4XDWA

Crystal structure of the l74f/m78v/i80v/l114f mutant of leh
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
145
structure length
145
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFTVVSVDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNFSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 42
structure length 145
sequence length 145
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xdwA00
1UUWB 3MYTA 1OGXA 1NDOB 4XDWA 3DMCA 2B1XB 2GXFA 3F7SA 3DXOA 1Q42A 4HM1B 3LYGA 1ASKA 5IEOA 2F86B 3F9SA 3MG1A 4PEJA 1CQSA 1DMMA 1GY6A 3NHXA 1OHOA 3UNLA 4LMIA 1OHPA 1JKGB 3OX9A 4L7KA 4ORLA 5HGRA 4OVMA 4X2HA 5D83A 5D81A 3HX8A 1DMNA 4STDA 4HKVB 3GZXB 3FF2A 1JKGA 1U5OA 5IF6A 3NV0B 3EHCA 3T8UA 1VZZA 1Q40B 3K7CA 3MHEA 1A2KA 4WYKB 3G8ZA 2BNGA 5EVHA 1E3VA 3NV0A 3JUMA 5FW5A 2UX0A 1ISKA 1OH0A 5CF2A 2HMKB 1Q40A 4HM7B 3A76A 1W00A 2I9WA 2W2CA 2K54A 3JUPA 5CK6A 3D9RA 3B4PA 3NUVA 2RGQA 3MSOA 3CNMA 3VSYA 4XBYA 1E97A 3LZAA 4HM3B 5DRVA 5KP3A 3F7XA 1STDA 3OV4A 3SOAA 4I4KA 2YFLB 3GZBA 3EQQB 2HMMB 1QMAA 1WQLB 4KVHA 2GBXB 4U13A 2STDA 5IEPA 1ZX2A 3FLJA 5IG3A 3B7CA 4HM0B 2XR8B 1S5AA 1BUQA 3NXJA 4K1UA 1TP6A 3WMDA 5CXOA 3MG2A 3T8NA 3I0YA 2XSHB 3ROBA 4XB5A 1JB2A 4HVNA 1UUVB 3H3HA 5AIIA 6STDA 5IENA 3M8CA 1JN5B 3EN8A 2XRXB 1O7HB 2Z7AA 4CDLA 5JPUA 3BLZA 5AI1A 4HM5B 4L8OA 3JUOA 5AEUB 3EN1B 1O7WB 1TUHA 1K41A 4FCJA 4MJDA 1ZO2A 8CHOA 2PZVA 3KKGA 2Z76A 1ULJB 3MG3A 2GBWB 2Z77A 3BB9A 4R1KA 3ER7A 4XBTA 5BVBA 5IG0A 3DZLA 4J9AA 3ECFA 3JUQA 4WP5A 1EG9B 1GS3A 3FF0A 4HM4B 5IERA 1EA2A 4WYKA 2CHCA 1NU3A 4HZ9B 1Z1SA 7STDA 3FGYA 4HM6B 1O7GB 5AIFA 4Q53A 2F98A 1JB4A 1W6YA 3HZPA 4HM8B 1E3RA 5DREA 3SOYA 4H3UA 2QGUA 2HMOB 1C7HA 4XM4A 3S5CA 4HM2B 1OUNA 3GRDA 2YFIB 5IG5A 1W02A 3G0KA 3FZWA 3MKIA 1OF5B 5IG4A 3F8HA 1OCVA 4XDVA 2A15A 2R4IA 3K0ZA 3STDA 2YFJB 2RFRA 2GEYA 1GY7A 3Q90A 4LEHA 4R9LA 4X2OA 4XBXA 1OGZA 5STDA 4R9KA 1QJGA 1SJWA 3KE7A 3F40A 3RGRA 1JN5A 1GY5A 4J8TA 3OWSA 1ULIB 2GEXA 3OXAA 2INXA 3KZTA 3OWYA 2XSOB 3EF8A 2HMJB 3CNXA 2BMQB 3E99A 3EX9A 3NBRA 4LGQA 3EBYA 4OUQA 3H51A 3CU3A 3EJVA 2BMOB 3DM8A 3DUKA 3B4OA 4GB5A 3F14A 1O7PB 1GYBA 2OWPA 3JUNA 1O7MB 3G16A 3OWUA 3NM2A 4K1VA 4L8PA 5CF1A 3FSDA 5JPPA 3GZYB 2HMNB 3SEDA 4IIAA 2BMRB 1OHSA 5BXQA 5KP4A 2JQ5A 2RCDA 5AIHA 2IMJA 3KSPA 5D82A 3IPTA 3B8LA 1O7NB 3CPOA 5CLKA 5TGNA 3RGAA 1AR0A 5KP1A 3FKAA 1DMQA 3GZRA 3GWRA 4FCMA 5AIGA 3EC9A 1OPYA 4WWUC 3EBTA 2F99A 5G2GA 4N3VA 2HMLB 2QIYA 4HZBB 5AEWB 3FH1A 1W01A 4RZMA 1OF5A 3F8XA 1JB5A 4HJLB 3HK4A 1NWWA 1IDPA 3UJMA 3VGNA 1HKXA 2B24B 2CKFB
chains in the Genus database with same CATH superfamily
1UUWB 1U8CB 3MYTA 1OGXA 2P05A 1NDOB 4XDWA 1MGRA 3DMCA 1WMOA 2B1XB 1BRSA 1X1YA 2GXFA 3F7SA 2BHMA 1RGGA 2WOFA 3FG3A 3DXOA 1Q42A 3CCQ3 2PNCA 4HM1B 1N5HA 1DVDA 1MOLA 3LYGA 1ASKA 1MWRA 5IEOA 3FCSB 1KQS2 3I553 1SQWA 2CWUA 2F86B 2W9QA 3F9SA 3MG1A 1M1K4 1BNRA 2CH9A 4PEJA 1CQSA 1DMMA 1GY6A 3NHXA 2XFSA 1NO3A 1OHOA 3PXMA 5EEOA 5GSPA 3UNLA 4LMIA 4MEIA 1RTUA 1F8NA 2P38A 3NM7A 1RGFA 3URPA 1X1WA 2MF7A 1OHPA 1JKGB 3JVCA 3HIGA 3OX9A 1V74A 4L7KA 4N6OB 4ORLA 1QVG2 3LTDA 5HGRA 4OVMA 3S27A 3AMOB 1DETA 2KF6A 2JDIH 5G1LA 1NJI4 3K5TA 1CEWI 1W4NA 4X2HA 1FGRA 1GMQA 5D83A 3WA3A 1B2SA 3KFQC 1B3SA 1T5YA 2CC3A 3BIRA 3HX8A 1DMNA 4STDA 5D81A 1B2MA 2P0XA 3DY5A 2XFTA 1RGHA 4HKVB 1BNJA 3GZXB 3FF2A 5BU4A 1JKGA 1RSNA 2CG1A 1S723 1U5OA 4O8SA 5IF6A 3NV0B 3EHCA 1AVLA 3AHWA 1LOWA 3T8UA 1VZZA 3AGNA 4RNYA 1Q40B 4EYCA 1NB3I 1TTOA 3K7CA 1IQXA 1RDSA 3LOYA 3MHEA 4I5QA 4BL2A 1A2KA 4KFFA 4BIRA 4HAAA 4EV2A 4WYKB 1JNQA 3G8ZA 2BNGA 4BU4A 1YIJ3 5EVHA 4FMCA 1W2B2 1K28A 1E3VA 3NV0A 1M9GA 3JUMA 2UX0A 1A2PA 1OH0A 3NBBA 5FW5A 5G1KA 5CF2A 5I97A 3CME3 2HMKB 1Q40A 4HM7B 6RNTA 1JZDA 3A76A 4ILFA 2V1LA 1W00A 1VQ63 1FGQA 2I9WA 2W2CA 4HBRA 3G6E3 2K54A 3A5EA 1RRHA 3EE1A 1I2EA 1GD3A 1RRLA 3N9HA 3JUPA 4GSPA 5CK6A 3D9RA 1NNVA 2WO0A 3B4PA 1WMNA 1B2ZA 1RN4A 1BOXA 1FUTA 1PY3A 3D3LA 3PCRA 3NUVA 1T3BA 1BU4A 1YGWA 2CFGA 2RGQA 3MSOA 1BSDA 1VQ53 1N9EA 4RNZA 1SIIA 3CNMA 4WFOA 3VSYA 4XBYA 3G713 1E97A 1EEJA 3LZAA 1CYVA 2W6JH 4HM3B 4LYLB 5DRVA 5KP3A 4BL3A 2F4YA 1US1A 2GSPA 2E2VA 3F7XA 4CPKA 1STDA 3OV4A 3ALAA 1Q7Y4 3SOAA 4I4KA 3TDGA 1YJW3 1FA3A 2YFLB 1IV9A 3GZBA 2FNQA 4J5GA 1WTHA 4WHAA 3EQQB 1G0TA 2HMMB 2P0MA 1QMAA 1WQLB 3LXUX 4RBNA 2L4VA 4KVHA 