1N8R4

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1n8r400
3CMA3 1K8A4 1S723 2OTL3 3CCJ3 1QVG2 3OW22 1Q7Y4 1YJW3 3CME3 3CCL3 3CCM3 3CXC2 3CCV3 1M1K4 1QVF2 2QEX3 3CCQ3 1YJN3 1M904 1VQL3 3I553 1VQ83 3CC73 1K734 1JJ22 2OTJ3 3CCU3 1N8R4 1VQ73 1VQ53 1VQ63 3CCR3 1VQ93 1VQO3 1VQK3 1VQP3 3CC23 3CCE3 3G4S3 1VQM3 1YIJ3 1YIT3 1K9M4 1KQS2 1VQ43 1Q814 2QA43 3CC43 1YI23 1Q824 1KC84 1NJI4 3CD63 1W2B2 1YHQ3 1Q864 3CPW2 3CCS3 1YJ93 1VQN3 3G713 3G6E3 3I563 1KD14
chains in the Genus database with same CATH superfamily
1I2GA 4BL3A 3IPTA 5TGNA 3GZBA 2LQVA 1SIIA 3KN4A 3BU4A 1RHLA 2P0MA 3FF2A 3CCL3 2RBIA 3A5EA 1UGIA 3CCQ3 3G0KA 1O7HB 4EV2A 2H0IA 1IVUA 1F8NA 2HMOB 3AHWA 9RNTA 1B2XA 2XRXB 1HU9A 1IVVA 2UUGC 2SBLA 4N6V0 1RGLA 2E2TA 4ZM8A 3NV0B 2KF6A 2W56B 5ELJA 1BRNL 3WR2A 5JPUA 1DETA 1O7PB 1B20A 5D81A 3NM2A 1GD3A 1UUWB 1DMQA 3MG1A 1FZUA 3OV4A 5CF1A 1BRJA 3F8HA 1A2KA 3JUOA 1RSNA 2KF3A 3KSPA 4K1UA 1K8A4 1T3BA 4O8SA 1MNLA 2B24B 2R4IA 1D6YA 2OTL3 4XDWA 1N8QA 3B7CA 5ELUA 4RNYA 3WOEB 1C7HA 5EVHA 1X1WA 1OGXA 4HM5B 5IEPA 2FGTA 4OUQA 2BT3A 1JB4A 3K7CA 2F56A 2Z7AA 2Z77A 5D82A 3G16A 1JKGB 1BSBA 2INXA 2ML5A 3D3LA 2W2CA 4N6MA 1GD4A 4CCVA 5IG5A 4LYLB 4MMZB 3EQQB 4HM1B 2JQ5A 3VGNA 1VQP3 1M9GA 1O7NB 1OF5A 3T0UA 3RDEA 3Q90A 1BNGA 1YI23 2BMQB 4N3VA 1AV4A 1LOXA 1Y4KA 2J8XB 3ALAA 2OOVC 3CCS3 1LRAA 3G6E3 4J8TA 1Z1SA 1EKMA 2D42A 5AIIA 1NU3A 1RLSA 5AEUB 2GXFA 2ZA4A 5EQLA 2BMRB 3CME3 1AVKA 1L5GB 5BXQA 2R41A 2ZDJA 1JKGA 3GWRA 2QEX3 6GSPA 4FR9A 5AIFA 3HX8A 3S5CA 1KSIA 3FG1A 1WTHA 1JNQA 1N8R4 1I0VA 4DKIA 3S27A 1LQMB 2HMLB 3I0YA 4PEJA 1YIJ3 3G4S3 4RNZA 4IT7A 4KVHA 1BRIA 3G8ZA 4EYCA 1IU7A 2CFDA 4WP5A 3KSED 3F8XA 3DGOA 1DE3A 4FMAA 4R1KA 1NNVA 1QMAA 1RGEA 3AMOB 3F7XA 1CH0A 1RRHA 1NDOB 4OVMA 1RNTA 3FSDA 5LC7A 5KP1A 1G96A 1IYYA 2P05A 1OCVA 1FA3A 2CKFB 4MEIA 3QRDA 2IYJA 3E99A 4R9KA 2F5MA 3CXC2 3KFQC 2PNCA 3B4PA 1GSPA 4ORLA 3V99A 3OWUA 3AGOA 3L0RA 1RN7A 1IQXA 3NBJA 3QK9A 1U8CB 1EG9B 2XSOB 1YNVX 1BSEA 1VQ73 1RGKA 3X3XA 4HM8B 1FGTA 1AR0A 1WMPA 2Z76A 1CYVA 3CC23 2WO0A 1YIT3 2XEPA 5EEOA 4EV5A 3CNMA 1KC84 3ER7A 4WYKB 1YHQ3 3LMLA 1OGZA 3OX9A 2OOVA 1B3SA 3NBRA 4RZMA 2Y73A 4BTYA 5IENA 1O7GB 3CMA3 4BL2A 1ROAA 3BB9A 3GZRA 3CCJ3 3Q3FA 1V57A 1RTUA 4OK0A 3CCU3 3MG2A 1PY3A 1PYLA 1T5YA 5IEOA 1Q7Y4 3KKGA 1JBTA 1TJDA 1BSCA 4LSOA 2OCTA 2OWPA 3TDGA 3NUVA 5CK6A 1IV9A 4EBGA 1SJWA 3FKAA 1BNEA 1CQSA 4AEQA 2HMNB 4O3VA 1UDII 1TUHA 3H3HA 5IW9A 4H3UA 4AKYA 1Q824 5D83A 2Y74A 3H51A 4HYZA 1NJI4 2RSXA 4L8PA 1CYUA 1VQN3 1JZDA 1DVDA 3G713 8RNTA 3I563 2I9WA 2KF4A 3JVCA 1O7WB 2AADA 3FZWA 3MWZA 3PGBA 1RCLA 1QALA 3PS8A 4N6LA 5LC6A 3Q1CA 1JN5A 2L1SA 1UW1A 1QVF2 1M1K4 3BNCA 5JBSA 1BGSA 2IA7A 2CFLA 3EN8A 2GU3A 3MYTA 3NXJA 2GBXB 4XB5A 3S67A 2WGQA 1LOWA 1GMRA 3MKIA 1A2PA 3F9SA 5G1LA 3CCR3 3LT8A 4H61A 4LMIA 3SLUA 3RNTA 1FGQA 2YFIB 5STDA 4N6UA 3EE1A 2CFWA 2CX1A 2BO9B 1W6CA 1Q864 1BANA 1I8VA 3HK4A 2GEYA 1BRKA 3EBYA 1KWIA 4WHAA 4BU4A 1LOYA 2ZHXB 3UNLA 1SQWA 4J9AA 2O9UX 4LGQA 3NQZA 3OWSA 2C10A 2XFTA 1UCKA 2WOHA 5HOHA 3F40A 1C54A 1HKXA 4HM0B 1ZGXA 3CC73 4HOHA 1K734 1JZOA 3FLJA 3NV0A 2W56A 2OQEC 3AHSA 1EQKA 4XDVA 3DY5A 1OACA 4XBYA 1V74A 2E2UA 1VQM3 3DGMA 3X3YA 1IQ8A 1Q814 2HMKB 2QA43 1OHOA 4MMXB 1MGRA 3GZXB 4NREA 4R4KA 1VQQA 2UX0A 6RNTA 3CPW2 4X2OA 3WA3A 3WODG 4HZBB 3HIGA 1RN4A 2K0MA 1S723 4I4KA 4JF8A 4R80A 1OHPA 1SIHA 3N54B 1CEWI 1IQYA 1UI8A 3PCSA 3VF1A 4EC6A 1EA2A 3SXXA 3CCV3 1Q7HA 1OPYA 1I0XA 2XGLA 2CHCA 1RGAA 4K90B 5FW5A 3T8NA 1JJ22 3DXOA 3LYGA 4N6OB 4RNTA 2O3OA 3Q2PA 5FGOA 1UUGB 2E2VA 1J2BA 2BMOB 1I2FA 1B2ZA 1VQO3 1KQS2 1DYUA 1TU5A 3EC9A 3EJVA 1RRLA 2XH9A 2P38A 4X2HA 1W2B2 1R4YA 3HIIA 1GOVA 1T2IA 3V98A 1TP6A 3WDGB 3WA2X 3JUPA 1BRHA 3EBTA 5AEWB 1DMMA 