4CDLA

Crystal structure of retro-aldolase ra110.4-6 complexed with inhibitor 1-(6-methoxy-2-naphthalenyl)-1,3-butanedione
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
126
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATIESPFGQPPIHGREQIAAHYRKWLGGGKLRVYLTGPVRANHNGCGTMLLRKEWVWNGQPCATDVILVMRFDEQGRIQTEQRYWSEVNLCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Active Site Plasticity of a Computationally Designed Retro-Aldolase Enzyme
rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 126
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4cdlA00
1ZX2A 7STDA 2BMQB 5IEPA 2CHCA 4XBXA 3NXJA 3HK4A 4CDLA 4WYKB 1OHSA 1Q42A 1GY7A 3NM2A 3VSYA 4X2OA 3FF2A 5AEWB 4H3UA 5IENA 1OGZA 4HZ9B 1A2KA 1ZO2A 1DMMA 3S5CA 4XBTA 2BMOB 5D83A 2Z76A 3F7XA 3Q90A 3HZPA 3F9SA 5AIHA 3GZBA 4J9AA 5G2GA 4HM4B 1OF5A 3OX9A 1JB4A 5AEUB 5KP4A 4HM8B 1NU3A 4XDWA 1OUNA 3GRDA 3JUQA 1E3VA 4ORLA 1BUQA 5STDA 1OPYA 3FF0A 1E3RA 4XBYA 4J8TA 4HM7B 3A76A 1W01A 1AR0A 4XDVA 1ASKA 4U13A 3FGYA 3LYGA 1O7MB 1DMNA 3KZTA 3FZWA 1QMAA 3MG2A 3JUPA 4N3VA 4KVHA 3EX9A 5TGNA 3VGNA 2GBXB 1O7HB 4IIAA 4HVNA 3LZAA 3F40A 3GZXB 4K1UA 4HZBB 5IERA 3G16A 1O7NB 2HMKB 4MJDA 3H3HA 3BLZA 3UJMA 3KE7A 1UUWB 4XM4A 5CXOA 1IDPA 3EHCA 3KSPA 5BXQA 4GB5A 1W02A 2XSHB 5FW5A 1OCVA 3I0YA 1Z1SA 3F8XA 5HGRA 3MG3A 5CF2A 1GS3A 4LGQA 2GEYA 3K7CA 5IG4A 6STDA 2YFJB 3MKIA 2INXA 3NV0A 2HMJB 3FLJA 2F86B 8CHOA 1C7HA 4LEHA 3CU3A 4K1VA 4FCMA 3KKGA 4L8PA 3NV0B 1UUVB 2UX0A 1ISKA 4HM2B 2B1XB 3CPOA 3JUNA 2PZVA 2Z77A 2QIYA 1OF5B 2YFLB 3B4PA 3T8NA 3OWSA 3OV4A 2STDA 1STDA 2Z7AA 5JPUA 3E99A 3WMDA 2GBWB 2HMOB 3NBRA 3OWYA 4PEJA 3F8HA 2A15A 5CF1A 4XB5A 2YFIB 1GY5A 5IG3A 3HX8A 3EQQB 1U5OA 2I9WA 3RGRA 3FKAA 4HM5B 4R9LA 3IPTA 3DUKA 3UNLA 3EF8A 1SJWA 3EBYA 2QGUA 1GY6A 3G8ZA 5DRVA 3MHEA 2HMMB 2K54A 3DXOA 3M8CA 3STDA 4L7KA 3EBTA 1S5AA 5IEOA 3JUMA 3K0ZA 2F98A 4HKVB 3EN8A 5EVHA 5D82A 2RGQA 4OVMA 2XRXB 3GZRA 1NDOB 4STDA 3GZYB 2W2CA 2XR8B 1GYBA 2RCDA 5AIFA 1VZZA 5IG0A 3CNXA 5AIGA 1OGXA 1JB5A 3CNMA 3G0KA 1OH0A 1WQLB 3EC9A 1EA2A 5CK6A 1NWWA 2BMRB 3BB9A 1O7PB 2R4IA 3DMCA 4WP5A 3EJVA 4WWUC 3SOAA 4HM3B 4HJLB 3ECFA 3ER7A 3DZLA 3FH1A 5IF6A 1OHOA 1O7GB 2GXFA 3SEDA 4X2HA 3T8UA 5AIIA 4RZMA 3F7SA 5KP3A 4HM6B 1JN5A 3OXAA 4FCJA 4LMIA 1CQSA 1OHPA 3JUOA 1DMQA 3F14A 4I4KA 1JN5B 3OWUA 4HM0B 2B24B 2F99A 1W6YA 1HKXA 3GWRA 3D9RA 4R1KA 1TUHA 3B4OA 1Q40A 1E97A 3MSOA 1EG9B 2CKFB 5AI1A 1K41A 3H51A 3B8LA 2IMJA 2BNGA 3B7CA 5IG5A 5KP1A 4R9KA 1O7WB 2JQ5A 3ROBA 1Q40B 4OUQA 1QJGA 2HMLB 1ULIB 3SOYA 1JKGA 3RGAA 5JPPA 2HMNB 3DM8A 3FSDA 1JB2A 4L8OA 2GEXA 1TP6A 4HM1B 1JKGB 4Q53A 2XSOB 3MG1A 5CLKA 1ULJB 5D81A 2RFRA 5BVBA 3EN1B 1W00A 3NHXA 5DREA 3NUVA 3MYTA 4WYKA 2OWPA
chains in the Genus database with same CATH superfamily
2R41A 1N9EA 3WDGB 2IYJA 1RGAA 3DGLA 1ZX2A 5M18A 7STDA 3SYUA 2BO9B 2BMQB 3CCE3 1W6GA 5IEPA 2K3DA 1LQGC 2CHCA 7RNTA 2WOFA 4N6MA 4XBXA 3NXJA 1VQM3 2WGOA 1RNTA 1UCKA 1QVG2 3HK4A 2XF3A 4CDLA 4WYKB 1OHSA 3AHSA 1Q42A 3K9MC 1GY7A 3NM2A 5EQLA 3VSYA 4X2OA 1I0XA 1UCLA 3FF2A 5AEWB 4RNTA 1R4CA 1W7CA 2P05A 3CCS3 3D3LA 2IUKA 4H3UA 3LTDA 4G1MB 4AEQA 5IENA 1OGZA 2CX1A 1VQK3 1YJN3 3D5IA 4JRFA 2IA7A 1A2KA 4HZ9B 1B3SA 1ZO2A 1DMMA 3S5CA 1RDSA 3AMOA 4XBTA 2C4BA 2BMOB 1UGHI 1G96A 4N6TA 4HAAA 3S29A 3X42A 5D83A 2Z76A 1A90A 1LRAA 3F7XA 4NHFA 3Q90A 4FMDA 3HZPA 4R80A 4ZM8A 1B21A 1ZGXA 3F9SA 1AQZA 3LT9A 5AIHA 3GZBA 4J9AA 3U97A 4IPBA 5G2GA 3BU4A 4N6LA 4WFOA 3AGOA 1BNIA 3CCU3 1U8CB 1YVBI 1X1WA 2CFDA 4KFEA 3AMOB 2L4VA 1RCKA 3FG1A 3WA2X 4LSOA 5LC7A 4HM4B 1OF5A 3OX9A 5G1KA 4R4KA 1JB4A 5LC6A 1BIRA 1BOXA 5RNTA 2O9UX 3WHOA 2C11A 5AEUB 5KP4A 4HM8B 2FXTA 2CX0A 1NU3A 3CCQ3 1RLSA 4XDWA 5M1AA 1OUNA 4RNZA 3GRDA 3PXMA 3BNEA 3JUQA 5GSPA 1E3VA 1JNQA 3S67A 1WTHA 2V1LA 4LZIA 1LVNA 4ORLA 8RNTA 1BUQA 2JDIH 5STDA 1OPYA 3DGNA 1UGIA 3FF0A 3K5TA 2AAEA 1E3RA 2UGIA 1BSEA 3X3XA 1WMPA 1IQ8A 1IT8A 4XBYA 5AYSC 1DVCA 1NJI4 3EB8A 1M904 4J8TA 4HM7B 4KT3B 3I563 1VQ93 1VQN3 1CYUA 3A76A 1B27A 3N9HA 1KC84 1CH0A 2LQVA 3CMA3 1FUWA 3A5EA 5ELUA 1W01A 2Z6BA 2XFTA 3ALAA 1YHQ3 1STFI 1AR0A 1B2SA 3U1WA 4XDVA 3CCV3 1ASKA 1PU4A 4U13A 3FGYA 3LYGA 4RBNA 3CME3 1K734 1O7MB 1UCIA 3LOYA 3N8BA 1DMNA 3KZTA 3NM7A 4LYLB 3FZWA 1T3BA 1QMAA 2QEX3 2D42A 3MG2A 1YJ93 5I97A 2W03A 3NX0A 3SVAA 1I3FA 1GSPA 3JUPA 3VF1A 4FR9A 1T5YA 