1N8R4

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1n8r400
3CCM3 3CCJ3 3CXC2 1YIJ3 1YJW3 1Q864 2QEX3 2QA43 1YJ93 2OTL3 1YJN3 1VQO3 3CC43 1KC84 1VQM3 1YIT3 1VQL3 1NJI4 1VQK3 3G6E3 3CCR3 3CD63 1QVF2 1VQ73 2OTJ3 3OW22 1S723 1VQ53 1Q824 3G713 3G4S3 1JJ22 1YI23 3CMA3 1KQS2 1K734 3I553 1Q7Y4 1VQ43 1QVG2 1K8A4 1M1K4 1VQ63 1VQN3 3CCU3 1KD14 1N8R4 3CPW2 1M904 3CCV3 1YHQ3 3CCE3 3CCQ3 3CCL3 1Q814 3CME3 3I563 3CC23 1W2B2 3CCS3 1VQ93 3CC73 1VQP3 1VQ83 1K9M4
chains in the Genus database with same CATH superfamily
1RRLA 2GU3A 2IMJA 4LGQA 3WDGB 3QRDA 1G96A 4I5QA 5AIIA 1OGZA 1IDPA 2Q07A 5BIRA 1QMAA 4J9AA 5CLKA 2ML5A 1RGCA 3SYUA 1GY7A 2CFGA 3ROBA 1Q824 3EBTA 4L7KA 3S28A 1OGXA 1W00A 2XRXB 3NHXA 4LEHA 3X41A 3IJEB 3ZFZA 2CWTA 3EQQB 1C7HA 1RGAA 1C54A 1WNHA 4FMDA 2AAEA 4K61A 4XBYA 1W2ZA 4CDLA 2OCTA 3STDA 1LOXA 3MKIA 4IPBA 1F8NA 1OPYA 4EYCA 1RNTA 3EF8A 1QALA 1D6ZA 3HIGA 3WOEB 4N6NB 5AIHA 1JZDA 2GSPA 3PYJA 3F14A 3MWZA 4FR9A 3RGAA 5A0OB 2CKFB 1BUQA 5G1KA 1UGIA 1BSDA 4MMYB 1US1A 2V1LA 2Y73A 4N3VA 1EG9B 1LOWA 1CQSA 1EA2A 1SARA 1FGTA 2R4IA 3EE1A 3H51A 4WFOA 3BU4A 1QJGA 2CIUA 4RNZA 1WQLB 8CHOA 2UX0A 3DXOA 4X2OA 1GY5A 3K9MC 3LMLA 4R4KA 1ULJB 2RSXA 1EUIC 4BL2A 5CF1A 4WYKB 1Z1SA 3FF2A 1LOYA 3AMOB 5BU4A 4MMXB 3F7SA 3T8UA 3NUVA 4NREA 3B4PA 4KFDA 1JBTA 1N5PA 3CCS3 2P38A 1OACA 3B8LA 1FGMA 4HBRA 4HM5B 4WP5A 4BTXA 1O7MB 3SVAA 3VSYA 3X3YA 4CCVA 1TRQA 4RNYA 1VQO3 2ZA4A 3DUKA 2CW9A 3Q2PA 4I4KA 1ZS7A 1HKXA 4MJDA 4HAAA 3D3LA 3MG2A 5ELUA 1AVLA 2BO9B 3UL6A 5EVHA 1VQ53 4ILFA 1OH0A 3FCSB 4R80A 2GU1A 3L0RA 5DRVA 3DZLA 1JJ22 2STDA 4NPBA 3HZPA 1B3SA 1W6GA 3EBYA 4HJLB 4WWUC 1DE3A 2W9QA 1BNEA 3OXAA 1RCKA 3CCU3 1GOVA 2XSOB 4STDA 1R4YA 1BNJA 4XM4A 3SOAA 1YHQ3 3CCE3 5AI1A 5FW5A 1DMMA 7RNTA 3KIIA 3KZTA 7STDA 4AEQA 1LQMB 1K28A 3SEDA 3CC73 1KC84 2KXGA 3CCM3 2W56A 3ZG5A 2OQEC 3J7Yd 3FLJA 2IY2A 1BOXA 3OWSA 1U8CB 3CPOA 2QA43 1FW7A 1BRSA 1JZOA 1SJWA 3DM8A 4HM3B 4N6TA 3BNBA 4H61A 3CNMA 2D1WA 1LNHA 1UCJA 1GS3A 1S723 2OOVA 3A76A 1I70A 2CHCA 4HM4B 4U13A 2XEPA 3S29A 4BL3A 5IENA 2Z76A 1YI23 2E2UA 4O02B 3OX9A 4HM6B 2KF3A 1I8VA 3Q1CA 3A5EA 1O7HB 1A2PA 4PEJA 1GYBA 1I0VA 2H0GA 1D6YA 3MSOA 5IW9A 3GZYB 4FCJA 1TRPA 4N6MA 2MC8A 2YFJB 5BXQA 5RNTA 3GWRA 1K9M4 1RDSA 2BMOB 3I0YA 4O3VA 3RDEA 3OV4A 5JPUA 2K0MA 4ZM8A 1BNSA 1RN4A 1I2GA 1YJN3 4GB5A 1K41A 1Q40A 3SLUA 1GD3A 2GXFA 4O2HA 1T2IA 2CX1A 1L5GB 3AGOA 2CH9A 1B2UA 1LRAA 3F9SA 1TIJA 1OF5B 3G6E3 1GMPA 1RGHA 2R41A 4WHAA 1CH0A 1FGOA 2BMQB 2B1XB 1RHLA 2E2TA 1WMNA 3NV0A 4HZ9B 1T2HA 4BTWA 4EC6A 1M1K4 1VQN3 3PGBA 5HOHA 1ROVA 5JPPA 1JN5B 1IYYA 2WGQA 3FH1A 3DGNA 4NHFA 3CME3 1ISKA 2XH9A 3HOHA 3NXJA 3DGYA 2FXTA 3LYGA 4BU4A 5IG0A 2XGLA 1UCIA 1PU4A 1YJ93 1B20A 1X1YA 3LH4A 3ZG0A 1NWWA 1FYSA 1JB2A 1UI8A 2GEYA 1RJOA 1VQL3 1V74A 5FGOA 5KP3A 1OHSA 1JRQA 1DVDA 1JNQA 2J8XB 4N6UA 5G2GA 4AKYA 2Z7AA 4O8SA 2CK3H 5BVBA 3NBJA 3BLZA 4CPKA 2CFWA 1BSBA 2XR8B 3K5TA 1Q7Y4 1J2BA 3WA2X 4XDWA 1Q42A 5KP1A 1FUSA 3MG3A 3SX1A 3WMDA 3CPW2 2LYXA 1V58A 2WOHA 3CC23 5ELJA 1YGEA 2BIRA 3GAXA 2C10A 1MWTA 4KFFA 2RFRA 3DH2A 4J5KA 2CG1A 5D83A 3T0UA 1TUHA 3CU3A 2BNGA 1ASKA 3MPHA 3NBBA 3NQZA 1FUTA 4FMAA 4K1VA 1R4CA 4XBXA 1OCVA 2M7OA 2P05A 1VQK3 1IVUA 1RLSA 2W2CA 2IYJA 2C4BA 2YFLB 1G0TA 2Z6BA 4FCMA 5IG4A 1BNFA 1SQWA 4GL6A 3X42A 2WO0A 3BNDA 3CMA3 5JBSA 3D9RA 1FGRA 1IV7A 1I3FA 2RCDA 4ORLA 5IERA 1NO3A 1I2EA 1BRIA 5AIGA 1BSAA 2RBIA 5M1AA 3S27A 1GD4A 2F4YA 3KN4A 3NM7A 5G1LA 1CYVA 1UW1A 2OQEA 2O3OA 3PXMA 1B2XA 1B2SA 2CC3A 2FGTA 2INXA 1DYUA 4G1MB 4HOHA 2KCDA 4OVMA 5AIFA 3MYTA 2CX0A 3F8HA 1JKGB 1RKYA 1DMQA 1NJI4 3BNEA 1DMNA 4FMBA 1VQ73 1NB3I 1OHPA 1RGEA 3HI7A 6GSPA 1EQKA 2YFIB 1TU5A 1K734 1IQYA 2HMMB 3LTBA 1AVKA 2HMJB 3JVCA 1HZ1A 4XDVA 