4CDLA

Crystal structure of retro-aldolase ra110.4-6 complexed with inhibitor 1-(6-methoxy-2-naphthalenyl)-1,3-butanedione
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATIESPFGQPPIHGREQIAAHYRKWLGGGKLRVYLTGPVRANHNGCGTMLLRKEWVWNGQPCATDVILVMRFDEQGRIQTEQRYWSEVNLCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Plasticity of a Computationally Designed Retro-Aldolase Enzyme
rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
total genus 30
structure length 126
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4cdlA00
3OX9A 3T8UA 3FKAA 2STDA 7STDA 3DZLA 5CF1A 3CNXA 3MHEA 1AR0A 3BB9A 3FSDA 2K54A 3DMCA 4HM1B 1OCVA 3H51A 4HM4B 5AEUB 3A76A 1STDA 4I4KA 3GZXB 3F14A 1GY6A 2BMOB 4J9AA 3FZWA 8CHOA 5IG5A 4X2HA 4WP5A 3E99A 4U13A 1OHOA 1ASKA 1W01A 3EN8A 1O7HB 1VZZA 2CHCA 3G8ZA 3GZYB 3KSPA 2GEYA 3EF8A 3NM2A 3EQQB 4H3UA 3JUPA 1WQLB 3FH1A 5EVHA 3FF2A 3G0KA 3NXJA 3SEDA 5CXOA 2XRXB 1HKXA 2XR8B 5IENA 3KE7A 3MG1A 1O7WB 2BMRB 3GRDA 3VGNA 4XB5A 5KP1A 1Z1SA 3DM8A 2XSHB 2XSOB 3HK4A 3GWRA 4HVNA 4R9LA 2HMLB 4K1VA 2HMKB 3HZPA 3OWSA 4Q53A 1OUNA 4STDA 4HJLB 4XBYA 5IG0A 3MYTA 3WMDA 2HMOB 4R9KA 4XBXA 1NU3A 2I9WA 5AIIA 5IEOA 5CLKA 1TUHA 3EBYA 3F7XA 3CNMA 3RGAA 3SOAA 1IDPA 4CDLA 5BVBA 3LZAA 1E97A 1EG9B 1CQSA 2PZVA 2Z7AA 1Q42A 5IF6A 2W2CA 3EX9A 4L8OA 1ULJB 2HMJB 3GZRA 3JUMA 1NWWA 1E3VA 2HMNB 3B7CA 4WWUC 5CK6A 5AIHA 1U5OA 4XDWA 3NV0B 3F7SA 2F86B 2RFRA 3FLJA 3H3HA 3KZTA 5AI1A 1NDOB 1DMMA 4WYKB 4HZ9B 5D83A 2Z77A 3IPTA 1OHPA 1Q40B 4L7KA 5JPPA 1JB2A 5DRVA 3K0ZA 5CF2A 1E3RA 4WYKA 4ORLA 4FCMA 2B24B 1ULIB 3F8XA 4HM5B 4FCJA 1O7NB 4RZMA 2YFJB 1K41A 5KP4A 1S5AA 3FGYA 4KVHA 1GS3A 5IG3A 3NV0A 3EC9A 4PEJA 1QJGA 1O7GB 1TP6A 1OF5A 2YFLB 3LYGA 5TGNA 1OF5B 3EHCA 3Q90A 2BNGA 4J8TA 1O7MB 3OWYA 4LMIA 3DUKA 3KKGA 2B1XB 5HGRA 3F8HA 4OVMA 3NUVA 3MG2A 1A2KA 2GBWB 3DXOA 4HKVB 4X2OA 3MSOA 3STDA 3UJMA 5IERA 1C7HA 1GYBA 1UUWB 3CU3A 3RGRA 5D82A 3M8CA 5G2GA 4HM0B 1BUQA 4HM7B 2BMQB 3OXAA 1W6YA 1OGXA 1GY7A 1Q40A 4K1UA 1OHSA 1W02A 4HM2B 3ER7A 5AIGA 3OWUA 5DREA 1QMAA 3EJVA 4IIAA 2A15A 2OWPA 2R4IA 4HM3B 2RGQA 5IEPA 2F98A 4N3VA 1ZX2A 3I0YA 5IG4A 1DMQA 1O7PB 4OUQA 5FW5A 2Z76A 1W00A 2JQ5A 5BXQA 2IMJA 3ECFA 1DMNA 4GB5A 3F9SA 1EA2A 1ISKA 3MKIA 1OH0A 4MJDA 5STDA 3T8NA 3EN1B 5JPUA 4XDVA 1GY5A 3CPOA 3HX8A 3B4OA 3FF0A 1JN5B 3G16A 3JUQA 4HZBB 2HMMB 3SOYA 1OPYA 3MG3A 3ROBA 6STDA 2QGUA 1JN5A 1JB4A 2CKFB 3NHXA 4LEHA 3VSYA 3UNLA 3D9RA 4HM8B 4L8PA 5AIFA 3OV4A 5KP3A 1JKGA 2RCDA 2YFIB 3B8LA 3B4PA 3K7CA 5D81A 4HM6B 2GBXB 3GZBA 1SJWA 4XM4A 2F99A 2UX0A 3F40A 1ZO2A 3NBRA 5AEWB 1UUVB 2INXA 4XBTA 3EBTA 1JB5A 3JUNA 1OGZA 2QIYA 4R1KA 2GEXA 4LGQA 2GXFA 1JKGB 3BLZA 3S5CA 3JUOA
chains in the Genus database with same CATH superfamily
3X3ZA 1Q824 2D42A 3X3YA 3PGBA 3T8UA 1IK3A 2STDA 3UB1A 4N6NB 2W56A 3MHEA 3FSDA 1BRHA 1WTHA 1M9GA 1X1WA 1WMPA 4EW5A 1W6GA 3A76A 1JJ22 1JBSA 1WNHA 1BNIA 3BNDA 1GY6A 1RN7A 1YJW3 4X2HA 4AKZA 2M7OA 3E99A 1FGTA 1ASKA 3EN8A 1QAKA 2CHCA 1VZZA 1I3IA 3J7Yd 4K1VA 3LOYA 1W5ZA 1WQLB 3SEDA 2W56B 4FR9A 1VQ43 2BMRB 4N6UA 1IU7A 2P05A 2CFDA 3K5TA 4O3VA 1I70A 2PNCA 2XSHB 2C11A 1GMPA 2V1LA 4R9LA 5JBSA 1A2PA 1JZDA 1HU9A 1BU4A 1OUNA 4N6MA 3WMDA 3CCE3 1Q864 3KFQC 4XBXA 1NU3A 1TUHA 1IQYA 4CDLA 1B2XA 1YI23 1DVDA 1BSEA 1TRQA 1BRJA 1UI7A 1RN4A 2W9QA 4MEIA 3U97A 1JBTA 1ULJB 5G1LA 3U1WA 1KC84 3JUMA 3V92A 2QA43 3B7CA 1X1UA 5CK6A 3T8NA 1I2GA 1RGGA 3F7SA 2F86B 3WDGB 3PXMA 1VQK3 1C54A 4EC6A 1RCLA 1GD3A 1BNRA 5D83A 1OHPA 1RGHA 1QAFA 1GOYA 1DE3A 4FCMA 2B24B 2F56A 1J2BA 4FCJA 1CEWI 3ALAA 3BNBA 9RNTA 3CCS3 1B2SA 1FA3A 1G02A 3EC9A 4WFOA 2FGTA 1OF5A 1FUSA 2FXTA 2YFLB 3LYGA 4EV2A 1VQN3 5TGNA 1OF5B 5ELUA 2CG1A 3Q90A 2BNGA 3WR2A 2YX9A 1TIJA 3D79A 2XFTA 4N6LA 2QEX3 2B1XB 5HGRA 2IY2A 4OVMA 3MG2A 4X2OA 2L4VA 3RGRA 2W9PA 5EQLA 1YIJ3 1PY3A 4HM0B 2BMQB 3OXAA 1W6YA 4ILFA 1OGXA 1OHSA 1W02A 1DETA 2W04A 1IT8A 4HAAA 2CC3A 1Q7HA 3OWUA 1QMAA 3EJVA 1A2VA 2OWPA 4HM3B 1LOYA 4J5KA 4OUQA 3O8YA 3QK9A 1W00A 5BXQA 2IMJA 2KF4A 3ECFA 5A0OB 3CCQ3 4GB5A 2CW9A 3F9SA 3LT9A 5FGOA 1UCJA 1T5YA 2C10A 4NPBA 1N9EA 5AYRB 5STDA 3G713 1LRAA 1FUWA 5JPUA 1GY5A 1UCIA 1BRGA 2CFGA 3CCU3 1I2FA 1UUGB 2O9UX 1W4NA 1MNLA 1QALA 4HZBB 2CX1A 1I2EA 4QWTA 1N8R4 1JB4A 4K90B 3VSYA 2CWVA 3UNLA 1W7CA 1JKGA 3B8LA 3WA2X 5IW9A 1IQXA 2FNQA 1SJWA 2F99A 2UX0A 3F40A 