3RGRA

Crystal structure of ketosteroid isomerase m116a from pseudomonas putida
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTAQAYWSEVNLSVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Crystal structure of ketosteroid isomerase M116A from Pseudomonas putida
rcsb
source organism Pseudomonas putida
total genus 38
structure length 128
sequence length 128
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3rgrA00
1W02A 1O7WB 1OGXA 1OF5B 4X2HA 1U5OA 2BNGA 1Q40B 3KKGA 1JKGB 4HZBB 3GZRA 5CF2A 5AIFA 2GBXB 1STDA 2R4IA 4X2OA 3T8UA 5D83A 3DUKA 3NUVA 3I0YA 2IMJA 3MG3A 4L8PA 3OWSA 2RGQA 2HMOB 3A76A 1ASKA 4J9AA 3FF0A 3EBTA 1ULIB 4WWUC 2GEXA 4R9KA 3CPOA 1O7MB 2HMNB 1K41A 3EN1B 3ROBA 4XDVA 5AEWB 3EBYA 1C7HA 3FF2A 5CXOA 3G0KA 1O7NB 1HKXA 2QIYA 3OWUA 1UUWB 5IF6A 5TGNA 2Z77A 3JUOA 3JUQA 2GBWB 4HM4B 5CK6A 3DMCA 3WMDA 1GYBA 4XBXA 4LMIA 3H51A 1QJGA 3HZPA 2JQ5A 3EC9A 1E97A 3NV0A 2F86B 3OXAA 4MJDA 3KSPA 3BLZA 4L8OA 3G16A 2STDA 3NBRA 3B4OA 1W00A 5IG5A 4RZMA 3FKAA 1Q40A 2YFLB 5D81A 3RGAA 1JKGA 1OHOA 1ZX2A 2Z7AA 5DREA 5KP1A 1O7GB 2F98A 2INXA 1CQSA 4K1VA 4XB5A 3NM2A 3SOAA 1E3RA 3STDA 2BMRB 4HM8B 4FCMA 5STDA 2K54A 3EX9A 2UX0A 4Q53A 2QGUA 2XSOB 3B4PA 3K7CA 2W2CA 2Z76A 5IERA 2BMQB 1OGZA 3DZLA 3ECFA 2OWPA 4HVNA 1A2KA 1OH0A 5G2GA 1DMNA 5KP3A 4HM1B 1W01A 1DMQA 4R9LA 3B7CA 3RGRA 1W6YA 3F14A 4WP5A 3GRDA 4HM0B 3CNMA 3DXOA 4L7KA 4R1KA 4KVHA 3JUMA 3F7SA 3OV4A 4HM3B 3UNLA 5FW5A 3F9SA 1GY5A 4STDA 5D82A 4H3UA 4HM7B 4HKVB 3F7XA 3GZBA 4LEHA 5IEOA 4HM5B 3ER7A 3BB9A 3FZWA 4PEJA 1VZZA 1BUQA 3JUNA 5AIHA 3S5CA 1OHPA 1JN5B 1GY6A 5IG4A 2PZVA 1O7PB 3FH1A 4XBYA 1OF5A 1GS3A 4HJLB 5KP4A 1GY7A 1QMAA 3F8HA 3IPTA 3KZTA 4LGQA 1JB2A 3FGYA 4OVMA 3EJVA 4U13A 1DMMA 3MKIA 3JUPA 3EF8A 4HM6B 5AI1A 5AEUB 2I9WA 4FCJA 3F8XA 3B8LA 3HK4A 4XBTA 