3KSED 5I97A 1JB5A 3O8YA 1BRNL 3RNTA 4L8OA 1IT7A 3Q3FA 3Q90A 3TDGA 4R1KA 7GSPA 1PY3A 4GSPA 1CYUA 2JDIH 2WOFA 1IU7A 3G0KA 3MG1A 3T8NA 1BSEA 3FSDA 3D5IA 4FMCA 3V99A 3FZWA 4HM0B 2D42A 4AKZA 4WYKA 3EJVA 1TFOA 3K0ZA 3AMOA 3FG3A 3JUPA 1OUNA 3GSPA 4N6V0 3CNXA 2MF7A 2C11A 1A2KA 4TX4A 1OHOA 5CF2A 3X3XA 3VGNA 1W7CA 4HM2B 3LT9A 4HZBB 2F86B 1K8A4 1JBRA 3WOFB 1NNVA 3D4AA 3U1WA 1O7WB 4K90B 1WMOA 1KSIA 3B7CA 2F56A 4OK0A 1DETA 4X2HA 5KP4A 4XBTA 1N9JA 3KKGA 1D6UA 3DGLA 5TGNA 1I0XA 1LXEA 1UDII 1W6YA 3LOYA 5AEWB 2KF5A 1V57A 6STDA 3EX9A 3UNLA 1B27A 1T3BA 1LNIA 1Y4KA 1BRGA 3CD63 3F7XA 1EKMA 1ULIB 3G8ZA 5M19A 2H0HA 1RGLA 4LYLB 3PCSA 3S5CA 1VZZA 4GHOA 2CWVA 3DY5A 3CCV3 3LTDA 1IVWA 5LC6A 1BAOA 1BNRA 2KF6A 3CCQ3 3CCL3 3N8BA 3QK9A 1RN7A 3G4S3 1RN1A 1JV2B 2O9UX 6RNTA 1W01A 1GY6A 2W04A 1Q9EA 1I2FA 3X3ZA 2OTL3 1W5ZA 3LZAA 3PZWA 1TFKA 2QIYA 4EV5A 1AQZA 3EHCA 1YIT3 2B24B 2K54A 1IVVA 1HYFA 2XSHB 2OOVC 4EV2A 3OW22 4J8TA 2CG0A 4FCZA 3JUOA 4H3UA 3AGNA 1IT8A 1UCLA 1UGHI 2HMKB 4OUQA 3GZBA 3JUNA 3URPA 2F5MA 1FGQA 3D79A 4QWTA 1VQ43 1IK3A 1M904 5STDA 3WR2A 3UJMA 3GRDA 1M9GA 2IUKA 2P0MA 1IVXA 1AV4A 3BNCA 1RTUA 3NM2A 4EBGA 2E2VA 1VQP3 1BRJA 1VQ63 1OF5A 2RNTA 3LTCA 5CK6A 2CFLA 2KRTA 1CEWI 3SOYA 5IEPA 2XFSA 1ZO2A 4EW5A 2Y74A 3KSPA 3D5GA 3HIIA 2PNCA 1BUJA 1B2ZA 1N8QA 1SPUA 2XFTA 4KFEA 4JRFA 1JN5A 1B21A 2XGNA 4BIRA 2KAAA 1MWRA 4KZ1A 1RSNA 2SARA 3FG1A 5IG3A 3PCRA 1M1XB 1IV9A 3NX0A 1LVNA 3ECFA 2UGIA 3DMCA 3JUQA 1QVG2 2L4VA 1MWSA 2KF4A 1N8R4 4IT7A 2IUJA 1BGSA 3WA3A 3OWUA 2I9WA 3I563 3FGYA 3BIRA 1BSCA 1YVBI 2OWPA 1W2B2 2HOHA 1B2MA 1GSPA 1PFPA 3V92A 1WMPA 1YJW3 1O7NB 3IMAB 3KFQC 1GOYA 3E99A 3EN8A 2GBWB 3CC43 2W03A 1ROAA 1MNLA 1BRHA 4HKVB 4IIAA 4LZIA 3UL5A 1X1XA 4KVHA 1KWIA 5AEUB 3CCR3 2W0QA 1MGWA 4HVNA 3OWYA 5M18A 2W56B 1RGKA 2F5WA 2W6JH 1AR0A 1QAFA 1SIHA 3AHWA 1RGGA 2GEXA 2SBLA 1TP6A 1TTOA 1KD14 4N6LA 3B4OA 3NQYA 3N54B 1W02A 5CXOA 5AYSC 3S67A 4LMIA 1Q814 4MMZB 2P0XA 1A67A 1Q7HA 1UUVB 3BB9A 4RNTA 4EXRA 3WODG 1FUWA 3LXUX 2F98A 2BT3A 1A90A 4HM7B 5IG5A 3PS8A 1IQ8A 1O7PB 2FNQA 4HYZA 8RNTA 5IEOA 1A2VA 1W4NA 4MEIA 1NU3A 4J5GA 1STDA 3F40A 1STFI 1JB4A 1RMSA 4KT3B 3EB8A 4N6OB 3LT8A 1N9EA 1UUGB 1QVF2 2GBXB 4LSOA 2CWUA 3GZXB 4JF8A 3G713 1DVCA 1UCKA 3V98A 2HMNB 1Q40B 2BHMA 2PZVA 2RGQA 2ZHXB 3FKAA 1MWUA 1ZGXA 1ZX2A 3I553 4RZMA 3KCHA 4HM1B 4BTYA 3IPTA 1GOUA 3FF0A 2BMRB 2K3DA 5EQLA 3K63A 3RGRA 1AY7A 2XF3A 3NBRA 1BANA 1UI7A 4HM8B 3SXXA 1E97A 1JKGA 2P09A 1NB5I 2W9PA 1RNBA 3G16A 1BNIA 1VQ83 2H0IA 2LQVA 3KE7A 3CXC2 1W6CA 4K1UA 5HGRA 2Z77A 1YIJ3 2QEX3 3JUMA 3NV0B 1N5HA 3EN1B 4XB5A 4R9LA 2IA7A 5EEOA 1O7GB 3HK4A 4DKIA 5IF6A 1QAKA 2QGUA 1MOLA 3H3HA 1YNVX 9RNTA 2CFKA 3ALAA 1T5YA 1BNGA 1LOVA 1BU4A 3U97A 2HMLB 3UB1A 1VQQA 3VF1A 5AYRB 2HMOB 1IQXA 2ZL8A 1JBSA 1X1UA 3M8CA 1I3IA 1X1WA 1SIIA 3HX8A 3X40A 1YGWA 5DREA 1LQGC 1YVSA 1VQ93 1PYLA 4Q53A 1GMQA 1E3VA 3MHEA 4RBNA 1NDOB 3FG4A 4CJNA 1RGFA 2F99A 3CCJ3 1Q864 1U5OA 1TJDA 4R9KA 1BRKA 2ML6A 5D82A 5D81A 5GSPA 1HU9A 2A15A 1FZUA 3WHOA 1VQM3 3DGOA 2L1SA 2YX9A 3EC9A 2UUGC 1UUWB 2OTJ3 3DGMA 1GMRA 1RCLA 2WGOA 2ZDJA 1MGRA 1WTHA 1BIRA 2AADA 1KQS2 3GZRA 3LTAA 1BVIA 1FA3A 2CFDA 1EEJA 3F8XA 2BU4A 3N9HA 1G02A 1RRHA 3AHSA 1S5AA 1E3RA 2JQ5A 3ER7A 3K7CA 5LC7A 4L8PA
chains in the Genus database with same CATH topology