2AADA 1RCKA 4GHOA 3FG1A 1KD14 1TIJA 1W5ZA 1FUWA 1EUIC 3PCSA 1BAOA 2GBXB 4U13A 3K9MC 3V99A 2OOVA 2STDA 1W6CA 2UUGC 3DH2A 5IEPA 5FGOA 1ZX2A 3FLJA 4HOHA 3SYUA 3SXXA 1BRHA 4BTWA 1TJDA 3B7CA 5IG3A 9RNTA 1A67A 1PYLA 4HM0B 1LNIA 2P09A 2ZA4A 3ZG5A 1BNSA 2D1WA 1BRJA 3SLUA 2XR8B 1S5AA 1ROVA 3DGNA 1BUQA 3CCR3 1MNLA 3LTBA 1B2UA 3VF1A 1JBSA 2KRTA 2CIUA 3KIIA 3NXJA 2ML6A 4K1UA 1GD4A 1TP6A 4R80A 2XGLA 1B20A 3AHSA 5AYSC 3WMDA 3OW22 3ZFZA 5A0OB 4G1MB 1BSCA 5CXOA 1IK3A 1BGSA 3MG2A 2WOHA 3HOHA 3T8NA 3I0YA 1N9JA 1PFPA 2XSHB 3ROBA 1RHLA 4XB5A 1JB2A 1LXEA 2C10A 1UUVB 4HVNA 1N8R4 5AYRB 3V92A 3GAXA 1VQ43 3H3HA 1CH0A 2GU1A 5AIIA 5IW9A 6STDA 2CW9A 5IENA 1AQZA 1GOYA 2OTL3 2W03A 3DGLA 3M8CA 5BIRA 1JN5B 4N6LA 1DVCA 1W6GA 2CFLA 3UL5A 1Q814 3EN8A 2XRXB 6GSPA 3NX0A 2KF5A 1IV7A 4O3VA 3AGOA 1I3IA 2FXTA 3BNDA 1TU5A 2WGOA 4EW5A 1O7HB 1YGEA 2OCTA 2Z7AA 1LQGC 4CDLA 5JPUA 1RMSA 3BLZA 2UGIA 5AI1A 1BRIA 3DGYA 1VQM3 4HM5B 4NHFA 1VQP3 1BIRA 4L8OA 1LOVA 2O3OA 1BNEA 2AAEA 3JUOA 4JF8A 1ZGXA 5AEUB 3X3YA 2R41A 3EN1B 1O7WB 2CG0A 1UW1A 1TUHA 3I563 1K41A 4FCJA 4MJDA 1I0VA 1HZ1A 1HU9A 1L5GB 1SIHA 4IT7A 1B21A 2H0GA 4GL6A 1GMPA 3CC43 1WMPA 1ZO2A 3MPHA 1UCKA 3GSPA 3CCJ3 1CYUA 8CHOA 4FMBA 1ZS7A 3WODG 2PZVA 1D6YA 3BNCA 3KKGA 1AVKA 2Z6BA 2C11A 2CFKA 2Y73A 2Z76A 3AMOA 1ULJB 1YNVX 1FW7A 3MG3A 1UGHI 1RNTA 5M18A 3IMAB 2GBWB 2Z77A 3BB9A 2J8XB 1BRNL 2LYXA 4FR9A 4LZIA 3LH4A 4R1KA 2OQEA 1K734 2CWTA 5LC6A 4AEQA 3ER7A 1VQK3 1IYYA 1RLSA 2KF4A 4XBTA 5EQLA 2FGTA 3BU4A 5IG0A 1MWTA 5BVBA 5M19A 3CCS3 4N6UA 3DZLA 1NB5I 4J9AA 1RJOA 3ECFA 3JUQA 1RGCA 4WP5A 1G96A 3D79A 1V57A 1EG9B 1R4YA 4HYZA 1VQ83 1GS3A 1AV4A 1W2ZA 3FF0A 3BNEA 4FCZA 1YHQ3 2WGQA 4DKIA 4HM4B 1Y4KA 2ZDJA 1EA2A 5IERA 3CCM3 2OQEC 4WYKA 1LOYA 1JJ22 2CHCA 1M904 1UUGB 1V58A 1MGWA 2RSXA 1RN7A 3CCU3 2BO9B 3WOEB 1NU3A 1QVF2 4HZ9B 1DYUA 1YI23 1Z1SA 7STDA 1BSEA 1A2VA 1YVBI 2IUKA 3FGYA 3LTAA 4OK0A 1UGIA 1RGAA 1B27A 4HM6B 2F56A 1O7GB 3LTCA 5AIFA 1LQMB 1FGMA 1N8QA 4Q53A 5M1AA 1RKYA 2F98A 1RGEA 3V98A 1JB4A 1FGTA 1EKMA 1JRQA 3LT8A 1W6YA 4N6V0 3HZPA 4HM8B 1UI8A 3PZWA 1E3RA 3S67A 5DREA 7GSPA 2W56B 3SOYA 3UB1A 2H0IA 4H3UA 5RNTA 2QGUA 1UDII 4N6TA 3X3ZA 2HMOB 1I0XA 1C7HA 1Q7HA 4BTXA 4XM4A 3S5CA 3ZG0A 4HM2B 1OUNA 3FG4A 3LMLA 1Q9EA 3CPW2 1RN1A 3GRDA 3CCL3 2YFIB 1W7CA 2K0MA 1MWUA 5IG5A 1W02A 4EBGA 4O02B 3G0KA 1IT8A 1TRPA 1YIT3 3FZWA 1BRGA 1OF5B 3MKIA 3WDGB 1I70A 5IG4A 3F8HA 1EQKA 1K9M4 1OCVA 1FUSA 3RNTA 4XDVA 2IY2A 3SVAA 1GOVA 2A15A 2ZL8A 2R4IA 3N8BA 1TFKA 3K0ZA 3STDA 1G02A 1FYSA 5ELUA 1BSAA 4RNTA 2Q07A 3WHOA 1VQQA 1BVIA 3CC23 1LVNA 2YFJB 1A90A 1BSBA 1YVSA 1QALA 1STFI 1UCJA 2RBIA 2RFRA 2GEYA 1C54A 1GY7A 2CK3H 2XEPA 4JRFA 3Q90A 4LEHA 4MMYB 4R9LA 4X2OA 4XBXA 2OTJ3 1VQ93 2O9UX 1OGZA 4IPBA 2E2TA 3PS8A 5STDA 4R9KA 1QJGA 1SJWA 1TFOA 3EB8A 3KE7A 4H61A 2MC8A 1TRQA 4NPBA 3F40A 4K61A 3RGRA 4N6MA 1FGOA 2BIRA 2L1SA 4TX4A 1JN5A 1GY5A 3CD63 1SARA 4J8TA 5ELJA 3OWSA 1ULIB 1JBRA 2GEXA 3OXAA 2INXA 1DE3A 3KZTA 2QA43 3OWYA 2XSOB 2F5WA 3EF8A 2CFDA 1BANA 1M1XB 1MWSA 1B2XA 2IYJA 4EC6A 2ML5A 3X42A 1FZUA 2HMJB 3CNXA 2BMQB 3E99A 3EX9A 1I3FA 4BTYA 4AKZA 1UCIA 1JBTA 3NBRA 1VQ73 4MMZB 3S28A 3BNBA 2Y74A 3HIIA 4LGQA 3Q1CA 3EBYA 4OUQA 1JZOA 2CX1A 5HOHA 3H51A 4AKYA 3DGOA 1GSPA 3CU3A 1IU7A 3KSED 3EJVA 4K90B 2BMOB 3Q2PA 1LRAA 4J5KA 3DM8A 3DUKA 1PU4A 1D6ZA 2KCDA 3B4OA 4EV5A 3L0RA 3D4AA 1I2FA 1GOUA 4GB5A 1YJ93 3F14A 3PYJA 4CJNA 4MMXB 1O7PB 4CCVA 1GYBA 1I8VA 3NQYA 1BUJA 2C4BA 3IJEB 1I2GA 1QAFA 1IVVA 2OWPA 3JUNA 4LSOA 3CCE3 1O7MB 3N54B 3G16A 3WR2A 4ZM8A 3OWUA 3T0UA 1IVXA 1ISKA 3NM2A 3PGBA 4K1VA 1Q864 1RNBA 2HOHA 1UCLA 4L8PA 7RNTA 5CF1A 2IUJA 4O2HA 3FSDA 1N5PA 1R4CA 8RNTA 5LC7A 4EXRA 5JPPA 1K8A4 3GZYB 2HMNB 3SEDA 1LNHA 3KCHA 4IIAA 2BU4A 3LT9A 4N6NB 4KT3B 2W04A 3CXC2 2KAAA 2BMRB 2D42A 3D5GA 1VQL3 1OHSA 2CWVA 5BXQA 5KP4A 2XH9A 1BRKA 1IVWA 2JQ5A 2RCDA 2ZHXB 5JBSA 1RCLA 5AIHA 3UL6A 1RGLA 3WOFB 2IMJA 2GU3A 3KSPA 5D82A 3IPTA 3J7Yd 2KF3A 2YX9A 1WNHA 3U97A 3CC73 3B8LA 1O7NB 1AY7A 3CPOA 5CLKA 5TGNA 3RGAA 3NQZA 3X41A 3NBJA 1BNGA 3X40A 1AR0A 1X1XA 2W0QA 1LOXA 3CCV3 1SPUA 5KP1A 3K63A 1QAKA 3FKAA 3CMA3 2LQVA 3QK9A 2M7OA 1DMQA 1KC84 1T2HA 3KN4A 1IQYA 1GMRA 1IT7A 4NREA 2SARA 4FMAA 1BNIA 3HI7A 3GZRA 1YJN3 2RNTA 3GWRA 4FCMA 4KFDA 3X3XA 3RDEA 5AIGA 2E2UA 4QWTA 3U1WA 2W56A 3EC9A 1OPYA 2KXGA 1D6UA 3WA2X 2CX0A 2BT3A 3D5IA 4R4KA 4WWUC 1KSIA 1ROAA 3EBTA 1IVUA 3QRDA 1VQN3 2F99A 2QEX3 5G2GA 2H0HA 4N3VA 2HMLB 1BNFA 1JV2B 1T2IA 2F5MA 4FMDA 1J2BA 1KWIA 1OACA 1UI7A 2QIYA 2K3DA 2SBLA 3O8YA 4HZBB 5AEWB 2XF3A 4KFEA 2IA7A 3FH1A 2XGNA 1VQO3 3Q3FA 1W01A 1X1UA 4RZMA 1IQ8A 1RGKA 1OF5A 2W9PA 1JB5A 1HYFA 3F8XA 4KZ1A 2CFWA 4HJLB 3DGMA 3HK4A 1NWWA 1IDPA 2OOVC 3MWZA 3S29A 3G4S3 3SX1A 3UJMA 3VGNA 1HKXA 1Q824 2B24B 2CKFB