3DGLA 1IVXA 4XBTA 2ZA4A 1JB5A 1IV9A 3X41A 3BLZA 1M1K4 3JUOA 5CXOA 3OX9A 4NHFA 4I5QA 3WA3A 3DZLA 5CF1A 1BNSA 1AR0A 3GSPA 4HM1B 1YHQ3 4FMBA 3H51A 4HM4B 1FGRA 4IT7A 5BIRA 1KD14 3FG4A 4AEQA 2KXGA 2E2UA 1BNFA 4N6OB 3F14A 1A67A 1LOVA 3KSPA 5AYSC 1O7HB 2OOVA 1BIRA 2GEYA 3EQQB 2SARA 2XRXB 1X1YA 1HKXA 3KE7A 1VQ73 1AVLA 1SARA 1UGIA 2GU3A 2OQEA 1BNEA 1TFOA 1FYSA 3KIIA 1MGRA 1WMNA 3ZFZA 3GWRA 4HVNA 2H0IA 1BSAA 3LXUX 2HMKB 5IG0A 3SX1A 4XBYA 1PYLA 4STDA 4HJLB 3X42A 2OTL3 3MYTA 1MWRA 4R9KA 1AY7A 2I9WA 3Q3FA 2WGOA 1EUIC 4J5GA 1EKMA 2XGNA 2W0QA 3CNMA 3DY5A 1IVUA 5BVBA 1CQSA 2PZVA 5IF6A 1Q42A 4BTXA 1V74A 3K9MC 3G4S3 2HMJB 4WWUC 1PU4A 3CCV3 4EXRA 3CXC2 1SQWA 3NV0B 3H3HA 1NDOB 1G96A 3A5EA 4HZ9B 1YVSA 3LH4A 3IPTA 1FW7A 5JPPA 3GAXA 3CCR3 4WYKA 2D1WA 4FCZA 1IQ8A 1ULIB 1RDSA 3F8XA 3NBJA 4HM5B 1I3FA 2YFJB 4HOHA 1LNHA 2GU1A 2BO9B 3AHSA 4KVHA 3NV0A 4DKIA 1QJGA 1RNBA 3WHOA 4R80A 3AMOB 3PCSA 3PCRA 1FUTA 1VQ83 2MC8A 4J8TA 5HOHA 1UCLA 5LC6A 1SPUA 3NUVA 4IPBA 2GBWB 4HKVB 2P0MA 1MGWA 3CCJ3 1C7HA 1GYBA 3CU3A 4BU4A 4H61A 3D5GA 1BRNL 4HM7B 1IV7A 2CX0A 3HIGA 1AVKA 4K1UA 3V99A 1BUQA 1QVF2 4HM2B 1CYUA 1JV2B 3CC23 1DVCA 3KCHA 4IIAA 2A15A 3DGYA 2R4IA 2KAAA 2RGQA 1RLSA 1BRSA 3DGOA 3BNCA 2Z76A 4CPKA 6RNTA 1ZGXA 1DMNA 4KT3B 1GOVA 2Q07A 1BOXA 3NQZA 3X40A 4XDVA 1LXEA 3HX8A 2O3OA 3FF0A 3SOYA 4FMDA 1N5HA 2GSPA 2W03A 1BNGA 1PFPA 1X1XA 3MG3A 4BTWA 5M19A 1MWTA 2CKFB 3NHXA 3LTBA 1B2ZA 3AGNA 1JBRA 4L8PA 4EYCA 2UGIA 2YFIB 2F5WA 1Y4KA 3L0RA 3GZBA 1KQS2 1TFKA 1YGWA 1ZO2A 1Q9EA 2INXA 1GSPA 3SXXA 1KWIA 3JUNA 3PYJA 3I563 1WMOA 8RNTA 5ELJA 3GZRA 1K734 1TU5A 4EBGA 3FKAA 1RGFA 7STDA 1RMSA 2BT3A 2H0GA 4EV5A 3LTDA 3BB9A 4MMYB 2K54A 3DMCA 3LTAA 3Q1CA 1OCVA 1YGEA 2Y73A 2CIUA 1KSIA 3NX0A 3D4AA 1STDA 4I4KA 1CYVA 1UW1A 1W2ZA 4N6V0 2OCTA 3MPHA 1BSBA 4WP5A 2KF3A 4U13A 1W01A 5IERA 1UCKA 3NQYA 3GZYB 3RNTA 1LQMB 1YVBI 1BAOA 3KSED 5BU4A 4HBRA 3FH1A 1GOUA 2F4YA 3FF2A 2R41A 3LTCA 3NXJA 5EVHA 5RNTA 2XR8B 3MG1A 1RGEA 3GRDA 2LQVA 3EB8A 3VGNA 1RSNA 1Z1SA 4CCVA 1F8NA 4R4KA 1B3SA 1MWUA 3SYUA 4CJNA 1VQ93 4BL3A 2E2VA 3HK4A 1AV4A 1VQQA 3OWSA 4K61A 3V98A 1Q814 1B27A 4LGQA 5IEOA 1T2IA 4MMXB 3N9HA 5AIIA 2IUJA 3EBYA 1RHLA 3RGAA 3WOEB 3SOAA 1IDPA 4NREA 4AKYA 1E97A 1EG9B 2P0XA 2Z7AA 3WOFB 3DGMA 2XH9A 2W2CA 3EX9A 4L8OA 4GL6A 1D6UA 4FMCA 1NWWA 1E3VA 2HMNB 5AIHA 2BIRA 2RSXA 3N54B 1U5OA 1T2HA 3KZTA 3FLJA 1YIT3 1UDII 4HYZA 4WYKB 2KCDA 1IVWA 1L5GB 1W2B2 4GSPA 1Q40B 1VQ53 3AHWA 1E3RA 3D5IA 1RGAA 1IYYA 1FZUA 3NM7A 3HIIA 2ML6A 4FMAA 3BNEA 2W6JH 3DGNA 1RRLA 5M1AA 1LOWA 1O7GB 3S28A 1TP6A 2L1SA 3AGOA 1TJDA 1FGMA 3FG1A 1FGQA 3HI7A 1RRHA 5EEOA 3SVAA 3S67A 1ROAA 1O7MB 3UL5A 1K8A4 2WO0A 3KKGA 1NNVA 1LQGC 1NB3I 2CFLA 2CK3H 3K63A 1A2KA 1JRQA 1N9JA 1RJOA 2Y74A 1FGOA 3MSOA 3STDA 3UJMA 2C4BA 2KF6A 3M8CA 1N5PA 1K28A 3SLUA 4KFEA 1GY7A 1Q40A 2AAEA 1EEJA 2CWTA 4O02B 1B2MA 3CC43 2BU4A 3ER7A 1N8QA 2WOFA 2F98A 4N3VA 3I0YA 1DMQA 5FW5A 4KZ1A 4N6TA 3KN4A 2JQ5A 5M18A 1RGLA 1HZ1A 3N8BA 1EA2A 1TTOA 3CPOA 2ML5A 1JN5B 1B2UA 2HMMB 3CMA3 2OTJ3 1OPYA 1NB5I 1BSDA 1V57A 1R4CA 4KFFA 3I553 2QGUA 1JN5A 1QVG2 4MMZB 4HM8B 5AIFA 1VQL3 3OV4A 4O8SA 2RCDA 3FCSB 5D81A 3LT8A 3K7CA 5KP3A 2ZHXB 4HM6B 4XM4A 5AEWB 3NBRA 3URPA 4ZM8A 2AADA 1M1XB 3EBTA 3QRDA 1LOXA 4LSOA 1OGZA 1NO3A 4R1KA 4JRFA 1JNQA 7GSPA 1JKGB 3S5CA 2XGLA 2ZDJA 2CG0A 3LMLA 3CNXA 3RDEA 1YNVX 4BIRA 2XEPA 3PS8A 3S27A 3S29A 3MWZA 5AEUB 1RNTA 4TX4A 4LZIA 1ZS7A 1BGSA 1ROVA 3GZXB 1RTUA 2BMOB 4J9AA 3CCM3 3FZWA 8CHOA 2P09A 2K3DA 1S723 1M904 4OK0A 1OHOA 7RNTA 3CPW2 3G8ZA 1BUJA 5DRVA 5IG5A 2OOVC 3NM2A 3EF8A 4H3UA 3JUPA 4WHAA 2LYXA 3G0KA 3CME3 1LVNA 4RNTA 1SIIA 4LYLB 2RNTA 5IENA 2KRTA 3UL6A 1O7WB 1BANA 4XB5A 5KP1A 3DM8A 2XF3A 1BVIA 1HYFA 1D6ZA 2ZL8A 2XSOB 1G0TA 3FG3A 2HMLB 3NBBA 1I8VA 3HZPA 1UGHI 4Q53A 2IA7A 5GSPA 1BSCA 1US1A 2HMOB 3CC73 1RN1A 5LC7A 3D3LA 5CLKA 1VQP3 3F7XA 4O2HA 3LZAA 4BTYA 1RGKA 2UUGC 3T0UA 5DREA 2CH9A 4XDWA 5AI1A 1OACA 1RKYA 2RFRA 2H0HA 2J8XB 3HOHA 1DMMA 3CCL3 2CWUA 1BRIA 3ZG0A 2Z77A 1A90A 4L7KA 4RBNA 2WGQA 1JB2A 2IUKA 3K0ZA 5CF2A 1JZOA 4ORLA 1I0VA 2K0MA 1VQ63 1VQM3 1GMRA 2CFKA 1Q7Y4 5G1KA 1O7NB 4RZMA 3DH2A 3CD63 1K41A 1BRKA 2F5MA 5KP4A 1S5AA 1W6CA 3FGYA 5I97A 1GS3A 5IG3A 4PEJA 1CH0A 4KFDA 3TDGA 1UI8A 3VF1A 3EHCA 1LNIA 1V58A 3WODG 2XFSA 2HOHA 3OWYA 4LMIA 3ZG5A 3DUKA 3F8HA 2CFWA 1MOLA 3BU4A 3DXOA 2KF5A 2RBIA 2MF7A 6GSPA 1UUWB 2SBLA 3BIRA 3JVCA 5D82A 5G2GA 1RGCA 3OW22 1U8CB 1I0XA 5AIGA 4BL2A 1RCKA 1AQZA 5IEPA 2P38A 1ZX2A 1B20A 1TRPA 5IG4A 1O7PB 3G6E3 1YJ93 4RNZA 1DYUA 1K9M4 4G1MB 4RNYA 1BNJA 2E2TA 1ISKA 3MKIA 1OH0A 4MJDA 3X3XA 3EN1B 3B4OA 3G16A 3JUQA 2OQEC 1YJN3 1GD4A 2WOHA 3EE1A 1VQO3 3ROBA 3AMOA 6STDA 3IJEB 3IMAB 1MWSA 3PZWA 4LEHA 1NJI4 1IVVA 3D9RA 2BHMA 1GMQA 1SIHA 3B4PA 2GBXB 2IYJA 2Z6BA 1EQKA 1T3BA 1UUVB 1R4YA 1STFI 4GHOA 1D6YA 4JF8A 2QIYA 2JDIH 2GEXA 1B21A 2GXFA 3Q2PA 1IT7A