3KCHA 4N3VA 4KVHA 1HU9A 1WMOA 3BNCA 1VQP3 2KF5A 2CWUA 3EX9A 4BTXA 5TGNA 1NB5I 4KZ1A 2KCDA 3VGNA 2L1SA 3GSPA 1I8VA 1FGQA 3GAXA 2GBXB 4CPKA 1O7HB 4IIAA 4HVNA 1YIJ3 3LZAA 6GSPA 3TDGA 1B20A 1BNRA 1W2ZA 3F40A 1IU7A 2OTL3 3GZXB 4K1UA 4HZBB 1YI23 1VQQA 5AYRB 5IERA 1RGGA 3G16A 4IT7A 1O7NB 2HMKB 3CC23 4MJDA 4O02B 3DGYA 2SARA 2XFSA 3H3HA 3BLZA 3UJMA 3Q2PA 3KE7A 3UL5A 1YNVX 1N5HA 1UUWB 4XM4A 5CXOA 1UUGB 1IDPA 2ZA4A 2ZHXB 2CFWA 3IJEB 1GOUA 2CWTA 1X1YA 3EHCA 3UL6A 1FZUA 3KSPA 5BXQA 1JZOA 1MGWA 3O8YA 1QALA 3G4S3 1FW7A 1GMPA 4GB5A 1DYUA 2OCTA 4KFFA 1W02A 1RSNA 4N6V0 3LH4A 5A0OB 2KXGA 2KF3A 2XSHB 5FW5A 1LOXA 3CXC2 4CJNA 1LOVA 1OCVA 1GOVA 3I0YA 4K90B 1Z1SA 3F8XA 2GU3A 1RGCA 3MG3A 5HGRA 1GS3A 1I2GA 1PFPA 1W4NA 2F4YA 2KRTA 5CF2A 3LT8A 3WOFB 2F5MA 4LGQA 1AVLA 1R4YA 2GEYA 3K7CA 5IG4A 3X40A 6STDA 1UI7A 4FMCA 1G0TA 1HZ1A 2W56A 2RNTA 2YFJB 2LYXA 1KWIA 3MKIA 4MMXB 1DVDA 3LXUX 1K9M4 1D6ZA 2INXA 3NV0A 2HMJB 1BGSA 1GMQA 3FLJA 3X3ZA 3SX1A 1IT7A 1FA3A 3HIGA 2F86B 3FCSB 4AKYA 1Y4KA 1B2ZA 4WHAA 8CHOA 1ZS7A 1C7HA 1J2BA 1PY3A 1UI8A 4LEHA 3CU3A 4K1VA 4FCMA 1MOLA 2W56B 1WMNA 3KKGA 3KFQC 2RBIA 2W6JH 3NQYA 1YGEA 1RCLA 4L8PA 1N9JA 2CIUA 3NV0B 1BNJA 1UUVB 3HOHA 4J5GA 4AKZA 2UX0A 3KSED 4GHOA 1ISKA 2XGNA 4HM2B 3LTBA 2QA43 1JBRA 2B1XB 3CPOA 1EUIC 1LQMB 3JUNA 1IVUA 2PZVA 2Z77A 3OW22 1YJW3 1KSIA 4QWTA 2QIYA 1OF5B 2YFLB 3B4PA 3DGOA 1SIIA 2P38A 3OWSA 3T8NA 4EW5A 1HYFA 3OV4A 4FMBA 2STDA 1NB3I 1STDA 3LTCA 2Z7AA 3WR2A 2O3OA 1YIT3 1GOYA 1LOYA 3E99A 5JPUA 3WMDA 1BRKA 2GBWB 2HMOB 3KN4A 3NBRA 3KIIA 1W6CA 1GD3A 1MWSA 3DY5A 3RDEA 1A67A 1BUJA 2MF7A 3OWYA 2F56A 2W04A 1RRHA 1GD4A 4PEJA 1BSCA 3F8HA 4ILFA 3D4AA 3G6E3 1TFOA 4BTYA 5ELJA 2A15A 1S723 1BRNL 1RRLA 5CF1A 1A2VA 4XB5A 2OQEC 1RN4A 2YFIB 3BNDA 4K61A 4N6OB 1IK3A 1N8QA 2OQEA 1GY5A 3ZG0A 5IG3A 3HX8A 2ZL8A 1QAFA 1U5OA 3EQQB 4MMZB 1US1A 1AVKA 4BU4A 2I9WA 3RGRA 2P09A 3FKAA 4HM5B 1AY7A 2FGTA 2CG0A 4BL3A 4R9LA 3IPTA 1Q9EA 1OACA 5BIRA 5HOHA 1I3IA 1JBTA 3DUKA 2RSXA 2F5WA 3UNLA 1MWRA 3EF8A 1JZDA 1ROAA 1BNFA 1VQL3 1SJWA 2W0QA 1I0VA 3EBYA 3Q1CA 3UB1A 2QGUA 2KF6A 3PZWA 2E2UA 2Y73A 2E2TA 3CPW2 2CWVA 2YX9A 1G02A 1GY6A 3G8ZA 2CFLA 1M9GA 1RJOA 5DRVA 1T2IA 1TIJA 3MHEA 2HMMB 4MMYB 3V98A 1QVF2 2K54A 3DXOA 1MNLA 3M8CA 1YGWA 3SLUA 3STDA 2XH9A 4L7KA 1Q864 2SBLA 4FCZA 1GMRA 1TFKA 3EBTA 2K0MA 1VQO3 1S5AA 3G713 5IEOA 3JUMA 1JRQA 2F98A 2W9QA 3K0ZA 1FUTA 3EN8A 4HKVB 1TTOA 4JF8A 4O8SA 1W2B2 2Y74A 3V92A 5EVHA 1RN7A 2C10A 1NNVA 5D82A 3LTAA 2KF4A 2RGQA 2XGLA 3LMLA 1V74A 2XRXB 4OVMA 3SXXA 1BVIA 1NDOB 3GZRA 4STDA 3GZYB 1Q7Y4 1BSDA 2M7OA 2W2CA 2XR8B 3JVCA 3URPA 3HI7A 1GYBA 2RCDA 5AIFA 3X41A 1VZZA 1FGOA 5IG0A 3CNXA 1B2UA 1FYSA 2ML6A 2H0HA 2IUJA 4EC6A 1BU4A 1TRQA 5AIGA 3V99A 1N5PA 1OGXA 3AHWA 1JB5A 3CNMA 1WNHA 1BRHA 3EE1A 1KQS2 3CC43 3G0KA 1OH0A 1WQLB 3EC9A 1EA2A 5CK6A 2CW9A 1X1XA 2CFKA 1UDII 1NWWA 4EBGA 1TRPA 1IV9A 1QAKA 2CG1A 3PCSA 1BAOA 2BMRB 1RN1A 3BB9A 3PYJA 1IV7A 3CCM3 1O7PB 2R4IA 4BL2A 1BANA 3DMCA 3FG3A 4BIRA 1BRGA 1IVVA 4GSPA 3EJVA 4WP5A 2WO0A 3ZG5A 4WWUC 3SOAA 4O3VA 1RGFA 1Q824 4HM3B 1UCJA 4KFDA 1C54A 1MWTA 1M1XB 4HJLB 1I2FA 2H0GA 3ECFA 3ER7A 1BRSA 3DZLA 3NBBA 5IW9A 3CC73 1I2EA 1FUSA 3FH1A 3AGNA 4EV2A 5IF6A 1OHOA 2W9PA 1O7GB 1RMSA 1ROVA 2GXFA 2WGQA 3SEDA 1BRIA 1FGRA 1RKYA 3T0UA 4X2HA 3T8UA 3PS8A 3WA3A 5AIIA 4HOHA 1CEWI 1TU5A 4RZMA 1BNGA 1LXEA 4N6UA 2E2VA 4RNYA 2ZDJA 3F7SA 1JJ22 3S27A 2CH9A 4EV5A 1V57A 1SIHA 5KP3A 4HM6B 2ML5A 3NBJA 4I5QA 5FGOA 2HOHA 3BIRA 1X1UA 1JN5A 1I70A 1BNEA 3FG4A 3HIIA 2MC8A 1BNSA 1D6UA 3OXAA 4EYCA 2AADA 4FCJA 5G1LA 1MGRA 3NQZA 1CQSA 2P0XA 4LMIA 1Q7HA 4TX4A 1OHPA 3JUOA 1DMQA 4NREA 7GSPA 3BNBA 1EEJA 1D6YA 3RNTA 3F14A 4I4KA 3QK9A 3WODG 1LNIA 3ZFZA 1RNBA 1SPUA 3MPHA 1JN5B 1K8A4 4GL6A 1EKMA 3K63A 1RGKA 3OWUA 2FNQA 2BIRA 4OK0A 2CK3H 3QRDA 2OOVC 4HM0B 3CCL3 3I553 2B24B 2OOVA 3CCJ3 1W5ZA 2H0IA 2F99A 1VQ43 1W6YA 4DKIA 1M1K4 1HKXA 1T2HA 1IYYA 1RHLA 1UW1A 3GWRA 3D9RA 2Q07A 4R1KA 1VQ53 1BRJA 1TUHA 2UUGC 3B4OA 1EQKA 2IY2A 1Q40A 1RGHA 1E97A 1F8NA 3MSOA 2OTJ3 3CCR3 1EG9B 2CKFB 1TJDA 1IVWA 1K41A 5AI1A 6RNTA 1IQXA 1RGLA 1KD14 4H61A 1DE3A 1JBSA 3X3YA 3N54B 5JBSA 3H51A 3S28A 1SARA 1B2XA 2GU1A 2J8XB 3B8LA 1N8R4 2IMJA 4J5KA 1FGMA 2BT3A 5BU4A 1YVSA 2BNGA 3B7CA 3D5GA 5IG5A 4R9KA 1O7WB 1CYVA 5KP1A 1BSAA 2BHMA 2JQ5A 3ROBA 3J7Yd 1V58A 2BU4A 1Q40B 3PCRA 4BTWA 3CD63 1SQWA 3L0RA 1LOWA 4OUQA 1QJGA 2HMLB 1NO3A 1ULIB 1K28A 1BSBA 3IMAB 2CFGA 2GSPA 1JKGA 1PYLA 3SOYA 1VQ83 1VQ63 4N6NB 1VQ73 1JV2B 3Q3FA 3WOEB 3RGAA 9RNTA 5JPPA 1FGTA 2HMNB 3PGBA 5M19A 1DETA 1B2MA 4CCVA 1RTUA 3DM8A 3FSDA 1IVXA 1JB2A 4L8OA 1AV4A 4HBRA 4EXRA 4O2HA 1IQYA 4MEIA 2CC3A 1RGEA 2GEXA 1Q814 1TP6A 1A2PA 4HM1B 1JKGB 1MWUA 4FMAA 2P0MA 4HYZA 4Q53A 2KAAA 2WOHA 2XSOB 3MG1A 5CLKA 1ULJB 5D81A 2RFRA 3DGMA 4NPBA 5BVBA 3MWZA 2XEPA 3EN1B 1W00A 3NHXA 5DREA 2D1WA 3NUVA 3MYTA 5EEOA 4WYKA 2PNCA 3DH2A 1L5GB 1LNHA 3D79A 2OWPA