3IJEB 3BNEA 1IDPA 1YGEA 1RGCA 1M904 3OXAA 3PZWA 3T8UA 2F5WA 1O7MB 2L4VA 1JBSA 2JDIH 4NPBA 1T2HA 1IVWA 2OQEA 2RNTA 3D79A 1Q9EA 4N6TA 2CWUA 4BIRA 1FUWA 2CW9A 3UL6A 4O2HA 2KXGA 1UCJA 3J7Yd 1B2UA 1GY7A 4ILFA 2IY2A 2W04A 5A0OB 3AMOA 1B2MA 2GSPA 2CIUA 1MWTA 2CK3H 2WOFA 5IF6A 5M18A 5AYRB 5M19A 3DGNA 2W03A 1MWUA 1SARA 4NHFA 4KZ1A 1UCLA 3KZTA 3ZG0A 1X1UA 3B4OA 7RNTA 3HI7A 3SOAA 1JRQA 3GSPA 4CPKA 2STDA 1VZZA 1G0TA 1W02A 1MWRA 3DMCA 3MHEA 3NQYA 1YJN3 1RNBA 1TFKA 1BNFA 3GAXA 1STDA 4GHOA 4KT3B 3UB1A 5IERA 4KFFA 1BNSA 5G1KA 1VQ53 1DVCA 1VQ63 4QWTA 2F4YA 1LXEA 4O02B 1VQ43 3KIIA 1WQLB 3VSYA 4WYKA 3CC43 3CNXA 4HJLB 7STDA 1PU4A 1I3FA 1NB5I 1RCKA 1GS3A 1GY5A 4MMYB 3SYUA 4FCJA 3NX0A 3NM7A 2BHMA 2CWVA 1BNIA 1IK3A 2KAAA 1BU4A 2CFKA 2Q07A 5I97A 1RKYA 2FNQA 5AIGA 3OW22 1OH0A 2YFLB 1ISKA 1YJW3 4WWUC 2XSHB 3IMAB 3RGRA 3URPA 3A76A 2HMJB 1TRQA 4L8OA 2K3DA 2CWTA 4R9LA 3I553 3U1WA 2KRTA 3K0ZA 3O8YA 1BNRA 1YVBI 5IG3A 4STDA 1B21A 3WMDA 1X1XA 1A2VA 4Q53A 3SEDA 1HZ1A 5BU4A 1AVLA 2GEXA 3AGNA 1UCIA 1RGGA 5DREA 1W01A 1BSAA 3CD63 1W4NA 3GZYB 1E3RA 1BAOA 1GMPA 2IUJA 2CH9A 5HGRA 3STDA 1TIJA 3BLZA 1D6UA 1GY6A 4K1VA 5CLKA 4HM2B 4HAAA 1TFOA 3V92A 1W6GA 1WNHA 3UL5A 2P0XA 1W5ZA 4HM7B 1AQZA 3CCM3 1N5PA 2AAEA 1QAFA 3NBBA 4FMCA 4JRFA 3KCHA 2H0GA 1DMNA 3K63A 1BUQA 4IPBA 3X3ZA 1EEJA 1IVXA 3BIRA 3EX9A 1RMSA 1W00A 1VQ83 1B2SA 3D9RA 3PCRA 3FF0A 1VQK3 1WMNA 3SX1A 3LXUX 1K41A 1IT7A 1SPUA 1FGMA 1WMOA 1E97A 2MF7A 2D1WA 3DZLA 1OF5B 3DGYA 1S5AA 1N9JA 3BNBA 1NB3I 2CX0A 4LZIA 1JB2A 2YX9A 4HM4B 2XFSA 3NHXA 1Q42A 4TX4A 2F99A 1JB5A 3EHCA 3FG3A 1RDSA 3FGYA 1BUJA 2MC8A 1U5OA 1G02A 1B27A 2P09A 5AYSC 1FW7A 1ROVA 1ASKA 1JV2B 2K54A 2F86B 4XBXA 3LTDA 1IV7A 4AKZA 3BNDA 3FH1A 2IUKA 1A90A 1I2EA 8CHOA 3X41A 4HZ9B 4FMBA 1A67A 4FCZA 3UJMA 1FUTA 3LTAA 3F14A 2C11A 2W6JH 2Z6BA 4J5GA 1W2ZA 1BNJA 1HYFA 1FGOA 2GBWB 3D5IA 1LVNA 1GOUA 1YGWA 2CFGA 3GRDA 1K28A 3KE7A 3LOYA 4GSPA 4LEHA 1BSDA 1R4CA 2QIYA 3K9MC 4K61A 1ZO2A 1OUNA 3LTBA 3LT9A 2XGNA 4U13A 1Q40B 4BTXA 2GU1A 1I3IA 2H0HA 4HM6B 1LNIA 1RGHA 2HOHA 1LOVA 3ROBA 1TRPA 4EW5A 5IG4A 1M1XB 7GSPA 2C4BA 3X42A 2IMJA 5GSPA 2YFJB 1UI7A 4HBRA 2HMMB 3ZFZA 2A15A 1VQ93 4BTWA 4GB5A 4L7KA 3ECFA 1GOYA 1JBRA 3CCE3 2FXTA 3N9HA 6STDA 1W7CA 3N8BA 4KFDA 4FMDA 3HOHA 4G1MB 3MG3A 3DH2A 4N6NB 3LH4A 2XF3A 3LZAA 3JUNA 3WHOA 1IT8A 1Q40A 3K5TA 3D5GA 2KF5A 3RGAA 1QVG2 1AY7A 3PYJA 1YVSA 1EUIC 4RBNA 2M7OA 1W6YA 1US1A 3WOFB 2B1XB 5IG0A 3JUQA 1NO3A 2W9PA 3PXMA 4J5KA 3CPOA 5CXOA 1FYSA 5CF2A 3SOYA 2OTJ3 2UGIA 3HZPA 3B8LA 1UGHI 3ZG5A 3MPHA 2RGQA 5JPPA 1N5HA 3X40A 3M8CA 1V58A 3DGLA 3S29A 1E3VA 1X1YA 1I70A 2W9QA 3FCSB 4FCMA 1BOXA 3CU3A 1BVIA 3F7SA 5KP4A 1OHSA 1MWSA 1UUVB 2RCDA 2ZL8A 3LTCA 3FG4A 4HVNA 5KP3A 3S28A 1N9EA 4XBTA 5DRVA 1YJ93 5AIHA 4IIAA 3U97A 1RJOA 3OWYA 1QJGA 3EB8A 1ZS7A 1TTOA 1BRGA 2BU4A 4MJDA 4EXRA 1FGRA 2BIRA 1GMQA 4GL6A 1PFPA 1BRSA 4XM4A 1RN1A 1RGFA 2PZVA 1JN5B 2SARA 5RNTA 1FUSA 1STFI 1VQL3 2WGOA 1MGWA 3EN1B 3JUMA 3DM8A 3DUKA 2BNGA 1BIRA 4KFEA 2F98A 1ULIB 2LYXA 3D4AA 3EF8A 1LQGC 2XR8B 2RFRA 4CJNA 4HKVB 1K9M4 2CG0A 2ML6A 5M1AA 1LNHA 1QAKA 1GYBA 2W0QA 1MOLA 5G2GA 1NWWA 1ZX2A 2QGUA 5AI1A 5BIRA 2CC3A 2KCDA 5BVBA 1ULJB 2V1LA 4WFOA 3MSOA 4I5QA 3SVAA 1D6ZA 4CDLA 4HM3B 1KD14 2CG1A
chains in the Genus database with same CATH topology