chains in the Genus database with same CATH topology
3X3ZA 1Q824 2D42A 3X3YA 3PGBA 3T8UA 1IK3A 2STDA 3UB1A 4N6NB 2W56A 3MHEA 3FSDA 1WTHA 1M9GA 1WMPA 1JJ22 1W6GA 3A76A 1WNHA 3BNDA 1GY6A 1RN7A 1YJW3 4X2HA 4AKZA 2M7OA 3E99A 1FGTA 1ASKA 3EN8A 1QAKA 2CHCA 1VZZA 3J7Yd 4K1VA 3LOYA 1W5ZA 1WQLB 3SEDA 2W56B 4FR9A 1VQ43 2BMRB 4N6UA 1IU7A 2P05A 2CFDA 3K5TA 4O3VA 2PNCA 2XSHB 2C11A 2V1LA 4R9LA 5JBSA 1OUNA 1HU9A 1Q864 4N6MA 3CCE3 3WMDA 3KFQC 4XBXA 1NU3A 1TUHA 1IQYA 4CDLA 1DVDA 1YI23 1UI7A 2W9QA 4MEIA 3U97A 1ULJB 3U1WA 1KC84 3JUMA 3V92A 2QA43 3B7CA 5CK6A 3T8NA 3F7SA 2F86B 3WDGB 3PXMA 1VQK3 4EC6A 1GD3A 5D83A 1OHPA 1QAFA 4FCMA 2B24B 1J2BA 4FCJA 1CEWI 3ALAA 3BNBA 3CCS3 1FA3A 3EC9A 4WFOA 2FGTA 1OF5A 2FXTA 2YFLB 3LYGA 4EV2A 1VQN3 5TGNA 1OF5B 5ELUA 2CG1A 3Q90A 2BNGA 2YX9A 1TIJA 2XFTA 4N6LA 2QEX3 2B1XB 5HGRA 4OVMA 3MG2A 4X2OA 2L4VA 3RGRA 2W9PA 5EQLA 1YIJ3 4HM0B 2BMQB 3OXAA 1W6YA 1OGXA 1OHSA 1W02A 2W04A 1IT8A 2CC3A 3OWUA 1QMAA 3EJVA 1A2VA 2OWPA 4HM3B 4OUQA 3O8YA 3QK9A 1W00A 5BXQA 2IMJA 3ECFA 5A0OB 3CCQ3 4GB5A 2CW9A 3F9SA 3LT9A 5FGOA 1T5YA 2C10A 1FUWA 1N9EA 5AYRB 5STDA 3G713 5JPUA 1GY5A 2CFGA 3CCU3 4HZBB 2O9UX 1W4NA 1MNLA 1QALA 4QWTA 1N8R4 1JB4A 4K90B 3VSYA 2CWVA 3UNLA 1W7CA 1JKGA 3B8LA 3WA2X 5IW9A 1IQXA 2FNQA 1SJWA 2F99A 2UX0A 3F40A 3DGLA 1IVXA 4XBTA 1JB5A 1IV9A 3X41A 3BLZA 1M1K4 3JUOA 5CXOA 3OX9A 4NHFA 3WA3A 3DZLA 5CF1A 1AR0A 4HM1B 1YHQ3 4FMBA 3H51A 4HM4B 1FGRA 4IT7A 1KD14 3FG4A 4AEQA 2KXGA 2E2UA 4N6OB 3F14A 1A67A 3KSPA 5AYSC 1O7HB 2OOVA 2GEYA 3EQQB 2XRXB 1HKXA 3KE7A 1VQ73 1AVLA 2GU3A 2OQEA 1TFOA 3KIIA 1WMNA 3GWRA 4HVNA 3LXUX 3SX1A 2HMKB 5IG0A 2OTL3 4XBYA 4STDA 3X42A 4HJLB 3MYTA 4R9KA 2I9WA 2WGOA 1EKMA 2XGNA 2W0QA 3CNMA 3DY5A 1IVUA 5BVBA 1CQSA 2PZVA 5IF6A 1Q42A 4BTXA 1V74A 3K9MC 3G4S3 2HMJB 4WWUC 1PU4A 3CCV3 4EXRA 3CXC2 1SQWA 3NV0B 3H3HA 1NDOB 1G96A 4HZ9B 3LH4A 3IPTA 5JPPA 3GAXA 3CCR3 4WYKA 2D1WA 4FCZA 1IQ8A 1ULIB 3NBJA 3F8XA 4HM5B 2YFJB 1LNHA 2GU1A 2BO9B 4KVHA 3NV0A 1QJGA 4R80A 3AMOB 3PCSA 3PCRA 1VQ83 2MC8A 4J8TA 5LC6A 1SPUA 3NUVA 4IPBA 2GBWB 4HKVB 2P0MA 3CCJ3 1C7HA 1GYBA 3CU3A 4H61A 1BUQA 4HM7B 1IV7A 3HIGA 3V99A 1AVKA 4K1UA 1QVF2 4HM2B 1CYUA 1JV2B 3CC23 1DVCA 4IIAA 2A15A 2R4IA 2RGQA 3DGOA 3BNCA 2Z76A 1DMNA 2Q07A 3NQZA 3X40A 4XDVA 1LXEA 3HX8A 2O3OA 3FF0A 3SOYA 4FMDA 1N5HA 2W03A 1PFPA 3MG3A 4BTWA 2CKFB 3NHXA 3LTBA 4L8PA 4EYCA 2YFIB 1Y4KA 3L0RA 3GZBA 1KQS2 1TFKA 1ZO2A 2INXA 3SXXA 1KWIA 3JUNA 3PYJA 3I563 1WMOA 5ELJA 3GZRA 1TU5A 4EBGA 3FKAA 7STDA 2BT3A 4EV5A 3LTDA 3BB9A 4MMYB 2K54A 3DMCA 3LTAA 3Q1CA 1OCVA 1YGEA 2Y73A 2CIUA 1KSIA 3NX0A 1STDA 4I4KA 1CYVA 1UW1A 1W2ZA 4N6V0 2OCTA 3MPHA 4WP5A 4U13A 1W01A 5IERA 3NQYA 3GZYB 1YVBI 3KSED 1K734 4HBRA 3FH1A 5EVHA 3FF2A 3LTCA 3NXJA 2XR8B 3MG1A 3GRDA 2LQVA 3EB8A 3VGNA 4CCVA 1Z1SA 1F8NA 4R4KA 1VQ93 2E2VA 3HK4A 1AV4A 3OWSA 4K61A 3V98A 1Q814 5IEOA 4MMXB 5AIIA 3N9HA 2IUJA 3EBYA 4AKYA 3RGAA 3WOEB 3SOAA 1IDPA 4NREA 1E97A 1EG9B 2P0XA 2Z7AA 3WOFB 3DGMA 2XH9A 2W2CA 3EX9A 4L8OA 4GL6A 1D6UA 4FMCA 1NWWA 1E3VA 2HMNB 5AIHA 2RSXA 3N54B 1U5OA 3KZTA 3FLJA 1YIT3 4HYZA 4WYKB 2KCDA 1IVWA 1L5GB 1W2B2 1Q40B 1VQ53 1E3RA 3NM7A 3HIIA 2ML6A 4FMAA 3BNEA 2W6JH 3DGNA 1RRLA 3S28A 1O7GB 1TP6A 1FGMA 3FG1A 1FGQA 3HI7A 1RRHA 5EEOA 3SVAA 3S67A 1ROAA 1O7MB 3UL5A 1K8A4 2WO0A 3KKGA 1NB3I 2CK3H 2CFLA 3K63A 1A2KA 1JRQA 1N9JA 1RJOA 2Y74A 1FGOA 3MSOA 3STDA 3UJMA 3M8CA 1N5PA 1K28A 3SLUA 4KFEA 1GY7A 1Q40A 2CWTA 4O02B 3CC43 3ER7A 1N8QA 2WOFA 2F98A 4N3VA 3I0YA 1DMQA 5FW5A 4KZ1A 4N6TA 3KN4A 2JQ5A 3N8BA 1EA2A 3CPOA 2ML5A 1JN5B 2HMMB 3CMA3 2OTJ3 1OPYA 1NB5I 1R4CA 4KFFA 3I553 2QGUA 1JN5A 1QVG2 4MMZB 4HM8B 5AIFA 1VQL3 3OV4A 4O8SA 2RCDA 3FCSB 5D81A 3LT8A 3K7CA 5KP3A 4HM6B 4XM4A 5AEWB 3NBRA 4ZM8A 3EBTA 1M1XB 3QRDA 1LOXA 4LSOA 1OGZA 1NO3A 4R1KA 4JRFA 1JNQA 