2HMMB 3VGNA 3EQQB 3MYTA 4CDLA 1SJWA 4WYKB 4I4KA 3MSOA 5IEPA 1JB5A 3KE7A 4HM2B 3NHXA 3F40A 6STDA 5IG0A 5DRVA 1TUHA 1NDOB 4GB5A 8CHOA 4XM4A 1NWWA 4K1UA 5HGRA 3M8CA 1ZO2A 1OPYA 1AR0A 3E99A 5EVHA 3NXJA 2A15A 2CHCA 1IDPA 1Z1SA 1OHSA 2YFJB 5AIGA 3Q90A 3GZXB 2XSHB 2HMJB 1TP6A 2XRXB 1UUVB 5JPPA 2RFRA 1ISKA 2HMKB 1JN5A 3VSYA 4HZ9B 1OUNA 3CU3A 2YFIB 4IIAA 2RCDA 3GZYB 5CF1A 3MG1A 3T8NA 1E3VA 2F99A 3MG2A 3HX8A 3CNXA 3SOYA 3EN8A 3FLJA 5AIIA 1WQLB 1O7HB 1Q42A 5BVBA 5IENA 3OX9A 2XR8B 2GXFA 1JB4A 3K0ZA 4N3VA 2B24B 1ULJB 4J8TA 7STDA 5CLKA 1EA2A 4XDWA 2BMOB 3DM8A 3G8ZA 3EHCA 2B1XB 2CKFB 3FSDA 1EG9B 4WYKA 4ORLA 3LZAA 2HMLB 3OWYA 5JPUA 5BXQA 2GEYA 3GWRA 1NU3A 3D9RA 3SEDA 3LYGA 3MHEA 1S5AA 3NV0B 3UJMA 5IG3A 3H3HA 4OUQA 1OCVA
chains in the Genus database with same CATH superfamily
1RLSA 1W02A 2XFTA 1N8QA 2KF6A 1O7WB 1OGXA 1OF5B 3CMA3 4X2HA 2P0MA 1U5OA 2E2UA 1A67A 3IMAB 3KFQC 1FGOA 2BNGA 1Q40B 4EYCA 3LTAA 1I3FA 5AYRB 2CX0A 1B27A 1GMQA 3AGNA 3KKGA 3CCL3 1BGSA 5BIRA 1JKGB 1LOYA 1W4NA 4HZBB 3HOHA 1IVXA 3GZRA 4H61A 3S67A 5CF2A 1L5GB 5I97A 5AIFA 3WR2A 1LRAA 1US1A 2CWTA 1STDA 2GBXB 2J8XB 2R4IA 1D6UA 4MMZB 3D3LA 4X2OA 3T8UA 5A0OB 1FUTA 2F56A 4ZM8A 7GSPA 5D83A 4FMCA 4ILFA 1MWSA 3PZWA 1FUSA 3DUKA 1RGFA 3NUVA 5BU4A 3I0YA 1YJW3 1FGRA 2KAAA 4K61A 1EEJA 2IMJA 1BRHA 3UL5A 5IENA 1GSPA 3BNEA 1LNIA 1LXEA 1RN4A 1IVWA 1OACA 2Y74A 3K5TA 3QK9A 3WOEB 3MG3A 3K9MC 4L8PA 3OWSA 2RGQA 1EQKA 3LH4A 1AVLA 1MOLA 2HMOB 2XGNA 2CFGA 1LQMB 1BAOA 1N5PA 2W6JH 4GL6A 3NBJA 3G6E3 2GU3A 3A76A 3CPW2 1VQ53 1NNVA 1ASKA 2UUGC 4J9AA 3OW22 1BSAA 2KF3A 3FF0A 1IVVA 2BIRA 3EBTA 2KF4A 1BRIA 1ULIB 1BRGA 3HI7A 4LSOA 2GEXA 1QAFA 4KZ1A 4R9KA 3K63A 4WWUC 3N9HA 2WOFA 1BRKA 3CPOA 3AHSA 1O7MB 3LTDA 3NQYA 4LYLB 1KC84 3WOFB 2CH9A 3EE1A 2HMNB 1K41A 4NHFA 2CFWA 3EN1B 1UCLA 