chains in the Genus database with same CATH topology
1UUWB 1U8CB 3MYTA 1OGXA 2P05A 1NDOB 4XDWA 3DMCA 1WMOA 2B1XB 2GXFA 3F7SA 2BHMA 2WOFA 3FG3A 3DXOA 1Q42A 3CCQ3 2PNCA 4HM1B 1N5HA 1DVDA 1MOLA 3LYGA 1ASKA 5IEOA 3FCSB 1KQS2 3I553 1SQWA 2CWUA 2F86B 2W9QA 3F9SA 3MG1A 1M1K4 2CH9A 4PEJA 1CQSA 1DMMA 1GY6A 3NHXA 2XFSA 1NO3A 1OHOA 3PXMA 5EEOA 3UNLA 4LMIA 4MEIA 1F8NA 2P38A 3NM7A 2MF7A 1OHPA 1JKGB 3JVCA 3HIGA 3OX9A 1V74A 4L7KA 4N6OB 4ORLA 1QVG2 3LTDA 5HGRA 4OVMA 3S27A 3AMOB 2JDIH 1NJI4 3K5TA 1CEWI 1W4NA 4X2HA 1FGRA 5D83A 3WA3A 3KFQC 1T5YA 2CC3A 5D81A 3HX8A 1DMNA 4STDA 2P0XA 3DY5A 2XFTA 4HKVB 3GZXB 1S723 3FF2A 1JKGA 2CG1A 1U5OA 4O8SA 5IF6A 3NV0B 3EHCA 1AVLA 3T8UA 1VZZA 4RNYA 1Q40B 4EYCA 1NB3I 3K7CA 1IQXA 3LOYA 3MHEA 1A2KA 4KFFA 4EV2A 4WYKB 1JNQA 3G8ZA 2BNGA 1YIJ3 5EVHA 4FMCA 1W2B2 1K28A 1E3VA 3NV0A 1M9GA 3JUMA 2UX0A 5FW5A 1OH0A 3NBBA 3CME3 5CF2A 1ISKA 5I97A 2HMKB 1Q40A 4HM7B 3A76A 2V1LA 1W00A 1VQ63 1FGQA 2I9WA 2W2CA 4HBRA 3G6E3 2K54A 1RRHA 3EE1A 1GD3A 1RRLA 3N9HA 3JUPA 5CK6A 3D9RA 3B4PA 2WO0A 1WMNA 3PCRA 3D3LA 3NUVA 2RGQA 2CFGA 3MSOA 1VQ53 1N9EA 4RNZA 1SIIA 3CNMA 4WFOA 3VSYA 4XBYA 3G713 1E97A 3LZAA 1CYVA 2W6JH 4HM3B 5DRVA 5KP3A 1US1A 2E2VA 3F7XA 1STDA 3OV4A 3ALAA 1Q7Y4 3SOAA 4I4KA 3TDGA 1YJW3 1FA3A 2YFLB 1IV9A 3GZBA 2FNQA 1WTHA 4WHAA 3EQQB 2HMMB 2P0MA 1QMAA 1WQLB 3LXUX 4RBNA 2L4VA 4KVHA 1FUWA 3FG1A 1KD14 1TIJA 1W5ZA 3PCSA 2GBXB 4U13A 3K9MC 3V99A 2OOVA 2STDA 1W6CA 5IEPA 5FGOA 1ZX2A 3FLJA 3SXXA 4BTWA 3B7CA 5IG3A 1A67A 4HM0B 2P09A 2D1WA 3SLUA 2XR8B 1S5AA 1ROVA 3DGNA 1BUQA 3CCR3 1MNLA 3LTBA 3VF1A 2KRTA 2CIUA 3KIIA 3NXJA 2ML6A 4K1UA 1GD4A 1TP6A 4R80A 2XGLA 5AYSC 3WMDA 3OW22 5A0OB 4G1MB 5CXOA 1IK3A 3MG2A 2WOHA 3T8NA 3I0YA 1N9JA 1PFPA 2XSHB 3ROBA 4XB5A 1JB2A 1LXEA 2C10A 1UUVB 4HVNA 1N8R4 5AYRB 3V92A 3GAXA 1VQ43 3H3HA 2GU1A 5AIIA 5IW9A 6STDA 2CW9A 5IENA 2OTL3 2W03A 3DGLA 3M8CA 1JN5B 4N6LA 1DVCA 1W6GA 2CFLA 3UL5A 1Q814 3EN8A 2XRXB 3NX0A 1IV7A 4O3VA 2FXTA 3BNDA 1TU5A 2WGOA 1O7HB 1YGEA 2OCTA 2Z7AA 4CDLA 5JPUA 3BLZA 5AI1A 1VQM3 4HM5B 4NHFA 1VQP3 4L8OA 2O3OA 3JUOA 4JF8A 5AEUB 3X3YA 3EN1B 1O7WB 2CG0A 1UW1A 1TUHA 3I563 1K41A 4FCJA 4MJDA 1HU9A 1L5GB 1SIHA 4IT7A 4GL6A 3CC43 1WMPA 1ZO2A 3MPHA 3CCJ3 1CYUA 8CHOA 4FMBA 3WODG 2PZVA 1D6YA 3BNCA 3KKGA 1AVKA 2Z6BA 2C11A 2CFKA 2Y73A 2Z76A 3AMOA 1ULJB 3MG3A 3IMAB 2GBWB 2Z77A 3BB9A 2LYXA 4FR9A 4LZIA 3LH4A 4R1KA 2OQEA 1K734 2CWTA 5LC6A 4AEQA 3ER7A 1VQK3 4XBTA 5EQLA 5BVBA 2FGTA 5IG0A 3CCS3 4N6UA 3DZLA 1NB5I 4J9AA 1RJOA 3ECFA 3JUQA 4WP5A 1G96A 1EG9B 4HYZA 1GS3A 1AV4A 1W2ZA 3FF0A 3BNEA 4FCZA 1YHQ3 2WGQA 4HM4B 1Y4KA 2ZDJA 1EA2A 5IERA 3CCM3 2OQEC 4WYKA 1JJ22 2CHCA 1M904 2RSXA 1RN7A 3CCU3 2BO9B 3WOEB 1NU3A 1QVF2 4HZ9B 1DYUA 1YI23 1Z1SA 7STDA 1A2VA 1YVBI 2IUKA 3FGYA 3LTAA 4OK0A 4HM6B 1O7GB 3LTCA 5AIFA 1FGMA 1N8QA 4Q53A 1RKYA 2F98A 3V98A 1JB4A 1FGTA 1EKMA 1JRQA 3LT8A 1W6YA 4N6V0 3HZPA 4HM8B 1UI8A 3PZWA 1E3RA 3S67A 5DREA 2W56B 3SOYA 3UB1A 4H3UA 2QGUA 4N6TA 3X3ZA 2HMOB 1C7HA 4BTXA 4XM4A 3S5CA 4HM2B 1OUNA 3FG4A 3LMLA 3CPW2 3GRDA 3CCL3 2YFIB 1W7CA 2K0MA 5IG5A 1W02A 4EBGA 4O02B 3G0KA 1IT8A 1YIT3 1YJN3 3FZWA 3MKIA 1OF5B 3WDGB 5IG4A 1VQ83 3F8HA 1EQKA 1K9M4 1OCVA 4XDVA 3SVAA 2A15A 2ZL8A 2R4IA 3N8BA 1TFKA 3K0ZA 3STDA 5ELUA 2Q07A 3CC23 1LVNA 2YFJB 1A90A 1QALA 1STFI 2RFRA 2GEYA 1GY7A 2CK3H 2XEPA 4JRFA 3Q90A 4LEHA 4MMYB 4R9LA 4X2OA 4XBXA 2OTJ3 1VQ93 2O9UX 1OGZA 4IPBA 2E2TA 3PS8A 5STDA 4R9KA 1QJGA 1SJWA 1TFOA 3EB8A 3KE7A 4H61A 2MC8A 3F40A 4K61A 3RGRA 4N6MA 1FGOA 4TX4A 1JN5A 1GY5A 3CD63 4J8TA 5ELJA 3OWSA 1ULIB 2GEXA 3OXAA 2INXA 3KZTA 2QA43 3OWYA 2XSOB 3EF8A 2CFDA 1M1XB 4EC6A 2ML5A 3X42A 2HMJB 3CNXA 2BMQB 3E99A 3EX9A 4BTYA 4AKZA 3NBRA 1VQ73 4MMZB 3S28A 3BNBA 2Y74A 3HIIA 4LGQA 3Q1CA 3EBYA 4OUQA 3H51A 4AKYA 3DGOA 3CU3A 1IU7A 3KSED 3EJVA 4K90B 2BMOB 3Q2PA 3DM8A 3DUKA 1PU4A 1D6ZA 2KCDA 3B4OA 4EV5A 3L0RA 