1JKGB 3S5CA 2XGLA 2ZDJA 2CG0A 3LMLA 3CNXA 3RDEA 2XEPA 3PS8A 3S27A 3S29A 3MWZA 5AEUB 4TX4A 4LZIA 1ROVA 3GZXB 2BMOB 4J9AA 3CCM3 3FZWA 8CHOA 2P09A 1S723 1M904 4OK0A 1OHOA 3CPW2 3G8ZA 5DRVA 5IG5A 2OOVC 3NM2A 3EF8A 4H3UA 3JUPA 4WHAA 2LYXA 3G0KA 3CME3 1LVNA 1SIIA 5IENA 2KRTA 3UL6A 1O7WB 4XB5A 5KP1A 3DM8A 2XF3A 1D6ZA 2ZL8A 2XSOB 3FG3A 2HMLB 3NBBA 3HZPA 4Q53A 2IA7A 1US1A 2HMOB 3CC73 5LC7A 3D3LA 5CLKA 1VQP3 3F7XA 4O2HA 3LZAA 4BTYA 3T0UA 5DREA 2CH9A 4XDWA 5AI1A 1OACA 1RKYA 2RFRA 1DMMA 3CCL3 2CWUA 2Z77A 1A90A 4L7KA 4RBNA 2WGQA 1JB2A 2IUKA 3K0ZA 5CF2A 4ORLA 1VQ63 2K0MA 1VQM3 2CFKA 1Q7Y4 3CD63 1O7NB 4RZMA 1K41A 5KP4A 1S5AA 1W6CA 3FGYA 5I97A 1GS3A 5IG3A 4PEJA 4KFDA 3TDGA 1UI8A 3VF1A 3EHCA 3WODG 2XFSA 3OWYA 4LMIA 3DUKA 3F8HA 2CFWA 1MOLA 3DXOA 2MF7A 1UUWB 2SBLA 3JVCA 5D82A 5G2GA 3OW22 1U8CB 5AIGA 5IEPA 2P38A 1ZX2A 5IG4A 3G6E3 1O7PB 1YJ93 4RNZA 1DYUA 1K9M4 4G1MB 4RNYA 2E2TA 1ISKA 3MKIA 1OH0A 4MJDA 3X3XA 3EN1B 3B4OA 3G16A 3JUQA 2OQEC 1YJN3 1GD4A 2WOHA 3EE1A 1VQO3 3ROBA 3AMOA 6STDA 3IJEB 3IMAB 4LEHA 3PZWA 1NJI4 1IVVA 3D9RA 2BHMA 1SIHA 3B4PA 2GBXB 2Z6BA 1EQKA 1UUVB 1STFI 4JF8A 1D6YA 2QIYA 2JDIH 2GEXA 4LGQA 2GXFA 3Q2PA 1IT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OX9 A;  3T8U A;  3FKA A;  2STD A;  7STD A;  3DZL A;  5CF1 A;  3CNX A;  3MHE A;  1AR0 A;  3BB9 A;  3FSD A;  2K54 A;  3DMC A;  4HM1 B;  1OCV A;  3H51 A;  4HM4 B;  5AEU B;  3A76 A;  1STD A;  4I4K A;  3GZX B;  3F14 A;  1GY6 A;  2BMO B;  4J9A A;  3FZW A;  8CHO A;  5IG5 A;  4X2H A;  4WP5 A;  3E99 A;  4U13 A;  1OHO A;  1ASK A;  1W01 A;  3EN8 A;  1O7H B;  1VZZ A;  2CHC A;  3G8Z A;  3GZY B;  3KSP A;  2GEY A;  3EF8 A;  3NM2 A;  3EQQ B;  4H3U A;  3JUP A;  1WQL B;  3FH1 A;  5EVH A;  3FF2 A;  3G0K A;  3NXJ A;  3SED A;  5CXO A;  2XRX B;  1HKX A;  2XR8 B;  5IEN A;  3KE7 A;  3MG1 A;  1O7W B;  2BMR B;  3GRD A;  3VGN A;  4XB5 A;  5KP1 A;  1Z1S A;  3DM8 A;  2XSH B;  2XSO B;  3HK4 A;  3GWR A;  4HVN A;  4R9L A;  2HML B;  4K1V A;  2HMK B;  3HZP A;  3OWS A;  4Q53 A;  1OUN A;  4STD A;  4HJL B;  4XBY A;  5IG0 A;  3MYT A;  3WMD A;  2HMO B;  4R9K A;  4XBX A;  1NU3 A;  2I9W A;  5AII A;  5IEO A;  5CLK A;  1TUH A;  3EBY A;  3F7X A;  3CNM A;  3RGA A;  3SOA A;  1IDP A;  4CDL A;  5BVB A;  3LZA A;  1E97 A;  1EG9 B;  1CQS A;  2PZV A;  2Z7A A;  1Q42 A;  5IF6 A;  2W2C A;  3EX9 A;  4L8O A;  1ULJ B;  2HMJ B;  3GZR A;  3JUM A;  1NWW A;  1E3V A;  2HMN B;  3B7C A;  4WWU C;  5CK6 A;  5AIH A;  1U5O A;  4XDW A;  3NV0 B;  3F7S A;  2F86 B;  2RFR A;  3FLJ A;  3H3H A;  3KZT A;  5AI1 A;  1NDO B;  1DMM A;  4WYK B;  4HZ9 B;  5D83 A;  2Z77 A;  3IPT A;  1OHP A;  1Q40 B;  4L7K A;  5JPP A;  1JB2 A;  5DRV A;  3K0Z A;  5CF2 A;  1E3R A;  4WYK A;  4ORL A;  4FCM A;  2B24 B;  1ULI B;  3F8X A;  4HM5 B;  4FCJ A;  1O7N B;  4RZM A;  2YFJ B;  1K41 A;  5KP4 A;  1S5A A;  3FGY A;  4KVH A;  1GS3 A;  5IG3 A;  3NV0 A;  3EC9 A;  4PEJ A;  1QJG A;  1O7G B;  1TP6 A;  1OF5 A;  2YFL B;  3LYG A;  5TGN A;  1OF5 B;  3EHC A;  3Q90 A;  2BNG A;  4J8T A;  1O7M B;  3OWY A;  4LMI A;  3DUK A;  3KKG A;  2B1X B;  5HGR A;  3F8H A;  4OVM A;  3NUV A;  3MG2 A;  1A2K A;  2GBW B;  3DXO A;  4HKV B;  4X2O A;  3MSO A;  3STD A;  3UJM A;  5IER A;  1C7H A;  1GYB A;  1UUW B;  3CU3 A;  3RGR A;  5D82 A;  3M8C A;  5G2G A;  4HM0 B;  1BUQ A;  4HM7 B;  2BMQ B;  3OXA A;  1W6Y A;  1OGX A;  1GY7 A;  1Q40 A;  4K1U A;  1OHS A;  1W02 A;  4HM2 B;  3ER7 A;  5AIG A;  3OWU A;  5DRE A;  1QMA A;  3EJV A;  4IIA A;  2A15 A;  2OWP A;  2R4I A;  4HM3 B;  2RGQ A;  5IEP A;  2F98 A;  4N3V A;  1ZX2 A;  3I0Y A;  5IG4 A;  1DMQ A;  1O7P B;  4OUQ A;  5FW5 A;  2Z76 A;  1W00 A;  2JQ5 A;  5BXQ A;  2IMJ A;  3ECF A;  1DMN A;  4GB5 A;  3F9S A;  1EA2 A;  1ISK A;  3MKI A;  1OH0 A;  4MJD A;  5STD A;  3T8N A;  3EN1 B;  5JPU A;  4XDV A;  1GY5 A;  3CPO A;  3HX8 A;  3B4O A;  3FF0 A;  1JN5 B;  3G16 A;  3JUQ A;  4HZB B;  2HMM B;  3SOY A;  1OPY A;  3MG3 A;  3ROB A;  6STD A;  2QGU A;  1JN5 A;  1JB4 A;  2CKF B;  3NHX A;  4LEH A;  3VSY A;  3UNL A;  3D9R A;  4HM8 B;  4L8P A;  5AIF A;  3OV4 A;  5KP3 A;  1JKG A;  2RCD A;  2YFI B;  3B8L A;  3B4P A;  3K7C A;  5D81 A;  4HM6 B;  2GBX B;  3GZB A;  1SJW A;  4XM4 A;  2F99 A;  2UX0 A;  3F40 A;  1ZO2 A;  3NBR A;  5AEW B;  1UUV B;  2INX A;  4XBT A;  3EBT A;  1JB5 A;  3JUN A;  1OGZ A;  2QIY A;  4R1K A;  2GEX A;  4LGQ A;  2GXF A;  1JKG B;  3BLZ A;  3S5C A;  3JUO A; 