chains in the Genus database with same CATH topology
1N9EA 3WDGB 3DGLA 1ZX2A 7STDA 2BO9B 2BMQB 3CCE3 1W6GA 5IEPA 2CHCA 2WOFA 4N6MA 4XBXA 3NXJA 1VQM3 2WGOA 1QVG2 3HK4A 2XF3A 4CDLA 4WYKB 1OHSA 1Q42A 3K9MC 1GY7A 3NM2A 5EQLA 3VSYA 4X2OA 3FF2A 5AEWB 1R4CA 1W7CA 2P05A 3CCS3 3D3LA 2IUKA 4H3UA 3LTDA 4G1MB 4AEQA 5IENA 1OGZA 1VQK3 1YJN3 4JRFA 2IA7A 1A2KA 4HZ9B 1ZO2A 1DMMA 3S5CA 4XBTA 3AMOA 2BMOB 1G96A 4N6TA 3S29A 3X42A 1A90A 5D83A 2Z76A 3F7XA 4NHFA 3Q90A 4FMDA 3HZPA 4R80A 4ZM8A 3F9SA 5AIHA 3LT9A 3GZBA 4J9AA 3U97A 4IPBA 5G2GA 4N6LA 4WFOA 3CCU3 1U8CB 1YVBI 2CFDA 4KFEA 3AMOB 2L4VA 3WA2X 3FG1A 4LSOA 5LC7A 4HM4B 1OF5A 3OX9A 4R4KA 1JB4A 5LC6A 2O9UX 2C11A 5AEUB 5KP4A 4HM8B 2FXTA 1NU3A 3CCQ3 4XDWA 1OUNA 4RNZA 3GRDA 3PXMA 3BNEA 3JUQA 1E3VA 1JNQA 3S67A 1WTHA 2V1LA 4LZIA 1LVNA 4ORLA 1BUQA 2JDIH 5STDA 1OPYA 3DGNA 3FF0A 3K5TA 1E3RA 3X3XA 1WMPA 1IQ8A 1IT8A 4XBYA 5AYSC 1DVCA 1NJI4 3EB8A 1M904 4J8TA 4HM7B 1VQ93 3I563 1VQN3 1CYUA 3A76A 3N9HA 1KC84 3CMA3 2LQVA 1FUWA 5ELUA 1W01A 2Z6BA 3ALAA 2XFTA 1YHQ3 1STFI 1AR0A 3U1WA 4XDVA 3CCV3 1ASKA 1PU4A 4U13A 3FGYA 3LYGA 4RBNA 3CME3 1K734 1O7MB 3LOYA 3N8BA 1DMNA 3KZTA 3NM7A 3FZWA 1QMAA 2QEX3 2D42A 3MG2A 1YJ93 5I97A 2W03A 3NX0A 3SVAA 3VF1A 3JUPA 4FR9A 1T5YA 4N3VA 4KVHA 1HU9A 1WMOA 3BNCA 1VQP3 2CWUA 3EX9A 4BTXA 5TGNA 1NB5I 4KZ1A 2KCDA 3VGNA 1FGQA 3GAXA 2GBXB 1O7HB 4IIAA 4HVNA 1YIJ3 3LZAA 3TDGA 1W2ZA 3F40A 1IU7A 2OTL3 3GZXB 4K1UA 4HZBB 1YI23 5AYRB 5IERA 3G16A 4IT7A 1O7NB 2HMKB 3CC23 4MJDA 4O02B 2XFSA 3H3HA 3BLZA 3UJMA 3Q2PA 3KE7A 3UL5A 1N5HA 1UUWB 4XM4A 5CXOA 1IDPA 2CFWA 3IJEB 2CWTA 3EHCA 3UL6A 3KSPA 5BXQA 3O8YA 1QALA 3G4S3 4GB5A 1DYUA 2OCTA 4KFFA 1W02A 4N6V0 3LH4A 5A0OB 2KXGA 2XSHB 5FW5A 1LOXA 3CXC2 1OCVA 3I0YA 4K90B 1Z1SA 3F8XA 2GU3A 5HGRA 3MG3A 5CF2A 1GS3A 1PFPA 1W4NA 2KRTA 3LT8A 3WOFB 4LGQA 1AVLA 2GEYA 3K7CA 5IG4A 3X40A 6STDA 1UI7A 4FMCA 2W56A 2YFJB 2LYXA 1KWIA 3MKIA 4MMXB 1DVDA 3LXUX 1K9M4 1D6ZA 2INXA 3NV0A 2HMJB 3FLJA 3X3ZA 3SX1A 1IT7A 1FA3A 3HIGA 2F86B 3FCSB 4AKYA 1Y4KA 4WHAA 8CHOA 1C7HA 1J2BA 1UI8A 4LEHA 3CU3A 4K1VA 4FCMA 1MOLA 2W56B 1WMNA 3KKGA 3KFQC 2W6JH 3NQYA 1YGEA 4L8PA 1N9JA 2CIUA 3NV0B 1UUVB 4AKZA 2UX0A 3KSED 1ISKA 2XGNA 4HM2B 3LTBA 2QA43 2B1XB 3CPOA 3JUNA 1IVUA 2PZVA 2Z77A 3OW22 1KSIA 4QWTA 2QIYA 1OF5B 2YFLB 3B4PA 3DGOA 1SIIA 2P38A 3OWSA 3T8NA 3OV4A 4FMBA 2STDA 1NB3I 1STDA 3LTCA 2Z7AA 2O3OA 1YIT3 5JPUA 3E99A 3WMDA 2GBWB 2HMOB 3KN4A 3NBRA 3KIIA 1W6CA 1GD3A 3DY5A 3RDEA 1A67A 2MF7A 3OWYA 2W04A 1RRHA 1GD4A 4PEJA 3F8HA 3G6E3 1TFOA 4BTYA 5ELJA 2A15A 1S723 1RRLA 5CF1A 1A2VA 4XB5A 2OQEC 2YFIB 3BNDA 4K61A 4N6OB 1IK3A 1N8QA 2OQEA 1GY5A 5IG3A 3HX8A 2ZL8A 1QAFA 1U5OA 3EQQB 4MMZB 1US1A 1AVKA 2I9WA 3RGRA 2P09A 3FKAA 4HM5B 2FGTA 2CG0A 4R9LA 3IPTA 1OACA 3DUKA 2RSXA 3UNLA 3EF8A 1ROAA 1VQL3 1SJWA 2W0QA 3EBYA 3Q1CA 3UB1A 2QGUA 3PZWA 2E2UA 2Y73A 2E2TA 3CPW2 2CWVA 2YX9A 1GY6A 3G8ZA 2CFLA 1M9GA 1RJOA 5DRVA 1TIJA 3MHEA 4MMYB 2HMMB 3V98A 1QVF2 2K54A 3DXOA 1MNLA 3M8CA 3SLUA 3STDA 2XH9A 4L7KA 1Q864 2SBLA 4FCZA 1TFKA 3EBTA 2K0MA 1VQO3 1S5AA 3G713 5IEOA 3JUMA 1JRQA 2F98A 2W9QA 3K0ZA 3EN8A 4HKVB 4JF8A 1W2B2 4O8SA 2Y74A 3V92A 5EVHA 1RN7A 2C10A 5D82A 3LTAA 2RGQA 2XGLA 3LMLA 1V74A 2XRXB 4OVMA 3SXXA 3GZRA 1NDOB 4STDA 3GZYB 1Q7Y4 2M7OA 2W2CA 2XR8B 3JVCA 3HI7A 1GYBA 2RCDA 5AIFA 3X41A 1VZZA 1FGOA 5IG0A 3CNXA 2ML6A 2IUJA 4EC6A 5AIGA 3V99A 1N5PA 1OGXA 1JB5A 3CNMA 1WNHA 3EE1A 1KQS2 3CC43 3G0KA 1OH0A 1WQLB 3EC9A 1EA2A 5CK6A 2CW9A 2CFKA 1NWWA 4EBGA 1IV9A 1QAKA 2CG1A 3PCSA 2BMRB 3PYJA 3BB9A 1IV7A 3CCM3 1O7PB 2R4IA 3FG3A 3DMCA 1IVVA 4WP5A 3EJVA 2WO0A 4WWUC 3SOAA 4O3VA 1Q824 4HM3B 4KFDA 1M1XB 4HJLB 3ECFA 3ER7A 3DZLA 3NBBA 5IW9A 3CC73 3FH1A 5IF6A 4EV2A 1OHOA 2W9PA 1O7GB 1ROVA 2GXFA 2WGQA 3SEDA 1FGRA 1RKYA 3T0UA 