3IPTA 5TGNA 3GZBA 2LQVA 1SIIA 3KN4A 2P0MA 3FF2A 3CCL3 3CCQ3 3G0KA 1O7HB 4EV2A 1IVUA 1F8NA 2HMOB 2XRXB 1HU9A 1IVVA 2SBLA 4N6V0 2E2TA 4ZM8A 3NV0B 2W56B 5ELJA 5JPUA 1O7PB 5D81A 3NM2A 1GD3A 1UUWB 1DMQA 3MG1A 3OV4A 5CF1A 3F8HA 1A2KA 3JUOA 3KSPA 4K1UA 1K8A4 4O8SA 1MNLA 2B24B 2R4IA 1D6YA 2OTL3 4XDWA 1N8QA 3B7CA 5ELUA 4RNYA 3WOEB 1C7HA 5EVHA 1OGXA 4HM5B 5IEPA 2FGTA 4OUQA 2BT3A 1JB4A 3K7CA 2Z7AA 2Z77A 5D82A 3G16A 1JKGB 2INXA 2ML5A 3CCU3 3D3LA 2W2CA 4N6MA 1GD4A 4CCVA 5IG5A 4MMZB 3EQQB 4HM1B 2JQ5A 3VGNA 1VQP3 1M9GA 1O7NB 1OF5A 3T0UA 3RDEA 3Q90A 1YI23 2BMQB 4N3VA 1AV4A 1LOXA 1Y4KA 3ALAA 2OOVC 3CCS3 3G6E3 4J8TA 1Z1SA 1EKMA 2D42A 5AIIA 1NU3A 5AEUB 2GXFA 5EQLA 2BMRB 3CME3 1AVKA 1L5GB 5BXQA 2ZDJA 1JKGA 3GWRA 2QEX3 4FR9A 5AIFA 3HX8A 3S5CA 1KSIA 3FG1A 1WTHA 1JNQA 1N8R4 3S27A 2HMLB 3I0YA 4PEJA 1YIJ3 3G4S3 4RNZA 4IT7A 4KVHA 3G8ZA 4EYCA 1IU7A 2CFDA 4WP5A 3KSED 3F8XA 3DGOA 4FMAA 4R1KA 1QMAA 3AMOB 4OVMA 3F7XA 1RRHA 1NDOB 5LC7A 3FSDA 5KP1A 1FA3A 1G96A 2P05A 1OCVA 2CKFB 4MEIA 3QRDA 3E99A 4R9KA 3CXC2 3KFQC 2PNCA 3B4PA 4ORLA 3V99A 3OWUA 3L0RA 1RN7A 1IQXA 3NBJA 3QK9A 1U8CB 1EG9B 2XSOB 1VQ73 3X3XA 4HM8B 1FGTA 2Z76A 1AR0A 1WMPA 1CYVA 3CC23 2WO0A 1YIT3 2XEPA 5EEOA 4EV5A 3CNMA 1KC84 3ER7A 4WYKB 1YHQ3 3LMLA 1OGZA 3OX9A 2OOVA 3NBRA 5IENA 4RZMA 2Y73A 4BTYA 1O7GB 3CMA3 1ROAA 3BB9A 3GZRA 3CCJ3 4OK0A 1Q7Y4 3MG2A 1T5YA 5IEOA 3KKGA 4LSOA 2OCTA 2OWPA 3TDGA 3NUVA 5CK6A 1IV9A 4EBGA 1SJWA 3FKAA 1CQSA 4AEQA 2HMNB 4O3VA 1TUHA 3H3HA 5IW9A 4H3UA 4AKYA 1Q824 5D83A 2Y74A 3H51A 4HYZA 1NJI4 2RSXA 4L8PA 1CYUA 1VQN3 1DVDA 3G713 3I563 2I9WA 3JVCA 1O7WB 3FZWA 3MWZA 3PGBA 1QALA 3PS8A 4N6LA 5LC6A 3Q1CA 1JN5A 1QVF2 1UW1A 1M1K4 3BNCA 5JBSA 2IA7A 2CFLA 3EN8A 2GU3A 3MYTA 3NXJA 2GBXB 4XB5A 3S67A 2WGQA 3MKIA 3F9SA 3CCR3 3LT8A 4H61A 4LMIA 3SLUA 1FGQA 2YFIB 5STDA 4N6UA 3EE1A 2CFWA 2BO9B 1W6CA 1Q864 3HK4A 2GEYA 3EBYA 1KWIA 4WHAA 3UNLA 1SQWA 4J9AA 2O9UX 4LGQA 3NQZA 3OWSA 2C10A 2XFTA 2WOHA 3F40A 1HKXA 4HM0B 3CC73 1K734 1EQKA 3FLJA 3NV0A 2W56A 2OQEC 4XDVA 3DY5A 1OACA 4XBYA 1V74A 2E2UA 1VQM3 3DGMA 3X3YA 1IQ8A 1Q814 2HMKB 2QA43 1OHOA 4MMXB 3GZXB 4NREA 4R4KA 2UX0A 3CPW2 4X2OA 3WA3A 3WODG 4HZBB 3HIGA 2K0MA 1S723 4I4KA 4JF8A 4R80A 1OHPA 1SIHA 3N54B 1CEWI 1IQYA 1UI8A 3PCSA 3VF1A 4EC6A 1EA2A 3SXXA 3CCV3 2XGLA 1OPYA 4K90B 2CHCA 5FW5A 3T8NA 1JJ22 3DXOA 3LYGA 4N6OB 5FGOA 2O3OA 3Q2PA 1J2BA 2E2VA 2BMOB 1VQO3 1KQS2 1DYUA 1TU5A 3EC9A 3EJVA 1RRLA 2XH9A 2P38A 4X2HA 1W2B2 3HIIA 3V98A 3WDGB 1TP6A 3WA2X 3JUPA 3EBTA 5AEWB 1DMMA 3IJEB 3BNEA 1IDPA 1YGEA 1M904 3OXAA 3PZWA 3T8UA 1O7MB 2L4VA 2JDIH 1IVWA 2OQEA 4N6TA 2CWUA 1FUWA 2CW9A 3UL6A 4O2HA 2KXGA 3J7Yd 1GY7A 2W04A 5A0OB 3AMOA 2CIUA 2CK3H 2WOFA 5IF6A 5AYRB 3DGNA 2W03A 4NHFA 4KZ1A 3KZTA 3B4OA 3HI7A 3SOAA 1JRQA 2STDA 1VZZA 1W02A 3DMCA 3MHEA 3NQYA 1YJN3 1TFKA 3GAXA 1STDA 3UB1A 5IERA 4KFFA 1VQ53 1DVCA 1VQ63 4QWTA 1LXEA 4O02B 1VQ43 3KIIA 1WQLB 3VSYA 4WYKA 3CC43 3CNXA 4HJLB 7STDA 1PU4A 1NB5I 1GS3A 1GY5A 4MMYB 4FCJA 3NX0A 3NM7A 2BHMA 2CWVA 1IK3A 2Q07A 5I97A 2CFKA 1RKYA 2FNQA 5AIGA 3OW22 1OH0A 2YFLB 1ISKA 1YJW3 4WWUC 2XSHB 3IMAB 3RGRA 3A76A 2HMJB 4L8OA 2CWTA 4R9LA 3I553 3U1WA 2KRTA 3K0ZA 3O8YA 1YVBI 5IG3A 4STDA 3WMDA 1A2VA 4Q53A 3SEDA 1AVLA 2GEXA 5DREA 1W01A 3CD63 1W4NA 3GZYB 1E3RA 2IUJA 2CH9A 5HGRA 3STDA 1TIJA 3BLZA 1D6UA 1GY6A 4K1VA 5CLKA 4HM2B 3V92A 1TFOA 1W6GA 1WNHA 3UL5A 2P0XA 1W5ZA 4HM7B 3CCM3 1N5PA 3NBBA 1QAFA 4JRFA 4FMCA 3K63A 1DMNA 1BUQA 4IPBA 3X3ZA 1IVXA 3EX9A 1W00A 1VQ83 3D9RA 1VQK3 3PCRA 3FF0A 1WMNA 3SX1A 3LXUX 1K41A 1IT7A 1SPUA 2MF7A 1FGMA 1E97A 1WMOA 2D1WA 3DZLA 1OF5B 1S5AA 1N9JA 3BNBA 1NB3I 4LZIA 1JB2A 2YX9A 4HM4B 2XFSA 3NHXA 1Q42A 4TX4A 2F99A 1JB5A 3EHCA 3FG3A 3FGYA 2MC8A 1U5OA 2P09A 5AYSC 1ROVA 1ASKA 1JV2B 2K54A 2F86B 4XBXA 3LTDA 1IV7A 4AKZA 3BNDA 3FH1A 2IUKA 1A90A 8CHOA 3X41A 4HZ9B 4FMBA 1A67A 4FCZA 3UJMA 3LTAA 3F14A 2C11A 2W6JH 2Z6BA 1W2ZA 1FGOA 2GBWB 1LVNA 2CFGA 3GRDA 4LEHA 1K28A 3KE7A 3LOYA 1R4CA 2QIYA 3K9MC 4K61A 1ZO2A 1OUNA 3LTBA 3LT9A 2XGNA 4U13A 1Q40B 4BTXA 2GU1A 4HM6B 3ROBA 5IG4A 1M1XB 3X42A 2IMJA 2YFJB 1UI7A 4HBRA 2HMMB 2A15A 1VQ93 4BTWA 4GB5A 4L7KA 3ECFA 3CCE3 2FXTA 3N9HA 