#chains in the Genus database with same CATH topology
 3X3Z A;  1Q82 4;  2D42 A;  3X3Y A;  3PGB A;  3T8U A;  1IK3 A;  2STD A;  3UB1 A;  4N6N B;  2W56 A;  3MHE A;  3FSD A;  1BRH A;  1WTH A;  1M9G A;  1X1W A;  1WMP A;  4EW5 A;  1W6G A;  3A76 A;  1JJ2 2;  1JBS A;  1WNH A;  1BNI A;  3BND A;  1GY6 A;  1RN7 A;  1YJW 3;  4X2H A;  4AKZ A;  2M7O A;  3E99 A;  1FGT A;  1ASK A;  3EN8 A;  1QAK A;  2CHC A;  1VZZ A;  1I3I A;  3J7Y d;  4K1V A;  3LOY A;  1W5Z A;  1WQL B;  3SED A;  2W56 B;  4FR9 A;  1VQ4 3;  2BMR B;  4N6U A;  1IU7 A;  2P05 A;  2CFD A;  3K5T A;  4O3V A;  1I70 A;  2PNC A;  2XSH B;  2C11 A;  1GMP A;  2V1L A;  4R9L A;  5JBS A;  1A2P A;  1JZD A;  1HU9 A;  1BU4 A;  1OUN A;  4N6M A;  3WMD A;  3CCE 3;  1Q86 4;  3KFQ C;  4XBX A;  1NU3 A;  1TUH A;  1IQY A;  4CDL A;  1B2X A;  1YI2 3;  1DVD A;  1BSE A;  1TRQ A;  1BRJ A;  1UI7 A;  1RN4 A;  2W9Q A;  4MEI A;  3U97 A;  1JBT A;  1ULJ B;  5G1L A;  3U1W A;  1KC8 4;  3JUM A;  3V92 A;  2QA4 3;  3B7C A;  1X1U A;  5CK6 A;  3T8N A;  1I2G A;  1RGG A;  3F7S A;  2F86 B;  3WDG B;  3PXM A;  1VQK 3;  1C54 A;  4EC6 A;  1RCL A;  1GD3 A;  1BNR A;  5D83 A;  1OHP A;  1RGH A;  1QAF A;  1GOY A;  1DE3 A;  4FCM A;  2B24 B;  2F56 A;  1J2B A;  4FCJ A;  1CEW I;  3ALA A;  3BNB A;  9RNT A;  3CCS 3;  1B2S A;  1FA3 A;  1G02 A;  3EC9 A;  4WFO A;  2FGT A;  1OF5 A;  1FUS A;  2FXT A;  2YFL B;  3LYG A;  4EV2 A;  1VQN 3;  5TGN A;  1OF5 B;  5ELU A;  2CG1 A;  3Q90 A;  2BNG A;  3WR2 A;  2YX9 A;  1TIJ A;  3D79 A;  2XFT A;  4N6L A;  2QEX 3;  2B1X B;  5HGR A;  2IY2 A;  4OVM A;  3MG2 A;  4X2O A;  2L4V A;  3RGR A;  2W9P A;  5EQL A;  1YIJ 3;  1PY3 A;  4HM0 B;  2BMQ B;  3OXA A;  1W6Y A;  4ILF A;  1OGX A;  1OHS A;  1W02 A;  1DET A;  2W04 A;  1IT8 A;  4HAA A;  2CC3 A;  1Q7H A;  3OWU A;  1QMA A;  3EJV A;  1A2V A;  2OWP A;  4HM3 B;  1LOY A;  4J5K A;  4OUQ A;  3O8Y A;  3QK9 A;  1W00 A;  5BXQ A;  2IMJ A;  2KF4 A;  3ECF A;  5A0O B;  3CCQ 3;  4GB5 A;  2CW9 A;  3F9S A;  3LT9 A;  5FGO A;  1UCJ A;  1T5Y A;  2C10 A;  4NPB A;  1N9E A;  5AYR B;  5STD A;  3G71 3;  1LRA A;  1FUW A;  5JPU A;  1GY5 A;  1UCI A;  1BRG A;  2CFG A;  3CCU 3;  1I2F A;  1UUG B;  2O9U X;  1W4N A;  1MNL A;  1QAL A;  4HZB B;  2CX1 A;  1I2E A;  4QWT A;  1N8R 4;  1JB4 A;  4K90 B;  3VSY A;  2CWV A;  3UNL A;  1W7C A;  1JKG A;  3B8L A;  3WA2 X;  5IW9 A;  1IQX A;  2FNQ A;  1SJW A;  2F99 A;  2UX0 A;  3F40 A;  3DGL A;  1IVX A;  4XBT A;  2ZA4 A;  1JB5 A;  1IV9 A;  3X41 A;  3BLZ A;  1M1K 4;  3JUO A;  5CXO A;  3OX9 A;  4NHF A;  4I5Q A;  3WA3 A;  3DZL A;  5CF1 A;  1BNS A;  1AR0 A;  3GSP A;  4HM1 B;  1YHQ 3;  4FMB A;  3H51 A;  4HM4 B;  1FGR A;  4IT7 A;  5BIR A;  1KD1 4;  3FG4 A;  4AEQ A;  2KXG A;  2E2U A;  1BNF A;  4N6O B;  3F14 A;  1A67 A;  1LOV A;  3KSP A;  5AYS C;  1O7H B;  2OOV A;  1BIR A;  2GEY A;  3EQQ B;  2SAR A;  2XRX B;  1X1Y A;  1HKX A;  3KE7 A;  1VQ7 3;  1AVL A;  1SAR A;  1UGI A;  2GU3 A;  2OQE A;  1BNE A;  1TFO A;  1FYS A;  3KII A;  1MGR A;  1WMN A;  3ZFZ A;  3GWR A;  4HVN A;  2H0I A;  1BSA A;  3LXU X;  2HMK B;  5IG0 A;  3SX1 A;  4XBY A;  1PYL A;  4STD A;  4HJL B;  3X42 A;  2OTL 3;  3MYT A;  1MWR A;  4R9K A;  1AY7 A;  2I9W A;  3Q3F A;  2WGO A;  1EUI C;  4J5G A;  1EKM A;  2XGN A;  2W0Q A;  3CNM A;  3DY5 A;  1IVU A;  5BVB A;  1CQS A;  2PZV A;  5IF6 A;  1Q42 A;  4BTX A;  1V74 A;  3K9M C;  3G4S 3;  2HMJ B;  4WWU C;  1PU4 A;  3CCV 3;  4EXR A;  3CXC 2;  1SQW A;  3NV0 B;  3H3H A;  1NDO B;  1G96 A;  3A5E A;  4HZ9 B;  1YVS A;  3LH4 A;  3IPT A;  1FW7 A;  5JPP A;  3GAX A;  3CCR 3;  4WYK A;  2D1W A;  4FCZ A;  1IQ8 A;  1ULI B;  1RDS A;  3F8X A;  3NBJ A;  4HM5 B;  1I3F A;  2YFJ B;  4HOH A;  1LNH A;  2GU1 A;  2BO9 B;  3AHS A;  4KVH A;  3NV0 A;  4DKI A;  1QJG A;  1RNB A;  3WHO A;  4R80 A;  3AMO B;  3PCS A;  3PCR A;  1FUT A;  1VQ8 3;  2MC8 A;  4J8T A;  5HOH A;  1UCL A;  5LC6 A;  1SPU A;  3NUV A;  4IPB A;  2GBW B;  4HKV B;  2P0M A;  1MGW A;  3CCJ 3;  1C7H A;  1GYB A;  3CU3 A;  4BU4 A;  4H61 A;  3D5G A;  1BRN L;  4HM7 B;  1IV7 A;  2CX0 A;  3HIG A;  1AVK A;  4K1U A;  3V99 A;  1BUQ A;  1QVF 2;  4HM2 B;  1CYU A;  1JV2 B;  3CC2 3;  1DVC A;  3KCH A;  4IIA A;  2A15 A;  3DGY A;  2R4I A;  2KAA A;  2RGQ A;  