4GB5A 1YJ93 3F14A 3PYJA 4MMXB 1O7PB 4CCVA 1GYBA 3NQYA 3IJEB 1QAFA 1IVVA 2OWPA 3JUNA 4LSOA 3CCE3 1O7MB 3N54B 3G16A 4ZM8A 3OWUA 3T0UA 1IVXA 3NM2A 3PGBA 4K1VA 1Q864 4L8PA 5CF1A 2IUJA 4O2HA 3FSDA 1N5PA 1R4CA 5LC7A 4EXRA 5JPPA 1K8A4 3GZYB 2HMNB 3SEDA 1LNHA 4IIAA 3LT9A 4N6NB 2W04A 3CXC2 2BMRB 2D42A 1VQL3 1OHSA 2CWVA 5BXQA 5KP4A 2XH9A 2JQ5A 1IVWA 2RCDA 5JBSA 1KC84 5AIHA 3UL6A 3WOFB 2IMJA 2GU3A 3KSPA 5D82A 3IPTA 3J7Yd 2YX9A 1WNHA 3U97A 3CC73 3B8LA 1O7NB 3CPOA 5CLKA 5TGNA 3RGAA 3X41A 3NQZA 3NBJA 3X40A 1AR0A 2W0QA 1LOXA 3CCV3 1SPUA 5KP1A 3K63A 1QAKA 3FKAA 3CMA3 2LQVA 3QK9A 2M7OA 1DMQA 3KN4A 1IQYA 1IT7A 4NREA 4FMAA 3HI7A 3GZRA 3GWRA 4FCMA 4KFDA 3X3XA 3RDEA 5AIGA 2E2UA 4QWTA 3U1WA 2W56A 3EC9A 1OPYA 2KXGA 1D6UA 3WA2X 2BT3A 4R4KA 4WWUC 1KSIA 1ROAA 3EBTA 1IVUA 3QRDA 1VQN3 2F99A 2QEX3 5G2GA 4N3VA 2HMLB 1JV2B 4FMDA 1J2BA 1KWIA 1OACA 1UI7A 2QIYA 2SBLA 3O8YA 4HZBB 5AEWB 2XF3A 4KFEA 2IA7A 3FH1A 2XGNA 1VQO3 1W01A 4RZMA 1IQ8A 1OF5A 2W9PA 1JB5A 3F8XA 4KZ1A 2CFWA 4HJLB 3DGMA 3HK4A 1NWWA 1IDPA 2OOVC 3MWZA 3S29A 3G4S3 3SX1A 3UJMA 3VGNA 1HKXA 1Q824 2B24B 2CKFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUW B;  3MYT A;  1OGX A;  1NDO B;  4XDW A;  3DMC A;  2B1X B;  2GXF A;  3F7S A;  3DXO A;  1Q42 A;  4HM1 B;  3LYG A;  1ASK A;  5IEO A;  2F86 B;  3F9S A;  3MG1 A;  4PEJ A;  1CQS A;  1DMM A;  1GY6 A;  3NHX A;  1OHO A;  3UNL A;  4LMI A;  1OHP A;  1JKG B;  3OX9 A;  4L7K A;  4ORL A;  5HGR A;  4OVM A;  4X2H A;  5D83 A;  5D81 A;  3HX8 A;  1DMN A;  4STD A;  4HKV B;  3GZX B;  3FF2 A;  1JKG A;  1U5O A;  5IF6 A;  3NV0 B;  3EHC A;  3T8U A;  1VZZ A;  1Q40 B;  3K7C A;  3MHE A;  1A2K A;  4WYK B;  3G8Z A;  2BNG A;  5EVH A;  1E3V A;  3NV0 A;  3JUM A;  5FW5 A;  2UX0 A;  1ISK A;  1OH0 A;  5CF2 A;  2HMK B;  1Q40 A;  4HM7 B;  3A76 A;  1W00 A;  2I9W A;  2W2C A;  2K54 A;  3JUP A;  5CK6 A;  3D9R A;  3B4P A;  3NUV A;  2RGQ A;  3MSO A;  3CNM A;  3VSY A;  4XBY A;  1E97 A;  3LZA A;  4HM3 B;  5DRV A;  5KP3 A;  3F7X A;  1STD A;  3OV4 A;  3SOA A;  4I4K A;  2YFL B;  3GZB A;  3EQQ B;  2HMM B;  1QMA A;  1WQL B;  4KVH A;  2GBX B;  4U13 A;  2STD A;  5IEP A;  1ZX2 A;  3FLJ A;  5IG3 A;  3B7C A;  4HM0 B;  2XR8 B;  1S5A A;  1BUQ A;  3NXJ A;  4K1U A;  1TP6 A;  3WMD A;  5CXO A;  3MG2 A;  3T8N A;  3I0Y A;  2XSH B;  3ROB A;  4XB5 A;  1JB2 A;  4HVN A;  1UUV B;  3H3H A;  5AII A;  6STD A;  5IEN A;  3M8C A;  1JN5 B;  3EN8 A;  2XRX B;  1O7H B;  2Z7A A;  4CDL A;  5JPU A;  3BLZ A;  5AI1 A;  4HM5 B;  4L8O A;  3JUO A;  5AEU B;  3EN1 B;  1O7W B;  1TUH A;  1K41 A;  4FCJ A;  4MJD A;  1ZO2 A;  8CHO A;  2PZV A;  3KKG A;  2Z76 A;  1ULJ B;  3MG3 A;  2GBW B;  2Z77 A;  3BB9 A;  4R1K A;  3ER7 A;  4XBT A;  5BVB A;  5IG0 A;  3DZL A;  4J9A A;  3ECF A;  3JUQ A;  4WP5 A;  1EG9 B;  1GS3 A;  3FF0 A;  4HM4 B;  5IER A;  1EA2 A;  4WYK A;  2CHC A;  1NU3 A;  4HZ9 B;  1Z1S A;  7STD A;  3FGY A;  4HM6 B;  1O7G B;  5AIF A;  4Q53 A;  2F98 A;  1JB4 A;  1W6Y A;  3HZP A;  4HM8 B;  1E3R A;  5DRE A;  3SOY A;  4H3U A;  2QGU A;  2HMO B;  1C7H A;  4XM4 A;  3S5C A;  4HM2 B;  1OUN A;  3GRD A;  2YFI B;  5IG5 A;  1W02 A;  3G0K A;  3FZW A;  3MKI A;  1OF5 B;  5IG4 A;  3F8H A;  1OCV A;  4XDV A;  2A15 A;  2R4I A;  3K0Z A;  3STD A;  2YFJ B;  2RFR A;  2GEY A;  1GY7 A;  3Q90 A;  4LEH A;  4R9L A;  4X2O A;  4XBX A;  1OGZ A;  5STD A;  4R9K A;  1QJG A;  1SJW A;  3KE7 A;  3F40 A;  3RGR A;  1JN5 A;  1GY5 A;  4J8T A;  3OWS A;  1ULI B;  2GEX A;  3OXA A;  2INX A;  3KZT A;  3OWY A;  2XSO B;  3EF8 A;  2HMJ B;  3CNX A;  2BMQ B;  3E99 A;  3EX9 A;  3NBR A;  4LGQ A;  3EBY A;  4OUQ A;  3H51 A;  3CU3 A;  3EJV A;  2BMO B;  3DM8 A;  3DUK A;  3B4O A;  4GB5 A;  3F14 A;  1O7P B;  1GYB A;  2OWP A;  3JUN A;  1O7M B;  3G16 A;  3OWU A;  3NM2 A;  4K1V A;  4L8P A;  5CF1 A;  3FSD A;  5JPP A;  3GZY B;  2HMN B;  3SED A;  4IIA A;  2BMR B;  1OHS A;  5BXQ A;  5KP4 A;  2JQ5 A;  2RCD A;  5AIH A;  2IMJ A;  3KSP A;  5D82 A;  3IPT A;  3B8L A;  1O7N B;  3CPO A;  5CLK A;  5TGN A;  3RGA A;  1AR0 A;  5KP1 A;  3FKA A;  1DMQ A;  3GZR A;  3GWR A;  4FCM A;  5AIG A;  3EC9 A;  1OPY A;  4WWU C;  3EBT A;  2F99 A;  5G2G A;  4N3V A;  2HML B;  2QIY A;  4HZB B;  5AEW B;  3FH1 A;  1W01 A;  4RZM A;  1OF5 A;  3F8X A;  1JB5 A;  4HJL B;  3HK4 A;  1NWW A;  1IDP A;  3UJM A;  3VGN A;  1HKX A;  2B24 B;  2CKF B; 