6STDA 1W7CA 3N8BA 4KFDA 4FMDA 4G1MB 3MG3A 4N6NB 3LH4A 2XF3A 3LZAA 3JUNA 1IT8A 1Q40A 3K5TA 3RGAA 1QVG2 3PYJA 4RBNA 2M7OA 1W6YA 1US1A 3WOFB 2B1XB 5IG0A 3JUQA 1NO3A 2W9PA 3PXMA 3CPOA 5CXOA 5CF2A 3SOYA 2OTJ3 3HZPA 3B8LA 3MPHA 2RGQA 5JPPA 1N5HA 3X40A 3M8CA 3DGLA 3S29A 1E3VA 2W9QA 3FCSB 4FCMA 3CU3A 3F7SA 5KP4A 1OHSA 1UUVB 2RCDA 2ZL8A 3LTCA 3FG4A 4HVNA 5KP3A 3S28A 1N9EA 4XBTA 5DRVA 1YJ93 5AIHA 4IIAA 3U97A 1RJOA 3OWYA 1QJGA 3EB8A 4MJDA 4EXRA 1FGRA 4GL6A 4XM4A 1PFPA 2PZVA 1JN5B 1STFI 1VQL3 2WGOA 3EN1B 3JUMA 3DM8A 3DUKA 2BNGA 4KFEA 2F98A 1ULIB 2LYXA 3EF8A 2XR8B 2RFRA 4HKVB 1K9M4 2ML6A 2CG0A 1LNHA 1QAKA 1GYBA 2W0QA 1MOLA 5G2GA 1NWWA 1ZX2A 2QGUA 5AI1A 2CC3A 2KCDA 5BVBA 1ULJB 2V1LA 4WFOA 3MSOA 3SVAA 1D6ZA 4CDLA 4HM3B 1KD14 2CG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA 3;  1K8A 4;  1S72 3;  2OTL 3;  3CCJ 3;  1QVG 2;  3OW2 2;  1Q7Y 4;  1YJW 3;  3CME 3;  3CCL 3;  3CCM 3;  3CXC 2;  3CCV 3;  1M1K 4;  1QVF 2;  2QEX 3;  3CCQ 3;  1YJN 3;  1M90 4;  1VQL 3;  3I55 3;  1VQ8 3;  3CC7 3;  1K73 4;  1JJ2 2;  2OTJ 3;  3CCU 3;  1N8R 4;  1VQ7 3;  1VQ5 3;  1VQ6 3;  3CCR 3;  1VQ9 3;  1VQO 3;  1VQK 3;  1VQP 3;  3CC2 3;  3CCE 3;  3G4S 3;  1VQM 3;  1YIJ 3;  1YIT 3;  1K9M 4;  1KQS 2;  1VQ4 3;  1Q81 4;  2QA4 3;  3CC4 3;  1YI2 3;  1Q82 4;  1KC8 4;  1NJI 4;  3CD6 3;  1W2B 2;  1YHQ 3;  1Q86 4;  3CPW 2;  3CCS 3;  1YJ9 3;  1VQN 3;  3G71 3;  3G6E 3;  3I56 3;  1KD1 4; 
#chains in the Genus database with same CATH topology
 1I2G A;  4BL3 A;  3IPT A;  5TGN A;  3GZB A;  2LQV A;  1SII A;  3KN4 A;  3BU4 A;  1RHL A;  2P0M A;  3FF2 A;  3CCL 3;  2RBI A;  3A5E A;  1UGI A;  3CCQ 3;  3G0K A;  1O7H B;  4EV2 A;  2H0I A;  1IVU A;  1F8N A;  2HMO B;  3AHW A;  9RNT A;  1B2X A;  2XRX B;  1HU9 A;  1IVV A;  2UUG C;  2SBL A;  4N6V 0;  1RGL A;  2E2T A;  4ZM8 A;  3NV0 B;  2KF6 A;  2W56 B;  5ELJ A;  1BRN L;  3WR2 A;  5JPU A;  1DET A;  1O7P B;  1B20 A;  5D81 A;  3NM2 A;  1GD3 A;  1UUW B;  1DMQ A;  3MG1 A;  1FZU A;  3OV4 A;  5CF1 A;  1BRJ A;  3F8H A;  1A2K A;  3JUO A;  1RSN A;  2KF3 A;  3KSP A;  4K1U A;  1K8A 4;  1T3B A;  4O8S A;  1MNL A;  2B24 B;  2R4I A;  1D6Y A;  2OTL 3;  4XDW A;  1N8Q A;  3B7C A;  5ELU A;  4RNY A;  3WOE B;  1C7H A;  5EVH A;  1X1W A;  1OGX A;  4HM5 B;  5IEP A;  2FGT A;  4OUQ A;  2BT3 A;  1JB4 A;  3K7C A;  2F56 A;  2Z7A A;  2Z77 A;  5D82 A;  3G16 A;  1JKG B;  1BSB A;  2INX A;  2ML5 A;  3D3L A;  2W2C A;  4N6M A;  1GD4 A;  4CCV A;  5IG5 A;  4LYL B;  4MMZ B;  3EQQ B;  4HM1 B;  2JQ5 A;  3VGN A;  1VQP 3;  1M9G A;  1O7N B;  1OF5 A;  3T0U A;  3RDE A;  3Q90 A;  1BNG A;  1YI2 3;  2BMQ B;  4N3V A;  1AV4 A;  1LOX A;  1Y4K A;  2J8X B;  3ALA A;  2OOV C;  3CCS 3;  1LRA A;  3G6E 3;  4J8T A;  1Z1S A;  1EKM A;  2D42 A;  5AII A;  1NU3 A;  1RLS A;  5AEU B;  2GXF A;  2ZA4 A;  5EQL A;  2BMR B;  3CME 3;  1AVK A;  1L5G B;  5BXQ A;  2R41 A;  2ZDJ A;  1JKG A;  3GWR A;  2QEX 3;  6GSP A;  4FR9 A;  5AIF A;  3HX8 A;  3S5C A;  1KSI A;  3FG1 A;  1WTH A;  1JNQ A;  1N8R 4;  1I0V A;  4DKI A;  3S27 A;  1LQM B;  2HML B;  3I0Y A;  4PEJ A;  1YIJ 3;  3G4S 3;  4RNZ A;  4IT7 A;  4KVH A;  1BRI A;  3G8Z A;  4EYC A;  1IU7 A;  2CFD A;  4WP5 A;  3KSE D;  3F8X A;  3DGO A;  1DE3 A;  4FMA A;  4R1K A;  1NNV A;  1QMA A;  1RGE A;  3AMO B;  3F7X A;  1CH0 A;  1RRH A;  1NDO B;  4OVM A;  1RNT A;  3FSD A;  5LC7 A;  5KP1 A;  1G96 A;  1IYY A;  2P05 A;  1OCV A;  1FA3 A;  2CKF B;  4MEI A;  3QRD A;  2IYJ A;  3E99 A;  4R9K A;  2F5M A;  3CXC 2;  3KFQ C;  2PNC A;  3B4P A;  1GSP A;  4ORL A;  3V99 A;  3OWU A;  3AGO A;  3L0R A;  1RN7 A;  1IQX A;  3NBJ A;  3QK9 A;  1U8C B;  1EG9 B;  2XSO B;  1YNV X;  1BSE A;  1VQ7 3;  1RGK A;  3X3X A;  4HM8 B;  1FGT A;  1AR0 A;  