4X2HA 3T8UA 3PS8A 3WA3A 5AIIA 1CEWI 1TU5A 4RZMA 1LXEA 4N6UA 2E2VA 4RNYA 2ZDJA 3F7SA 1JJ22 3S27A 2CH9A 4EV5A 1SIHA 5KP3A 4HM6B 2ML5A 3NBJA 5FGOA 1JN5A 3FG4A 3HIIA 2MC8A 1D6UA 3OXAA 4EYCA 4FCJA 3NQZA 4LMIA 1CQSA 2P0XA 4TX4A 1OHPA 3JUOA 1DMQA 4NREA 3BNBA 1D6YA 3F14A 4I4KA 3QK9A 3WODG 1SPUA 3MPHA 1JN5B 1K8A4 4GL6A 1EKMA 3K63A 3OWUA 2FNQA 4OK0A 2CK3H 3QRDA 2OOVC 4HM0B 3CCL3 3I553 2B24B 2OOVA 3CCJ3 1W5ZA 2F99A 1W6YA 1M1K4 1HKXA 1UW1A 3GWRA 3D9RA 2Q07A 4R1KA 1VQ53 1TUHA 3B4OA 1EQKA 1Q40A 2OTJ3 1E97A 1F8NA 3MSOA 3CCR3 1EG9B 2CKFB 1IVWA 1K41A 5AI1A 1KD14 1IQXA 4H61A 3X3YA 3N54B 5JBSA 3H51A 3S28A 2GU1A 3B8LA 1N8R4 2IMJA 1FGMA 2BT3A 2BNGA 3B7CA 5IG5A 5KP1A 4R9KA 1O7WB 1CYVA 3J7Yd 1YJW3 2BHMA 2JQ5A 3ROBA 1VQ43 3CD63 3PCRA 1Q40B 4BTWA 1SQWA 3L0RA 4OUQA 1QJGA 2HMLB 1NO3A 1ULIB 1K28A 3IMAB 1VQ83 2CFGA 3SOYA 1JKGA 1VQ63 4N6NB 1VQ73 1JV2B 3WOEB 3RGAA 5JPPA 1FGTA 2HMNB 3PGBA 4CCVA 3DM8A 3FSDA 1IVXA 1JB2A 4L8OA 1AV4A 4HBRA 4EXRA 4O2HA 1IQYA 4MEIA 2CC3A 1Q814 2GEXA 1TP6A 4HM1B 1JKGB 4FMAA 2P0MA 4HYZA 4Q53A 2WOHA 2XSOB 3MG1A 5CLKA 1ULJB 5D81A 2RFRA 3DGMA 5BVBA 3MWZA 2XEPA 3EN1B 1W00A 3NHXA 5DREA 2D1WA 3NUVA 3MYTA 5EEOA 4WYKA 2PNCA 1L5GB 1LNHA 2OWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZX2 A;  7STD A;  2BMQ B;  5IEP A;  2CHC A;  4XBX A;  3NXJ A;  3HK4 A;  4CDL A;  4WYK B;  1OHS A;  1Q42 A;  1GY7 A;  3NM2 A;  3VSY A;  4X2O A;  3FF2 A;  5AEW B;  4H3U A;  5IEN A;  1OGZ A;  4HZ9 B;  1A2K A;  1ZO2 A;  1DMM A;  3S5C A;  4XBT A;  2BMO B;  5D83 A;  2Z76 A;  3F7X A;  3Q90 A;  3HZP A;  3F9S A;  5AIH A;  3GZB A;  4J9A A;  5G2G A;  4HM4 B;  1OF5 A;  3OX9 A;  1JB4 A;  5AEU B;  5KP4 A;  4HM8 B;  1NU3 A;  4XDW A;  1OUN A;  3GRD A;  3JUQ A;  1E3V A;  4ORL A;  1BUQ A;  5STD A;  1OPY A;  3FF0 A;  1E3R A;  4XBY A;  4J8T A;  4HM7 B;  3A76 A;  1W01 A;  1AR0 A;  4XDV A;  1ASK A;  4U13 A;  3FGY A;  3LYG A;  1O7M B;  1DMN A;  3KZT A;  3FZW A;  1QMA A;  3MG2 A;  3JUP A;  4N3V A;  4KVH A;  3EX9 A;  5TGN A;  3VGN A;  2GBX B;  1O7H B;  4IIA A;  4HVN A;  3LZA A;  3F40 A;  3GZX B;  4K1U A;  4HZB B;  5IER A;  3G16 A;  1O7N B;  2HMK B;  4MJD A;  3H3H A;  3BLZ A;  3UJM A;  3KE7 A;  1UUW B;  4XM4 A;  5CXO A;  1IDP A;  3EHC A;  3KSP A;  5BXQ A;  4GB5 A;  1W02 A;  2XSH B;  5FW5 A;  1OCV A;  3I0Y A;  1Z1S A;  3F8X A;  5HGR A;  3MG3 A;  5CF2 A;  1GS3 A;  4LGQ A;  2GEY A;  3K7C A;  5IG4 A;  6STD A;  2YFJ B;  3MKI A;  2INX A;  3NV0 A;  2HMJ B;  3FLJ A;  2F86 B;  8CHO A;  1C7H A;  4LEH A;  3CU3 A;  4K1V A;  4FCM A;  3KKG A;  4L8P A;  3NV0 B;  1UUV B;  2UX0 A;  1ISK A;  4HM2 B;  2B1X B;  3CPO A;  3JUN A;  2PZV A;  2Z77 A;  2QIY A;  1OF5 B;  2YFL B;  3B4P A;  3T8N A;  3OWS A;  3OV4 A;  2STD A;  1STD A;  2Z7A A;  5JPU A;  3E99 A;  3WMD A;  2GBW B;  2HMO B;  3NBR A;  3OWY A;  4PEJ A;  3F8H A;  2A15 A;  5CF1 A;  4XB5 A;  2YFI B;  1GY5 A;  5IG3 A;  3HX8 A;  3EQQ B;  1U5O A;  2I9W A;  3RGR A;  3FKA A;  4HM5 B;  4R9L A;  3IPT A;  3DUK A;  3UNL A;  3EF8 A;  1SJW A;  3EBY A;  2QGU A;  1GY6 A;  3G8Z A;  5DRV A;  3MHE A;  2HMM B;  2K54 A;  3DXO A;  3M8C A;  3STD A;  4L7K A;  3EBT A;  1S5A A;  5IEO A;  3JUM A;  3K0Z A;  2F98 A;  4HKV B;  3EN8 A;  5EVH A;  5D82 A;  2RGQ A;  4OVM A;  2XRX B;  3GZR A;  1NDO B;  4STD A;  3GZY B;  2W2C A;  2XR8 B;  1GYB A;  2RCD A;  5AIF A;  1VZZ A;  5IG0 A;  3CNX A;  5AIG A;  1OGX A;  1JB5 A;  3CNM A;  3G0K A;  1OH0 A;  1WQL B;  3EC9 A;  1EA2 A;  5CK6 A;  1NWW A;  2BMR B;  3BB9 A;  1O7P B;  2R4I A;  3DMC A;  4WP5 A;  3EJV A;  4WWU C;  3SOA A;  4HM3 B;  4HJL B;  3ECF A;  3ER7 A;  3DZL A;  3FH1 A;  5IF6 A;  1OHO A;  1O7G B;  2GXF A;  3SED A;  4X2H A;  3T8U A;  5AII A;  4RZM A;  3F7S A;  5KP3 A;  4HM6 B;  1JN5 A;  3OXA A;  4FCJ A;  4LMI A;  1CQS A;  1OHP A;  3JUO A;  1DMQ A;  3F14 A;  4I4K A;  1JN5 B;  3OWU A;  4HM0 B;  2B24 B;  2F99 A;  1W6Y A;  1HKX A;  3GWR A;  3D9R A;  4R1K A;  1TUH A;  3B4O A;  1Q40 A;  1E97 A;  3MSO A;  1EG9 B;  2CKF B;  5AI1 A;  1K41 A;  3H51 A;  3B8L A;  2IMJ A;  2BNG A;  3B7C A;  5IG5 A;  5KP1 A;  4R9K A;  1O7W B;  2JQ5 A;  3ROB A;  1Q40 B;  4OUQ A;  1QJG A;  2HML B;  1ULI B;  3SOY A;  1JKG A;  3RGA A;  5JPP A;  2HMN B;  3DM8 A;  3FSD A;  1JB2 A;  4L8O A;  2GEX A;  1TP6 A;  4HM1 B;  1JKG B;  4Q53 A;  2XSO B;  3MG1 A;  5CLK A;  1ULJ B;  5D81 A;  2RFR A;  5BVB A;  3EN1 B;  1W00 A;  3NHX A;  5DRE A;  3NUV A;  3MYT A;  4WYK A;  2OWP A; 