#chains in the Genus database with same CATH topology
 1UUW B;  1U8C B;  3MYT A;  1OGX A;  2P05 A;  1NDO B;  4XDW A;  1MGR A;  3DMC A;  1WMO A;  2B1X B;  1BRS A;  1X1Y A;  2GXF A;  3F7S A;  2BHM A;  1RGG A;  2WOF A;  3FG3 A;  3DXO A;  1Q42 A;  3CCQ 3;  2PNC A;  4HM1 B;  1N5H A;  1DVD A;  1MOL A;  3LYG A;  1ASK A;  1MWR A;  5IEO A;  3FCS B;  1KQS 2;  3I55 3;  1SQW A;  2CWU A;  2F86 B;  2W9Q A;  3F9S A;  3MG1 A;  1M1K 4;  1BNR A;  2CH9 A;  4PEJ A;  1CQS A;  1DMM A;  1GY6 A;  3NHX A;  2XFS A;  1NO3 A;  1OHO A;  3PXM A;  5EEO A;  5GSP A;  3UNL A;  4LMI A;  4MEI A;  1RTU A;  1F8N A;  2P38 A;  3NM7 A;  1RGF A;  3URP A;  1X1W A;  2MF7 A;  1OHP A;  1JKG B;  3JVC A;  3HIG A;  3OX9 A;  1V74 A;  4L7K A;  4N6O B;  4ORL A;  1QVG 2;  3LTD A;  5HGR A;  4OVM A;  3S27 A;  3AMO B;  1DET A;  2KF6 A;  2JDI H;  5G1L A;  1NJI 4;  3K5T A;  1CEW I;  1W4N A;  4X2H A;  1FGR A;  1GMQ A;  5D83 A;  3WA3 A;  1B2S A;  3KFQ C;  1B3S A;  1T5Y A;  2CC3 A;  3BIR A;  3HX8 A;  1DMN A;  4STD A;  5D81 A;  1B2M A;  2P0X A;  3DY5 A;  2XFT A;  1RGH A;  4HKV B;  1BNJ A;  3GZX B;  3FF2 A;  5BU4 A;  1JKG A;  1RSN A;  2CG1 A;  1S72 3;  1U5O A;  4O8S A;  5IF6 A;  3NV0 B;  3EHC A;  1AVL A;  3AHW A;  1LOW A;  3T8U A;  1VZZ A;  3AGN A;  4RNY A;  1Q40 B;  4EYC A;  1NB3 I;  1TTO A;  3K7C A;  1IQX A;  1RDS A;  3LOY A;  3MHE A;  4I5Q A;  4BL2 A;  1A2K A;  4KFF A;  4BIR A;  4HAA A;  4EV2 A;  4WYK B;  1JNQ A;  3G8Z A;  2BNG A;  4BU4 A;  1YIJ 3;  5EVH A;  4FMC A;  1W2B 2;  1K28 A;  1E3V A;  3NV0 A;  1M9G A;  3JUM A;  2UX0 A;  1A2P A;  1OH0 A;  3NBB A;  5FW5 A;  5G1K A;  5CF2 A;  5I97 A;  3CME 3;  2HMK B;  1Q40 A;  4HM7 B;  6RNT A;  1JZD A;  3A76 A;  4ILF A;  2V1L A;  1W00 A;  1VQ6 3;  1FGQ A;  2I9W A;  2W2C A;  4HBR A;  3G6E 3;  2K54 A;  3A5E A;  1RRH A;  3EE1 A;  1I2E A;  1GD3 A;  1RRL A;  3N9H A;  3JUP A;  4GSP A;  5CK6 A;  3D9R A;  1NNV A;  2WO0 A;  3B4P A;  1WMN A;  1B2Z A;  1RN4 A;  1BOX A;  1FUT A;  1PY3 A;  3D3L A;  3PCR A;  3NUV A;  1T3B A;  1BU4 A;  1YGW A;  2CFG A;  2RGQ A;  3MSO A;  1BSD A;  1VQ5 3;  1N9E A;  4RNZ A;  1SII A;  3CNM A;  4WFO A;  3VSY A;  4XBY A;  3G71 3;  1E97 A;  1EEJ A;  3LZA A;  1CYV A;  2W6J H;  4HM3 B;  4LYL B;  5DRV A;  5KP3 A;  4BL3 A;  2F4Y A;  1US1 A;  2GSP A;  2E2V A;  3F7X A;  4CPK A;  1STD A;  3OV4 A;  3ALA A;  1Q7Y 4;  3SOA A;  4I4K A;  3TDG A;  1YJW 3;  1FA3 A;  2YFL B;  1IV9 A;  3GZB A;  2FNQ A;  4J5G A;  1WTH A;  4WHA A;  3EQQ B;  1G0T A;  2HMM B;  2P0M A;  1QMA A;  1WQL B;  3LXU X;  4RBN A;  2L4V A;  4KVH A;  2AAD A;  1RCK A;  4GHO A;  3FG1 A;  1KD1 4;  1TIJ A;  1W5Z A;  1FUW A;  1EUI C;  3PCS A;  1BAO A;  2GBX B;  4U13 A;  3K9M C;  3V99 A;  2OOV A;  2STD A;  1W6C A;  2UUG C;  3DH2 A;  5IEP A;  5FGO A;  1ZX2 A;  3FLJ A;  4HOH A;  3SYU A;  3SXX A;  1BRH A;  4BTW A;  1TJD A;  3B7C A;  5IG3 A;  9RNT A;  1A67 A;  1PYL A;  4HM0 B;  1LNI A;  2P09 A;  2ZA4 A;  3ZG5 A;  1BNS A;  2D1W A;  1BRJ A;  3SLU A;  2XR8 B;  1S5A A;  1ROV A;  3DGN A;  1BUQ A;  3CCR 3;  1MNL A;  3LTB A;  1B2U A;  3VF1 A;  1JBS A;  2KRT A;  2CIU A;  3KII A;  3NXJ A;  2ML6 A;  4K1U A;  1GD4 A;  1TP6 A;  4R80 A;  2XGL A;  1B20 A;  3AHS A;  5AYS C;  3WMD A;  3OW2 2;  3ZFZ A;  5A0O B;  4G1M B;  1BSC A;  5CXO A;  1IK3 A;  1BGS A;  3MG2 A;  2WOH A;  3HOH A;  3T8N A;  3I0Y A;  1N9J A;  1PFP A;  2XSH B;  3ROB A;  1RHL A;  4XB5 A;  1JB2 A;  1LXE A;  2C10 A;  1UUV B;  4HVN A;  1N8R 4;  5AYR B;  3V92 A;  3GAX A;  1VQ4 3;  3H3H A;  1CH0 A;  2GU1 A;  5AII A;  5IW9 A;  6STD A;  2CW9 A;  5IEN A;  1AQZ A;  1GOY A;  2OTL 3;  2W03 A;  3DGL A;  3M8C A;  5BIR A;  1JN5 B;  4N6L A;  1DVC A;  1W6G A;  2CFL A;  3UL5 A;  1Q81 4;  3EN8 A;  2XRX B;  6GSP A;  3NX0 A;  2KF5 A;  1IV7 A;  4O3V A;  3AGO A;  1I3I A;  2FXT A;  3BND A;  1TU5 A;  2WGO A;  4EW5 A;  1O7H B;  1YGE A;  2OCT A;  2Z7A A;  1LQG C;  4CDL A;  5JPU A;  1RMS A;  3BLZ A;  2UGI A;  5AI1 A;  1BRI A;  3DGY A;  1VQM 3;  4HM5 B;  4NHF A;  1VQP 3;  1BIR A;  4L8O A;  1LOV A;  2O3O A;  1BNE A;  2AAE A;  3JUO A;  4JF8 A;  1ZGX A;  5AEU B;  3X3Y A;  2R41 A;  3EN1 B;  1O7W B;  2CG0 A;  1UW1 A;  1TUH A;  3I56 3;  1K41 A;  4FCJ A;  4MJD A;  1I0V A;  1HZ1 A;  1HU9 A;  1L5G B;  1SIH A;  4IT7 