1RRLA 2GU3A 2IMJA 4LGQA 3WDGB 3QRDA 1G96A 5AIIA 1OGZA 1IDPA 2Q07A 1QMAA 4J9AA 5CLKA 2ML5A 1GY7A 2CFGA 3ROBA 1Q824 3EBTA 4L7KA 3S28A 1OGXA 1W00A 2XRXB 3NHXA 4LEHA 3X41A 3IJEB 2CWTA 3EQQB 1C7HA 1WNHA 4FMDA 4K61A 4XBYA 4CDLA 1W2ZA 2OCTA 3STDA 1LOXA 3MKIA 4IPBA 1F8NA 1OPYA 4EYCA 3EF8A 1QALA 1D6ZA 3HIGA 3WOEB 4N6NB 5AIHA 3PYJA 3F14A 3MWZA 4FR9A 3RGAA 5A0OB 2CKFB 1BUQA 4MMYB 1US1A 2V1LA 2Y73A 4N3VA 1EG9B 3H51A 1CQSA 1EA2A 4WFOA 1FGTA 2R4IA 3EE1A 1QJGA 2CIUA 4RNZA 1WQLB 8CHOA 2UX0A 3DXOA 4X2OA 1GY5A 3K9MC 3LMLA 4R4KA 1ULJB 2RSXA 5CF1A 4WYKB 1Z1SA 3FF2A 3AMOB 4MMXB 3F7SA 3T8UA 3NUVA 4NREA 3B4PA 4KFDA 1N5PA 3CCS3 2P38A 1OACA 3B8LA 1FGMA 4HBRA 4HM5B 4WP5A 4BTXA 1O7MB 3SVAA 3VSYA 3X3YA 4CCVA 4RNYA 1VQO3 3DUKA 2CW9A 3Q2PA 4I4KA 1HKXA 4MJDA 3D3LA 3MG2A 5ELUA 1AVLA 2BO9B 3UL6A 5EVHA 1VQ53 1OH0A 3FCSB 4R80A 2GU1A 3L0RA 5DRVA 3DZLA 1JJ22 2STDA 3HZPA 1W6GA 3EBYA 4HJLB 4WWUC 2W9QA 3OXAA 3CCU3 2XSOB 4STDA 4XM4A 3SOAA 1YHQ3 3CCE3 5AI1A 5FW5A 1DMMA 3KIIA 3KZTA 7STDA 4AEQA 3SEDA 1K28A 3CC73 1KC84 2KXGA 3CCM3 2W56A 3J7Yd 2OQEC 3FLJA 3OWSA 2QA43 1U8CB 3CPOA 3DM8A 1SJWA 4HM3B 4N6TA 3BNBA 4H61A 3CNMA 2D1WA 1LNHA 1S723 1GS3A 2OOVA 3A76A 4HM4B 2CHCA 4U13A 2XEPA 3S29A 5IENA 2Z76A 1YI23 2E2UA 4O02B 3OX9A 4HM6B 3Q1CA 1O7HB 4PEJA 1GYBA 1D6YA 3MSOA 5IW9A 3GZYB 4FCJA 4N6MA 2MC8A 2YFJB 5BXQA 3GWRA 1K9M4 2BMOB 3I0YA 3RDEA 4O3VA 3OV4A 5JPUA 2K0MA 4ZM8A 1YJN3 4GB5A 1K41A 1Q40A 3SLUA 1GD3A 2GXFA 4O2HA 1L5GB 2CH9A 3F9SA 3G6E3 1TIJA 1OF5B 4WHAA 1FGOA 2BMQB 2B1XB 2E2TA 4HZ9B 1WMNA 3NV0A 4BTWA 4EC6A 1M1K4 1VQN3 3PGBA 5JPPA 1ROVA 1JN5B 2WGQA 3FH1A 3DGNA 4NHFA 3CME3 1ISKA 2XH9A 3NXJA 2FXTA 3LYGA 5IG0A 2XGLA 1PU4A 1YJ93 3LH4A 1NWWA 1JB2A 1UI8A 2GEYA 1RJOA 1VQL3 1V74A 5FGOA 5KP3A 1OHSA 1JRQA 1DVDA 1JNQA 4N6UA 4AKYA 5G2GA 2Z7AA 4O8SA 2CK3H 5BVBA 3NBJA 3BLZA 2CFWA 2XR8B 3K5TA 1Q7Y4 1J2BA 3WA2X 4XDWA 1Q42A 5KP1A 3MG3A 3SX1A 3WMDA 3CPW2 2LYXA 2WOHA 3CC23 5ELJA 1YGEA 3GAXA 2C10A 4KFFA 2RFRA 2CG1A 5D83A 3T0UA 1TUHA 3CU3A 2BNGA 1ASKA 3MPHA 3NBBA 3NQZA 4FMAA 4K1VA 1R4CA 4XBXA 1OCVA 2M7OA 2P05A 1VQK3 1IVUA 2YFLB 2W2CA 2Z6BA 4FCMA 5IG4A 1SQWA 4GL6A 3X42A 2WO0A 3BNDA 3CMA3 5JBSA 3D9RA 1FGRA 1IV7A 2RCDA 4ORLA 5IERA 1NO3A 5AIGA 3S27A 1GD4A 3KN4A 3NM7A 1CYVA 1UW1A 2OQEA 2O3OA 3PXMA 2CC3A 2FGTA 2INXA 1DYUA 4G1MB 2KCDA 4OVMA 5AIFA 3MYTA 3F8HA 1JKGB 1RKYA 1DMQA 1NJI4 3BNEA 1DMNA 4FMBA 1VQ73 1NB3I 1OHPA 3HI7A 1EQKA 2YFIB 1TU5A 1K734 1IQYA 2HMMB 3LTBA 1AVKA 2HMJB 3JVCA 4XDVA 3KSED 5I97A 1JB5A 3O8YA 4L8OA 1IT7A 3Q90A 3TDGA 4R1KA 1CYUA 2JDIH 2WOFA 1IU7A 3G0KA 3MG1A 3T8NA 3FSDA 4FMCA 3V99A 3FZWA 4HM0B 2D42A 4AKZA 4WYKA 3EJVA 1TFOA 3K0ZA 3AMOA 3FG3A 3JUPA 1OUNA 4N6V0 3CNXA 2MF7A 2C11A 1A2KA 4TX4A 1OHOA 5CF2A 3X3XA 3VGNA 1W7CA 4HM2B 3LT9A 4HZBB 2F86B 1K8A4 3WOFB 3U1WA 1O7WB 4K90B 1WMOA 1KSIA 3B7CA 4OK0A 5KP4A 4X2HA 4XBTA 1N9JA 3KKGA 1D6UA 3DGLA 5TGNA 1LXEA 1W6YA 3LOYA 5AEWB 6STDA 3EX9A 3UNLA 1Y4KA 3CD63 3F7XA 1EKMA 1ULIB 3G8ZA 3PCSA 3S5CA 1VZZA 2CWVA 3DY5A 3CCV3 3LTDA 1IVWA 5LC6A 3CCQ3 3CCL3 3N8BA 3QK9A 1RN7A 3G4S3 1JV2B 2O9UX 1W01A 1GY6A 2W04A 3X3ZA 2OTL3 1W5ZA 3LZAA 3PZWA 1TFKA 2QIYA 4EV5A 3EHCA 1YIT3 2B24B 2K54A 1IVVA 2XSHB 2OOVC 4EV2A 3OW22 4J8TA 2CG0A 4FCZA 3JUOA 4H3UA 1IT8A 4OUQA 2HMKB 3GZBA 3JUNA 1FGQA 4QWTA 1VQ43 1IK3A 1M904 5STDA 3UJMA 3GRDA 1M9GA 2IUKA 2P0MA 1IVXA 1AV4A 3BNCA 3NM2A 4EBGA 2E2VA 1VQP3 1VQ63 1OF5A 3LTCA 5CK6A 2CFLA 2KRTA 1CEWI 3SOYA 5IEPA 2XFSA 1ZO2A 2Y74A 3KSPA 3HIIA 2PNCA 1N8QA 1SPUA 4KFEA 2XFTA 4JRFA 1JN5A 2XGNA 4KZ1A 3FG1A 5IG3A 3PCRA 1M1XB 1IV9A 3NX0A 1LVNA 3ECFA 3DMCA 3JUQA 1QVG2 2L4VA 1N8R4 4IT7A 2IUJA 3WA3A 3OWUA 2I9WA 3I563 3FGYA 1W2B2 2OWPA 1YVBI 1PFPA 3V92A 1WMPA 1YJW3 1O7NB 3IMAB 3KFQC 3E99A 3EN8A 2GBWB 3CC43 2W03A 1ROAA 1MNLA 4IIAA 4HKVB 4LZIA 3UL5A 4KVHA 1KWIA 5AEUB 3CCR3 2W0QA 4HVNA 3OWYA 2W56B 2W6JH 1AR0A 1QAFA 1SIHA 2GEXA 2SBLA 1TP6A 1KD14 4N6LA 3B4OA 3NQYA 3N54B 1W02A 5CXOA 5AYSC 3S67A 4LMIA 1Q814 4MMZB 2P0XA 1A67A 1UUVB 4EXRA 3BB9A 3WODG 1FUWA 3LXUX 2F98A 2BT3A 1A90A 4HM7B 5IG5A 3PS8A 1IQ8A 1O7PB 2FNQA 4HYZA 5IEOA 1A2VA 1W4NA 4MEIA 1NU3A 1STDA 3F40A 1STFI 1JB4A 3EB8A 4N6OB 3LT8A 