#chains in the Genus database with same CATH topology
 2R41 A;  1N9E A;  3WDG B;  2IYJ A;  1RGA A;  3DGL A;  1ZX2 A;  5M18 A;  7STD A;  3SYU A;  2BO9 B;  2BMQ B;  3CCE 3;  1W6G A;  5IEP A;  2K3D A;  1LQG C;  2CHC A;  7RNT A;  2WOF A;  4N6M A;  4XBX A;  3NXJ A;  1VQM 3;  2WGO A;  1RNT A;  1UCK A;  1QVG 2;  3HK4 A;  2XF3 A;  4CDL A;  4WYK B;  1OHS A;  3AHS A;  1Q42 A;  3K9M C;  1GY7 A;  3NM2 A;  5EQL A;  3VSY A;  4X2O A;  1I0X A;  1UCL A;  3FF2 A;  5AEW B;  4RNT A;  1R4C A;  1W7C A;  2P05 A;  3CCS 3;  3D3L A;  2IUK A;  4H3U A;  3LTD A;  4G1M B;  4AEQ A;  5IEN A;  1OGZ A;  2CX1 A;  1VQK 3;  1YJN 3;  3D5I A;  4JRF A;  2IA7 A;  1A2K A;  4HZ9 B;  1B3S A;  1ZO2 A;  1DMM A;  3S5C A;  1RDS A;  3AMO A;  4XBT A;  2C4B A;  2BMO B;  1UGH I;  1G96 A;  4N6T A;  4HAA A;  3S29 A;  3X42 A;  5D83 A;  2Z76 A;  1A90 A;  1LRA A;  3F7X A;  4NHF A;  3Q90 A;  4FMD A;  3HZP A;  4R80 A;  4ZM8 A;  1B21 A;  1ZGX A;  3F9S A;  1AQZ A;  3LT9 A;  5AIH A;  3GZB A;  4J9A A;  3U97 A;  4IPB A;  5G2G A;  3BU4 A;  4N6L A;  4WFO A;  3AGO A;  1BNI A;  3CCU 3;  1U8C B;  1YVB I;  1X1W A;  2CFD A;  4KFE A;  3AMO B;  2L4V A;  1RCK A;  3FG1 A;  3WA2 X;  4LSO A;  5LC7 A;  4HM4 B;  1OF5 A;  3OX9 A;  5G1K A;  4R4K A;  1JB4 A;  5LC6 A;  1BIR A;  1BOX A;  5RNT A;  2O9U X;  3WHO A;  2C11 A;  5AEU B;  5KP4 A;  4HM8 B;  2FXT A;  2CX0 A;  1NU3 A;  3CCQ 3;  1RLS A;  4XDW A;  5M1A A;  1OUN A;  4RNZ A;  3GRD A;  3PXM A;  3BNE A;  3JUQ A;  5GSP A;  1E3V A;  1JNQ A;  3S67 A;  1WTH A;  2V1L A;  4LZI A;  1LVN A;  4ORL A;  8RNT A;  1BUQ A;  2JDI H;  5STD A;  1OPY A;  3DGN A;  1UGI A;  3FF0 A;  3K5T A;  2AAE A;  1E3R A;  2UGI A;  1BSE A;  3X3X A;  1WMP A;  1IQ8 A;  1IT8 A;  4XBY A;  5AYS C;  1DVC A;  1NJI 4;  3EB8 A;  1M90 4;  4J8T A;  4HM7 B;  4KT3 B;  3I56 3;  1VQ9 3;  1VQN 3;  1CYU A;  3A76 A;  1B27 A;  3N9H A;  1KC8 4;  1CH0 A;  2LQV A;  3CMA 3;  1FUW A;  3A5E A;  5ELU A;  1W01 A;  2Z6B A;  2XFT A;  3ALA A;  1YHQ 3;  1STF I;  1AR0 A;  1B2S A;  3U1W A;  4XDV A;  3CCV 3;  1ASK A;  1PU4 A;  4U13 A;  3FGY A;  3LYG A;  4RBN A;  3CME 3;  1K73 4;  1O7M B;  1UCI A;  3LOY A;  3N8B A;  1DMN A;  3KZT A;  3NM7 A;  4LYL B;  3FZW A;  1T3B A;  1QMA A;  2QEX 3;  2D42 A;  3MG2 A;  1YJ9 3;  5I97 A;  2W03 A;  3NX0 A;  3SVA A;  1I3F A;  1GSP A;  3JUP A;  3VF1 A;  4FR9 A;  1T5Y A;  3KCH A;  4N3V A;  4KVH A;  1HU9 A;  1WMO A;  3BNC A;  1VQP 3;  2KF5 A;  2CWU A;  3EX9 A;  4BTX A;  5TGN A;  1NB5 I;  4KZ1 A;  2KCD A;  3VGN A;  2L1S A;  3GSP A;  1I8V A;  1FGQ A;  3GAX A;  2GBX B;  4CPK A;  1O7H B;  4IIA A;  4HVN A;  1YIJ 3;  3LZA A;  6GSP A;  3TDG A;  1B20 A;  1BNR A;  1W2Z A;  3F40 A;  1IU7 A;  2OTL 3;  3GZX B;  4K1U A;  4HZB B;  1YI2 3;  1VQQ A;  5AYR B;  5IER A;  1RGG A;  3G16 A;  4IT7 A;  1O7N B;  2HMK B;  3CC2 3;  4MJD A;  4O02 B;  3DGY A;  2SAR A;  2XFS A;  3H3H A;  3BLZ A;  3UJM A;  3Q2P A;  3KE7 A;  3UL5 A;  1YNV X;  1N5H A;  1UUW B;  4XM4 A;  5CXO A;  1UUG B;  1IDP A;  2ZA4 A;  2ZHX B;  2CFW A;  3IJE B;  1GOU A;  2CWT A;  1X1Y A;  3EHC A;  3UL6 A;  1FZU A;  3KSP A;  5BXQ A;  1JZO A;  1MGW A;  3O8Y A;  1QAL A;  3G4S 3;  1FW7 A;  1GMP A;  4GB5 A;  1DYU A;  2OCT A;  4KFF A;  1W02 A;  1RSN A;  4N6V 0;  3LH4 A;  5A0O B;  2KXG A;  2KF3 A;  2XSH B;  5FW5 A;  1LOX A;  3CXC 2;  4CJN A;  1LOV A;  1OCV A;  1GOV A;  3I0Y A;  4K90 B;  1Z1S A;  3F8X A;  2GU3 A;  1RGC A;  3MG3 A;  5HGR A;  1GS3 A;  1I2G A;  1PFP A;  1W4N A;  2F4Y A;  2KRT A;  5CF2 A;  3LT8 A;  3WOF B;  2F5M A;  4LGQ A;  1AVL A;  1R4Y A;  2GEY A;  3K7C A;  5IG4 A;  3X40 A;  6STD A;  1UI7 A;  4FMC A;  1G0T A;  1HZ1 A;  2W56 A;  2RNT A;  2YFJ B;  2LYX A;  1KWI A;  3MKI A;  4MMX B;  1DVD A;  3LXU X;  1K9M 4;  1D6Z A;  2INX A;  3NV0 A;  2HMJ B;  1BGS A;  1GMQ A;  3FLJ A;  3X3Z A;  3SX1 A;  1IT7 A;  1FA3 A;  3HIG A;  2F86 B;  3FCS B;  4AKY A;  1Y4K A;  1B2Z A;  4WHA A;  8CHO A;  1ZS7 A;  1C7H A;  1J2B A;  1PY3 A;  1UI8 A;  4LEH A;  3CU3 A;  4K1V A;  4FCM A;  1MOL A;  2W56 B;  1WMN A;  3KKG A;  3KFQ C;  2RBI A;  2W6J H;  3NQY A;  1YGE A;  1RCL A;  4L8P A;  1N9J A;  2CIU A;  3NV0 B;  1BNJ A;  1UUV B;  3HOH A;  4J5G A;  4AKZ A;  2UX0 A;  3KSE