1RLS A;  1BRS A;  3DGO A;  3BNC A;  2Z76 A;  4CPK A;  6RNT A;  1ZGX A;  1DMN A;  4KT3 B;  1GOV A;  2Q07 A;  1BOX A;  3NQZ A;  3X40 A;  4XDV A;  1LXE A;  3HX8 A;  2O3O A;  3FF0 A;  3SOY A;  4FMD A;  1N5H A;  2GSP A;  2W03 A;  1BNG A;  1PFP A;  1X1X A;  3MG3 A;  4BTW A;  5M19 A;  1MWT A;  2CKF B;  3NHX A;  3LTB A;  1B2Z A;  3AGN A;  1JBR A;  4L8P A;  4EYC A;  2UGI A;  2YFI B;  2F5W A;  1Y4K A;  3L0R A;  3GZB A;  1KQS 2;  1TFK A;  1YGW A;  1ZO2 A;  1Q9E A;  2INX A;  1GSP A;  3SXX A;  1KWI A;  3JUN A;  3PYJ A;  3I56 3;  1WMO A;  8RNT A;  5ELJ A;  3GZR A;  1K73 4;  1TU5 A;  4EBG A;  3FKA A;  1RGF A;  7STD A;  1RMS A;  2BT3 A;  2H0G A;  4EV5 A;  3LTD A;  3BB9 A;  4MMY B;  2K54 A;  3DMC A;  3LTA A;  3Q1C A;  1OCV A;  1YGE A;  2Y73 A;  2CIU A;  1KSI A;  3NX0 A;  3D4A A;  1STD A;  4I4K A;  1CYV A;  1UW1 A;  1W2Z A;  4N6V 0;  2OCT A;  3MPH A;  1BSB A;  4WP5 A;  2KF3 A;  4U13 A;  1W01 A;  5IER A;  1UCK A;  3NQY A;  3GZY B;  3RNT A;  1LQM B;  1YVB I;  1BAO A;  3KSE D;  5BU4 A;  4HBR A;  3FH1 A;  1GOU A;  2F4Y A;  3FF2 A;  2R41 A;  3LTC A;  3NXJ A;  5EVH A;  5RNT A;  2XR8 B;  3MG1 A;  1RGE A;  3GRD A;  2LQV A;  3EB8 A;  3VGN A;  1RSN A;  1Z1S A;  4CCV A;  1F8N A;  4R4K A;  1B3S A;  1MWU A;  3SYU A;  4CJN A;  1VQ9 3;  4BL3 A;  2E2V A;  3HK4 A;  1AV4 A;  1VQQ A;  3OWS A;  4K61 A;  3V98 A;  1Q81 4;  1B27 A;  4LGQ A;  5IEO A;  1T2I A;  4MMX B;  3N9H A;  5AII A;  2IUJ A;  3EBY A;  1RHL A;  3RGA A;  3WOE B;  3SOA A;  1IDP A;  4NRE A;  4AKY A;  1E97 A;  1EG9 B;  2P0X A;  2Z7A A;  3WOF B;  3DGM A;  2XH9 A;  2W2C A;  3EX9 A;  4L8O A;  4GL6 A;  1D6U A;  4FMC A;  1NWW A;  1E3V A;  2HMN B;  5AIH A;  2BIR A;  2RSX A;  3N54 B;  1U5O A;  1T2H A;  3KZT A;  3FLJ A;  1YIT 3;  1UDI I;  4HYZ A;  4WYK B;  2KCD A;  1IVW A;  1L5G B;  1W2B 2;  4GSP A;  1Q40 B;  1VQ5 3;  3AHW A;  1E3R A;  3D5I A;  1RGA A;  1IYY A;  1FZU A;  3NM7 A;  3HII A;  2ML6 A;  4FMA A;  3BNE A;  2W6J H;  3DGN A;  1RRL A;  5M1A A;  1LOW A;  1O7G B;  3S28 A;  1TP6 A;  2L1S A;  3AGO A;  1TJD A;  1FGM A;  3FG1 A;  1FGQ A;  3HI7 A;  1RRH A;  5EEO A;  3SVA A;  3S67 A;  1ROA A;  1O7M B;  3UL5 A;  1K8A 4;  2WO0 A;  3KKG A;  1NNV A;  1LQG C;  1NB3 I;  2CFL A;  2CK3 H;  3K63 A;  1A2K A;  1JRQ A;  1N9J A;  1RJO A;  2Y74 A;  1FGO A;  3MSO A;  3STD A;  3UJM A;  2C4B A;  2KF6 A;  3M8C A;  1N5P A;  1K28 A;  3SLU A;  4KFE A;  1GY7 A;  1Q40 A;  2AAE A;  1EEJ A;  2CWT A;  4O02 B;  1B2M A;  3CC4 3;  2BU4 A;  3ER7 A;  1N8Q A;  2WOF A;  2F98 A;  4N3V A;  3I0Y A;  1DMQ A;  5FW5 A;  4KZ1 A;  4N6T A;  3KN4 A;  2JQ5 A;  5M18 A;  1RGL A;  1HZ1 A;  3N8B A;  1EA2 A;  1TTO A;  3CPO A;  2ML5 A;  1JN5 B;  1B2U A;  2HMM B;  3CMA 3;  2OTJ 3;  1OPY A;  1NB5 I;  1BSD A;  1V57 A;  1R4C A;  4KFF A;  3I55 3;  2QGU A;  1JN5 A;  1QVG 2;  4MMZ B;  4HM8 B;  5AIF A;  1VQL 3;  3OV4 A;  4O8S A;  2RCD A;  3FCS B;  5D81 A;  3LT8 A;  3K7C A;  5KP3 A;  2ZHX B;  4HM6 B;  4XM4 A;  5AEW B;  3NBR A;  3URP A;  4ZM8 A;  2AAD A;  1M1X B;  3EBT A;  3QRD A;  1LOX A;  4LSO A;  1OGZ A;  1NO3 A;  4R1K A;  4JRF A;  1JNQ A;  7GSP A;  1JKG B;  3S5C A;  2XGL A;  2ZDJ A;  2CG0 A;  3LML A;  3CNX A;  3RDE A;  1YNV X;  4BIR A;  2XEP A;  3PS8 A;  3S27 A;  3S29 A;  3MWZ A;  5AEU B;  1RNT A;  4TX4 A;  4LZI A;  1ZS7 A;  1BGS A;  1ROV A;  3GZX B;  1RTU A;  2BMO B;  4J9A A;  3CCM 3;  3FZW A;  8CHO A;  2P09 A;  2K3D A;  1S72 3;  1M90 4;  4OK0 A;  1OHO A;  7RNT A;  3CPW 2;  3G8Z A;  1BUJ A;  5DRV A;  5IG5 A;  2OOV C;  3NM2 A;  3EF8 A;  4H3U A;  3JUP A;  4WHA A;  2LYX A;  3G0K A;  3CME 3;  1LVN A;  4RNT A;  1SII A;  4LYL B;  2RNT A;  5IEN A;  2KRT A;  3UL6 A;  1O7W B;  1BAN A;  4XB5 A;  5KP1 A;  3DM8 A;  2XF3 A;  1BVI A;  1HYF A;  1D6Z A;  2ZL8 A;  2XSO B;  1G0T A;  3FG3 A;  2HML B;  3NBB A;  1I8V A;  3HZP A;  1UGH I;  4Q53 A;  2IA7 A;  5GSP A;  1BSC A;  1US1 A;  2HMO B;  3CC7 3;  1RN1 A;  5LC7 A;  3D3L A;  5CLK A;  1VQP 3;  3F7X A;  4O2H A;  3LZA A;  4BTY A;  1RGK A;  2UUG C;  3T0U A;  5DRE A;  2CH9 A;  4XDW A;  5AI1 A;  1OAC A;  1RKY A;  2RFR A;  2H0H A;  2J8X B;  3HOH A;  1DMM A;  3CCL 3;  2CWU A;  1BRI A;  3ZG0 A;  2Z77 A;  1A90 A;  4L7K A;  4RBN A;  2WGQ A;  1JB2 A;  2IUK A;  3K0Z A;  5CF2 A;  1JZO A;  4ORL A;  1I0V A;  2K0M A;  1VQ6 3;  1VQM 3;  