1N9EA 1QVF2 2GBXB 4LSOA 2CWUA 3GZXB 4JF8A 3G713 1DVCA 3V98A 2HMNB 1Q40B 2BHMA 2PZVA 2RGQA 3FKAA 3I553 1ZX2A 4RZMA 4HM1B 4BTYA 3IPTA 3RGRA 3FF0A 2BMRB 5EQLA 3K63A 2XF3A 3NBRA 4HM8B 1UI7A 3SXXA 1E97A 1JKGA 2P09A 1NB5I 2W9PA 3G16A 1VQ83 2LQVA 3KE7A 3CXC2 1W6CA 4K1UA 5HGRA 2Z77A 1YIJ3 2QEX3 3JUMA 3NV0B 1N5HA 3EN1B 4XB5A 4R9LA 2IA7A 5EEOA 1O7GB 3HK4A 5IF6A 1QAKA 2QGUA 1MOLA 3H3HA 2CFKA 3ALAA 1T5YA 3U97A 2HMLB 3UB1A 3VF1A 5AYRB 2HMOB 1IQXA 2ZL8A 3M8CA 1SIIA 3HX8A 3X40A 5DREA 1VQ93 4Q53A 1E3VA 3MHEA 4RBNA 1NDOB 3FG4A 3CCJ3 2F99A 1Q864 1U5OA 4R9KA 2ML6A 5D82A 5D81A 1HU9A 2A15A 1VQM3 3DGOA 2YX9A 3EC9A 1UUWB 2OTJ3 3DGMA 2WGOA 2ZDJA 1WTHA 1KQS2 3GZRA 3LTAA 1FA3A 2CFDA 3F8XA 3N9HA 1RRHA 1S5AA 1E3RA 2JQ5A 3ER7A 3K7CA 5LC7A 4L8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM 3;  3CCJ 3;  3CXC 2;  1YIJ 3;  1YJW 3;  1Q86 4;  2QEX 3;  2QA4 3;  1YJ9 3;  2OTL 3;  1YJN 3;  1VQO 3;  3CC4 3;  1KC8 4;  1VQM 3;  1YIT 3;  1VQL 3;  1NJI 4;  1VQK 3;  3G6E 3;  3CCR 3;  3CD6 3;  1QVF 2;  1VQ7 3;  2OTJ 3;  3OW2 2;  1S72 3;  1VQ5 3;  1Q82 4;  3G71 3;  3G4S 3;  1JJ2 2;  1YI2 3;  3CMA 3;  1KQS 2;  1K73 4;  3I55 3;  1Q7Y 4;  1VQ4 3;  1QVG 2;  1K8A 4;  1M1K 4;  1VQ6 3;  1VQN 3;  3CCU 3;  1KD1 4;  1N8R 4;  3CPW 2;  1M90 4;  3CCV 3;  1YHQ 3;  3CCE 3;  3CCQ 3;  3CCL 3;  1Q81 4;  3CME 3;  3I56 3;  3CC2 3;  1W2B 2;  3CCS 3;  1VQ9 3;  3CC7 3;  1VQP 3;  1VQ8 3;  1K9M 4; 
#chains in the Genus database with same CATH topology
 1RRL A;  2GU3 A;  2IMJ A;  4LGQ A;  3WDG B;  3QRD A;  1G96 A;  4I5Q A;  5AII A;  1OGZ A;  1IDP A;  2Q07 A;  5BIR A;  1QMA A;  4J9A A;  5CLK A;  2ML5 A;  1RGC A;  3SYU A;  1GY7 A;  2CFG A;  3ROB A;  1Q82 4;  3EBT A;  4L7K A;  3S28 A;  1OGX A;  1W00 A;  2XRX B;  3NHX A;  4LEH A;  3X41 A;  3IJE B;  3ZFZ A;  2CWT A;  3EQQ B;  1C7H A;  1RGA A;  1C54 A;  1WNH A;  4FMD A;  2AAE A;  4K61 A;  4XBY A;  1W2Z A;  4CDL A;  2OCT A;  3STD A;  1LOX A;  3MKI A;  4IPB A;  1F8N A;  1OPY A;  4EYC A;  1RNT A;  3EF8 A;  1QAL A;  1D6Z A;  3HIG A;  3WOE B;  4N6N B;  5AIH A;  1JZD A;  2GSP A;  3PYJ A;  3F14 A;  3MWZ A;  4FR9 A;  3RGA A;  5A0O B;  2CKF B;  1BUQ A;  5G1K A;  1UGI A;  1BSD A;  4MMY B;  1US1 A;  2V1L A;  2Y73 A;  4N3V A;  1EG9 B;  1LOW A;  1CQS A;  1EA2 A;  1SAR A;  1FGT A;  2R4I A;  3EE1 A;  3H51 A;  4WFO A;  3BU4 A;  1QJG A;  2CIU A;  4RNZ A;  1WQL B;  8CHO A;  2UX0 A;  3DXO A;  4X2O A;  1GY5 A;  3K9M C;  3LML A;  4R4K A;  1ULJ B;  2RSX A;  1EUI C;  4BL2 A;  5CF1 A;  4WYK B;  1Z1S A;  3FF2 A;  1LOY A;  3AMO B;  5BU4 A;  4MMX B;  3F7S A;  3T8U A;  3NUV A;  4NRE A;  3B4P A;  4KFD A;  1JBT A;  1N5P A;  3CCS 3;  2P38 A;  1OAC A;  3B8L A;  1FGM A;  4HBR A;  4HM5 B;  4WP5 A;  4BTX A;  1O7M B;  3SVA A;  3VSY A;  3X3Y A;  4CCV A;  1TRQ A;  4RNY A;  1VQO 3;  2ZA4 A;  3DUK A;  2CW9 A;  3Q2P A;  4I4K A;  1ZS7 A;  1HKX A;  4MJD A;  4HAA A;  3D3L A;  3MG2 A;  5ELU A;  1AVL A;  2BO9 B;  3UL6 A;  5EVH A;  1VQ5 3;  4ILF A;  1OH0 A;  3FCS B;  4R80 A;  2GU1 A;  3L0R A;  5DRV A;  3DZL A;  1JJ2 2;  2STD A;  4NPB A;  3HZP A;  1B3S A;  1W6G A;  3EBY A;  4HJL B;  4WWU C;  1DE3 A;  2W9Q A;  1BNE A;  3OXA A;  1RCK A;  3CCU 3;  1GOV A;  2XSO B;  4STD A;  1R4Y A;  1BNJ A;  4XM4 A;  3SOA A;  1YHQ 3;  3CCE 3;  5AI1 A;  5FW5 A;  1DMM A;  7RNT A;  3KII A;  3KZT A;  7STD A;  4AEQ A;  1LQM B;  1K28 A;  3SED A;  3CC7 3;  1KC8 4;  2KXG A;  3CCM 3;  2W56 A;  3ZG5 A;  2OQE C;  3J7Y d;  3FLJ A;  2IY2 A;  1BOX A;  3OWS A;  1U8C B;  3CPO A;  2QA4 3;  1FW7 A;  1BRS A;  1JZO A;  1SJW A;  3DM8 A;  4HM3 B;  4N6T A;  3BNB A;  4H61 A;  3CNM A;  2D1W A;  1LNH A;  1UCJ A;  1GS3 A;  1S72 3;  2OOV A;  3A76 A;  1I70 A;  2CHC A;  