4MMXB 4R1KA 3B7CA 3KN4A 1VQ73 3D5IA 1W2B2 1IT8A 2WGQA 1IDPA 1MWTA 2GBXB 2BU4A 2ZDJA 2CK3H 3EHCA 3HOHA 4LMIA 4HM7B 2GU3A 1E3RA 1OF5B 1RN1A 3KSED 1L5GB 1RGAA 1ULIB 3HI7A 1RGCA 5CF1A 4LZIA 1UCKA 4AKZA 1KD14 1AVLA 1BIRA 2W9PA 1RJOA 3OXAA 3PCRA 3CCE3 1S5AA 2R4IA 3DGNA 4GL6A 4RNYA 1C54A 1M9GA 1VQO3 2YFJB 4XBTA 1TFOA 2XH9A 3MKIA 1DMQA 4KT3B 4KZ1A 4NHFA 5GSPA 1JZDA 1O7GB 1GY5A 1RGKA 2W9QA 3FG1A 2F86B 2XRXB 4KFEA 3FH1A 2L4VA 1W6GA 4IPBA 1A2VA 4RBNA 1IV7A 1LOYA 1VQ43 3BU4A 3DGLA 3E99A 4GB5A 4HM8B 4GHOA 4J5KA 2W04A 3D9RA 4BL2A 2AADA 2KCDA 3MG3A 3OX9A 3Q90A 4FMBA 3AMOB 1YI23 1NJI4 1B2XA 3WDGB 4KFFA 2Y74A 1RTUA 2I9WA 2XGLA 2BNGA 1TRPA 1GD3A 1U5OA 4XDWA 1BU4A 3F8HA 1KC84 5STDA 3UJMA 1OHPA 2IY2A 3F9SA 3N9HA 1EEJA 1BANA 3QRDA 4K61A 3WODG 3JUOA 1WNHA 4N6NB 1LOWA 1TUHA 1UUGB 1US1A 1JV2B 3L0RA 5AYRB 1N9EA 4BTXA 1ROVA 1TJDA 3CC73 1PFPA 1Z1SA 1IVWA 3DGYA 5AEWB 1A2KA 1PYLA 2KF4A 4FCMA 3K0ZA 3LTBA 3AHSA 1BNIA 1BRKA 3NBJA 2W56B 3ER7A 1N9JA 4K1VA 1BRGA 2A15A 3KFQC 1JKGA 3PZWA 2OCTA 2F5MA 4H3UA 2OWPA 2OQEC 2ZHXB 1ISKA 3NX0A 1LQGC 2XEPA 3KIIA 3URPA 4XB5A 3KZTA 1LOVA 1R4CA 3BNCA 3NQYA 4R80A 3AHWA 1I2FA 1ZGXA 3G8ZA 1JN5A 4OUQA 2WOHA 4N6V0 2GEXA 1FGQA 4LEHA 3GZXB 1UGHI 2Z77A 2HMLB 3T8NA 3CPOA 3D3LA 1N5PA 4WHAA 2WGOA 1DYUA 2E2UA 3CCS3 3U1WA 1Q7Y4 9RNTA 4EV2A 3G6E3 3IMAB 4U13A 2P05A 1YJW3 1BNEA 1DVCA 2XF3A 1OF5A 1UI7A 1QAKA 2KF3A 1MWSA 3HIIA 3SEDA 1BSEA 1NB3I 5AI1A 1Q824 1K9M4 1BSBA 1RN7A 1BNSA 4TX4A 1N8QA 4BTWA 1B20A 3GZRA 2H0IA 1UCJA 3FF2A 3K5TA 1I8VA 1AVKA 1BGSA 2SARA 2XSOB 3PS8A 4EC6A 3BLZA 1W02A 2FNQA 1NNVA 4J8TA 3NBRA 1K41A 1O7NB 5IG5A 2OTL3 2PZVA 1T2HA 4X2HA 3G4S3 3FG3A 2UUGC 4LSOA 4HM0B 1SQWA 2P09A 3X40A 3OW22 1Q7HA 1FYSA 4EYCA 1AQZA 1GMQA 3CCR3 2BMOB 3WMDA 3KSPA 1J2BA 3FF0A 3NBBA 1RCLA 1BNJA 2UGIA 1WMOA 2CWVA 1GOVA 1O7PB 3X42A 5FW5A 1U8CB 2Z6BA 1B2MA 1YVBI 1TRQA 2IA7A 1VQ93 3AMOA 2OOVC 1I0XA 3RDEA 1SIHA 1VQP3 1IYYA 4EW5A 2CFWA 4Q53A 1K734 1FUTA 2E2TA 1IQYA 1LQMB 4I4KA 1K28A 1WQLB 1VQ53 3CCQ3 1D6ZA 2IUKA 4EV5A 3WA3A 4AEQA 1X1UA 3LT8A 1FGRA 2KAAA 1GMPA 1GOYA 2CFDA 4N3VA 1FZUA 2IYJA 2E2VA 3MG1A 5AYSC 3OWUA 2OQEA 1BRNL 2HMOB 5ELUA 1VQQA 4HM6B 3Q1CA 3SOYA 1RNTA 2RFRA 1HKXA 3TDGA 1RCKA 4DKIA 2H0HA 1CYVA 3Q2PA 1ASKA 3GWRA 4PEJA 1Q864 1JBTA 1W7CA 4KFDA 1K8A4 4HJLB 2WO0A 1BUJA 5IW9A 7GSPA 1MWRA 1W6CA 1BNRA 4XDVA 1O7MB 1GY7A 5IENA 1GYBA 3JUPA 1LXEA 1ULJB 2K3DA 4FMDA 2QA43 4FCJA 2XFTA 2F56A 1TFKA 2CG1A 1QALA 7RNTA 1RDSA 4MJDA 3S67A 1AV4A 2ZA4A 3NXJA 2CIUA 2BHMA 1TU5A 3CCU3 4L7KA 4HM1B 1RGEA 3SLUA 3X3YA 3OWYA 4CCVA 3WA2X 3EJVA 1BOXA 2C10A 1GSPA 1OCVA 5FGOA 3VF1A 1BSCA 3EB8A 3UNLA 3NV0B 1IVUA 3F7XA 4ORLA 3ZG0A 2CX0A 1Q40B 2W6JH 3DUKA 3U97A 1VQK3 3GRDA 3VSYA 3BNEA 1TTOA 5M18A 1GS3A 1Y4KA 3GZYB 2IUJA 1FUWA 1A2PA 2QEX3 3SX1A 1LVNA 1RRHA 1DE3A 4X2OA 5EEOA 5BXQA 4XM4A 1QJGA 3S5CA 4JRFA 2OOVA 5G1LA 5BVBA 1MGRA 1N5HA 1PU4A 1STFI 1LNIA 3V98A 1T2IA 2RBIA 5DRVA 3F14A 3LXUX 3GSPA 2QIYA 2J8XB 4BIRA 3X3XA 3DGOA 2CWTA 4LGQA 3OV4A 4CJNA 4R9LA 3VGNA 1ROAA 2M7OA 1YIJ3 2FGTA 2XFSA 2BMRB 1DETA 3MSOA 3O8YA 1UGIA 4ZM8A 1OHOA 3X3ZA 4OVMA 1B2SA 1E3VA 2LQVA 1GMRA 1RN4A 1LRAA 5CXOA 2JDIH 2BIRA 1UUWB 2BO9B 3EX9A 3NQZA 2W2CA 1JB2A 5IF6A 3KE7A 1EQKA 1RGLA 4WYKA 5D81A 3I563 1FGOA 3GZBA 1JB5A 2KXGA 2P0MA 4MMZB 5BIRA 5IG3A 3M8CA 4WP5A 1V57A 2O3OA 1IU7A 4G1MB 2B24B 1G0TA 1R4YA 3KKGA 1GY6A 1MNLA 1UW1A 2D1WA 1FA3A 3X41A 1BNGA 3CCM3 1I2EA 5DREA 1FGMA 1CEWI 2FXTA 3ALAA 1RMSA 1SJWA 1IK3A 4KVHA 1JB4A 1OGXA 1B21A 3DXOA 4MMYB 1DMMA 3IPTA 5I97A 1W00A 3Q3FA 1N8R4 4STDA 4H61A 1EG9B 1HZ1A 4N6MA 2RCDA 5A0OB 1YHQ3 1C7HA 3NUVA 3LTDA 1OGZA 1W5ZA 2ML5A 1QVF2 1VZZA 3RGAA 3N8BA 1EA2A 4FCZA 1GD4A 1WMNA 3LTCA 4HYZA 5HGRA 4EBGA 1A90A 5JBSA 2GU1A 4XBYA 1WTHA 5EVHA 1ZS7A 3CME3 4RZMA 3GAXA 1Q40A 1V74A 3D5GA 3LH4A 4ILFA 5AIIA 1JBRA 3LMLA 4J5GA 3D4AA 1T5YA 2WOFA 3F8XA 1BSDA 2LYXA 3CCV3 3PCSA 1D6YA 1HYFA 1M1XB 3DGMA 3WHOA 4HM4B 1MWUA 5CF2A 