1GMR A;  2CFK A;  1Q7Y 4;  5G1K A;  1O7N B;  4RZM A;  3DH2 A;  3CD6 3;  1K41 A;  1BRK A;  2F5M A;  5KP4 A;  1S5A A;  1W6C A;  3FGY A;  5I97 A;  1GS3 A;  5IG3 A;  4PEJ A;  1CH0 A;  4KFD A;  3TDG A;  1UI8 A;  3VF1 A;  3EHC A;  1LNI A;  1V58 A;  3WOD G;  2XFS A;  2HOH A;  3OWY A;  4LMI A;  3ZG5 A;  3DUK A;  3F8H A;  2CFW A;  1MOL A;  3BU4 A;  3DXO A;  2KF5 A;  2RBI A;  2MF7 A;  6GSP A;  1UUW B;  2SBL A;  3BIR A;  3JVC A;  5D82 A;  5G2G A;  1RGC A;  3OW2 2;  1U8C B;  1I0X A;  5AIG A;  4BL2 A;  1RCK A;  1AQZ A;  5IEP A;  2P38 A;  1ZX2 A;  1B20 A;  1TRP A;  5IG4 A;  1O7P B;  3G6E 3;  1YJ9 3;  4RNZ A;  1DYU A;  1K9M 4;  4G1M B;  4RNY A;  1BNJ A;  2E2T A;  1ISK A;  3MKI A;  1OH0 A;  4MJD A;  3X3X A;  3EN1 B;  3B4O A;  3G16 A;  3JUQ A;  2OQE C;  1YJN 3;  1GD4 A;  2WOH A;  3EE1 A;  1VQO 3;  3ROB A;  3AMO A;  6STD A;  3IJE B;  3IMA B;  1MWS A;  3PZW A;  4LEH A;  1NJI 4;  1IVV A;  3D9R A;  2BHM A;  1GMQ A;  1SIH A;  3B4P A;  2GBX B;  2IYJ A;  2Z6B A;  1EQK A;  1T3B A;  1UUV B;  1R4Y A;  1STF I;  4GHO A;  1D6Y A;  4JF8 A;  2QIY A;  2JDI H;  2GEX A;  1B21 A;  2GXF A;  3Q2P A;  1IT7 A; 
#chains in the Genus database with same CATH homology
 3X3Z A;  1Q82 4;  2D42 A;  3X3Y A;  3PGB A;  3T8U A;  1IK3 A;  2STD A;  3UB1 A;  4N6N B;  2W56 A;  3MHE A;  3FSD A;  1WTH A;  1M9G A;  1WMP A;  1JJ2 2;  1W6G A;  3A76 A;  1WNH A;  3BND A;  1GY6 A;  1RN7 A;  1YJW 3;  4X2H A;  4AKZ A;  2M7O A;  3E99 A;  1FGT A;  1ASK A;  3EN8 A;  1QAK A;  2CHC A;  1VZZ A;  3J7Y d;  4K1V A;  3LOY A;  1W5Z A;  1WQL B;  3SED A;  2W56 B;  4FR9 A;  1VQ4 3;  2BMR B;  4N6U A;  1IU7 A;  2P05 A;  2CFD A;  3K5T A;  4O3V A;  2PNC A;  2XSH B;  2C11 A;  2V1L A;  4R9L A;  5JBS A;  1OUN A;  1HU9 A;  1Q86 4;  4N6M A;  3CCE 3;  3WMD A;  3KFQ C;  4XBX A;  1NU3 A;  1TUH A;  1IQY A;  4CDL A;  1DVD A;  1YI2 3;  1UI7 A;  2W9Q A;  4MEI A;  3U97 A;  1ULJ B;  3U1W A;  1KC8 4;  3JUM A;  3V92 A;  2QA4 3;  3B7C A;  5CK6 A;  3T8N A;  3F7S A;  2F86 B;  3WDG B;  3PXM A;  1VQK 3;  4EC6 A;  1GD3 A;  5D83 A;  1OHP A;  1QAF A;  4FCM A;  2B24 B;  1J2B A;  4FCJ A;  1CEW I;  3ALA A;  3BNB A;  3CCS 3;  1FA3 A;  3EC9 A;  4WFO A;  2FGT A;  1OF5 A;  2FXT A;  2YFL B;  3LYG A;  4EV2 A;  1VQN 3;  5TGN A;  1OF5 B;  5ELU A;  2CG1 A;  3Q90 A;  2BNG A;  2YX9 A;  1TIJ A;  2XFT A;  4N6L A;  2QEX 3;  2B1X B;  5HGR A;  4OVM A;  3MG2 A;  4X2O A;  2L4V A;  3RGR A;  2W9P A;  5EQL A;  1YIJ 3;  4HM0 B;  2BMQ B;  3OXA A;  1W6Y A;  1OGX A;  1OHS A;  1W02 A;  2W04 A;  1IT8 A;  2CC3 A;  3OWU A;  1QMA A;  3EJV A;  1A2V A;  2OWP A;  4HM3 B;  4OUQ A;  3O8Y A;  3QK9 A;  1W00 A;  5BXQ A;  2IMJ A;  3ECF A;  5A0O B;  3CCQ 3;  4GB5 A;  2CW9 A;  3F9S A;  3LT9 A;  5FGO A;  1T5Y A;  2C10 A;  1FUW A;  1N9E A;  5AYR B;  5STD A;  3G71 3;  5JPU A;  1GY5 A;  2CFG A;  3CCU 3;  4HZB B;  2O9U X;  1W4N A;  1MNL A;  1QAL A;  4QWT A;  1N8R 4;  1JB4 A;  4K90 B;  3VSY A;  2CWV A;  3UNL A;  1W7C A;  1JKG A;  3B8L A;  3WA2 X;  5IW9 A;  1IQX A;  2FNQ A;  1SJW A;  2F99 A;  2UX0 A;  3F40 A;  3DGL A;  1IVX A;  4XBT A;  1JB5 A;  1IV9 A;  3X41 A;  3BLZ A;  1M1K 4;  3JUO A;  5CXO A;  3OX9 A;  4NHF A;  3WA3 A;  3DZL A;  5CF1 A;  1AR0 A;  4HM1 B;  1YHQ 3;  4FMB A;  3H51 A;  4HM4 B;  1FGR A;  4IT7 A;  1KD1 4;  3FG4 A;  4AEQ A;  2KXG A;  2E2U A;  4N6O B;  3F14 A;  1A67 A;  3KSP A;  5AYS C;  1O7H B;  2OOV A;  2GEY A;  3EQQ B;  2XRX B;  1HKX A;  3KE7 A;  1VQ7 3;  1AVL A;  2GU3 A;  2OQE A;  1TFO A;  3KII A;  1WMN A;  3GWR A;  4HVN A;  3LXU X;  3SX1 A;  2HMK B;  5IG0 A;  2OTL 3;  4XBY A;  4STD A;  3X42 A;  4HJL B;  3MYT A;  4R9K A;  2I9W A;  2WGO A;  1EKM A;  2XGN A;  2W0Q A;  3CNM A;  3DY5 A;  1IVU A;  5BVB A;  1CQS A;  2PZV A;  5IF6 A;  1Q42 A;  4BTX A;  1V74 A;  3K9M C;  3G4S 3;  2HMJ B;  4WWU C;  1PU4 A;  3CCV 3;  4EXR A;  3CXC 2;  1SQW A;  3NV0 B;  3H3H A;  1NDO B;  1G96 A;  4HZ9 B;  3LH4 A;  3IPT A;  5JPP A;  3GAX A;  3CCR 3;  4WYK A;  2D1W A;  4FCZ A;  1IQ8 A;  1ULI B;  3NBJ A;  3F8X A;  4HM5 B;  2YFJ B;  1LNH A;  2GU1 A;  2BO9 B;  4KVH A;  3NV0 A;  1QJG A;  4R80 A;  3AMO B;  3PCS A;  3PCR A;  1VQ8 3;  2MC8 A;  4J8T A;  5LC6 A;  1SPU A;  3NUV A;  4IPB A;  2GBW B;  4HKV B;  2P0M A;  3CCJ 3;  1C7H A;  1GYB A;  3CU3 A;  4H61 A;  1BUQ A;  4HM7 B;  1IV7 