A;  1B21 A;  2H0G A;  4GL6 A;  1GMP A;  3CC4 3;  1WMP A;  1ZO2 A;  3MPH A;  1UCK A;  3GSP A;  3CCJ 3;  1CYU A;  8CHO A;  4FMB A;  1ZS7 A;  3WOD G;  2PZV A;  1D6Y A;  3BNC A;  3KKG A;  1AVK A;  2Z6B A;  2C11 A;  2CFK A;  2Y73 A;  2Z76 A;  3AMO A;  1ULJ B;  1YNV X;  1FW7 A;  3MG3 A;  1UGH I;  1RNT A;  5M18 A;  3IMA B;  2GBW B;  2Z77 A;  3BB9 A;  2J8X B;  1BRN L;  2LYX A;  4FR9 A;  4LZI A;  3LH4 A;  4R1K A;  2OQE A;  1K73 4;  2CWT A;  5LC6 A;  4AEQ A;  3ER7 A;  1VQK 3;  1IYY A;  1RLS A;  2KF4 A;  4XBT A;  5EQL A;  2FGT A;  3BU4 A;  5IG0 A;  1MWT A;  5BVB A;  5M19 A;  3CCS 3;  4N6U A;  3DZL A;  1NB5 I;  4J9A A;  1RJO A;  3ECF A;  3JUQ A;  1RGC A;  4WP5 A;  1G96 A;  3D79 A;  1V57 A;  1EG9 B;  1R4Y A;  4HYZ A;  1VQ8 3;  1GS3 A;  1AV4 A;  1W2Z A;  3FF0 A;  3BNE A;  4FCZ A;  1YHQ 3;  2WGQ A;  4DKI A;  4HM4 B;  1Y4K A;  2ZDJ A;  1EA2 A;  5IER A;  3CCM 3;  2OQE C;  4WYK A;  1LOY A;  1JJ2 2;  2CHC A;  1M90 4;  1UUG B;  1V58 A;  1MGW A;  2RSX A;  1RN7 A;  3CCU 3;  2BO9 B;  3WOE B;  1NU3 A;  1QVF 2;  4HZ9 B;  1DYU A;  1YI2 3;  1Z1S A;  7STD A;  1BSE A;  1A2V A;  1YVB I;  2IUK A;  3FGY A;  3LTA A;  4OK0 A;  1UGI A;  1RGA A;  1B27 A;  4HM6 B;  2F56 A;  1O7G B;  3LTC A;  5AIF A;  1LQM B;  1FGM A;  1N8Q A;  4Q53 A;  5M1A A;  1RKY A;  2F98 A;  1RGE A;  3V98 A;  1JB4 A;  1FGT A;  1EKM A;  1JRQ A;  3LT8 A;  1W6Y A;  4N6V 0;  3HZP A;  4HM8 B;  1UI8 A;  3PZW A;  1E3R A;  3S67 A;  5DRE A;  7GSP A;  2W56 B;  3SOY A;  3UB1 A;  2H0I A;  4H3U A;  5RNT A;  2QGU A;  1UDI I;  4N6T A;  3X3Z A;  2HMO B;  1I0X A;  1C7H A;  1Q7H A;  4BTX A;  4XM4 A;  3S5C A;  3ZG0 A;  4HM2 B;  1OUN A;  3FG4 A;  3LML A;  1Q9E A;  3CPW 2;  1RN1 A;  3GRD A;  3CCL 3;  2YFI B;  1W7C A;  2K0M A;  1MWU A;  5IG5 A;  1W02 A;  4EBG A;  4O02 B;  3G0K A;  1IT8 A;  1TRP A;  1YIT 3;  3FZW A;  1BRG A;  1OF5 B;  3MKI A;  3WDG B;  1I70 A;  5IG4 A;  3F8H A;  1EQK A;  1K9M 4;  1OCV A;  1FUS A;  3RNT A;  4XDV A;  2IY2 A;  3SVA A;  1GOV A;  2A15 A;  2ZL8 A;  2R4I A;  3N8B A;  1TFK A;  3K0Z A;  3STD A;  1G02 A;  1FYS A;  5ELU A;  1BSA A;  4RNT A;  2Q07 A;  3WHO A;  1VQQ A;  1BVI A;  3CC2 3;  1LVN A;  2YFJ B;  1A90 A;  1BSB A;  1YVS A;  1QAL A;  1STF I;  1UCJ A;  2RBI A;  2RFR A;  2GEY A;  1C54 A;  1GY7 A;  2CK3 H;  2XEP A;  4JRF A;  3Q90 A;  4LEH A;  4MMY B;  4R9L A;  4X2O A;  4XBX A;  2OTJ 3;  1VQ9 3;  2O9U X;  1OGZ A;  4IPB A;  2E2T A;  3PS8 A;  5STD A;  4R9K A;  1QJG A;  1SJW A;  1TFO A;  3EB8 A;  3KE7 A;  4H61 A;  2MC8 A;  1TRQ A;  4NPB A;  3F40 A;  4K61 A;  3RGR A;  4N6M A;  1FGO A;  2BIR A;  2L1S A;  4TX4 A;  1JN5 A;  1GY5 A;  3CD6 3;  1SAR A;  4J8T A;  5ELJ A;  3OWS A;  1ULI B;  1JBR A;  2GEX A;  3OXA A;  2INX A;  1DE3 A;  3KZT A;  2QA4 3;  3OWY A;  2XSO B;  2F5W A;  3EF8 A;  2CFD A;  1BAN A;  1M1X B;  1MWS A;  1B2X A;  2IYJ A;  4EC6 A;  2ML5 A;  3X42 A;  1FZU A;  2HMJ B;  3CNX A;  2BMQ B;  3E99 A;  3EX9 A;  1I3F A;  4BTY A;  4AKZ A;  1UCI A;  1JBT A;  3NBR A;  1VQ7 3;  4MMZ B;  3S28 A;  3BNB A;  2Y74 A;  3HII A;  4LGQ A;  3Q1C A;  3EBY A;  4OUQ A;  1JZO A;  2CX1 A;  5HOH A;  3H51 A;  4AKY A;  3DGO A;  1GSP A;  3CU3 A;  1IU7 A;  3KSE D;  3EJV A;  4K90 B;  2BMO B;  3Q2P A;  1LRA A;  4J5K A;  3DM8 A;  3DUK A;  1PU4 A;  1D6Z A;  2KCD A;  3B4O A;  4EV5 A;  3L0R A;  3D4A A;  1I2F A;  1GOU A;  4GB5 A;  1YJ9 3;  3F14 A;  3PYJ A;  4CJN A;  4MMX B;  1O7P B;  4CCV A;  1GYB A;  1I8V A;  3NQY A;  1BUJ A;  2C4B A;  3IJE B;  1I2G A;  1QAF A;  1IVV A;  2OWP A;  3JUN A;  4LSO A;  3CCE 3;  1O7M B;  3N54 B;  3G16 A;  3WR2 A;  4ZM8 A;  3OWU A;  3T0U A;  1IVX A;  1ISK A;  3NM2 A;  3PGB A;  4K1V A;  1Q86 4;  1RNB A;  2HOH A;  1UCL A;  4L8P A;  7RNT A;  5CF1 A;  2IUJ A;  4O2H A;  3FSD A;  1N5P A;  1R4C A;  8RNT A;  5LC7 A;  4EXR A;  5JPP A;  1K8A 4;  3GZY B;  2HMN B;  3SED A;  1LNH A;  3KCH A;  4IIA A;  2BU4 A;  3LT9 A;  4N6N B;  4KT3 B;  2W04 A;  3CXC 2;  2KAA A;  2BMR B;  2D42 A;  3D5G A;  1VQL 3;  1OHS A;  2CWV A;  5BXQ A;  5KP4 A;  2XH9 A;  1BRK A;  1IVW A;  2JQ5 A;  2RCD A;  2ZHX B;  5JBS A;  1RCL A;  5AIH A;  3UL6 A;  1RGL A;  3WOF B;  2IMJ A;  2GU3 A;  3KSP A;  5D82 A;  3IPT A;  3J7Y d;  2KF3 A;  2YX9 A;  1WNH A;  3U97 A;  3CC7 3;  3B8L A;  1O7N B;  1AY7 A;  3CPO A;  5CLK A;  