8CHOA 4QWTA 1IQXA 3S28A 3MG2A 5D83A 5G1KA 2QGUA 3HIGA 3SVAA 3CMA3 2F99A 1DMNA 3BIRA 4HKVB 5KP1A 5LC6A 1ZX2A 1VQ63 3LTAA 2W03A 1I0VA 1O7WB 2KF6A 1EKMA 5BU4A 3G16A 4JF8A 1S723 1V58A 3ECFA 1RRLA 3ROBA 2OTJ3 2W56A 3EBYA 1BVIA 1YVSA 2YFLB 3PYJA 5D82A 1TP6A 1Q42A 3FCSB 3HZPA 4O2HA 3EBTA 1OUNA 4O02B 6RNTA 3SYUA 3RGRA 3V99A 4BTYA 3B4PA 2MF7A 4L8PA 3G0KA 2RSXA 1RKYA 3T0UA 1MOLA 1BRIA 3F40A 1JBSA 3EQQB 3K63A 1KWIA 3K9MC 1FW7A 2HMJB 1VQ83 1UDII 2BMQB 2HOHA 4J9AA 5IEPA 3CCJ3 1VQM3 1M904 3B4OA 1YGEA 3PGBA 3LZAA 1W4NA 4WWUC 2IMJA 3DH2A 3N54B 3ZFZA 5AIHA 4I5QA 1D6UA 1RLSA 1X1XA 1O7HB 1NB5I 1CQSA 3JVCA 3FSDA 2CX1A 3CC43 3IJEB 1LOXA 1JNQA 2PNCA 4HBRA 4AKYA 1Q9EA 1W2ZA 1B3SA 3DM8A 2B1XB 3AGOA 5CLKA 3CNMA 2XGNA 1STDA 4R4KA 3K7CA 3CCL3 1YNVX 1UCLA 1YJ93 2CFGA 4N6TA 3V92A 5KP4A 4OK0A 3BNBA 3A76A 3NHXA 2O9UX 3JUQA 4XBXA 1DVDA 4HOHA 2GBWB 1WMPA 2INXA 1A67A 4EXRA 2GEYA 2P0XA 1X1YA 3JUNA 3EC9A 1G96A 2Z7AA 3STDA 3EN1B 2F98A 3PXMA 1JJ22 4R9KA 3AGNA 3KCHA 2XSHB 4HZBB 4RNZA 2K54A 5AEUB 1YIT3 2Y73A 1B2UA 5IERA 1IVXA 1B2ZA 1NU3A 4HM5B 3B8LA 4HVNA 1MGWA 4O8SA 1NDOB 1I2GA 5ELJA 1I3IA 1BRJA 3I0YA 1KQS2 1G02A 4HM2B 4LYLB 4CDLA 1QVG2 2CWUA 2F5WA 2SBLA 3ZG5A 1OACA 1YJN3 5M1AA 1IV9A 5AIFA 2RNTA 3RNTA 1YGWA 1X1WA 3LOYA 4FMAA 1M1K4 2C11A 3HX8A 3DZLA 2KF5A 3OWSA 1W01A 1BSAA 2R41A 3MHEA 2CFKA 3NM2A 3WR2A 1BUQA 1SARA 2CH9A 3CNXA 1FGTA 3UL5A 2KRTA 2JQ5A 1RGGA 1CH0A 1T3BA 1OHSA 3CU3A 1FUSA 3LT9A 3CPW2 3SOAA 5RNTA 4BU4A 3BNDA 3FG4A 3HK4A 1RSNA 1IVVA 1ZO2A 2XR8B 5JPPA 2F4YA 2UX0A 2D42A 4GSPA 1RHLA 4BL3A 3CD63 4WFOA 4NREA 1VQL3 1W6YA 1OPYA 2L1SA 1I70A 3T8UA 3I553 2HMNB 4N6UA 1BNFA 1OH0A 4K90B 3FLJA 1NO3A 4FR9A 5EQLA 1IT7A 4N6OB 4L8OA 3EN8A 3EF8A 5TGNA 5IG0A 1TIJA 1RGHA 2GXFA 3F7SA 3WOEB 5KP3A 3G713 2CG0A 2YFIB 3EE1A 1RGFA 1UCIA 4HM3B 1LNHA 1UI8A 3S27A 2C4BA 5AIGA 6STDA 1F8NA 3NV0A 1KSIA 2GSPA 1QMAA 2Q07A 4IIAA 4O3VA 1CYUA 3QK9A 1RNBA 3A5EA 3LYGA 4N6LA 5LC7A 2CKFB 3JUMA 3UL6A 1BAOA 8RNTA 5HOHA 3CC23 4K1UA 1EUIC 1IQ8A 4FMCA 1B27A 2CC3A 2V1LA 1BRHA 1VQN3 3DY5A 3D79A 2BT3A 3CXC2
chains in the Genus database with same CATH topology
1AR0A 2HMMB 1QAFA 2P38A 3WOFB 3DMCA 2K0MA 3FZWA 3J7Yd 3UB1A 2CFLA 2ZL8A 2ML6A 1JKGB 3BB9A 5G2GA 3MYTA 3S29A 1NWWA 5IG4A 3NM7A 2STDA 2W0QA 3H51A 1UUVB 2YX9A 2Z76A 4IT7A 1SIIA 1HU9A 2RGQA 3H3HA 1JN5B 1JRQA 1E97A 5IEOA 7STDA 1Q814 4HZ9B 3SXXA 4MEIA 2CHCA 3FKAA 3MPHA 4WYKB 5JPUA 2MC8A 5CK6A 2HMKB 1SPUA 4MMXB 3FGYA 3MWZA 2CW9A 4R1KA 3B7CA 3KN4A 1VQ73 1W2B2 1IT8A 2WGQA 1IDPA 2GBXB 2ZDJA 3EHCA 2CK3H 4LMIA 4HM7B 2GU3A 1E3RA 1OF5B 3KSED 1L5GB 5CF1A 1ULIB 3HI7A 4LZIA 4AKZA 1KD14 1AVLA 2W9PA 1RJOA 3OXAA 3PCRA 3CCE3 1S5AA 2R4IA 3DGNA 4GL6A 4RNYA 1M9GA 1VQO3 2YFJB 4XBTA 1TFOA 2XH9A 3MKIA 1DMQA 4KZ1A 4NHFA 5IG3A 1O7GB 1GY5A 2W9QA 3FG1A 2F86B 2XRXB 4KFEA 3FH1A 2L4VA 1W6GA 4IPBA 1A2VA 4RBNA 1IV7A 1VQ43 3E99A 3DGLA 4GB5A 4HM8B 2W04A 3D9RA 2KCDA 3MG3A 3OX9A 3Q90A 4FMBA 3AMOB 1YI23 1NJI4 3WDGB 4KFFA 2Y74A 2I9WA 2XGLA 2BNGA 1GD3A 1U5OA 4XDWA 3F8HA 1KC84 5STDA 3UJMA 1OHPA 3F9SA 3N9HA 3WODG 3QRDA 4K61A 3JUOA 1WNHA 4N6NB 1TUHA 1US1A 1JV2B 3L0RA 5AYRB 1N9EA 4BTXA 1ROVA 3CC73 1PFPA 1Z1SA 1IVWA 5AEWB 1A2KA 4FCMA 3K0ZA 3LTBA 3NBJA 2W56B 3ER7A 1N9JA 4K1VA 3KFQC 2A15A 3PZWA 1JKGA 2OCTA 4H3UA 2OWPA 2OQEC 1ISKA 3NX0A 2XEPA 3KIIA 4XB5A 3KZTA 1R4CA 3BNCA 3NQYA 4R80A 3G8ZA 1JN5A 4OUQA 2WOHA 4N6V0 2GEXA 1FGQA 4LEHA 3GZXB 2Z77A 2HMLB 3T8NA 3CPOA 3D3LA 1N5PA 4WHAA 2WGOA 1DYUA 2E2UA 3CCS3 3U1WA 1Q7Y4 4EV2A 3G6E3 3IMAB 4U13A 2P05A 1YJW3 1DVCA 2XF3A 1OF5A 1UI7A 1QAKA 3HIIA 3SEDA 1Q824 1NB3I 5AI1A 1K9M4 1RN7A 4TX4A 4BTWA 1N8QA 3GZRA 3PS8A 3FF2A 4AKYA 3K5TA 4EC6A 1AVKA 2XSOB 3BLZA 1W02A 2FNQA 4J8TA 3NBRA 1K41A 1O7NB 5IG5A 2OTL3 2PZVA 4X2HA 3G4S3 3FG3A 4LSOA 4HM0B 1SQWA 2P09A 3X40A 3OW22 4EYCA 3CCR3 2BMOB 3WMDA 3KSPA 1J2BA 3FF0A 3NBBA 3X42A 1WMOA 2CWVA 1O7PB 5FW5A 1U8CB 2Z6BA 1YVBI 2IA7A 1VQ93 3AMOA 2OOVC 