A;  3HIG A;  3V99 A;  1AVK A;  4K1U A;  1QVF 2;  4HM2 B;  1CYU A;  1JV2 B;  3CC2 3;  1DVC A;  4IIA A;  2A15 A;  2R4I A;  2RGQ A;  3DGO A;  3BNC A;  2Z76 A;  1DMN A;  2Q07 A;  3NQZ A;  3X40 A;  4XDV A;  1LXE A;  3HX8 A;  2O3O A;  3FF0 A;  3SOY A;  4FMD A;  1N5H A;  2W03 A;  1PFP A;  3MG3 A;  4BTW A;  2CKF B;  3NHX A;  3LTB A;  4L8P A;  4EYC A;  2YFI B;  1Y4K A;  3L0R A;  3GZB A;  1KQS 2;  1TFK A;  1ZO2 A;  2INX A;  3SXX A;  1KWI A;  3JUN A;  3PYJ A;  3I56 3;  1WMO A;  5ELJ A;  3GZR A;  1TU5 A;  4EBG A;  3FKA A;  7STD A;  2BT3 A;  4EV5 A;  3LTD A;  3BB9 A;  4MMY B;  2K54 A;  3DMC A;  3LTA A;  3Q1C A;  1OCV A;  1YGE A;  2Y73 A;  2CIU A;  1KSI A;  3NX0 A;  1STD A;  4I4K A;  1CYV A;  1UW1 A;  1W2Z A;  4N6V 0;  2OCT A;  3MPH A;  4WP5 A;  4U13 A;  1W01 A;  5IER A;  3NQY A;  3GZY B;  1YVB I;  3KSE D;  1K73 4;  4HBR A;  3FH1 A;  5EVH A;  3FF2 A;  3LTC A;  3NXJ A;  2XR8 B;  3MG1 A;  3GRD A;  2LQV A;  3EB8 A;  3VGN A;  4CCV A;  1Z1S A;  1F8N A;  4R4K A;  1VQ9 3;  2E2V A;  3HK4 A;  1AV4 A;  3OWS A;  4K61 A;  3V98 A;  1Q81 4;  5IEO A;  4MMX B;  5AII A;  3N9H A;  2IUJ A;  3EBY A;  4AKY A;  3RGA A;  3WOE B;  3SOA A;  1IDP A;  4NRE A;  1E97 A;  1EG9 B;  2P0X A;  2Z7A A;  3WOF B;  3DGM A;  2XH9 A;  2W2C A;  3EX9 A;  4L8O A;  4GL6 A;  1D6U A;  4FMC A;  1NWW A;  1E3V A;  2HMN B;  5AIH A;  2RSX A;  3N54 B;  1U5O A;  3KZT A;  3FLJ A;  1YIT 3;  4HYZ A;  4WYK B;  2KCD A;  1IVW A;  1L5G B;  1W2B 2;  1Q40 B;  1VQ5 3;  1E3R A;  3NM7 A;  3HII A;  2ML6 A;  4FMA A;  3BNE A;  2W6J H;  3DGN A;  1RRL A;  3S28 A;  1O7G B;  1TP6 A;  1FGM A;  3FG1 A;  1FGQ A;  3HI7 A;  1RRH A;  5EEO A;  3SVA A;  3S67 A;  1ROA A;  1O7M B;  3UL5 A;  1K8A 4;  2WO0 A;  3KKG A;  1NB3 I;  2CK3 H;  2CFL A;  3K63 A;  1A2K A;  1JRQ A;  1N9J A;  1RJO A;  2Y74 A;  1FGO A;  3MSO A;  3STD A;  3UJM A;  3M8C A;  1N5P A;  1K28 A;  3SLU A;  4KFE A;  1GY7 A;  1Q40 A;  2CWT A;  4O02 B;  3CC4 3;  3ER7 A;  1N8Q A;  2WOF A;  2F98 A;  4N3V A;  3I0Y A;  1DMQ A;  5FW5 A;  4KZ1 A;  4N6T A;  3KN4 A;  2JQ5 A;  3N8B A;  1EA2 A;  3CPO A;  2ML5 A;  1JN5 B;  2HMM B;  3CMA 3;  2OTJ 3;  1OPY A;  1NB5 I;  1R4C A;  4KFF A;  3I55 3;  2QGU A;  1JN5 A;  1QVG 2;  4MMZ B;  4HM8 B;  5AIF A;  1VQL 3;  3OV4 A;  4O8S A;  2RCD A;  3FCS B;  5D81 A;  3LT8 A;  3K7C A;  5KP3 A;  4HM6 B;  4XM4 A;  5AEW B;  3NBR A;  4ZM8 A;  3EBT A;  1M1X B;  3QRD A;  1LOX A;  4LSO A;  1OGZ A;  1NO3 A;  4R1K A;  4JRF A;  1JNQ A;  1JKG B;  3S5C A;  2XGL A;  2ZDJ A;  2CG0 A;  3LML A;  3CNX A;  3RDE A;  2XEP A;  3PS8 A;  3S27 A;  3S29 A;  3MWZ A;  5AEU B;  4TX4 A;  4LZI A;  1ROV A;  3GZX B;  2BMO B;  4J9A A;  3CCM 3;  3FZW A;  8CHO A;  2P09 A;  1S72 3;  1M90 4;  4OK0 A;  1OHO A;  3CPW 2;  3G8Z A;  5DRV A;  5IG5 A;  2OOV C;  3NM2 A;  3EF8 A;  4H3U A;  3JUP A;  4WHA A;  2LYX A;  3G0K A;  3CME 3;  1LVN A;  1SII A;  5IEN A;  2KRT A;  3UL6 A;  1O7W B;  4XB5 A;  5KP1 A;  3DM8 A;  2XF3 A;  1D6Z A;  2ZL8 A;  2XSO B;  3FG3 A;  2HML B;  3NBB A;  3HZP A;  4Q53 A;  2IA7 A;  1US1 A;  2HMO B;  3CC7 3;  5LC7 A;  3D3L A;  5CLK A;  1VQP 3;  3F7X A;  4O2H A;  3LZA A;  4BTY A;  3T0U A;  5DRE A;  2CH9 A;  4XDW A;  5AI1 A;  1OAC A;  1RKY A;  2RFR A;  1DMM A;  3CCL 3;  2CWU A;  2Z77 A;  1A90 A;  4L7K A;  4RBN A;  2WGQ A;  1JB2 A;  2IUK A;  3K0Z A;  5CF2 A;  4ORL A;  1VQ6 3;  2K0M A;  1VQM 3;  2CFK A;  1Q7Y 4;  3CD6 3;  1O7N B;  4RZM A;  1K41 A;  5KP4 A;  1S5A A;  1W6C A;  3FGY A;  5I97 A;  1GS3 A;  5IG3 A;  4PEJ A;  4KFD A;  3TDG A;  1UI8 A;  3VF1 A;  3EHC A;  3WOD G;  2XFS A;  3OWY A;  4LMI A;  3DUK A;  3F8H A;  2CFW A;  1MOL A;  3DXO A;  2MF7 A;  1UUW B;  2SBL A;  3JVC A;  5D82 A;  5G2G A;  3OW2 2;  1U8C B;  5AIG A;  5IEP A;  2P38 A;  1ZX2 A;  5IG4 A;  3G6E 3;  1O7P B;  1YJ9 3;  4RNZ A;  1DYU A;  1K9M 4;  4G1M B;  4RNY A;  2E2T A;  1ISK A;  3MKI A;  1OH0 A;  4MJD A;  3X3X A;  3EN1 B;  3B4O A;  3G16 A;  3JUQ A;  2OQE C;  1YJN 3;  1GD4 A;  2WOH A;  3EE1 A;  1VQO 3;  3ROB A;  3AMO A;  6STD A;  3IJE B;  3IMA B;  4LEH A;  3PZW A;  1NJI 4;  1IVV A;  3D9R A;  2BHM A;  1SIH A;  3B4P A;  2GBX B;  2Z6B A;  1EQK A;  1UUV B;  1STF I;  4JF8 A;  1D6Y A;  2QIY A;  2JDI H;  2GEX A;  4LGQ A;  2GXF A;  3Q2P A;  1IT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...