4HM4 B;  4U13 A;  2XEP A;  3S29 A;  4BL3 A;  5IEN A;  2Z76 A;  1YI2 3;  2E2U A;  4O02 B;  3OX9 A;  4HM6 B;  2KF3 A;  1I8V A;  3Q1C A;  3A5E A;  1O7H B;  1A2P A;  4PEJ A;  1GYB A;  1I0V A;  2H0G A;  1D6Y A;  3MSO A;  5IW9 A;  3GZY B;  4FCJ A;  1TRP A;  4N6M A;  2MC8 A;  2YFJ B;  5BXQ A;  5RNT A;  3GWR A;  1K9M 4;  1RDS A;  2BMO B;  3I0Y A;  4O3V A;  3RDE A;  3OV4 A;  5JPU A;  2K0M A;  4ZM8 A;  1BNS A;  1RN4 A;  1I2G A;  1YJN 3;  4GB5 A;  1K41 A;  1Q40 A;  3SLU A;  1GD3 A;  2GXF A;  4O2H A;  1T2I A;  2CX1 A;  1L5G B;  3AGO A;  2CH9 A;  1B2U A;  1LRA A;  3F9S A;  1TIJ A;  1OF5 B;  3G6E 3;  1GMP A;  1RGH A;  2R41 A;  4WHA A;  1CH0 A;  1FGO A;  2BMQ B;  2B1X B;  1RHL A;  2E2T A;  1WMN A;  3NV0 A;  4HZ9 B;  1T2H A;  4BTW A;  4EC6 A;  1M1K 4;  1VQN 3;  3PGB A;  5HOH A;  1ROV A;  5JPP A;  1JN5 B;  1IYY A;  2WGQ A;  3FH1 A;  3DGN A;  4NHF A;  3CME 3;  1ISK A;  2XH9 A;  3HOH A;  3NXJ A;  3DGY A;  2FXT A;  3LYG A;  4BU4 A;  5IG0 A;  2XGL A;  1UCI A;  1PU4 A;  1YJ9 3;  1B20 A;  1X1Y A;  3LH4 A;  3ZG0 A;  1NWW A;  1FYS A;  1JB2 A;  1UI8 A;  2GEY A;  1RJO A;  1VQL 3;  1V74 A;  5FGO A;  5KP3 A;  1OHS A;  1JRQ A;  1DVD A;  1JNQ A;  2J8X B;  4N6U A;  5G2G A;  4AKY A;  2Z7A A;  4O8S A;  2CK3 H;  5BVB A;  3NBJ A;  3BLZ A;  4CPK A;  2CFW A;  1BSB A;  2XR8 B;  3K5T A;  1Q7Y 4;  1J2B A;  3WA2 X;  4XDW A;  1Q42 A;  5KP1 A;  1FUS A;  3MG3 A;  3SX1 A;  3WMD A;  3CPW 2;  2LYX A;  1V58 A;  2WOH A;  3CC2 3;  5ELJ A;  1YGE A;  2BIR A;  3GAX A;  2C10 A;  1MWT A;  4KFF A;  2RFR A;  3DH2 A;  4J5K A;  2CG1 A;  5D83 A;  3T0U A;  1TUH A;  3CU3 A;  2BNG A;  1ASK A;  3MPH A;  3NBB A;  3NQZ A;  1FUT A;  4FMA A;  4K1V A;  1R4C A;  4XBX A;  1OCV A;  2M7O A;  2P05 A;  1VQK 3;  1IVU A;  1RLS A;  2W2C A;  2IYJ A;  2C4B A;  2YFL B;  1G0T A;  2Z6B A;  4FCM A;  5IG4 A;  1BNF A;  1SQW A;  4GL6 A;  3X42 A;  2WO0 A;  3BND A;  3CMA 3;  5JBS A;  3D9R A;  1FGR A;  1IV7 A;  1I3F A;  2RCD A;  4ORL A;  5IER A;  1NO3 A;  1I2E A;  1BRI A;  5AIG A;  1BSA A;  2RBI A;  5M1A A;  3S27 A;  1GD4 A;  2F4Y A;  3KN4 A;  3NM7 A;  5G1L A;  1CYV A;  1UW1 A;  2OQE A;  2O3O A;  3PXM A;  1B2X A;  1B2S A;  2CC3 A;  2FGT A;  2INX A;  1DYU A;  4G1M B;  4HOH A;  2KCD A;  4OVM A;  5AIF A;  3MYT A;  2CX0 A;  3F8H A;  1JKG B;  1RKY A;  1DMQ A;  1NJI 4;  3BNE A;  1DMN A;  4FMB A;  1VQ7 3;  1NB3 I;  1OHP A;  1RGE A;  3HI7 A;  6GSP A;  1EQK A;  2YFI B;  1TU5 A;  1K73 4;  1IQY A;  2HMM B;  3LTB A;  1AVK A;  2HMJ B;  3JVC A;  1HZ1 A;  4XDV A;  3KSE D;  5I97 A;  1JB5 A;  3O8Y A;  1BRN L;  3RNT A;  4L8O A;  1IT7 A;  3Q3F A;  3Q90 A;  3TDG A;  4R1K A;  7GSP A;  1PY3 A;  4GSP A;  1CYU A;  2JDI H;  2WOF A;  1IU7 A;  3G0K A;  3MG1 A;  3T8N A;  1BSE A;  3FSD A;  3D5I A;  4FMC A;  3V99 A;  3FZW A;  4HM0 B;  2D42 A;  4AKZ A;  4WYK A;  3EJV A;  1TFO A;  3K0Z A;  3AMO A;  3FG3 A;  3JUP A;  1OUN A;  3GSP A;  4N6V 0;  3CNX A;  2MF7 A;  2C11 A;  1A2K A;  4TX4 A;  1OHO A;  5CF2 A;  3X3X A;  3VGN A;  1W7C A;  4HM2 B;  3LT9 A;  4HZB B;  2F86 B;  1K8A 4;  1JBR A;  3WOF B;  1NNV A;  3D4A A;  3U1W A;  1O7W B;  4K90 B;  1WMO A;  1KSI A;  3B7C A;  2F56 A;  4OK0 A;  1DET A;  4X2H A;  5KP4 A;  4XBT A;  1N9J A;  3KKG A;  1D6U A;  3DGL A;  5TGN A;  1I0X A;  1LXE A;  1UDI I;  1W6Y A;  3LOY A;  5AEW B;  2KF5 A;  1V57 A;  6STD A;  3EX9 A;  3UNL A;  1B27 A;  1T3B A;  1LNI A;  1Y4K A;  1BRG A;  3CD6 3;  3F7X A;  1EKM A;  1ULI B;  3G8Z A;  5M19 A;  2H0H A;  1RGL A;  4LYL B;  3PCS A;  3S5C A;  1VZZ A;  4GHO A;  2CWV A;  3DY5 A;  3CCV 3;  3LTD A;  1IVW A;  5LC6 A;  1BAO A;  1BNR A;  2KF6 A;  3CCQ 3;  3CCL 3;  3N8B A;  3QK9 A;  1RN7 A;  3G4S 3;  1RN1 A;  1JV2 B;  2O9U X;  6RNT