3RDEA 1SIHA 1VQP3 2CFWA 4Q53A 1K734 2E2TA 1IQYA 4I4KA 1K28A 1WQLB 3CCQ3 1D6ZA 2IUKA 4EV5A 3WA3A 4AEQA 3LT8A 1FGRA 2CFDA 4N3VA 2E2VA 3MG1A 5AYSC 3OWUA 2OQEA 2HMOB 5ELUA 4HM6B 3Q1CA 3SOYA 2RFRA 1HKXA 3TDGA 1CYVA 3Q2PA 1ASKA 3GWRA 4PEJA 1Q864 1W7CA 4KFDA 1K8A4 4HJLB 2WO0A 5IW9A 1W6CA 4XDVA 1O7MB 1GY7A 5IENA 1GYBA 3JUPA 1LXEA 1ULJB 4FMDA 2QA43 4FCJA 2XFTA 1TFKA 2CG1A 1QALA 4MJDA 3S67A 1AV4A 3NXJA 2CIUA 2BHMA 1TU5A 3CCU3 4L7KA 4HM1B 3SLUA 3X3YA 3OWYA 4CCVA 3WA2X 3EJVA 5FGOA 2C10A 3VF1A 1OCVA 3EB8A 3UNLA 3NV0B 1IVUA 3F7XA 4ORLA 3U97A 1Q40B 2W6JH 3DUKA 1VQK3 3GRDA 3VSYA 3BNEA 1GS3A 1Y4KA 3GZYB 2IUJA 1FUWA 2QEX3 3SX1A 1LVNA 1RRHA 4X2OA 5EEOA 5BXQA 4XM4A 1QJGA 3S5CA 4JRFA 2OOVA 5BVBA 1N5HA 1PU4A 1STFI 3V98A 5DRVA 3F14A 3LXUX 2QIYA 3X3XA 3DGOA 2CWTA 4LGQA 3OV4A 4R9LA 3VGNA 1ROAA 2M7OA 1YIJ3 2FGTA 2XFSA 2BMRB 3MSOA 3O8YA 4ZM8A 1OHOA 3X3ZA 4OVMA 1E3VA 2LQVA 5CXOA 2JDIH 1UUWB 2BO9B 3EX9A 3NQZA 2W2CA 1JB2A 5IF6A 3KE7A 1EQKA 5D81A 4WYKA 3I563 1FGOA 3GZBA 1JB5A 2KXGA 2P0MA 4MMZB 3M8CA 4WP5A 2O3OA 1IU7A 4G1MB 2B24B 3KKGA 1GY6A 1MNLA 1UW1A 2D1WA 1FA3A 3X41A 3CCM3 5DREA 1FGMA 1CEWI 2FXTA 3ALAA 1SJWA 1IK3A 4KVHA 1JB4A 1OGXA 3DXOA 4MMYB 1DMMA 3IPTA 5I97A 1W00A 1N8R4 4STDA 4H61A 1EG9B 4N6MA 5A0OB 2RCDA 1YHQ3 1C7HA 3NUVA 3LTDA 1OGZA 1W5ZA 2ML5A 1QVF2 1VZZA 3RGAA 3N8BA 1EA2A 4FCZA 1GD4A 1WMNA 3LTCA 4HYZA 5HGRA 4EBGA 1A90A 5JBSA 2GU1A 4XBYA 1WTHA 5EVHA 3CME3 4RZMA 3GAXA 1Q40A 1V74A 3LH4A 5AIIA 3LMLA 3CCV3 1T5YA 2WOFA 3F8XA 2LYXA 3PCSA 1M1XB 1D6YA 3DGMA 4HM4B 5CF2A 8CHOA 4QWTA 1IQXA 3S28A 3MG2A 5D83A 2QGUA 3HIGA 3SVAA 3CMA3 2F99A 1DMNA 4HKVB 5KP1A 5LC6A 1ZX2A 1VQ63 3LTAA 2W03A 1O7WB 1EKMA 2OTJ3 3G16A 4JF8A 1S723 3ROBA 3ECFA 1RRLA 2W56A 3EBYA 3PYJA 2YFLB 5D82A 1TP6A 1Q42A 3FCSB 3HZPA 4O2HA 3EBTA 1OUNA 4O02B 3RGRA 3V99A 4BTYA 3B4PA 2MF7A 4L8PA 3G0KA 2RSXA 1RKYA 3T0UA 1MOLA 3F40A 3EQQB 3K63A 1KWIA 3K9MC 2HMJB 1VQ83 2BMQB 4J9AA 5IEPA 3CCJ3 1VQM3 1M904 3B4OA 1YGEA 3PGBA 3LZAA 1W4NA 4WWUC 2IMJA 3N54B 5AIHA 1D6UA 1O7HB 1NB5I 1CQSA 3JVCA 3FSDA 3CC43 3IJEB 1LOXA 1JNQA 2PNCA 4HBRA 1W2ZA 5CLKA 3DM8A 2B1XB 3CNMA 2XGNA 1STDA 4R4KA 3K7CA 3CCL3 1YJ93 2CFGA 4N6TA 3V92A 5KP4A 4OK0A 3BNBA 3A76A 3NHXA 2O9UX 3JUQA 4XBXA 1DVDA 2GBWB 1WMPA 2INXA 1A67A 4EXRA 2GEYA 2P0XA 3JUNA 3STDA 3EC9A 1G96A 2Z7AA 3EN1B 2F98A 3PXMA 1JJ22 4R9KA 4HZBB 2XSHB 4RNZA 1YIT3 2K54A 5AEUB 2Y73A 5IERA 1IVXA 1NU3A 4HM5B 3B8LA 4HVNA 4O8SA 5ELJA 1NDOB 1VQ53 1KQS2 3I0YA 4HM2B 4CDLA 1QVG2 2CWUA 2SBLA 1OACA 1YJN3 1IV9A 5AIFA 4FMAA 3LOYA 1M1K4 2C11A 3HX8A 3DZLA 3OWSA 1W01A 3MHEA 2CFKA 3NM2A 1BUQA 2CH9A 3CNXA 1FGTA 3UL5A 2KRTA 2JQ5A 1OHSA 3CU3A 3LT9A 3CPW2 3SOAA 3BNDA 3FG4A 3HK4A 1ZO2A 1IVVA 2XR8B 5JPPA 2UX0A 2D42A 3CD63 4WFOA 4NREA 1VQL3 1W6YA 1OPYA 3T8UA 3I553 2HMNB 4N6UA 1OH0A 4K90B 5EQLA 3FLJA 1NO3A 4FR9A 1IT7A 4N6OB 4L8OA 3EN8A 3EF8A 5TGNA 5IG0A 1TIJA 2GXFA 3F7SA 3G713 3WOEB 5KP3A 2CG0A 2YFIB 3EE1A 4HM3B 1LNHA 1UI8A 3S27A 5AIGA 6STDA 1F8NA 3NV0A 1KSIA 1QMAA 2Q07A 4IIAA 4O3VA 1CYUA 3QK9A 3LYGA 4N6LA 5LC7A 2CKFB 3JUMA 3UL6A 3CC23 4K1UA 1IQ8A 4FMCA 2CC3A 2V1LA 1VQN3 3DY5A 2BT3A 3CXC2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR0 A;  2HMM B;  3DMC A;  3FZW A;  1JKG B;  3BB9 A;  5G2G A;  3MYT A;  1NWW A;  5IG4 A;  2STD A;  3H51 A;  1UUV B;  2Z76 A;  2RGQ A;  3H3H A;  1JN5 B;  1E97 A;  5IEO A;  7STD A;  4HZ9 B;  2CHC A;  3FKA A;  4WYK B;  5JPU A;  5CK6 A;  2HMK B;  3FGY A;  4R1K A;  3B7C A;  1IDP A;  2GBX B;  3EHC A;  4LMI A;  4HM7 B;  1E3R A;  1OF5 B;  5CF1 A;  1ULI B;  3OXA A;  1S5A A;  2R4I A;  2YFJ B;  4XBT A;  5IG3 A;  3MKI A;  1DMQ A;  1O7G B;  1GY5 A;  2F86 B;  2XRX B;  3FH1 A;  3E99 A;  4GB5 A;  4HM8 B;  3D9R A;  3OX9 A;  3MG3 A;  3Q90 A;  2I9W A;  2BNG A;  1U5O A;  4XDW A;  3F8H A;  5STD A;  3UJM A;  1OHP A;  3F9S A;  3JUO A;  1TUH A;  1Z1S A;  5AEW B;  1A2K A;  4FCM A;  3K0Z A;  3ER7 A;  4K1V A;  2A15 A;  