1WMP A;  2Z76 A;  1CYV A;  3CC2 3;  2WO0 A;  1YIT 3;  2XEP A;  5EEO A;  4EV5 A;  3CNM A;  1KC8 4;  3ER7 A;  4WYK B;  1YHQ 3;  3LML A;  1OGZ A;  3OX9 A;  2OOV A;  1B3S A;  3NBR A;  4RZM A;  2Y73 A;  4BTY A;  5IEN A;  1O7G B;  3CMA 3;  4BL2 A;  1ROA A;  3BB9 A;  3GZR A;  3CCJ 3;  3Q3F A;  1V57 A;  1RTU A;  4OK0 A;  3CCU 3;  3MG2 A;  1PY3 A;  1PYL A;  1T5Y A;  5IEO A;  1Q7Y 4;  3KKG A;  1JBT A;  1TJD A;  1BSC A;  4LSO A;  2OCT A;  2OWP A;  3TDG A;  3NUV A;  5CK6 A;  1IV9 A;  4EBG A;  1SJW A;  3FKA A;  1BNE A;  1CQS A;  4AEQ A;  2HMN B;  4O3V A;  1UDI I;  1TUH A;  3H3H A;  5IW9 A;  4H3U A;  4AKY A;  1Q82 4;  5D83 A;  2Y74 A;  3H51 A;  4HYZ A;  1NJI 4;  2RSX A;  4L8P A;  1CYU A;  1VQN 3;  1JZD A;  1DVD A;  3G71 3;  8RNT A;  3I56 3;  2I9W A;  2KF4 A;  3JVC A;  1O7W B;  2AAD A;  3FZW A;  3MWZ A;  3PGB A;  1RCL A;  1QAL A;  3PS8 A;  4N6L A;  5LC6 A;  3Q1C A;  1JN5 A;  2L1S A;  1UW1 A;  1QVF 2;  1M1K 4;  3BNC A;  5JBS A;  1BGS A;  2IA7 A;  2CFL A;  3EN8 A;  2GU3 A;  3MYT A;  3NXJ A;  2GBX B;  4XB5 A;  3S67 A;  2WGQ A;  1LOW A;  1GMR A;  3MKI A;  1A2P A;  3F9S A;  5G1L A;  3CCR 3;  3LT8 A;  4H61 A;  4LMI A;  3SLU A;  3RNT A;  1FGQ A;  2YFI B;  5STD A;  4N6U A;  3EE1 A;  2CFW A;  2CX1 A;  2BO9 B;  1W6C A;  1Q86 4;  1BAN A;  1I8V A;  3HK4 A;  2GEY A;  1BRK A;  3EBY A;  1KWI A;  4WHA A;  4BU4 A;  1LOY A;  2ZHX B;  3UNL A;  1SQW A;  4J9A A;  2O9U X;  4LGQ A;  3NQZ A;  3OWS A;  2C10 A;  2XFT A;  1UCK A;  2WOH A;  5HOH A;  3F40 A;  1C54 A;  1HKX A;  4HM0 B;  1ZGX A;  3CC7 3;  4HOH A;  1K73 4;  1JZO A;  3FLJ A;  3NV0 A;  2W56 A;  2OQE C;  3AHS A;  1EQK A;  4XDV A;  3DY5 A;  1OAC A;  4XBY A;  1V74 A;  2E2U A;  1VQM 3;  3DGM A;  3X3Y A;  1IQ8 A;  1Q81 4;  2HMK B;  2QA4 3;  1OHO A;  4MMX B;  1MGR A;  3GZX B;  4NRE A;  4R4K A;  1VQQ A;  2UX0 A;  6RNT A;  3CPW 2;  4X2O A;  3WA3 A;  3WOD G;  4HZB B;  3HIG A;  1RN4 A;  2K0M A;  1S72 3;  4I4K A;  4JF8 A;  4R80 A;  1OHP A;  1SIH A;  3N54 B;  1CEW I;  1IQY A;  1UI8 A;  3PCS A;  3VF1 A;  4EC6 A;  1EA2 A;  3SXX A;  3CCV 3;  1Q7H A;  1OPY A;  1I0X A;  2XGL A;  2CHC A;  1RGA A;  4K90 B;  5FW5 A;  3T8N A;  1JJ2 2;  3DXO A;  3LYG A;  4N6O B;  4RNT A;  2O3O A;  3Q2P A;  5FGO A;  1UUG B;  2E2V A;  1J2B A;  2BMO B;  1I2F A;  1B2Z A;  1VQO 3;  1KQS 2;  1DYU A;  1TU5 A;  3EC9 A;  3EJV A;  1RRL A;  2XH9 A;  2P38 A;  4X2H A;  1W2B 2;  1R4Y A;  3HII A;  1GOV A;  1T2I A;  3V98 A;  1TP6 A;  3WDG B;  3WA2 X;  3JUP A;  1BRH A;  3EBT A;  5AEW B;  1DMM A;  3IJE B;  3BNE A;  1IDP A;  1YGE A;  1RGC A;  1M90 4;  3OXA A;  3PZW A;  3T8U A;  2F5W A;  1O7M B;  2L4V A;  1JBS A;  2JDI H;  4NPB A;  1T2H A;  1IVW A;  2OQE A;  2RNT A;  3D79 A;  1Q9E A;  4N6T A;  2CWU A;  4BIR A;  1FUW A;  2CW9 A;  3UL6 A;  4O2H A;  2KXG A;  1UCJ A;  3J7Y d;  1B2U A;  1GY7 A;  4ILF A;  2IY2 A;  2W04 A;  5A0O B;  3AMO A;  1B2M A;  2GSP A;  2CIU A;  1MWT A;  2CK3 H;  2WOF A;  5IF6 A;  5M18 A;  5AYR B;  5M19 A;  3DGN A;  2W03 A;  1MWU A;  1SAR A;  4NHF A;  4KZ1 A;  1UCL A;  3KZT A;  3ZG0 A;  1X1U A;  3B4O A;  7RNT A;  3HI7 A;  3SOA A;  1JRQ A;  3GSP A;  4CPK A;  2STD A;  1VZZ A;  1G0T A;  1W02 A;  1MWR A;  3DMC A;  3MHE A;  3NQY A;  1YJN 3;  1RNB A;  1TFK A;  1BNF A;  3GAX A;  1STD A;  4GHO A;  4KT3 B;  3UB1 A;  5IER A;  4KFF A;  1BNS A;  5G1K A;  1VQ5 3;  1DVC A;  1VQ6 3;  4QWT A;  2F4Y A;  1LXE A;  4O02 B;  1VQ4 3;  3KII A;  1WQL B;  3VSY A;  4WYK A;  3CC4 3;  3CNX A;  4HJL B;  7STD A;  1PU4 A;  1I3F A;  1NB5 I;  1RCK A;  1GS3 A;  1GY5 A;  4MMY B;  3SYU A;  4FCJ A;  3NX0 A;  3NM7 A;  2BHM A;  2CWV A;  1BNI A;  1IK3 A;  2KAA A;  1BU4 A;  2CFK A;  2Q07 A;  5I97 A;  1RKY A;  2FNQ A;  5AIG