D;  4GHO A;  1ISK A;  2XGN A;  4HM2 B;  3LTB A;  2QA4 3;  1JBR A;  2B1X B;  3CPO A;  1EUI C;  1LQM B;  3JUN A;  1IVU A;  2PZV A;  2Z77 A;  3OW2 2;  1YJW 3;  1KSI A;  4QWT A;  2QIY A;  1OF5 B;  2YFL B;  3B4P A;  3DGO A;  1SII A;  2P38 A;  3OWS A;  3T8N A;  4EW5 A;  1HYF A;  3OV4 A;  4FMB A;  2STD A;  1NB3 I;  1STD A;  3LTC A;  2Z7A A;  3WR2 A;  2O3O A;  1YIT 3;  1GOY A;  1LOY A;  3E99 A;  5JPU A;  3WMD A;  1BRK A;  2GBW B;  2HMO B;  3KN4 A;  3NBR A;  3KII A;  1W6C A;  1GD3 A;  1MWS A;  3DY5 A;  3RDE A;  1A67 A;  1BUJ A;  2MF7 A;  3OWY A;  2F56 A;  2W04 A;  1RRH A;  1GD4 A;  4PEJ A;  1BSC A;  3F8H A;  4ILF A;  3D4A A;  3G6E 3;  1TFO A;  4BTY A;  5ELJ A;  2A15 A;  1S72 3;  1BRN L;  1RRL A;  5CF1 A;  1A2V A;  4XB5 A;  2OQE C;  1RN4 A;  2YFI B;  3BND A;  4K61 A;  4N6O B;  1IK3 A;  1N8Q A;  2OQE A;  1GY5 A;  3ZG0 A;  5IG3 A;  3HX8 A;  2ZL8 A;  1QAF A;  1U5O A;  3EQQ B;  4MMZ B;  1US1 A;  1AVK A;  4BU4 A;  2I9W A;  3RGR A;  2P09 A;  3FKA A;  4HM5 B;  1AY7 A;  2FGT A;  2CG0 A;  4BL3 A;  4R9L A;  3IPT A;  1Q9E A;  1OAC A;  5BIR A;  5HOH A;  1I3I A;  1JBT A;  3DUK A;  2RSX A;  2F5W A;  3UNL A;  1MWR A;  3EF8 A;  1JZD A;  1ROA A;  1BNF A;  1VQL 3;  1SJW A;  2W0Q A;  1I0V A;  3EBY A;  3Q1C A;  3UB1 A;  2QGU A;  2KF6 A;  3PZW A;  2E2U A;  2Y73 A;  2E2T A;  3CPW 2;  2CWV A;  2YX9 A;  1G02 A;  1GY6 A;  3G8Z A;  2CFL A;  1M9G A;  1RJO A;  5DRV A;  1T2I A;  1TIJ A;  3MHE A;  2HMM B;  4MMY B;  3V98 A;  1QVF 2;  2K54 A;  3DXO A;  1MNL A;  3M8C A;  1YGW A;  3SLU A;  3STD A;  2XH9 A;  4L7K A;  1Q86 4;  2SBL A;  4FCZ A;  1GMR A;  1TFK A;  3EBT A;  2K0M A;  1VQO 3;  1S5A A;  3G71 3;  5IEO A;  3JUM A;  1JRQ A;  2F98 A;  2W9Q A;  3K0Z A;  1FUT A;  3EN8 A;  4HKV B;  1TTO A;  4JF8 A;  4O8S A;  1W2B 2;  2Y74 A;  3V92 A;  5EVH A;  1RN7 A;  2C10 A;  1NNV A;  5D82 A;  3LTA A;  2KF4 A;  2RGQ A;  2XGL A;  3LML A;  1V74 A;  2XRX B;  4OVM A;  3SXX A;  1BVI A;  1NDO B;  3GZR A;  4STD A;  3GZY B;  1Q7Y 4;  1BSD A;  2M7O A;  2W2C A;  2XR8 B;  3JVC A;  3URP A;  3HI7 A;  1GYB A;  2RCD A;  5AIF A;  3X41 A;  1VZZ A;  1FGO A;  5IG0 A;  3CNX A;  1B2U A;  1FYS A;  2ML6 A;  2H0H A;  2IUJ A;  4EC6 A;  1BU4 A;  1TRQ A;  5AIG A;  3V99 A;  1N5P A;  1OGX A;  3AHW A;  1JB5 A;  3CNM A;  1WNH A;  1BRH A;  3EE1 A;  1KQS 2;  3CC4 3;  3G0K A;  1OH0 A;  1WQL B;  3EC9 A;  1EA2 A;  5CK6 A;  2CW9 A;  1X1X A;  2CFK A;  1UDI I;  1NWW A;  4EBG A;  1TRP A;  1IV9 A;  1QAK A;  2CG1 A;  3PCS A;  1BAO A;  2BMR B;  1RN1 A;  3BB9 A;  3PYJ A;  1IV7 A;  3CCM 3;  1O7P B;  2R4I A;  4BL2 A;  1BAN A;  3DMC A;  3FG3 A;  4BIR A;  1BRG A;  1IVV A;  4GSP A;  3EJV A;  4WP5 A;  2WO0 A;  3ZG5 A;  4WWU C;  3SOA A;  4O3V A;  1RGF A;  1Q82 4;  4HM3 B;  1UCJ A;  4KFD A;  1C54 A;  1MWT A;  1M1X B;  4HJL B;  1I2F A;  2H0G A;  3ECF A;  3ER7 A;  1BRS A;  3DZL A;  3NBB A;  5IW9 A;  3CC7 3;  1I2E A;  1FUS A;  3FH1 A;  3AGN A;  4EV2 A;  5IF6 A;  1OHO A;  2W9P A;  1O7G B;  1RMS A;  1ROV A;  2GXF A;  2WGQ A;  3SED A;  1BRI A;  1FGR A;  1RKY A;  3T0U A;  4X2H A;  3T8U A;  3PS8 A;  3WA3 A;  5AII A;  4HOH A;  1CEW I;  1TU5 A;  4RZM A;  1BNG A;  1LXE A;  4N6U A;  2E2V A;  4RNY A;  2ZDJ A;  3F7S A;  1JJ2 2;  3S27 A;  2CH9 A;  4EV5 A;  1V57 A;  1SIH A;  5KP3 A;  4HM6 B;  2ML5 A;  3NBJ A;  4I5Q A;  5FGO A;  2HOH A;  3BIR A;  1X1U A;  1JN5 A;  1I70 A;  1BNE A;  3FG4 A;  3HII A;  2MC8 A;  1BNS A;  1D6U A;  3OXA A;  4EYC A;  2AAD A;  4FCJ A;  5G1L A;  1MGR A;  3NQZ A;  1CQS A;  2P0X A;  4LMI A;  1Q7H A;  4TX4 A;  1OHP A;  3JUO A;  1DMQ A;  4NRE A;  7GSP A;  3BNB A;  1EEJ A;  1D6Y A;  3RNT A;  3F14 A;  4I4K A;  3QK9 A;  3WOD G;  1LNI A;  3ZFZ A;  1RNB A;  1SPU A;  3MPH A;  1JN5 B;  1K8A 4;  4GL6 A;  1EKM A;  3K63 A;  1RGK A;  3OWU A;  2FNQ A;  2BIR A;  4OK0 A;  2CK3 H;  3QRD A;  2OOV C;  4HM0 B;  3CCL 3;  3I55 3;  2B24 B;  2OOV A;  3CCJ 3;  1W5Z A;  2H0I A;  2F99 A;  1VQ4 3;  1W6Y A;  4DKI A;  1M1K 4;  1HKX A;  1T2H A;  1IYY A;  1RHL A;  1UW1 A;  3GWR A;  3D9R A;  2Q07 A;  4R1K A;  1VQ5 3;  1BRJ A;  1TUH A;  2UUG C;  3B4O A;  1EQK A;  2IY2 A;  1Q40 A;  1RGH A;  1E97 A;  1F8N A;  3MSO A;  2OTJ 3;  3CCR 3;  1EG9 B;  2CKF B;  1TJD A;  1IVW A;  1K41 A;  5AI1 A;  6RNT A;  1IQX A;  1RGL A;  1KD1 4;  4H61 A;  1DE3 A;  1JBS