1JKG A;  4H3U A;  2OWP A;  1ISK A;  4XB5 A;  3KZT A;  3G8Z A;  1JN5 A;  4OUQ A;  2GEX A;  4LEH A;  3GZX B;  2Z77 A;  2HML B;  3T8N A;  3CPO A;  4U13 A;  1OF5 A;  3SED A;  5AI1 A;  3GZR A;  3FF2 A;  2XSO B;  3BLZ A;  1W02 A;  4J8T A;  3NBR A;  1K41 A;  1O7N B;  5IG5 A;  2PZV A;  4X2H A;  4HM0 B;  2BMO B;  3WMD A;  3KSP A;  3FF0 A;  1O7P B;  5FW5 A;  4Q53 A;  4I4K A;  1WQL B;  4N3V A;  3MG1 A;  3OWU A;  2HMO B;  4HM6 B;  3SOY A;  2RFR A;  1HKX A;  1ASK A;  3GWR A;  4PEJ A;  4HJL B;  4XDV A;  1O7M B;  1GY7 A;  5IEN A;  1GYB A;  3JUP A;  1ULJ B;  4FCJ A;  4MJD A;  3NXJ A;  4L7K A;  4HM1 B;  3OWY A;  3EJV A;  1OCV A;  3UNL A;  3NV0 B;  3F7X A;  4ORL A;  1Q40 B;  3DUK A;  3GRD A;  3VSY A;  1GS3 A;  3GZY B;  4X2O A;  5BXQ A;  4XM4 A;  1QJG A;  3S5C A;  5BVB A;  5DRV A;  3F14 A;  2QIY A;  4LGQ A;  3OV4 A;  4R9L A;  3VGN A;  2BMR B;  3MSO A;  1OHO A;  4OVM A;  1E3V A;  5CXO A;  1UUW B;  3EX9 A;  2W2C A;  1JB2 A;  5IF6 A;  3KE7 A;  5D81 A;  4WYK A;  3GZB A;  1JB5 A;  3M8C A;  4WP5 A;  2B24 B;  3KKG A;  1GY6 A;  5DRE A;  1SJW A;  4KVH A;  1JB4 A;  1OGX A;  3DXO A;  1DMM A;  3IPT A;  1W00 A;  4STD A;  1EG9 B;  2RCD A;  1C7H A;  3NUV A;  1OGZ A;  1VZZ A;  3RGA A;  1EA2 A;  5HGR A;  4XBY A;  5EVH A;  4RZM A;  1Q40 A;  5AII A;  3F8X A;  4HM4 B;  5CF2 A;  8CHO A;  3MG2 A;  5D83 A;  2QGU A;  2F99 A;  1DMN A;  4HKV B;  5KP1 A;  1ZX2 A;  1O7W B;  3G16 A;  3ROB A;  3ECF A;  3EBY A;  5D82 A;  2YFL B;  1TP6 A;  1Q42 A;  3HZP A;  3EBT A;  1OUN A;  3RGR A;  3B4P A;  4L8P A;  3G0K A;  3F40 A;  3EQQ B;  2HMJ B;  2BMQ B;  4J9A A;  5IEP A;  3B4O A;  3LZA A;  4WWU C;  2IMJ A;  5AIH A;  1O7H B;  1CQS A;  3FSD A;  5CLK A;  3DM8 A;  2B1X B;  3CNM A;  1STD A;  3K7C A;  5KP4 A;  3A76 A;  3NHX A;  3JUQ A;  4XBX A;  2GBW B;  2INX A;  2GEY A;  3JUN A;  3STD A;  3EC9 A;  2Z7A A;  3EN1 B;  2F98 A;  4R9K A;  4HZB B;  2XSH B;  2K54 A;  5AEU B;  5IER A;  1NU3 A;  4HM5 B;  3B8L A;  4HVN A;  1NDO B;  3I0Y A;  4HM2 B;  4CDL A;  5AIF A;  3HX8 A;  3DZL A;  3OWS A;  1W01 A;  3MHE A;  3NM2 A;  1BUQ A;  3CNX A;  2JQ5 A;  1OHS A;  3CU3 A;  3SOA A;  3HK4 A;  1ZO2 A;  2XR8 B;  5JPP A;  2UX0 A;  1W6Y A;  1OPY A;  3T8U A;  2HMN B;  1OH0 A;  3FLJ A;  4L8O A;  3EN8 A;  3EF8 A;  5TGN A;  5IG0 A;  2GXF A;  3F7S A;  5KP3 A;  2YFI B;  4HM3 B;  5AIG A;  6STD A;  3NV0 A;  1QMA A;  4IIA A;  3LYG A;  2CKF B;  3JUM A;  4K1U A; 
#chains in the Genus database with same CATH topology
 1AR0 A;  2HMM B;  1QAF A;  2P38 A;  3WOF B;  3DMC A;  2K0M A;  3FZW A;  3J7Y d;  3UB1 A;  2CFL A;  2H0G A;  2ZL8 A;  2ML6 A;  1JKG B;  3BB9 A;  5G2G A;  1BRS A;  3MYT A;  3S29 A;  1NWW A;  4NPB A;  5IG4 A;  3NM7 A;  2STD A;  2W0Q A;  3H51 A;  1UUV B;  2YX9 A;  2Z76 A;  1GOU A;  2AAE A;  1JZO A;  4IT7 A;  1SII A;  4RNT A;  4CPK A;  1HU9 A;  2RGQ A;  3H3H A;  1JN5 B;  1JRQ A;  1E97 A;  5IEO A;  7STD A;  1Q81 4;  4HZ9 B;  3SXX A;  4MEI A;  2CHC A;  5M19 A;  6GSP A;  3FKA A;  3MPH A;  4WYK B;  5JPU A;  2MC8 A;  1PY3 A;  1AY7 A;  5CK6 A;  2HMK B;  4HAA A;  1SPU A;  1I3F A;  3FGY A;  3MWZ A;  2CW9 A;  4MMX B;  4R1K A;  3B7C A;  3KN4 A;  1VQ7 3;  3D5I A;  1W2B 2;  1IT8 A;  2WGQ A;  1IDP A;  1MWT A;  2GBX B;  2BU4 A;  2ZDJ A;  2CK3 H;  3EHC A;  3HOH A;  4LMI A;  4HM7 B;  2GU3 A;  1E3R A;  1OF5 B;  1RN1 A;  3KSE D;  1L5G B;  1RGA A;  1ULI B;  3HI7 A;  1RGC A;  5CF1 A;  4LZI A;  1UCK A;  4AKZ A;  1KD1 4;  1AVL A;  1BIR A;  2W9P A;  1RJO A;  3OXA A;  3PCR A;  3CCE 3;  1S5A A;  2R4I A;  3DGN A;  4GL6 A;  4RNY A;  1C54 A;  1M9G A;  1VQO 3;  2YFJ B;  4XBT A;  1TFO A;  2XH9 A;  3MKI A;  1DMQ A;  4KT3 B;  4KZ1 A;  4NHF A;  5GSP A;  1JZD A;  1O7G B;  1GY5 A;  1RGK A;  2W9Q A;  3FG1 A;  2F86 B;  2XRX B;  4KFE A;  3FH1 A;  2L4V A;  1W6G A;  4IPB A;  1A2V A;  4RBN A;  1IV7 A;  1LOY A;  1VQ4 3;  3BU4 A;  3DGL A;  3E99 A;  4GB5 A;  4HM8 B;  4GHO A;  4J5K