5TGN A;  3RGA A;  3NQZ A;  3X41 A;  3NBJ A;  1BNG A;  3X40 A;  1AR0 A;  1X1X A;  2W0Q A;  1LOX A;  3CCV 3;  1SPU A;  5KP1 A;  3K63 A;  1QAK A;  3FKA A;  3CMA 3;  2LQV A;  3QK9 A;  2M7O A;  1DMQ A;  1KC8 4;  1T2H A;  3KN4 A;  1IQY A;  1GMR A;  1IT7 A;  4NRE A;  2SAR A;  4FMA A;  1BNI A;  3HI7 A;  3GZR A;  1YJN 3;  2RNT A;  3GWR A;  4FCM A;  4KFD A;  3X3X A;  3RDE A;  5AIG A;  2E2U A;  4QWT A;  3U1W A;  2W56 A;  3EC9 A;  1OPY A;  2KXG A;  1D6U A;  3WA2 X;  2CX0 A;  2BT3 A;  3D5I A;  4R4K A;  4WWU C;  1KSI A;  1ROA A;  3EBT A;  1IVU A;  3QRD A;  1VQN 3;  2F99 A;  2QEX 3;  5G2G A;  2H0H A;  4N3V A;  2HML B;  1BNF A;  1JV2 B;  1T2I A;  2F5M A;  4FMD A;  1J2B A;  1KWI A;  1OAC A;  1UI7 A;  2QIY A;  2K3D A;  2SBL A;  3O8Y A;  4HZB B;  5AEW B;  2XF3 A;  4KFE A;  2IA7 A;  3FH1 A;  2XGN A;  1VQO 3;  3Q3F A;  1W01 A;  1X1U A;  4RZM A;  1IQ8 A;  1RGK A;  1OF5 A;  2W9P A;  1JB5 A;  1HYF A;  3F8X A;  4KZ1 A;  2CFW A;  4HJL B;  3DGM A;  3HK4 A;  1NWW A;  1IDP A;  2OOV C;  3MWZ A;  3S29 A;  3G4S 3;  3SX1 A;  3UJM A;  3VGN A;  1HKX A;  1Q82 4;  2B24 B;  2CKF B; 
#chains in the Genus database with same CATH homology
 1UUW B;  1U8C B;  3MYT A;  1OGX A;  2P05 A;  1NDO B;  4XDW A;  3DMC A;  1WMO A;  2B1X B;  2GXF A;  3F7S A;  2BHM A;  2WOF A;  3FG3 A;  3DXO A;  1Q42 A;  3CCQ 3;  2PNC A;  4HM1 B;  1N5H A;  1DVD A;  1MOL A;  3LYG A;  1ASK A;  5IEO A;  3FCS B;  1KQS 2;  3I55 3;  1SQW A;  2CWU A;  2F86 B;  2W9Q A;  3F9S A;  3MG1 A;  1M1K 4;  2CH9 A;  4PEJ A;  1CQS A;  1DMM A;  1GY6 A;  3NHX A;  2XFS A;  1NO3 A;  1OHO A;  3PXM A;  5EEO A;  3UNL A;  4LMI A;  4MEI A;  1F8N A;  2P38 A;  3NM7 A;  2MF7 A;  1OHP A;  1JKG B;  3JVC A;  3HIG A;  3OX9 A;  1V74 A;  4L7K A;  4N6O B;  4ORL A;  1QVG 2;  3LTD A;  5HGR A;  4OVM A;  3S27 A;  3AMO B;  2JDI H;  1NJI 4;  3K5T A;  1CEW I;  1W4N A;  4X2H A;  1FGR A;  5D83 A;  3WA3 A;  3KFQ C;  1T5Y A;  2CC3 A;  5D81 A;  3HX8 A;  1DMN A;  4STD A;  2P0X A;  3DY5 A;  2XFT A;  4HKV B;  3GZX B;  1S72 3;  3FF2 A;  1JKG A;  2CG1 A;  1U5O A;  4O8S A;  5IF6 A;  3NV0 B;  3EHC A;  1AVL A;  3T8U A;  1VZZ A;  4RNY A;  1Q40 B;  4EYC A;  1NB3 I;  3K7C A;  1IQX A;  3LOY A;  3MHE A;  1A2K A;  4KFF A;  4EV2 A;  4WYK B;  1JNQ A;  3G8Z A;  2BNG A;  1YIJ 3;  5EVH A;  4FMC A;  1W2B 2;  1K28 A;  1E3V A;  3NV0 A;  1M9G A;  3JUM A;  2UX0 A;  5FW5 A;  1OH0 A;  3NBB A;  3CME 3;  5CF2 A;  1ISK A;  5I97 A;  2HMK B;  1Q40 A;  4HM7 B;  3A76 A;  2V1L A;  1W00 A;  1VQ6 3;  1FGQ A;  2I9W A;  2W2C A;  4HBR A;  3G6E 3;  2K54 A;  1RRH A;  3EE1 A;  1GD3 A;  1RRL A;  3N9H A;  3JUP A;  5CK6 A;  3D9R A;  3B4P A;  2WO0 A;  1WMN A;  3PCR A;  3D3L A;  3NUV A;  2RGQ A;  2CFG A;  3MSO A;  1VQ5 3;  1N9E A;  4RNZ A;  1SII A;  3CNM A;  4WFO A;  3VSY A;  4XBY A;  3G71 3;  1E97 A;  3LZA A;  1CYV A;  2W6J H;  4HM3 B;  5DRV A;  5KP3 A;  1US1 A;  2E2V A;  3F7X A;  1STD A;  3OV4 A;  3ALA A;  1Q7Y 4;  3SOA A;  4I4K A;  3TDG A;  1YJW 3;  1FA3 A;  2YFL B;  1IV9 A;  3GZB A;  2FNQ A;  1WTH A;  4WHA A;  3EQQ B;  2HMM B;  2P0M A;  1QMA A;  1WQL B;  3LXU X;  4RBN A;  2L4V A;  4KVH A;  1FUW A;  3FG1 A;  1KD1 4;  1TIJ A;  1W5Z A;  3PCS A;  2GBX B;  4U13 A;  3K9M C;  3V99 A;  2OOV A;  2STD A;  1W6C A;  5IEP A;  5FGO A;  1ZX2 A;  3FLJ A;  3SXX A;  4BTW A;  3B7C A;  5IG3 A;  1A67 A;  4HM0 B;  2P09 A;  2D1W A;  3SLU A;  2XR8 B;  1S5A A;  1ROV A;  3DGN A;  1BUQ A;  3CCR 3;  1MNL A;  3LTB A;  3VF1 A;  2KRT A;  2CIU A;  3KII A;  3NXJ A;  2ML6 A;  4K1U A;  1GD4 A;  1TP6 A;  4R80 A;  2XGL A;  5AYS C;  3WMD A;  3OW2 2;  5A0O B;  4G1M B;  5CXO A;  1IK3 A;  3MG2 A;  2WOH A;  3T8N A;  3I0Y A;  1N9J A;  1PFP A;  2XSH B;  3ROB A;  4XB5 A;  1JB2 A;  1LXE A;  2C10 A;  1UUV B;  4HVN A;  1N8R 4;  5AYR B;  3V92 A;  3GAX A;  1VQ4 3;  3H3H A;  2GU1 A;  5AII A;  5IW9 A;  6STD A;  2CW9 A;  5IEN A;  2OTL 3;  2W03 A;  3DGL A;  3M8C A;  1JN5 B;  4N6L A;  1DVC A;  1W6G A;  2CFL A;  3UL5 A;  1Q81 4;  3EN8 A;  2XRX B;  3NX0 A;  1IV7 A;  4O3V A;  2FXT A;  3BND A;  1TU5 A;  2WGO A;  1O7H B;  1YGE A;  2OCT A;  2Z7A A;  4CDL A;  5JPU A;  3BLZ A;  5AI1 A;  1VQM 3;  4HM5 B;  4NHF A;  1VQP 3;  4L8O A;  2O3O A;  3JUO A;  4JF8 A;  5AEU B;  3X3Y A;  3EN1 B;  1O7W B;  2CG0 A;  1UW1 A;  1TUH A;  3I56 