A;  3X3Y A;  3N54 B;  5JBS A;  3H51 A;  3S28 A;  1SAR A;  1B2X A;  2GU1 A;  2J8X B;  3B8L A;  1N8R 4;  2IMJ A;  4J5K A;  1FGM A;  2BT3 A;  5BU4 A;  1YVS A;  2BNG A;  3B7C A;  3D5G A;  5IG5 A;  4R9K A;  1O7W B;  1CYV A;  5KP1 A;  1BSA A;  2BHM A;  2JQ5 A;  3ROB A;  3J7Y d;  1V58 A;  2BU4 A;  1Q40 B;  3PCR A;  4BTW A;  3CD6 3;  1SQW A;  3L0R A;  1LOW A;  4OUQ A;  1QJG A;  2HML B;  1NO3 A;  1ULI B;  1K28 A;  1BSB A;  3IMA B;  2CFG A;  2GSP A;  1JKG A;  1PYL A;  3SOY A;  1VQ8 3;  1VQ6 3;  4N6N B;  1VQ7 3;  1JV2 B;  3Q3F A;  3WOE B;  3RGA A;  9RNT A;  5JPP A;  1FGT A;  2HMN B;  3PGB A;  5M19 A;  1DET A;  1B2M A;  4CCV A;  1RTU A;  3DM8 A;  3FSD A;  1IVX A;  1JB2 A;  4L8O A;  1AV4 A;  4HBR A;  4EXR A;  4O2H A;  1IQY A;  4MEI A;  2CC3 A;  1RGE A;  2GEX A;  1Q81 4;  1TP6 A;  1A2P A;  4HM1 B;  1JKG B;  1MWU A;  4FMA A;  2P0M A;  4HYZ A;  4Q53 A;  2KAA A;  2WOH A;  2XSO B;  3MG1 A;  5CLK A;  1ULJ B;  5D81 A;  2RFR A;  3DGM A;  4NPB A;  5BVB A;  3MWZ A;  2XEP A;  3EN1 B;  1W00 A;  3NHX A;  5DRE A;  2D1W A;  3NUV A;  3MYT A;  5EEO A;  4WYK A;  2PNC A;  3DH2 A;  1L5G B;  1LNH A;  3D79 A;  2OWP A; 
#chains in the Genus database with same CATH homology
 1N9E A;  3WDG B;  3DGL A;  1ZX2 A;  7STD A;  2BO9 B;  2BMQ B;  3CCE 3;  1W6G A;  5IEP A;  2CHC A;  2WOF A;  4N6M A;  4XBX A;  3NXJ A;  1VQM 3;  2WGO A;  1QVG 2;  3HK4 A;  2XF3 A;  4CDL A;  4WYK B;  1OHS A;  1Q42 A;  3K9M C;  1GY7 A;  3NM2 A;  5EQL A;  3VSY A;  4X2O A;  3FF2 A;  5AEW B;  1R4C A;  1W7C A;  2P05 A;  3CCS 3;  3D3L A;  2IUK A;  4H3U A;  3LTD A;  4G1M B;  4AEQ A;  5IEN A;  1OGZ A;  1VQK 3;  1YJN 3;  4JRF A;  2IA7 A;  1A2K A;  4HZ9 B;  1ZO2 A;  1DMM A;  3S5C A;  4XBT A;  3AMO A;  2BMO B;  1G96 A;  4N6T A;  3S29 A;  3X42 A;  1A90 A;  5D83 A;  2Z76 A;  3F7X A;  4NHF A;  3Q90 A;  4FMD A;  3HZP A;  4R80 A;  4ZM8 A;  3F9S A;  5AIH A;  3LT9 A;  3GZB A;  4J9A A;  3U97 A;  4IPB A;  5G2G A;  4N6L A;  4WFO A;  3CCU 3;  1U8C B;  1YVB I;  2CFD A;  4KFE A;  3AMO B;  2L4V A;  3WA2 X;  3FG1 A;  4LSO A;  5LC7 A;  4HM4 B;  1OF5 A;  3OX9 A;  4R4K A;  1JB4 A;  5LC6 A;  2O9U X;  2C11 A;  5AEU B;  5KP4 A;  4HM8 B;  2FXT A;  1NU3 A;  3CCQ 3;  4XDW A;  1OUN A;  4RNZ A;  3GRD A;  3PXM A;  3BNE A;  3JUQ A;  1E3V A;  1JNQ A;  3S67 A;  1WTH A;  2V1L A;  4LZI A;  1LVN A;  4ORL A;  1BUQ A;  2JDI H;  5STD A;  1OPY A;  3DGN A;  3FF0 A;  3K5T A;  1E3R A;  3X3X A;  1WMP A;  1IQ8 A;  1IT8 A;  4XBY A;  5AYS C;  1DVC A;  1NJI 4;  3EB8 A;  1M90 4;  4J8T A;  4HM7 B;  1VQ9 3;  3I56 3;  1VQN 3;  1CYU A;  3A76 A;  3N9H A;  1KC8 4;  3CMA 3;  2LQV A;  1FUW A;  5ELU A;  1W01 A;  2Z6B A;  3ALA A;  2XFT A;  1YHQ 3;  1STF I;  1AR0 A;  3U1W A;  4XDV A;  3CCV 3;  1ASK A;  1PU4 A;  4U13 A;  3FGY A;  3LYG A;  4RBN A;  3CME 3;  1K73 4;  1O7M B;  3LOY A;  3N8B A;  1DMN A;  3KZT A;  3NM7 A;  3FZW A;  1QMA A;  2QEX 3;  2D42 A;  3MG2 A;  1YJ9 3;  5I97 A;  2W03 A;  3NX0 A;  3SVA A;  3VF1 A;  3JUP A;  4FR9 A;  1T5Y A;  4N3V A;  4KVH A;  1HU9 A;  1WMO A;  3BNC A;  1VQP 3;  2CWU A;  3EX9 A;  4BTX A;  5TGN A;  1NB5 I;  4KZ1 A;  2KCD A;  3VGN A;  1FGQ A;  3GAX A;  2GBX B;  1O7H B;  4IIA A;  4HVN A;  1YIJ 3;  3LZA A;  3TDG A;  1W2Z A;  3F40 A;  1IU7 A;  2OTL 3;  3GZX B;  4K1U A;  4HZB B;  1YI2 3;  5AYR B;  5IER A;  3G16 A;  4IT7 A;  1O7N B;  2HMK B;  3CC2 3;  4MJD A;  4O02 B;  2XFS A;  3H3H A;  3BLZ A;  3UJM A;  3Q2P A;  3KE7 A;  3UL5 A;  1N5H A;  1UUW B;  4XM4 A;  5CXO A;  1IDP A;  2CFW A;  3IJE B;  2CWT A;  3EHC A;  3UL6 A;  3KSP A;  5BXQ A;  3O8Y A;  1QAL A;  3G4S 3;  4GB5 A;  1DYU A;  2OCT A;  4KFF A;  1W02 A;  4N6V 0;  3LH4 A;  5A0O B;  2KXG A;  2XSH B;  5FW5 A;  1LOX A;  3CXC 2;  1OCV A;  3I0Y A;  4K90 B;  1Z1S A;  3F8X A;  2GU3 A;  5HGR A;  3MG3 A;  5CF2 A;  1GS3 A;  1PFP A;  1W4N A;  2KRT A;  3LT8 A;  3WOF B;  4LGQ A;  1AVL A;  2GEY A;  3K7C A;  5IG4 A;  3X40 A;  6STD A;  1UI7 A;  4FMC A;  2W56 A;  2YFJ B;  2LYX A;  1KWI A;  3MKI A;  4MMX B;  1DVD A;  3LXU X;  1K9M 4;  1D6Z A;  2INX A;  3NV0 A;  2HMJ B;  3FLJ A;  3X3Z A;  3SX1 A;  1IT7 A;  1FA3 A;  3HIG A;  2F86 B;  3FCS B;  4AKY A;  1Y4K A;  4WHA A;  8CHO A;  1C7H A;  1J2B A;  1UI8 A;  4LEH A;  3CU3 A;  4K1V A;  4FCM A;  1MOL A;  2W56 B;  1WMN A;  3KKG A;  3KFQ C;  2W6J H;  