A;  2W04 A;  3D9R A;  4BL2 A;  2AAD A;  2KCD A;  3MG3 A;  3OX9 A;  3Q90 A;  4FMB A;  3AMO B;  1YI2 3;  1NJI 4;  1B2X A;  3WDG B;  4KFF A;  2Y74 A;  1RTU A;  2I9W A;  2XGL A;  2BNG A;  1TRP A;  1GD3 A;  1U5O A;  4XDW A;  1BU4 A;  3F8H A;  1KC8 4;  5STD A;  3UJM A;  1OHP A;  2IY2 A;  3F9S A;  3N9H A;  1EEJ A;  1BAN A;  3QRD A;  4K61 A;  3WOD G;  3JUO A;  1WNH A;  4N6N B;  1LOW A;  1TUH A;  1UUG B;  1US1 A;  1JV2 B;  3L0R A;  5AYR B;  1N9E A;  4BTX A;  1ROV A;  1TJD A;  3CC7 3;  1PFP A;  1Z1S A;  1IVW A;  3DGY A;  5AEW B;  1A2K A;  1PYL A;  2KF4 A;  4FCM A;  3K0Z A;  3LTB A;  3AHS A;  1BNI A;  1BRK A;  3NBJ A;  2W56 B;  3ER7 A;  1N9J A;  4K1V A;  1BRG A;  2A15 A;  3KFQ C;  1JKG A;  3PZW A;  2OCT A;  2F5M A;  4H3U A;  2OWP A;  2OQE C;  2ZHX B;  1ISK A;  3NX0 A;  1LQG C;  2XEP A;  3KII A;  3URP A;  4XB5 A;  3KZT A;  1LOV A;  1R4C A;  3BNC A;  3NQY A;  4R80 A;  3AHW A;  1I2F A;  1ZGX A;  3G8Z A;  1JN5 A;  4OUQ A;  2WOH A;  4N6V 0;  2GEX A;  1FGQ A;  4LEH A;  3GZX B;  1UGH I;  2Z77 A;  2HML B;  3T8N A;  3CPO A;  3D3L A;  1N5P A;  4WHA A;  2WGO A;  1DYU A;  2E2U A;  3CCS 3;  3U1W A;  1Q7Y 4;  9RNT A;  4EV2 A;  3G6E 3;  3IMA B;  4U13 A;  2P05 A;  1YJW 3;  1BNE A;  1DVC A;  2XF3 A;  1OF5 A;  1UI7 A;  1QAK A;  2KF3 A;  1MWS A;  3HII A;  3SED A;  1BSE A;  1NB3 I;  5AI1 A;  1Q82 4;  1K9M 4;  1BSB A;  1RN7 A;  1BNS A;  4TX4 A;  1N8Q A;  4BTW A;  1B20 A;  3GZR A;  2H0I A;  1UCJ A;  3FF2 A;  3K5T A;  1I8V A;  1AVK A;  1BGS A;  2SAR A;  2XSO B;  3PS8 A;  4EC6 A;  3BLZ A;  1W02 A;  2FNQ A;  1NNV A;  4J8T A;  3NBR A;  1K41 A;  1O7N B;  5IG5 A;  2OTL 3;  2PZV A;  1T2H A;  4X2H A;  3G4S 3;  3FG3 A;  2UUG C;  4LSO A;  4HM0 B;  1SQW A;  2P09 A;  3X40 A;  3OW2 2;  1Q7H A;  1FYS A;  4EYC A;  1AQZ A;  1GMQ A;  3CCR 3;  2BMO B;  3WMD A;  3KSP A;  1J2B A;  3FF0 A;  3NBB A;  1RCL A;  1BNJ A;  2UGI A;  1WMO A;  2CWV A;  1GOV A;  1O7P B;  3X42 A;  5FW5 A;  1U8C B;  2Z6B A;  1B2M A;  1YVB I;  1TRQ A;  2IA7 A;  1VQ9 3;  3AMO A;  2OOV C;  1I0X A;  3RDE A;  1SIH A;  1VQP 3;  1IYY A;  4EW5 A;  2CFW A;  4Q53 A;  1K73 4;  1FUT A;  2E2T A;  1IQY A;  1LQM B;  4I4K A;  1K28 A;  1WQL B;  1VQ5 3;  3CCQ 3;  1D6Z A;  2IUK A;  4EV5 A;  3WA3 A;  4AEQ A;  1X1U A;  3LT8 A;  1FGR A;  2KAA A;  1GMP A;  1GOY A;  2CFD A;  4N3V A;  1FZU A;  2IYJ A;  2E2V A;  3MG1 A;  5AYS C;  3OWU A;  2OQE A;  1BRN L;  2HMO B;  5ELU A;  1VQQ A;  4HM6 B;  3Q1C A;  3SOY A;  1RNT A;  2RFR A;  1HKX A;  3TDG A;  1RCK A;  4DKI A;  2H0H A;  1CYV A;  3Q2P A;  1ASK A;  3GWR A;  4PEJ A;  1Q86 4;  1JBT A;  1W7C A;  4KFD A;  1K8A 4;  4HJL B;  2WO0 A;  1BUJ A;  5IW9 A;  7GSP A;  1MWR A;  1W6C A;  1BNR A;  4XDV A;  1O7M B;  1GY7 A;  5IEN A;  1GYB A;  3JUP A;  1LXE A;  1ULJ B;  2K3D A;  4FMD A;  2QA4 3;  4FCJ A;  2XFT A;  2F56 A;  1TFK A;  2CG1 A;  1QAL A;  7RNT A;  1RDS A;  4MJD A;  3S67 A;  1AV4 A;  2ZA4 A;  3NXJ A;  2CIU A;  2BHM A;  1TU5 A;  3CCU 3;  4L7K A;  4HM1 B;  1RGE A;  3SLU A;  3X3Y A;  3OWY A;  4CCV A;  3WA2 X;  3EJV A;  1BOX A;  2C10 A;  1GSP A;  1OCV A;  5FGO A;  3VF1 A;  1BSC A;  3EB8 A;  3UNL A;  3NV0 B;  1IVU A;  3F7X A;  4ORL A;  3ZG0 A;  2CX0 A;  1Q40 B;  2W6J H;  3DUK A;  3U97 A;  1VQK 3;  3GRD A;  3VSY A;  3BNE A;  1TTO A;  5M18 A;  1GS3 A;  1Y4K A;  3GZY B;  2IUJ A;  1FUW A;  1A2P A;  2QEX 3;  3SX1 A;  1LVN A;  1RRH A;  1DE3 A;  4X2O A;  5EEO A;  5BXQ A;  4XM4 A;  1QJG A;  3S5C A;  4JRF A;  2OOV A;  5G1L A;  5BVB A;  1MGR A;  1N5H A;  1PU4 A;  1STF I;  1LNI A;  3V98 A;  1T2I A;  2RBI A;  5DRV A;  3F14 A;  3LXU X;  3GSP A;  2QIY A;  2J8X B;  4BIR A;  3X3X A;  3DGO A;  2CWT A;  4LGQ A;  3OV4 A;  4CJN A;  4R9L A;  3VGN A;  1ROA A;  2M7O A;  1YIJ 3;  2FGT A;  2XFS A;  2BMR B;  1DET A;  3MSO A;  3O8Y A;  1UGI A;  4ZM8 A;  1OHO A;  3X3Z A;  4OVM A;  1B2S A;  1E3V A;  2LQV A;  1GMR A;  1RN4 A;  1LRA A;  5CXO A;  