A;  3OW2 2;  1OH0 A;  2YFL B;  1ISK A;  1YJW 3;  4WWU C;  2XSH B;  3IMA B;  3RGR A;  3URP A;  3A76 A;  2HMJ B;  1TRQ A;  4L8O A;  2K3D A;  2CWT A;  4R9L A;  3I55 3;  3U1W A;  2KRT A;  3K0Z A;  3O8Y A;  1BNR A;  1YVB I;  5IG3 A;  4STD A;  1B21 A;  3WMD A;  1X1X A;  1A2V A;  4Q53 A;  3SED A;  1HZ1 A;  5BU4 A;  1AVL A;  2GEX A;  3AGN A;  1UCI A;  1RGG A;  5DRE A;  1W01 A;  1BSA A;  3CD6 3;  1W4N A;  3GZY B;  1E3R A;  1BAO A;  1GMP A;  2IUJ A;  2CH9 A;  5HGR A;  3STD A;  1TIJ A;  3BLZ A;  1D6U A;  1GY6 A;  4K1V A;  5CLK A;  4HM2 B;  4HAA A;  1TFO A;  3V92 A;  1W6G A;  1WNH A;  3UL5 A;  2P0X A;  1W5Z A;  4HM7 B;  1AQZ A;  3CCM 3;  1N5P A;  2AAE A;  1QAF A;  3NBB A;  4FMC A;  4JRF A;  3KCH A;  2H0G A;  1DMN A;  3K63 A;  1BUQ A;  4IPB A;  3X3Z A;  1EEJ A;  1IVX A;  3BIR A;  3EX9 A;  1RMS A;  1W00 A;  1VQ8 3;  1B2S A;  3D9R A;  3PCR A;  3FF0 A;  1VQK 3;  1WMN A;  3SX1 A;  3LXU X;  1K41 A;  1IT7 A;  1SPU A;  1FGM A;  1WMO A;  1E97 A;  2MF7 A;  2D1W A;  3DZL A;  1OF5 B;  3DGY A;  1S5A A;  1N9J A;  3BNB A;  1NB3 I;  2CX0 A;  4LZI A;  1JB2 A;  2YX9 A;  4HM4 B;  2XFS A;  3NHX A;  1Q42 A;  4TX4 A;  2F99 A;  1JB5 A;  3EHC A;  3FG3 A;  1RDS A;  3FGY A;  1BUJ A;  2MC8 A;  1U5O A;  1G02 A;  1B27 A;  2P09 A;  5AYS C;  1FW7 A;  1ROV A;  1ASK A;  1JV2 B;  2K54 A;  2F86 B;  4XBX A;  3LTD A;  1IV7 A;  4AKZ A;  3BND A;  3FH1 A;  2IUK A;  1A90 A;  1I2E A;  8CHO A;  3X41 A;  4HZ9 B;  4FMB A;  1A67 A;  4FCZ A;  3UJM A;  1FUT A;  3LTA A;  3F14 A;  2C11 A;  2W6J H;  2Z6B A;  4J5G A;  1W2Z A;  1BNJ A;  1HYF A;  1FGO A;  2GBW B;  3D5I A;  1LVN A;  1GOU A;  1YGW A;  2CFG A;  3GRD A;  1K28 A;  3KE7 A;  3LOY A;  4GSP A;  4LEH A;  1BSD A;  1R4C A;  2QIY A;  3K9M C;  4K61 A;  1ZO2 A;  1OUN A;  3LTB A;  3LT9 A;  2XGN A;  4U13 A;  1Q40 B;  4BTX A;  2GU1 A;  1I3I A;  2H0H A;  4HM6 B;  1LNI A;  1RGH A;  2HOH A;  1LOV A;  3ROB A;  1TRP A;  4EW5 A;  5IG4 A;  1M1X B;  7GSP A;  2C4B A;  3X42 A;  2IMJ A;  5GSP A;  2YFJ B;  1UI7 A;  4HBR A;  2HMM B;  3ZFZ A;  2A15 A;  1VQ9 3;  4BTW A;  4GB5 A;  4L7K A;  3ECF A;  1GOY A;  1JBR A;  3CCE 3;  2FXT A;  3N9H A;  6STD A;  1W7C A;  3N8B A;  4KFD A;  4FMD A;  3HOH A;  4G1M B;  3MG3 A;  3DH2 A;  4N6N B;  3LH4 A;  2XF3 A;  3LZA A;  3JUN A;  3WHO A;  1IT8 A;  1Q40 A;  3K5T A;  3D5G A;  2KF5 A;  3RGA A;  1QVG 2;  1AY7 A;  3PYJ A;  1YVS A;  1EUI C;  4RBN A;  2M7O A;  1W6Y A;  1US1 A;  3WOF B;  2B1X B;  5IG0 A;  3JUQ A;  1NO3 A;  2W9P A;  3PXM A;  4J5K A;  3CPO A;  5CXO A;  1FYS A;  5CF2 A;  3SOY A;  2OTJ 3;  2UGI A;  3HZP A;  3B8L A;  1UGH I;  3ZG5 A;  3MPH A;  2RGQ A;  5JPP A;  1N5H A;  3X40 A;  3M8C A;  1V58 A;  3DGL A;  3S29 A;  1E3V A;  1X1Y A;  1I70 A;  2W9Q A;  3FCS B;  4FCM A;  1BOX A;  3CU3 A;  1BVI A;  3F7S A;  5KP4 A;  1OHS A;  1MWS A;  1UUV B;  2RCD A;  2ZL8 A;  3LTC A;  3FG4 A;  4HVN A;  5KP3 A;  3S28 A;  1N9E A;  4XBT A;  5DRV A;  1YJ9 3;  5AIH A;  4IIA A;  3U97 A;  1RJO A;  3OWY A;  1QJG A;  3EB8 A;  1ZS7 A;  1TTO A;  1BRG A;  2BU4 A;  4MJD A;  4EXR A;  1FGR A;  2BIR A;  1GMQ A;  4GL6 A;  1PFP A;  1BRS A;  4XM4 A;  1RN1 A;  1RGF A;  2PZV A;  1JN5 B;  2SAR A;  5RNT A;  1FUS A;  1STF I;  1VQL 3;  2WGO A;  1MGW A;  3EN1 B;  3JUM A;  3DM8 A;  3DUK A;  2BNG A;  1BIR A;  4KFE A;  2F98 A;  1ULI B;  2LYX A;  3D4A A;  3EF8 A;  1LQG C;  2XR8 B;  2RFR A;  4CJN A;  4HKV B;  1K9M 4;  2CG0 A;  2ML6 A;  5M1A A;  1LNH A;  1QAK A;  1GYB A;  2W0Q A;  1MOL A;  5G2G A;  1NWW A;  1ZX2 A;  2QGU A;  5AI1 A;  5BIR A;  2CC3 A;  2KCD A;  5BVB A;  1ULJ B;  2V1L A;  4WFO A;  3MSO A;  4I5Q A;  3SVA A;  1D6Z A;  4CDL A;  4HM3 B;  1KD1 4;  2CG1 A; 
#chains in the Genus database with same CATH homology