A;  1W01 A;  1GY6 A;  2W04 A;  1Q9E A;  1I2F A;  3X3Z A;  2OTL 3;  1W5Z A;  3LZA A;  3PZW A;  1TFK A;  2QIY A;  4EV5 A;  1AQZ A;  3EHC A;  1YIT 3;  2B24 B;  2K54 A;  1IVV A;  1HYF A;  2XSH B;  2OOV C;  4EV2 A;  3OW2 2;  4J8T A;  2CG0 A;  4FCZ A;  3JUO A;  4H3U A;  3AGN A;  1IT8 A;  1UCL A;  1UGH I;  2HMK B;  4OUQ A;  3GZB A;  3JUN A;  3URP A;  2F5M A;  1FGQ A;  3D79 A;  4QWT A;  1VQ4 3;  1IK3 A;  1M90 4;  5STD A;  3WR2 A;  3UJM A;  3GRD A;  1M9G A;  2IUK A;  2P0M A;  1IVX A;  1AV4 A;  3BNC A;  1RTU A;  3NM2 A;  4EBG A;  2E2V A;  1VQP 3;  1BRJ A;  1VQ6 3;  1OF5 A;  2RNT A;  3LTC A;  5CK6 A;  2CFL A;  2KRT A;  1CEW I;  3SOY A;  5IEP A;  2XFS A;  1ZO2 A;  4EW5 A;  2Y74 A;  3KSP A;  3D5G A;  3HII A;  2PNC A;  1BUJ A;  1B2Z A;  1N8Q A;  1SPU A;  2XFT A;  4KFE A;  4JRF A;  1JN5 A;  1B21 A;  2XGN A;  4BIR A;  2KAA A;  1MWR A;  4KZ1 A;  1RSN A;  2SAR A;  3FG1 A;  5IG3 A;  3PCR A;  1M1X B;  1IV9 A;  3NX0 A;  1LVN A;  3ECF A;  2UGI A;  3DMC A;  3JUQ A;  1QVG 2;  2L4V A;  1MWS A;  2KF4 A;  1N8R 4;  4IT7 A;  2IUJ A;  1BGS A;  3WA3 A;  3OWU A;  2I9W A;  3I56 3;  3FGY A;  3BIR A;  1BSC A;  1YVB I;  2OWP A;  1W2B 2;  2HOH A;  1B2M A;  1GSP A;  1PFP A;  3V92 A;  1WMP A;  1YJW 3;  1O7N B;  3IMA B;  3KFQ C;  1GOY A;  3E99 A;  3EN8 A;  2GBW B;  3CC4 3;  2W03 A;  1ROA A;  1MNL A;  1BRH A;  4HKV B;  4IIA A;  4LZI A;  3UL5 A;  1X1X A;  4KVH A;  1KWI A;  5AEU B;  3CCR 3;  2W0Q A;  1MGW A;  4HVN A;  3OWY A;  5M18 A;  2W56 B;  1RGK A;  2F5W A;  2W6J H;  1AR0 A;  1QAF A;  1SIH A;  3AHW A;  1RGG A;  2GEX A;  2SBL A;  1TP6 A;  1TTO A;  1KD1 4;  4N6L A;  3B4O A;  3NQY A;  3N54 B;  1W02 A;  5CXO A;  5AYS C;  3S67 A;  4LMI A;  1Q81 4;  4MMZ B;  2P0X A;  1A67 A;  1Q7H A;  1UUV B;  3BB9 A;  4RNT A;  4EXR A;  3WOD G;  1FUW A;  3LXU X;  2F98 A;  2BT3 A;  1A90 A;  4HM7 B;  5IG5 A;  3PS8 A;  1IQ8 A;  1O7P B;  2FNQ A;  4HYZ A;  8RNT A;  5IEO A;  1A2V A;  1W4N A;  4MEI A;  1NU3 A;  4J5G A;  1STD A;  3F40 A;  1STF I;  1JB4 A;  1RMS A;  4KT3 B;  3EB8 A;  4N6O B;  3LT8 A;  1N9E A;  1UUG B;  1QVF 2;  2GBX B;  4LSO A;  2CWU A;  3GZX B;  4JF8 A;  3G71 3;  1DVC A;  1UCK A;  3V98 A;  2HMN B;  1Q40 B;  2BHM A;  2PZV A;  2RGQ A;  2ZHX B;  3FKA A;  1MWU A;  1ZGX A;  1ZX2 A;  3I55 3;  4RZM A;  3KCH A;  4HM1 B;  4BTY A;  3IPT A;  1GOU A;  3FF0 A;  2BMR B;  2K3D A;  5EQL A;  3K63 A;  3RGR A;  1AY7 A;  2XF3 A;  3NBR A;  1BAN A;  1UI7 A;  4HM8 B;  3SXX A;  1E97 A;  1JKG A;  2P09 A;  1NB5 I;  2W9P A;  1RNB A;  3G16 A;  1BNI A;  1VQ8 3;  2H0I A;  2LQV A;  3KE7 A;  3CXC 2;  1W6C A;  4K1U A;  5HGR A;  2Z77 A;  1YIJ 3;  2QEX 3;  3JUM A;  3NV0 B;  1N5H A;  3EN1 B;  4XB5 A;  4R9L A;  2IA7 A;  5EEO A;  1O7G B;  3HK4 A;  4DKI A;  5IF6 A;  1QAK A;  2QGU A;  1MOL A;  3H3H A;  1YNV X;  9RNT A;  2CFK A;  3ALA A;  1T5Y A;  1BNG A;  1LOV A;  1BU4 A;  3U97 A;  2HML B;  3UB1 A;  1VQQ A;  3VF1 A;  5AYR B;  2HMO B;  1IQX A;  2ZL8 A;  1JBS A;  1X1U A;  3M8C A;  1I3I A;  1X1W A;  1SII A;  3HX8 A;  3X40 A;  1YGW A;  5DRE A;  1LQG C;  1YVS A;  1VQ9 3;  1PYL A;  4Q53 A;  1GMQ A;  1E3V A;  3MHE A;  4RBN A;  1NDO B;  3FG4 A;  4CJN A;  1RGF A;  2F99 A;  3CCJ 3;  1Q86 4;  1U5O A;  1TJD A;  4R9K A;  1BRK A;  2ML6 A;  5D82 A;  5D81 A;  5GSP A;  1HU9 A;  2A15 A;  1FZU A;  3WHO A;  1VQM 3;  3DGO A;  2L1S A;  2YX9 A;  3EC9 A;  2UUG C;  1UUW B;  2OTJ 3;  3DGM A;  1GMR A;  1RCL A;  2WGO A;  2ZDJ A;  1MGR A;  1WTH A;  1BIR A;  2AAD A;  1KQS 2;  3GZR A;  3LTA A;  1BVI A;  1FA3 A;  2CFD A;  1EEJ A;  3F8X A;  2BU4 A;  3N9H A;  1G02 A;  1RRH A;  3AHS A;  1S5A A;  1E3R A;  2JQ5 A;  3ER7 A;  3K7C A;  5LC7 A;  4L8P A; 
#chains in the Genus database with same CATH homology