2JDI H;  2BIR A;  1UUW B;  2BO9 B;  3EX9 A;  3NQZ A;  2W2C A;  1JB2 A;  5IF6 A;  3KE7 A;  1EQK A;  1RGL A;  4WYK A;  5D81 A;  3I56 3;  1FGO A;  3GZB A;  1JB5 A;  2KXG A;  2P0M A;  4MMZ B;  5BIR A;  5IG3 A;  3M8C A;  4WP5 A;  1V57 A;  2O3O A;  1IU7 A;  4G1M B;  2B24 B;  1G0T A;  1R4Y A;  3KKG A;  1GY6 A;  1MNL A;  1UW1 A;  2D1W A;  1FA3 A;  3X41 A;  1BNG A;  3CCM 3;  1I2E A;  5DRE A;  1FGM A;  1CEW I;  2FXT A;  3ALA A;  1RMS A;  1SJW A;  1IK3 A;  4KVH A;  1JB4 A;  1OGX A;  1B21 A;  3DXO A;  4MMY B;  1DMM A;  3IPT A;  5I97 A;  1W00 A;  3Q3F A;  1N8R 4;  4STD A;  4H61 A;  1EG9 B;  1HZ1 A;  4N6M A;  2RCD A;  5A0O B;  1YHQ 3;  1C7H A;  3NUV A;  3LTD A;  1OGZ A;  1W5Z A;  2ML5 A;  1QVF 2;  1VZZ A;  3RGA A;  3N8B A;  1EA2 A;  4FCZ A;  1GD4 A;  1WMN A;  3LTC A;  4HYZ A;  5HGR A;  4EBG A;  1A90 A;  5JBS A;  2GU1 A;  4XBY A;  1WTH A;  5EVH A;  1ZS7 A;  3CME 3;  4RZM A;  3GAX A;  1Q40 A;  1V74 A;  3D5G A;  3LH4 A;  4ILF A;  5AII A;  1JBR A;  3LML A;  4J5G A;  3D4A A;  1T5Y A;  2WOF A;  3F8X A;  1BSD A;  2LYX A;  3CCV 3;  3PCS A;  1D6Y A;  1HYF A;  1M1X B;  3DGM A;  3WHO A;  4HM4 B;  1MWU A;  5CF2 A;  8CHO A;  4QWT A;  1IQX A;  3S28 A;  3MG2 A;  5D83 A;  5G1K A;  2QGU A;  3HIG A;  3SVA A;  3CMA 3;  2F99 A;  1DMN A;  3BIR A;  4HKV B;  5KP1 A;  5LC6 A;  1ZX2 A;  1VQ6 3;  3LTA A;  2W03 A;  1I0V A;  1O7W B;  2KF6 A;  1EKM A;  5BU4 A;  3G16 A;  4JF8 A;  1S72 3;  1V58 A;  3ECF A;  1RRL A;  3ROB A;  2OTJ 3;  2W56 A;  3EBY A;  1BVI A;  1YVS A;  2YFL B;  3PYJ A;  5D82 A;  1TP6 A;  1Q42 A;  3FCS B;  3HZP A;  4O2H A;  3EBT A;  1OUN A;  4O02 B;  6RNT A;  3SYU A;  3RGR A;  3V99 A;  4BTY A;  3B4P A;  2MF7 A;  4L8P A;  3G0K A;  2RSX A;  1RKY A;  3T0U A;  1MOL A;  1BRI A;  3F40 A;  1JBS A;  3EQQ B;  3K63 A;  1KWI A;  3K9M C;  1FW7 A;  2HMJ B;  1VQ8 3;  1UDI I;  2BMQ B;  2HOH A;  4J9A A;  5IEP A;  3CCJ 3;  1VQM 3;  1M90 4;  3B4O A;  1YGE A;  3PGB A;  3LZA A;  1W4N A;  4WWU C;  2IMJ A;  3DH2 A;  3N54 B;  3ZFZ A;  5AIH A;  4I5Q A;  1D6U A;  1RLS A;  1X1X A;  1O7H B;  1NB5 I;  1CQS A;  3JVC A;  3FSD A;  2CX1 A;  3CC4 3;  3IJE B;  1LOX A;  1JNQ A;  2PNC A;  4HBR A;  4AKY A;  1Q9E A;  1W2Z A;  1B3S A;  3DM8 A;  2B1X B;  3AGO A;  5CLK A;  3CNM A;  2XGN A;  1STD A;  4R4K A;  3K7C A;  3CCL 3;  1YNV X;  1UCL A;  1YJ9 3;  2CFG A;  4N6T A;  3V92 A;  5KP4 A;  4OK0 A;  3BNB A;  3A76 A;  3NHX A;  2O9U X;  3JUQ A;  4XBX A;  1DVD A;  4HOH A;  2GBW B;  1WMP A;  2INX A;  1A67 A;  4EXR A;  2GEY A;  2P0X A;  1X1Y A;  3JUN A;  3EC9 A;  1G96 A;  2Z7A A;  3STD A;  3EN1 B;  2F98 A;  3PXM A;  1JJ2 2;  4R9K A;  3AGN A;  3KCH A;  2XSH B;  4HZB B;  4RNZ A;  2K54 A;  5AEU B;  1YIT 3;  2Y73 A;  1B2U A;  5IER A;  1IVX A;  1B2Z A;  1NU3 A;  4HM5 B;  3B8L A;  4HVN A;  1MGW A;  4O8S A;  1NDO B;  1I2G A;  5ELJ A;  1I3I A;  1BRJ A;  3I0Y A;  1KQS 2;  1G02 A;  4HM2 B;  4LYL B;  4CDL A;  1QVG 2;  2CWU A;  2F5W A;  2SBL A;  3ZG5 A;  1OAC A;  1YJN 3;  5M1A A;  1IV9 A;  5AIF A;  2RNT A;  3RNT A;  1YGW A;  1X1W A;  3LOY A;  4FMA A;  1M1K 4;  2C11 A;  3HX8 A;  3DZL A;  2KF5 A;  3OWS A;  1W01 A;  1BSA A;  2R41 A;  3MHE A;  2CFK A;  3NM2 A;  3WR2 A;  1BUQ A;  1SAR A;  2CH9 A;  3CNX A;  1FGT A;  3UL5 A;  2KRT A;  2JQ5 A;  1RGG A;  1CH0 A;  1T3B A;  1OHS A;  3CU3 A;  1FUS A;  3LT9 A;  3CPW 2;  3SOA A;  5RNT A;  4BU4 A;  3BND A;  3FG4 A;  3HK4 A;  1RSN A;  1IVV A;  1ZO2 A;  2XR8 B;  5JPP A;  2F4Y A;  2UX0 A;  2D42 A;  4GSP A;  1RHL A;  4BL3 A;  3CD6 3;  4WFO A;  4NRE A;  1VQL 3;  1W6Y A;  1OPY A;  2L1S A;  1I70 A;  3T8U A;  3I55 3;  2HMN B;  4N6U A;  1BNF A;  1OH0 A;  4K90 B;  3FLJ A;  1NO3 A;  4FR9 A;  5EQL A;  1IT7 A;  4N6O B;  4L8O A;  3EN8 A;  3EF8 A;  5TGN A;  5IG0 A;  1TIJ A;  1RGH A;  2GXF A;  3F7S A;  3WOE B;  5KP3 A;  3G71 3;  2CG0 A;  2YFI B;  3EE1 A;  1RGF A;  1UCI A;  4HM3 B;  1LNH A;  1UI8 A;  3S27 A;  2C4B A;  5AIG A;  6STD A;  1F8N A;  3NV0 A;  1KSI A;  2GSP A;  1QMA A;  2Q07 A;  4IIA A;  4O3V A;  1CYU A;  3QK9 A;  1RNB A;  3A5E A;  3LYG A;  4N6L A;  5LC7 A;  2CKF B;  3JUM A;  3UL6 A;  1BAO A;  8RNT A;  5HOH A;  3CC2 3;  4K1U A;  1EUI C;  1IQ8 A;  4FMC A;  1B27 A;  2CC3 A;  2V1L A;  1BRH A;  1VQN 3;  3DY5 A;  3D79 A;  2BT3 A;  3CXC 2; 