 3IPT A;  5TGN A;  3GZB A;  2LQV A;  1SII A;  3KN4 A;  2P0M A;  3FF2 A;  3CCL 3;  3CCQ 3;  3G0K A;  1O7H B;  4EV2 A;  1IVU A;  1F8N A;  2HMO B;  2XRX B;  1HU9 A;  1IVV A;  2SBL A;  4N6V 0;  2E2T A;  4ZM8 A;  3NV0 B;  2W56 B;  5ELJ A;  5JPU A;  1O7P B;  5D81 A;  3NM2 A;  1GD3 A;  1UUW B;  1DMQ A;  3MG1 A;  3OV4 A;  5CF1 A;  3F8H A;  1A2K A;  3JUO A;  3KSP A;  4K1U A;  1K8A 4;  4O8S A;  1MNL A;  2B24 B;  2R4I A;  1D6Y A;  2OTL 3;  4XDW A;  1N8Q A;  3B7C A;  5ELU A;  4RNY A;  3WOE B;  1C7H A;  5EVH A;  1OGX A;  4HM5 B;  5IEP A;  2FGT A;  4OUQ A;  2BT3 A;  1JB4 A;  3K7C A;  2Z7A A;  2Z77 A;  5D82 A;  3G16 A;  1JKG B;  2INX A;  2ML5 A;  3CCU 3;  3D3L A;  2W2C A;  4N6M A;  1GD4 A;  4CCV A;  5IG5 A;  4MMZ B;  3EQQ B;  4HM1 B;  2JQ5 A;  3VGN A;  1VQP 3;  1M9G A;  1O7N B;  1OF5 A;  3T0U A;  3RDE A;  3Q90 A;  1YI2 3;  2BMQ B;  4N3V A;  1AV4 A;  1LOX A;  1Y4K A;  3ALA A;  2OOV C;  3CCS 3;  3G6E 3;  4J8T A;  1Z1S A;  1EKM A;  2D42 A;  5AII A;  1NU3 A;  5AEU B;  2GXF A;  5EQL A;  2BMR B;  3CME 3;  1AVK A;  1L5G B;  5BXQ A;  2ZDJ A;  1JKG A;  3GWR A;  2QEX 3;  4FR9 A;  5AIF A;  3HX8 A;  3S5C A;  1KSI A;  3FG1 A;  1WTH A;  1JNQ A;  1N8R 4;  3S27 A;  2HML B;  3I0Y A;  4PEJ A;  1YIJ 3;  3G4S 3;  4RNZ A;  4IT7 A;  4KVH A;  3G8Z A;  4EYC A;  1IU7 A;  2CFD A;  4WP5 A;  3KSE D;  3F8X A;  3DGO A;  4FMA A;  4R1K A;  1QMA A;  3AMO B;  4OVM A;  3F7X A;  1RRH A;  1NDO B;  5LC7 A;  3FSD A;  5KP1 A;  1FA3 A;  1G96 A;  2P05 A;  1OCV A;  2CKF B;  4MEI A;  3QRD A;  3E99 A;  4R9K A;  3CXC 2;  3KFQ C;  2PNC A;  3B4P A;  4ORL A;  3V99 A;  3OWU A;  3L0R A;  1RN7 A;  1IQX A;  3NBJ A;  3QK9 A;  1U8C B;  1EG9 B;  2XSO B;  1VQ7 3;  3X3X A;  4HM8 B;  1FGT A;  2Z76 A;  1AR0 A;  1WMP A;  1CYV A;  3CC2 3;  2WO0 A;  1YIT 3;  2XEP A;  5EEO A;  4EV5 A;  3CNM A;  1KC8 4;  3ER7 A;  4WYK B;  1YHQ 3;  3LML A;  1OGZ A;  3OX9 A;  2OOV A;  3NBR A;  5IEN A;  4RZM A;  2Y73 A;  4BTY A;  1O7G B;  3CMA 3;  1ROA A;  3BB9 A;  3GZR A;  3CCJ 3;  4OK0 A;  1Q7Y 4;  3MG2 A;  1T5Y A;  5IEO A;  3KKG A;  4LSO A;  2OCT A;  2OWP A;  3TDG A;  3NUV A;  5CK6 A;  1IV9 A;  4EBG A;  1SJW A;  3FKA A;  1CQS A;  4AEQ A;  2HMN B;  4O3V A;  1TUH A;  3H3H A;  5IW9 A;  4H3U A;  4AKY A;  1Q82 4;  5D83 A;  2Y74 A;  3H51 A;  4HYZ A;  1NJI 4;  2RSX A;  4L8P A;  1CYU A;  1VQN 3;  1DVD A;  3G71 3;  3I56 3;  2I9W A;  3JVC A;  1O7W B;  3FZW A;  3MWZ A;  3PGB A;  1QAL A;  3PS8 A;  4N6L A;  5LC6 A;  3Q1C A;  1JN5 A;  1QVF 2;  1UW1 A;  1M1K 4;  3BNC A;  5JBS A;  2IA7 A;  2CFL A;  3EN8 A;  2GU3 A;  3MYT A;  3NXJ A;  2GBX B;  4XB5 A;  3S67 A;  2WGQ A;  3MKI A;  3F9S A;  3CCR 3;  3LT8 A;  4H61 A;  4LMI A;  3SLU A;  1FGQ A;  2YFI B;  5STD A;  4N6U A;  3EE1 A;  2CFW A;  2BO9 B;  1W6C A;  1Q86 4;  3HK4 A;  2GEY A;  3EBY A;  1KWI A;  4WHA A;  3UNL A;  1SQW A;  4J9A A;  2O9U X;  4LGQ A;  3NQZ A;  3OWS A;  2C10 A;  2XFT A;  2WOH A;  3F40 A;  1HKX A;  4HM0 B;  3CC7 3;  1K73 4;  1EQK A;  3FLJ A;  3NV0 A;  2W56 A;  2OQE C;  4XDV A;  3DY5 A;  1OAC A;  4XBY A;  1V74 A;  2E2U A;  1VQM 3;  3DGM A;  3X3Y A;  1IQ8 A;  1Q81 4;  2HMK B;  2QA4 3;  1OHO A;  4MMX B;  3GZX B;  4NRE A;  4R4K A;  2UX0 A;  3CPW 2;  4X2O A;  3WA3 A;  3WOD G;  4HZB B;  3HIG A;  2K0M A;  1S72 3;  4I4K A;  4JF8 A;  4R80 A;  1OHP A;  1SIH A;  3N54 B;  1CEW I;  1IQY A;  1UI8 A;  3PCS A;  3VF1 A;  4EC6 A;  1EA2 A;  3SXX A;  3CCV 3;  2XGL A;  1OPY A;  4K90 B;  2CHC A;  5FW5 A;  3T8N A;  1JJ2 2;  3DXO A;  3LYG A;  4N6O B;  5FGO A;  2O3O A;  3Q2P A;  1J2B A;  2E2V A;  2BMO B;  1VQO 3;  1KQS 2;  1DYU A;  1TU5 A;  3EC9 A;  3EJV A;  1RRL A;  2XH9 A;  2P38 A;  4X2H A;  1W2B 2;  3HII A;  