3NQY A;  1YGE A;  4L8P A;  1N9J A;  2CIU A;  3NV0 B;  1UUV B;  4AKZ A;  2UX0 A;  3KSE D;  1ISK A;  2XGN A;  4HM2 B;  3LTB A;  2QA4 3;  2B1X B;  3CPO A;  3JUN A;  1IVU A;  2PZV A;  2Z77 A;  3OW2 2;  1KSI A;  4QWT A;  2QIY A;  1OF5 B;  2YFL B;  3B4P A;  3DGO A;  1SII A;  2P38 A;  3OWS A;  3T8N A;  3OV4 A;  4FMB A;  2STD A;  1NB3 I;  1STD A;  3LTC A;  2Z7A A;  2O3O A;  1YIT 3;  5JPU A;  3E99 A;  3WMD A;  2GBW B;  2HMO B;  3KN4 A;  3NBR A;  3KII A;  1W6C A;  1GD3 A;  3DY5 A;  3RDE A;  1A67 A;  2MF7 A;  3OWY A;  2W04 A;  1RRH A;  1GD4 A;  4PEJ A;  3F8H A;  3G6E 3;  1TFO A;  4BTY A;  5ELJ A;  2A15 A;  1S72 3;  1RRL A;  5CF1 A;  1A2V A;  4XB5 A;  2OQE C;  2YFI B;  3BND A;  4K61 A;  4N6O B;  1IK3 A;  1N8Q A;  2OQE A;  1GY5 A;  5IG3 A;  3HX8 A;  2ZL8 A;  1QAF A;  1U5O A;  3EQQ B;  4MMZ B;  1US1 A;  1AVK A;  2I9W A;  3RGR A;  2P09 A;  3FKA A;  4HM5 B;  2FGT A;  2CG0 A;  4R9L A;  3IPT A;  1OAC A;  3DUK A;  2RSX A;  3UNL A;  3EF8 A;  1ROA A;  1VQL 3;  1SJW A;  2W0Q A;  3EBY A;  3Q1C A;  3UB1 A;  2QGU A;  3PZW A;  2E2U A;  2Y73 A;  2E2T A;  3CPW 2;  2CWV A;  2YX9 A;  1GY6 A;  3G8Z A;  2CFL A;  1M9G A;  1RJO A;  5DRV A;  1TIJ A;  3MHE A;  4MMY B;  2HMM B;  3V98 A;  1QVF 2;  2K54 A;  3DXO A;  1MNL A;  3M8C A;  3SLU A;  3STD A;  2XH9 A;  4L7K A;  1Q86 4;  2SBL A;  4FCZ A;  1TFK A;  3EBT A;  2K0M A;  1VQO 3;  1S5A A;  3G71 3;  5IEO A;  3JUM A;  1JRQ A;  2F98 A;  2W9Q A;  3K0Z A;  3EN8 A;  4HKV B;  4JF8 A;  1W2B 2;  4O8S A;  2Y74 A;  3V92 A;  5EVH A;  1RN7 A;  2C10 A;  5D82 A;  3LTA A;  2RGQ A;  2XGL A;  3LML A;  1V74 A;  2XRX B;  4OVM A;  3SXX A;  3GZR A;  1NDO B;  4STD A;  3GZY B;  1Q7Y 4;  2M7O A;  2W2C A;  2XR8 B;  3JVC A;  3HI7 A;  1GYB A;  2RCD A;  5AIF A;  3X41 A;  1VZZ A;  1FGO A;  5IG0 A;  3CNX A;  2ML6 A;  2IUJ A;  4EC6 A;  5AIG A;  3V99 A;  1N5P A;  1OGX A;  1JB5 A;  3CNM A;  1WNH A;  3EE1 A;  1KQS 2;  3CC4 3;  3G0K A;  1OH0 A;  1WQL B;  3EC9 A;  1EA2 A;  5CK6 A;  2CW9 A;  2CFK A;  1NWW A;  4EBG A;  1IV9 A;  1QAK A;  2CG1 A;  3PCS A;  2BMR B;  3PYJ A;  3BB9 A;  1IV7 A;  3CCM 3;  1O7P B;  2R4I A;  3FG3 A;  3DMC A;  1IVV A;  4WP5 A;  3EJV A;  2WO0 A;  4WWU C;  3SOA A;  4O3V A;  1Q82 4;  4HM3 B;  4KFD A;  1M1X B;  4HJL B;  3ECF A;  3ER7 A;  3DZL A;  3NBB A;  5IW9 A;  3CC7 3;  3FH1 A;  5IF6 A;  4EV2 A;  1OHO A;  2W9P A;  1O7G B;  1ROV A;  2GXF A;  2WGQ A;  3SED A;  1FGR A;  1RKY A;  3T0U A;  4X2H A;  3T8U A;  3PS8 A;  3WA3 A;  5AII A;  1CEW I;  1TU5 A;  4RZM A;  1LXE A;  4N6U A;  2E2V A;  4RNY A;  2ZDJ A;  3F7S A;  1JJ2 2;  3S27 A;  2CH9 A;  4EV5 A;  1SIH A;  5KP3 A;  4HM6 B;  2ML5 A;  3NBJ A;  5FGO A;  1JN5 A;  3FG4 A;  3HII A;  2MC8 A;  1D6U A;  3OXA A;  4EYC A;  4FCJ A;  3NQZ A;  4LMI A;  1CQS A;  2P0X A;  4TX4 A;  1OHP A;  3JUO A;  1DMQ A;  4NRE A;  3BNB A;  1D6Y A;  3F14 A;  4I4K A;  3QK9 A;  3WOD G;  1SPU A;  3MPH A;  1JN5 B;  1K8A 4;  4GL6 A;  1EKM A;  3K63 A;  3OWU A;  2FNQ A;  4OK0 A;  2CK3 H;  3QRD A;  2OOV C;  4HM0 B;  3CCL 3;  3I55 3;  2B24 B;  2OOV A;  3CCJ 3;  1W5Z A;  2F99 A;  1W6Y A;  1M1K 4;  1HKX A;  1UW1 A;  3GWR A;  3D9R A;  2Q07 A;  4R1K A;  1VQ5 3;  1TUH A;  3B4O A;  1EQK A;  1Q40 A;  2OTJ 3;  1E97 A;  1F8N A;  3MSO A;  3CCR 3;  1EG9 B;  2CKF B;  1IVW A;  1K41 A;  5AI1 A;  1KD1 4;  1IQX A;  4H61 A;  3X3Y A;  3N54 B;  5JBS A;  3H51 A;  3S28 A;  2GU1 A;  3B8L A;  1N8R 4;  2IMJ A;  1FGM A;  2BT3 A;  2BNG A;  3B7C A;  5IG5 A;  5KP1 A;  4R9K A;  1O7W B;  1CYV A;  3J7Y d;  1YJW 3;  2BHM A;  2JQ5 A;  3ROB A;  1VQ4 3;  3CD6 3;  3PCR A;  1Q40 B;  4BTW A;  1SQW A;  3L0R A;  4OUQ A;  1QJG A;  2HML B;  1NO3 A;  1ULI B;  1K28 A;  3IMA B;  1VQ8 3;  2CFG A;  3SOY A;  1JKG A;  1VQ6 3;  4N6N B;  1VQ7 3;  1JV2 B;  3WOE B;  3RGA A;  5JPP A;  1FGT A;  2HMN B;  3PGB A;  4CCV A;  3DM8 A;  3FSD A;  1IVX A;  1JB2 A;  4L8O A;  1AV4 A;  4HBR A;  4EXR A;  4O2H A;  1IQY A;  4MEI A;  2CC3 A;  1Q81 4;  2GEX A;  1TP6 A;  4HM1 B;  1JKG B;  4FMA A;  2P0M A;  4HYZ A;  4Q53 A;  2WOH A;  2XSO B;  3MG1 A;  5CLK A;  1ULJ B;  5D81 A;  2RFR A;  3DGM A;  5BVB A;  3MWZ A;  2XEP A;  3EN1 B;  1W00 A;  3NHX A;  5DRE A;  2D1W A;  3NUV A;  3MYT A;  5EEO A;  4WYK A;  2PNC A;  1L5G B;  1LNH A;  2OWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...