#chains in the Genus database with same CATH homology
 1AR0 A;  2HMM B;  1QAF A;  2P38 A;  3WOF B;  3DMC A;  2K0M A;  3FZW A;  3J7Y d;  3UB1 A;  2CFL A;  2ZL8 A;  2ML6 A;  1JKG B;  3BB9 A;  5G2G A;  3MYT A;  3S29 A;  1NWW A;  5IG4 A;  3NM7 A;  2STD A;  2W0Q A;  3H51 A;  1UUV B;  2YX9 A;  2Z76 A;  4IT7 A;  1SII A;  1HU9 A;  2RGQ A;  3H3H A;  1JN5 B;  1JRQ A;  1E97 A;  5IEO A;  7STD A;  1Q81 4;  4HZ9 B;  3SXX A;  4MEI A;  2CHC A;  3FKA A;  3MPH A;  4WYK B;  5JPU A;  2MC8 A;  5CK6 A;  2HMK B;  1SPU A;  4MMX B;  3FGY A;  3MWZ A;  2CW9 A;  4R1K A;  3B7C A;  3KN4 A;  1VQ7 3;  1W2B 2;  1IT8 A;  2WGQ A;  1IDP A;  2GBX B;  2ZDJ A;  3EHC A;  2CK3 H;  4LMI A;  4HM7 B;  2GU3 A;  1E3R A;  1OF5 B;  3KSE D;  1L5G B;  5CF1 A;  1ULI B;  3HI7 A;  4LZI A;  4AKZ A;  1KD1 4;  1AVL A;  2W9P A;  1RJO A;  3OXA A;  3PCR A;  3CCE 3;  1S5A A;  2R4I A;  3DGN A;  4GL6 A;  4RNY A;  1M9G A;  1VQO 3;  2YFJ B;  4XBT A;  1TFO A;  2XH9 A;  3MKI A;  1DMQ A;  4KZ1 A;  4NHF A;  5IG3 A;  1O7G B;  1GY5 A;  2W9Q A;  3FG1 A;  2F86 B;  2XRX B;  4KFE A;  3FH1 A;  2L4V A;  1W6G A;  4IPB A;  1A2V A;  4RBN A;  1IV7 A;  1VQ4 3;  3E99 A;  3DGL A;  4GB5 A;  4HM8 B;  2W04 A;  3D9R A;  2KCD A;  3MG3 A;  3OX9 A;  3Q90 A;  4FMB A;  3AMO B;  1YI2 3;  1NJI 4;  3WDG B;  4KFF A;  2Y74 A;  2I9W A;  2XGL A;  2BNG A;  1GD3 A;  1U5O A;  4XDW A;  3F8H A;  1KC8 4;  5STD A;  3UJM A;  1OHP A;  3F9S A;  3N9H A;  3WOD G;  3QRD A;  4K61 A;  3JUO A;  1WNH A;  4N6N B;  1TUH A;  1US1 A;  1JV2 B;  3L0R A;  5AYR B;  1N9E A;  4BTX A;  1ROV A;  3CC7 3;  1PFP A;  1Z1S A;  1IVW A;  5AEW B;  1A2K A;  4FCM A;  3K0Z A;  3LTB A;  3NBJ A;  2W56 B;  3ER7 A;  1N9J A;  4K1V A;  3KFQ C;  2A15 A;  3PZW A;  1JKG A;  2OCT A;  4H3U A;  2OWP A;  2OQE C;  1ISK A;  3NX0 A;  2XEP A;  3KII A;  4XB5 A;  3KZT A;  1R4C A;  3BNC A;  3NQY A;  4R80 A;  3G8Z A;  1JN5 A;  4OUQ A;  2WOH A;  4N6V 0;  2GEX A;  1FGQ A;  4LEH A;  3GZX B;  2Z77 A;  2HML B;  3T8N A;  3CPO A;  3D3L A;  1N5P A;  4WHA A;  2WGO A;  1DYU A;  2E2U A;  3CCS 3;  3U1W A;  1Q7Y 4;  4EV2 A;  3G6E 3;  3IMA B;  4U13 A;  2P05 A;  1YJW 3;  1DVC A;  2XF3 A;  1OF5 A;  1UI7 A;  1QAK A;  3HII A;  3SED A;  1Q82 4;  1NB3 I;  5AI1 A;  1K9M 4;  1RN7 A;  4TX4 A;  4BTW A;  1N8Q A;  3GZR A;  3PS8 A;  3FF2 A;  4AKY A;  3K5T A;  4EC6 A;  1AVK A;  2XSO B;  3BLZ A;  1W02 A;  2FNQ A;  4J8T A;  3NBR A;  1K41 A;  1O7N B;  5IG5 A;  2OTL 3;  2PZV A;  4X2H A;  3G4S 3;  3FG3 A;  4LSO A;  4HM0 B;  1SQW A;  2P09 A;  3X40 A;  3OW2 2;  4EYC A;  3CCR 3;  2BMO B;  3WMD A;  3KSP A;  1J2B A;  3FF0 A;  3NBB A;  3X42 A;  1WMO A;  2CWV A;  1O7P B;  5FW5 A;  1U8C B;  2Z6B A;  1YVB I;  2IA7 A;  1VQ9 3;  3AMO A;  2OOV C;  3RDE A;  1SIH A;  1VQP 3;  2CFW A;  4Q53 A;  1K73 4;  2E2T A;  1IQY A;  4I4K A;  1K28 A;  1WQL B;  3CCQ 3;  1D6Z A;  2IUK A;  4EV5 A;  3WA3 A;  4AEQ A;  3LT8 A;  1FGR A;  2CFD A;  4N3V A;  2E2V A;  3MG1 A;  5AYS C;  3OWU A;  2OQE A;  2HMO B;  5ELU A;  4HM6 B;  3Q1C A;  3SOY A;  2RFR A;  1HKX A;  3TDG A;  1CYV A;  3Q2P A;  1ASK A;  3GWR A;  4PEJ A;  1Q86 4;  1W7C A;  4KFD A;  1K8A 4;  4HJL B;  2WO0 A;  5IW9 A;  1W6C A;  4XDV A;  1O7M B;  1GY7 A;  5IEN A;  1GYB A;  3JUP A;  1LXE A;  1ULJ B;  4FMD A;  2QA4 3;  4FCJ A;  2XFT A;  1TFK A;  2CG1 A;  1QAL A;  4MJD A;  3S67 A;  1AV4 A;  3NXJ A;  2CIU A;  2BHM A;  1TU5 A;  3CCU 3;  4L7K A;  4HM1 B;  3SLU A;  3X3Y A;  3OWY A;  4CCV A;  3WA2 X;  3EJV A;  5FGO A;  2C10 A;  3VF1 A;  1OCV A;  3EB8 A;  3UNL A;  3NV0 B;  1IVU A;  3F7X