3;  1K41 A;  4FCJ A;  4MJD A;  1HU9 A;  1L5G B;  1SIH A;  4IT7 A;  4GL6 A;  3CC4 3;  1WMP A;  1ZO2 A;  3MPH A;  3CCJ 3;  1CYU A;  8CHO A;  4FMB A;  3WOD G;  2PZV A;  1D6Y A;  3BNC A;  3KKG A;  1AVK A;  2Z6B A;  2C11 A;  2CFK A;  2Y73 A;  2Z76 A;  3AMO A;  1ULJ B;  3MG3 A;  3IMA B;  2GBW B;  2Z77 A;  3BB9 A;  2LYX A;  4FR9 A;  4LZI A;  3LH4 A;  4R1K A;  2OQE A;  1K73 4;  2CWT A;  5LC6 A;  4AEQ A;  3ER7 A;  1VQK 3;  4XBT A;  5EQL A;  5BVB A;  2FGT A;  5IG0 A;  3CCS 3;  4N6U A;  3DZL A;  1NB5 I;  4J9A A;  1RJO A;  3ECF A;  3JUQ A;  4WP5 A;  1G96 A;  1EG9 B;  4HYZ A;  1GS3 A;  1AV4 A;  1W2Z A;  3FF0 A;  3BNE A;  4FCZ A;  1YHQ 3;  2WGQ A;  4HM4 B;  1Y4K A;  2ZDJ A;  1EA2 A;  5IER A;  3CCM 3;  2OQE C;  4WYK A;  1JJ2 2;  2CHC A;  1M90 4;  2RSX A;  1RN7 A;  3CCU 3;  2BO9 B;  3WOE B;  1NU3 A;  1QVF 2;  4HZ9 B;  1DYU A;  1YI2 3;  1Z1S A;  7STD A;  1A2V A;  1YVB I;  2IUK A;  3FGY A;  3LTA A;  4OK0 A;  4HM6 B;  1O7G B;  3LTC A;  5AIF A;  1FGM A;  1N8Q A;  4Q53 A;  1RKY A;  2F98 A;  3V98 A;  1JB4 A;  1FGT A;  1EKM A;  1JRQ A;  3LT8 A;  1W6Y A;  4N6V 0;  3HZP A;  4HM8 B;  1UI8 A;  3PZW A;  1E3R A;  3S67 A;  5DRE A;  2W56 B;  3SOY A;  3UB1 A;  4H3U A;  2QGU A;  4N6T A;  3X3Z A;  2HMO B;  1C7H A;  4BTX A;  4XM4 A;  3S5C A;  4HM2 B;  1OUN A;  3FG4 A;  3LML A;  3CPW 2;  3GRD A;  3CCL 3;  2YFI B;  1W7C A;  2K0M A;  5IG5 A;  1W02 A;  4EBG A;  4O02 B;  3G0K A;  1IT8 A;  1YIT 3;  1YJN 3;  3FZW A;  3MKI A;  1OF5 B;  3WDG B;  5IG4 A;  1VQ8 3;  3F8H A;  1EQK A;  1K9M 4;  1OCV A;  4XDV A;  3SVA A;  2A15 A;  2ZL8 A;  2R4I A;  3N8B A;  1TFK A;  3K0Z A;  3STD A;  5ELU A;  2Q07 A;  3CC2 3;  1LVN A;  2YFJ B;  1A90 A;  1QAL A;  1STF I;  2RFR A;  2GEY A;  1GY7 A;  2CK3 H;  2XEP A;  4JRF A;  3Q90 A;  4LEH A;  4MMY B;  4R9L A;  4X2O A;  4XBX A;  2OTJ 3;  1VQ9 3;  2O9U X;  1OGZ A;  4IPB A;  2E2T A;  3PS8 A;  5STD A;  4R9K A;  1QJG A;  1SJW A;  1TFO A;  3EB8 A;  3KE7 A;  4H61 A;  2MC8 A;  3F40 A;  4K61 A;  3RGR A;  4N6M A;  1FGO A;  4TX4 A;  1JN5 A;  1GY5 A;  3CD6 3;  4J8T A;  5ELJ A;  3OWS A;  1ULI B;  2GEX A;  3OXA A;  2INX A;  3KZT A;  2QA4 3;  3OWY A;  2XSO B;  3EF8 A;  2CFD A;  1M1X B;  4EC6 A;  2ML5 A;  3X42 A;  2HMJ B;  3CNX A;  2BMQ B;  3E99 A;  3EX9 A;  4BTY A;  4AKZ A;  3NBR A;  1VQ7 3;  4MMZ B;  3S28 A;  3BNB A;  2Y74 A;  3HII A;  4LGQ A;  3Q1C A;  3EBY A;  4OUQ A;  3H51 A;  4AKY A;  3DGO A;  3CU3 A;  1IU7 A;  3KSE D;  3EJV A;  4K90 B;  2BMO B;  3Q2P A;  3DM8 A;  3DUK A;  1PU4 A;  1D6Z A;  2KCD A;  3B4O A;  4EV5 A;  3L0R A;  4GB5 A;  1YJ9 3;  3F14 A;  3PYJ A;  4MMX B;  1O7P B;  4CCV A;  1GYB A;  3NQY A;  3IJE B;  1QAF A;  1IVV A;  2OWP A;  3JUN A;  4LSO A;  3CCE 3;  1O7M B;  3N54 B;  3G16 A;  4ZM8 A;  3OWU A;  3T0U A;  1IVX A;  3NM2 A;  3PGB A;  4K1V A;  1Q86 4;  4L8P A;  5CF1 A;  2IUJ A;  4O2H A;  3FSD A;  1N5P A;  1R4C A;  5LC7 A;  4EXR A;  5JPP A;  1K8A 4;  3GZY B;  2HMN B;  3SED A;  1LNH A;  4IIA A;  3LT9 A;  4N6N B;  2W04 A;  3CXC 2;  2BMR B;  2D42 A;  1VQL 3;  1OHS A;  2CWV A;  5BXQ A;  5KP4 A;  2XH9 A;  2JQ5 A;  1IVW A;  2RCD A;  5JBS A;  1KC8 4;  5AIH A;  3UL6 A;  3WOF B;  2IMJ A;  2GU3 A;  3KSP A;  5D82 A;  3IPT A;  3J7Y d;  2YX9 A;  1WNH A;  3U97 A;  3CC7 3;  3B8L A;  1O7N B;  3CPO A;  5CLK A;  5TGN A;  3RGA A;  3X41 A;  3NQZ A;  3NBJ A;  3X40 A;  1AR0 A;  2W0Q A;  1LOX A;  3CCV 3;  1SPU A;  5KP1 A;  3K63 A;  1QAK A;  3FKA A;  3CMA 3;  2LQV A;  3QK9 A;  2M7O A;  1DMQ A;  3KN4 A;  1IQY A;  1IT7 A;  4NRE A;  4FMA A;  3HI7 A;  3GZR A;  3GWR A;  4FCM A;  4KFD A;  3X3X A;  3RDE A;  5AIG A;  2E2U A;  4QWT A;  3U1W A;  2W56 A;  3EC9 A;  1OPY A;  2KXG A;  1D6U A;  3WA2 X;  2BT3 A;  4R4K A;  4WWU C;  1KSI A;  1ROA A;  3EBT A;  1IVU A;  3QRD A;  1VQN 3;  2F99 A;  2QEX 3;  5G2G A;  4N3V A;  2HML B;  1JV2 B;  4FMD A;  1J2B A;  1KWI A;  1OAC A;  1UI7 A;  2QIY A;  2SBL A;  3O8Y A;  4HZB B;  5AEW B;  2XF3 A;  4KFE A;  2IA7 A;  3FH1 A;  2XGN A;  1VQO 3;  1W01 A;  4RZM A;  1IQ8 A;  1OF5 A;  2W9P A;  1JB5 A;  3F8X A;  4KZ1 A;  2CFW A;  4HJL B;  3DGM A;  3HK4 A;  1NWW A;  1IDP A;  2OOV C;  3MWZ A;  3S29 A;  3G4S 3;  3SX1 A;  3UJM A;  3VGN A;  1HKX A;  1Q82 4;  2B24 B;  2CKF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...