 1RRL A;  2GU3 A;  2IMJ A;  4LGQ A;  3WDG B;  3QRD A;  1G96 A;  5AII A;  1OGZ A;  1IDP A;  2Q07 A;  1QMA A;  4J9A A;  5CLK A;  2ML5 A;  1GY7 A;  2CFG A;  3ROB A;  1Q82 4;  3EBT A;  4L7K A;  3S28 A;  1OGX A;  1W00 A;  2XRX B;  3NHX A;  4LEH A;  3X41 A;  3IJE B;  2CWT A;  3EQQ B;  1C7H A;  1WNH A;  4FMD A;  4K61 A;  4XBY A;  4CDL A;  1W2Z A;  2OCT A;  3STD A;  1LOX A;  3MKI A;  4IPB A;  1F8N A;  1OPY A;  4EYC A;  3EF8 A;  1QAL A;  1D6Z A;  3HIG A;  3WOE B;  4N6N B;  5AIH A;  3PYJ A;  3F14 A;  3MWZ A;  4FR9 A;  3RGA A;  5A0O B;  2CKF B;  1BUQ A;  4MMY B;  1US1 A;  2V1L A;  2Y73 A;  4N3V A;  1EG9 B;  3H51 A;  1CQS A;  1EA2 A;  4WFO A;  1FGT A;  2R4I A;  3EE1 A;  1QJG A;  2CIU A;  4RNZ A;  1WQL B;  8CHO A;  2UX0 A;  3DXO A;  4X2O A;  1GY5 A;  3K9M C;  3LML A;  4R4K A;  1ULJ B;  2RSX A;  5CF1 A;  4WYK B;  1Z1S A;  3FF2 A;  3AMO B;  4MMX B;  3F7S A;  3T8U A;  3NUV A;  4NRE A;  3B4P A;  4KFD A;  1N5P A;  3CCS 3;  2P38 A;  1OAC A;  3B8L A;  1FGM A;  4HBR A;  4HM5 B;  4WP5 A;  4BTX A;  1O7M B;  3SVA A;  3VSY A;  3X3Y A;  4CCV A;  4RNY A;  1VQO 3;  3DUK A;  2CW9 A;  3Q2P A;  4I4K A;  1HKX A;  4MJD A;  3D3L A;  3MG2 A;  5ELU A;  1AVL A;  2BO9 B;  3UL6 A;  5EVH A;  1VQ5 3;  1OH0 A;  3FCS B;  4R80 A;  2GU1 A;  3L0R A;  5DRV A;  3DZL A;  1JJ2 2;  2STD A;  3HZP A;  1W6G A;  3EBY A;  4HJL B;  4WWU C;  2W9Q A;  3OXA A;  3CCU 3;  2XSO B;  4STD A;  4XM4 A;  3SOA A;  1YHQ 3;  3CCE 3;  5AI1 A;  5FW5 A;  1DMM A;  3KII A;  3KZT A;  7STD A;  4AEQ A;  3SED A;  1K28 A;  3CC7 3;  1KC8 4;  2KXG A;  3CCM 3;  2W56 A;  3J7Y d;  2OQE C;  3FLJ A;  3OWS A;  2QA4 3;  1U8C B;  3CPO A;  3DM8 A;  1SJW A;  4HM3 B;  4N6T A;  3BNB A;  4H61 A;  3CNM A;  2D1W A;  1LNH A;  1S72 3;  1GS3 A;  2OOV A;  3A76 A;  4HM4 B;  2CHC A;  4U13 A;  2XEP A;  3S29 A;  5IEN A;  2Z76 A;  1YI2 3;  2E2U A;  4O02 B;  3OX9 A;  4HM6 B;  3Q1C A;  1O7H B;  4PEJ A;  1GYB A;  1D6Y A;  3MSO A;  5IW9 A;  3GZY B;  4FCJ A;  4N6M A;  2MC8 A;  2YFJ B;  5BXQ A;  3GWR A;  1K9M 4;  2BMO B;  3I0Y A;  3RDE A;  4O3V A;  3OV4 A;  5JPU A;  2K0M A;  4ZM8 A;  1YJN 3;  4GB5 A;  1K41 A;  1Q40 A;  3SLU A;  1GD3 A;  2GXF A;  4O2H A;  1L5G B;  2CH9 A;  3F9S A;  3G6E 3;  1TIJ A;  1OF5 B;  4WHA A;  1FGO A;  2BMQ B;  2B1X B;  2E2T A;  4HZ9 B;  1WMN A;  3NV0 A;  4BTW A;  4EC6 A;  1M1K 4;  1VQN 3;  3PGB A;  5JPP A;  1ROV A;  1JN5 B;  2WGQ A;  3FH1 A;  3DGN A;  4NHF A;  3CME 3;  1ISK A;  2XH9 A;  3NXJ A;  2FXT A;  3LYG A;  5IG0 A;  2XGL A;  1PU4 A;  1YJ9 3;  3LH4 A;  1NWW A;  1JB2 A;  1UI8 A;  2GEY A;  1RJO A;  1VQL 3;  1V74 A;  5FGO A;  5KP3 A;  1OHS A;  1JRQ A;  1DVD A;  1JNQ A;  4N6U A;  4AKY A;  5G2G A;  2Z7A A;  4O8S A;  2CK3 H;  5BVB A;  3NBJ A;  3BLZ A;  2CFW A;  2XR8 B;  3K5T A;  1Q7Y 4;  1J2B A;  3WA2 X;  4XDW A;  1Q42 A;  5KP1 A;  3MG3 A;  3SX1 A;  3WMD A;  3CPW 2;  2LYX A;  2WOH A;  3CC2 3;  5ELJ A;  1YGE A;  3GAX A;  2C10 A;  4KFF A;  2RFR A;  2CG1 A;  5D83 A;  3T0U A;  1TUH A;  3CU3 A;  2BNG A;  1ASK A;  3MPH A;  3NBB A;  3NQZ A;  4FMA A;  4K1V A;  1R4C A;  4XBX A;  1OCV A;  2M7O A;  2P05 A;  1VQK 3;  1IVU A;  2YFL B;  2W2C A;  2Z6B A;  4FCM A;  5IG4 A;  1SQW A;  4GL6 A;  3X42 A;  2WO0 A;  3BND A;  3CMA 3;  5JBS A;  3D9R A;  1FGR A;  1IV7 A;  2RCD A;  4ORL A;  5IER A;  1NO3 A;  5AIG A;  3S27 A;  1GD4 A;  3KN4 A;  3NM7 A;  1CYV A;  1UW1 A;  2OQE A;  2O3O A;  3PXM A;  2CC3 A;  2FGT A;  2INX A;  1DYU A;  4G1M B;  2KCD A;  4OVM A;  5AIF A;  3MYT A;  3F8H A;  1JKG B;  1RKY A;  1DMQ A;  1NJI 4;  3BNE A;  1DMN A;  4FMB A;  1VQ7 3;  1NB3 I;  1OHP A;  3HI7 A;  1EQK A;  2YFI B;  1TU5 A;  1K73 4;  1IQY A;  2HMM B;  3LTB A;  1AVK A;  