A;  4ORL A;  3U97 A;  1Q40 B;  2W6J H;  3DUK A;  1VQK 3;  3GRD A;  3VSY A;  3BNE A;  1GS3 A;  1Y4K A;  3GZY B;  2IUJ A;  1FUW A;  2QEX 3;  3SX1 A;  1LVN A;  1RRH A;  4X2O A;  5EEO A;  5BXQ A;  4XM4 A;  1QJG A;  3S5C A;  4JRF A;  2OOV A;  5BVB A;  1N5H A;  1PU4 A;  1STF I;  3V98 A;  5DRV A;  3F14 A;  3LXU X;  2QIY A;  3X3X A;  3DGO A;  2CWT A;  4LGQ A;  3OV4 A;  4R9L A;  3VGN A;  1ROA A;  2M7O A;  1YIJ 3;  2FGT A;  2XFS A;  2BMR B;  3MSO A;  3O8Y A;  4ZM8 A;  1OHO A;  3X3Z A;  4OVM A;  1E3V A;  2LQV A;  5CXO A;  2JDI H;  1UUW B;  2BO9 B;  3EX9 A;  3NQZ A;  2W2C A;  1JB2 A;  5IF6 A;  3KE7 A;  1EQK A;  5D81 A;  4WYK A;  3I56 3;  1FGO A;  3GZB A;  1JB5 A;  2KXG A;  2P0M A;  4MMZ B;  3M8C A;  4WP5 A;  2O3O A;  1IU7 A;  4G1M B;  2B24 B;  3KKG A;  1GY6 A;  1MNL A;  1UW1 A;  2D1W A;  1FA3 A;  3X41 A;  3CCM 3;  5DRE A;  1FGM A;  1CEW I;  2FXT A;  3ALA A;  1SJW A;  1IK3 A;  4KVH A;  1JB4 A;  1OGX A;  3DXO A;  4MMY B;  1DMM A;  3IPT A;  5I97 A;  1W00 A;  1N8R 4;  4STD A;  4H61 A;  1EG9 B;  4N6M A;  5A0O B;  2RCD A;  1YHQ 3;  1C7H A;  3NUV A;  3LTD A;  1OGZ A;  1W5Z A;  2ML5 A;  1QVF 2;  1VZZ A;  3RGA A;  3N8B A;  1EA2 A;  4FCZ A;  1GD4 A;  1WMN A;  3LTC A;  4HYZ A;  5HGR A;  4EBG A;  1A90 A;  5JBS A;  2GU1 A;  4XBY A;  1WTH A;  5EVH A;  3CME 3;  4RZM A;  3GAX A;  1Q40 A;  1V74 A;  3LH4 A;  5AII A;  3LML A;  3CCV 3;  1T5Y A;  2WOF A;  3F8X A;  2LYX A;  3PCS A;  1M1X B;  1D6Y A;  3DGM A;  4HM4 B;  5CF2 A;  8CHO A;  4QWT A;  1IQX A;  3S28 A;  3MG2 A;  5D83 A;  2QGU A;  3HIG A;  3SVA A;  3CMA 3;  2F99 A;  1DMN A;  4HKV B;  5KP1 A;  5LC6 A;  1ZX2 A;  1VQ6 3;  3LTA A;  2W03 A;  1O7W B;  1EKM A;  2OTJ 3;  3G16 A;  4JF8 A;  1S72 3;  3ROB A;  3ECF A;  1RRL A;  2W56 A;  3EBY A;  3PYJ A;  2YFL B;  5D82 A;  1TP6 A;  1Q42 A;  3FCS B;  3HZP A;  4O2H A;  3EBT A;  1OUN A;  4O02 B;  3RGR A;  3V99 A;  4BTY A;  3B4P A;  2MF7 A;  4L8P A;  3G0K A;  2RSX A;  1RKY A;  3T0U A;  1MOL A;  3F40 A;  3EQQ B;  3K63 A;  1KWI A;  3K9M C;  2HMJ B;  1VQ8 3;  2BMQ B;  4J9A A;  5IEP A;  3CCJ 3;  1VQM 3;  1M90 4;  3B4O A;  1YGE A;  3PGB A;  3LZA A;  1W4N A;  4WWU C;  2IMJ A;  3N54 B;  5AIH A;  1D6U A;  1O7H B;  1NB5 I;  1CQS A;  3JVC A;  3FSD A;  3CC4 3;  3IJE B;  1LOX A;  1JNQ A;  2PNC A;  4HBR A;  1W2Z A;  5CLK A;  3DM8 A;  2B1X B;  3CNM A;  2XGN A;  1STD A;  4R4K A;  3K7C A;  3CCL 3;  1YJ9 3;  2CFG A;  4N6T A;  3V92 A;  5KP4 A;  4OK0 A;  3BNB A;  3A76 A;  3NHX A;  2O9U X;  3JUQ A;  4XBX A;  1DVD A;  2GBW B;  1WMP A;  2INX A;  1A67 A;  4EXR A;  2GEY A;  2P0X A;  3JUN A;  3STD A;  3EC9 A;  1G96 A;  2Z7A A;  3EN1 B;  2F98 A;  3PXM A;  1JJ2 2;  4R9K A;  4HZB B;  2XSH B;  4RNZ A;  1YIT 3;  2K54 A;  5AEU B;  2Y73 A;  5IER A;  1IVX A;  1NU3 A;  4HM5 B;  3B8L A;  4HVN A;  4O8S A;  5ELJ A;  1NDO B;  1VQ5 3;  1KQS 2;  3I0Y A;  4HM2 B;  4CDL A;  1QVG 2;  2CWU A;  2SBL A;  1OAC A;  1YJN 3;  1IV9 A;  5AIF A;  4FMA A;  3LOY A;  1M1K 4;  2C11 A;  3HX8 A;  3DZL A;  3OWS A;  1W01 A;  3MHE A;  2CFK A;  3NM2 A;  1BUQ A;  2CH9 A;  3CNX A;  1FGT A;  3UL5 A;  2KRT A;  2JQ5 A;  1OHS A;  3CU3 A;  3LT9 A;  3CPW 2;  3SOA A;  3BND A;  3FG4 A;  3HK4 A;  1ZO2 A;  1IVV A;  2XR8 B;  5JPP A;  2UX0 A;  2D42 A;  3CD6 3;  4WFO A;  4NRE A;  1VQL 3;  1W6Y A;  1OPY A;  3T8U A;  3I55 3;  2HMN B;  4N6U A;  1OH0 A;  4K90 B;  5EQL A;  3FLJ A;  1NO3 A;  4FR9 A;  1IT7 A;  4N6O B;  4L8O A;  3EN8 A;  3EF8 A;  5TGN A;  5IG0 A;  1TIJ A;  2GXF A;  3F7S A;  3G71 3;  3WOE B;  5KP3 A;  2CG0 A;  2YFI B;  3EE1 A;  4HM3 B;  1LNH A;  1UI8 A;  3S27 A;  5AIG A;  6STD A;  1F8N A;  3NV0 A;  1KSI A;  1QMA A;  2Q07 A;  4IIA A;  4O3V A;  1CYU A;  3QK9 A;  3LYG A;  4N6L A;  5LC7 A;  2CKF B;  3JUM A;  3UL6 A;  3CC2 3;  4K1U A;  1IQ8 A;  4FMC A;  2CC3 A;  2V1L A;  1VQN 3;  3DY5 A;  2BT3 A;  3CXC 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...