3V98 A;  3WDG B;  1TP6 A;  3WA2 X;  3JUP A;  3EBT A;  5AEW B;  1DMM A;  3IJE B;  3BNE A;  1IDP A;  1YGE A;  1M90 4;  3OXA A;  3PZW A;  3T8U A;  1O7M B;  2L4V A;  2JDI H;  1IVW A;  2OQE A;  4N6T A;  2CWU A;  1FUW A;  2CW9 A;  3UL6 A;  4O2H A;  2KXG A;  3J7Y d;  1GY7 A;  2W04 A;  5A0O B;  3AMO A;  2CIU A;  2CK3 H;  2WOF A;  5IF6 A;  5AYR B;  3DGN A;  2W03 A;  4NHF A;  4KZ1 A;  3KZT A;  3B4O A;  3HI7 A;  3SOA A;  1JRQ A;  2STD A;  1VZZ A;  1W02 A;  3DMC A;  3MHE A;  3NQY A;  1YJN 3;  1TFK A;  3GAX A;  1STD A;  3UB1 A;  5IER A;  4KFF A;  1VQ5 3;  1DVC A;  1VQ6 3;  4QWT A;  1LXE A;  4O02 B;  1VQ4 3;  3KII A;  1WQL B;  3VSY A;  4WYK A;  3CC4 3;  3CNX A;  4HJL B;  7STD A;  1PU4 A;  1NB5 I;  1GS3 A;  1GY5 A;  4MMY B;  4FCJ A;  3NX0 A;  3NM7 A;  2BHM A;  2CWV A;  1IK3 A;  2Q07 A;  5I97 A;  2CFK A;  1RKY A;  2FNQ A;  5AIG A;  3OW2 2;  1OH0 A;  2YFL B;  1ISK A;  1YJW 3;  4WWU C;  2XSH B;  3IMA B;  3RGR A;  3A76 A;  2HMJ B;  4L8O A;  2CWT A;  4R9L A;  3I55 3;  3U1W A;  2KRT A;  3K0Z A;  3O8Y A;  1YVB I;  5IG3 A;  4STD A;  3WMD A;  1A2V A;  4Q53 A;  3SED A;  1AVL A;  2GEX A;  5DRE A;  1W01 A;  3CD6 3;  1W4N A;  3GZY B;  1E3R A;  2IUJ A;  2CH9 A;  5HGR A;  3STD A;  1TIJ A;  3BLZ A;  1D6U A;  1GY6 A;  4K1V A;  5CLK A;  4HM2 B;  3V92 A;  1TFO A;  1W6G A;  1WNH A;  3UL5 A;  2P0X A;  1W5Z A;  4HM7 B;  3CCM 3;  1N5P A;  3NBB A;  1QAF A;  4JRF A;  4FMC A;  3K63 A;  1DMN A;  1BUQ A;  4IPB A;  3X3Z A;  1IVX A;  3EX9 A;  1W00 A;  1VQ8 3;  3D9R A;  1VQK 3;  3PCR A;  3FF0 A;  1WMN A;  3SX1 A;  3LXU X;  1K41 A;  1IT7 A;  1SPU A;  2MF7 A;  1FGM A;  1E97 A;  1WMO A;  2D1W A;  3DZL A;  1OF5 B;  1S5A A;  1N9J A;  3BNB A;  1NB3 I;  4LZI A;  1JB2 A;  2YX9 A;  4HM4 B;  2XFS A;  3NHX A;  1Q42 A;  4TX4 A;  2F99 A;  1JB5 A;  3EHC A;  3FG3 A;  3FGY A;  2MC8 A;  1U5O A;  2P09 A;  5AYS C;  1ROV A;  1ASK A;  1JV2 B;  2K54 A;  2F86 B;  4XBX A;  3LTD A;  1IV7 A;  4AKZ A;  3BND A;  3FH1 A;  2IUK A;  1A90 A;  8CHO A;  3X41 A;  4HZ9 B;  4FMB A;  1A67 A;  4FCZ A;  3UJM A;  3LTA A;  3F14 A;  2C11 A;  2W6J H;  2Z6B A;  1W2Z A;  1FGO A;  2GBW B;  1LVN A;  2CFG A;  3GRD A;  4LEH A;  1K28 A;  3KE7 A;  3LOY A;  1R4C A;  2QIY A;  3K9M C;  4K61 A;  1ZO2 A;  1OUN A;  3LTB A;  3LT9 A;  2XGN A;  4U13 A;  1Q40 B;  4BTX A;  2GU1 A;  4HM6 B;  3ROB A;  5IG4 A;  1M1X B;  3X42 A;  2IMJ A;  2YFJ B;  1UI7 A;  4HBR A;  2HMM B;  2A15 A;  1VQ9 3;  4BTW A;  4GB5 A;  4L7K A;  3ECF A;  3CCE 3;  2FXT A;  3N9H A;  6STD A;  1W7C A;  3N8B A;  4KFD A;  4FMD A;  4G1M B;  3MG3 A;  4N6N B;  3LH4 A;  2XF3 A;  3LZA A;  3JUN A;  1IT8 A;  1Q40 A;  3K5T A;  3RGA A;  1QVG 2;  3PYJ A;  4RBN A;  2M7O A;  1W6Y A;  1US1 A;  3WOF B;  2B1X B;  5IG0 A;  3JUQ A;  1NO3 A;  2W9P A;  3PXM A;  3CPO A;  5CXO A;  5CF2 A;  3SOY A;  2OTJ 3;  3HZP A;  3B8L A;  3MPH A;  2RGQ A;  5JPP A;  1N5H A;  3X40 A;  3M8C A;  3DGL A;  3S29 A;  1E3V A;  2W9Q A;  3FCS B;  4FCM A;  3CU3 A;  3F7S A;  5KP4 A;  1OHS A;  1UUV B;  2RCD A;  2ZL8 A;  3LTC A;  3FG4 A;  4HVN A;  5KP3 A;  3S28 A;  1N9E A;  4XBT A;  5DRV A;  1YJ9 3;  5AIH A;  4IIA A;  3U97 A;  1RJO A;  3OWY A;  1QJG A;  3EB8 A;  4MJD A;  4EXR A;  1FGR A;  4GL6 A;  4XM4 A;  1PFP A;  2PZV A;  1JN5 B;  1STF I;  1VQL 3;  2WGO A;  3EN1 B;  3JUM A;  3DM8 A;  3DUK A;  2BNG A;  4KFE A;  2F98 A;  1ULI B;  2LYX A;  3EF8 A;  2XR8 B;  2RFR A;  4HKV B;  1K9M 4;  2ML6 A;  2CG0 A;  1LNH A;  1QAK A;  1GYB A;  2W0Q A;  1MOL A;  5G2G A;  1NWW A;  1ZX2 A;  2QGU A;  5AI1 A;  2CC3 A;  2KCD A;  5BVB A;  1ULJ B;  2V1L A;  4WFO A;  3MSO A;  3SVA A;  1D6Z A;  4CDL A;  4HM3 B;  1KD1 4;  2CG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...