2HMJ B;  3JVC A;  4XDV A;  3KSE D;  5I97 A;  1JB5 A;  3O8Y A;  4L8O A;  1IT7 A;  3Q90 A;  3TDG A;  4R1K A;  1CYU A;  2JDI H;  2WOF A;  1IU7 A;  3G0K A;  3MG1 A;  3T8N A;  3FSD A;  4FMC A;  3V99 A;  3FZW A;  4HM0 B;  2D42 A;  4AKZ A;  4WYK A;  3EJV A;  1TFO A;  3K0Z A;  3AMO A;  3FG3 A;  3JUP A;  1OUN A;  4N6V 0;  3CNX A;  2MF7 A;  2C11 A;  1A2K A;  4TX4 A;  1OHO A;  5CF2 A;  3X3X A;  3VGN A;  1W7C A;  4HM2 B;  3LT9 A;  4HZB B;  2F86 B;  1K8A 4;  3WOF B;  3U1W A;  1O7W B;  4K90 B;  1WMO A;  1KSI A;  3B7C A;  4OK0 A;  5KP4 A;  4X2H A;  4XBT A;  1N9J A;  3KKG A;  1D6U A;  3DGL A;  5TGN A;  1LXE A;  1W6Y A;  3LOY A;  5AEW B;  6STD A;  3EX9 A;  3UNL A;  1Y4K A;  3CD6 3;  3F7X A;  1EKM A;  1ULI B;  3G8Z A;  3PCS A;  3S5C A;  1VZZ A;  2CWV A;  3DY5 A;  3CCV 3;  3LTD A;  1IVW A;  5LC6 A;  3CCQ 3;  3CCL 3;  3N8B A;  3QK9 A;  1RN7 A;  3G4S 3;  1JV2 B;  2O9U X;  1W01 A;  1GY6 A;  2W04 A;  3X3Z A;  2OTL 3;  1W5Z A;  3LZA A;  3PZW A;  1TFK A;  2QIY A;  4EV5 A;  3EHC A;  1YIT 3;  2B24 B;  2K54 A;  1IVV A;  2XSH B;  2OOV C;  4EV2 A;  3OW2 2;  4J8T A;  2CG0 A;  4FCZ A;  3JUO A;  4H3U A;  1IT8 A;  4OUQ A;  2HMK B;  3GZB A;  3JUN A;  1FGQ A;  4QWT A;  1VQ4 3;  1IK3 A;  1M90 4;  5STD A;  3UJM A;  3GRD A;  1M9G A;  2IUK A;  2P0M A;  1IVX A;  1AV4 A;  3BNC A;  3NM2 A;  4EBG A;  2E2V A;  1VQP 3;  1VQ6 3;  1OF5 A;  3LTC A;  5CK6 A;  2CFL A;  2KRT A;  1CEW I;  3SOY A;  5IEP A;  2XFS A;  1ZO2 A;  2Y74 A;  3KSP A;  3HII A;  2PNC A;  1N8Q A;  1SPU A;  4KFE A;  2XFT A;  4JRF A;  1JN5 A;  2XGN A;  4KZ1 A;  3FG1 A;  5IG3 A;  3PCR A;  1M1X B;  1IV9 A;  3NX0 A;  1LVN A;  3ECF A;  3DMC A;  3JUQ A;  1QVG 2;  2L4V A;  1N8R 4;  4IT7 A;  2IUJ A;  3WA3 A;  3OWU A;  2I9W A;  3I56 3;  3FGY A;  1W2B 2;  2OWP A;  1YVB I;  1PFP A;  3V92 A;  1WMP A;  1YJW 3;  1O7N B;  3IMA B;  3KFQ C;  3E99 A;  3EN8 A;  2GBW B;  3CC4 3;  2W03 A;  1ROA A;  1MNL A;  4IIA A;  4HKV B;  4LZI A;  3UL5 A;  4KVH A;  1KWI A;  5AEU B;  3CCR 3;  2W0Q A;  4HVN A;  3OWY A;  2W56 B;  2W6J H;  1AR0 A;  1QAF A;  1SIH A;  2GEX A;  2SBL A;  1TP6 A;  1KD1 4;  4N6L A;  3B4O A;  3NQY A;  3N54 B;  1W02 A;  5CXO A;  5AYS C;  3S67 A;  4LMI A;  1Q81 4;  4MMZ B;  2P0X A;  1A67 A;  1UUV B;  4EXR A;  3BB9 A;  3WOD G;  1FUW A;  3LXU X;  2F98 A;  2BT3 A;  1A90 A;  4HM7 B;  5IG5 A;  3PS8 A;  1IQ8 A;  1O7P B;  2FNQ A;  4HYZ A;  5IEO A;  1A2V A;  1W4N A;  4MEI A;  1NU3 A;  1STD A;  3F40 A;  1STF I;  1JB4 A;  3EB8 A;  4N6O B;  3LT8 A;  1N9E A;  1QVF 2;  2GBX B;  4LSO A;  2CWU A;  3GZX B;  4JF8 A;  3G71 3;  1DVC A;  3V98 A;  2HMN B;  1Q40 B;  2BHM A;  2PZV A;  2RGQ A;  3FKA A;  3I55 3;  1ZX2 A;  4RZM A;  4HM1 B;  4BTY A;  3IPT A;  3RGR A;  3FF0 A;  2BMR B;  5EQL A;  3K63 A;  2XF3 A;  3NBR A;  4HM8 B;  1UI7 A;  3SXX A;  1E97 A;  1JKG A;  2P09 A;  1NB5 I;  2W9P A;  3G16 A;  1VQ8 3;  2LQV A;  3KE7 A;  3CXC 2;  1W6C A;  4K1U A;  5HGR A;  2Z77 A;  1YIJ 3;  2QEX 3;  3JUM A;  3NV0 B;  1N5H A;  3EN1 B;  4XB5 A;  4R9L A;  2IA7 A;  5EEO A;  1O7G B;  3HK4 A;  5IF6 A;  1QAK A;  2QGU A;  1MOL A;  3H3H A;  2CFK A;  3ALA A;  1T5Y A;  3U97 A;  2HML B;  3UB1 A;  3VF1 A;  5AYR B;  2HMO B;  1IQX A;  2ZL8 A;  3M8C A;  1SII A;  3HX8 A;  3X40 A;  5DRE A;  1VQ9 3;  4Q53 A;  1E3V A;  3MHE A;  4RBN A;  1NDO B;  3FG4 A;  3CCJ 3;  2F99 A;  1Q86 4;  1U5O A;  4R9K A;  2ML6 A;  5D82 A;  5D81 A;  1HU9 A;  2A15 A;  1VQM 3;  3DGO A;  2YX9 A;  3EC9 A;  1UUW B;  2OTJ 3;  3DGM A;  2WGO A;  2ZDJ A;  1WTH A;  1KQS 2;  3GZR A;  3LTA A;  1FA3 A;  2CFD A;  3F8X A;  3N9H A;  1RRH A;  1S5A A;  1E3R A;  2JQ5 A;  3ER7 A;  3K7C A;  5LC7 A;  4L8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...