3ROBA 2E2TA 1IQYA 4XDVA 5AEWB 1D6ZA 3EBYA 2XFSA 8RNTA 1FZUA 1C7HA 3FF2A 1M1XB 2W9PA 1B2ZA 7RNTA 2O9UX 1QVF2 5CXOA 4DKIA 3G0KA 1K28A 1O7NB 1C54A 3CCQ3 3LTBA 1HKXA 2QIYA 3OWUA 1B3SA 3D5IA 3TDGA 1UUWB 5FGOA 3I553 3CCU3 5IF6A 1RKYA 1RN7A 4N6LA 3HIIA 5TGNA 1UI7A 1YIJ3 3WHOA 2P05A 2XGLA 2Z77A 3JUOA 3JUQA 3V92A 4FMAA 3VF1A 1F8NA 2GBWB 2ZL8A 3QRDA 9RNTA 4HM4B 5CK6A 1IV9A 1MNLA 3DMCA 1S723 1J2BA 2M7OA 1B20A 3WMDA 2C10A 1MWRA 1PYLA 1GYBA 1MWTA 4XBXA 5G1LA 1RTUA 2UGIA 4LMIA 3H51A 2CX1A 3V99A 3MWZA 3D79A 1QJGA 1X1UA 1TFKA 1GD3A 1YGWA 4NREA 4GHOA 3HZPA 1VQ93 2XEPA 2CFDA 2JQ5A 3EC9A 1M9GA 1SARA 1E97A 3NV0A 3CCJ3 3PCSA 3U97A 2F86B 2HOHA 3WA2X 3OXAA 3AHWA 3KSPA 1RSNA 3BLZA 4MJDA 4BU4A 2GU1A 2LQVA 4L8OA 3SYUA 1VQM3 3G16A 2STDA 1M1K4 3S27A 1X1YA 3NBRA 3B4OA 6GSPA 1W00A 1UW1A 3N8BA 5IG5A 4RZMA 3FKAA 1Q40A 2YFLB 1I3IA 2E2VA 5D81A 2V1LA 1UCIA 2P38A 1YVSA 3RGAA 3ZFZA 4BL2A 3BU4A 1JKGA 4OK0A 4EW5A 1EKMA 2CC3A 1Q814 1OHOA 1ZX2A 2Z7AA 4QWTA 5DREA 5KP1A 1O7GB 1W7CA 1ZS7A 3WODG 1W2B2 1GMPA 2BU4A 3SX1A 1DETA 2F98A 1RRHA 2FNQA 1LVNA 2INXA 1CQSA 1CYUA 4K1VA 2W56B 2QEX3 1RGKA 1STFI 1G0TA 4XB5A 5ELUA 4NPBA 3X41A 1K734 3X40A 3LT9A 4R4KA 1W2ZA 1B2UA 2L4VA 3ZG5A 3UB1A 3NM2A 3NX0A 3SOAA 1E3RA 1UGHI 3X42A 2AAEA 3STDA 2BMRB 4CPKA 3G4S3 3CCE3 1B21A 3LMLA 4N6OB 1DYUA 1V57A 4HM8B 4JF8A 2BT3A 4HYZA 4FCMA 1LOWA 4KFEA 2K54A 2YX9A 2UX0A 3EX9A 1UDII 4Q53A 5STDA 1U8CB 2KF5A 1RJOA 2QGUA 2W9QA 2RBIA 2XSOB 3IJEB 4BTWA 1YJ93 1TFOA 1YGEA 3B4PA 3U1WA 4N6TA 1BSCA 1RNTA 3S29A 3K7CA 2W2CA 2XF3A 2Z76A 1KD14 5RNTA 3SLUA 5IERA 3BIRA 1A90A 1JRQA 3FG1A 2BHMA 1WMOA 2BMQB 2XH9A 1OGZA 2AADA 3PXMA 2P09A 1FGMA 1SQWA 2C4BA 3DZLA 3FCSB 1IT7A 4G1MB 3ECFA 1RCLA 2O3OA 2OWPA 5HOHA 1TU5A 4HVNA 4RNYA 1A2KA 3CC73 1OH0A 5G2GA 1BNGA 1JZDA 4N6UA 1DMNA 1PY3A 2CFKA 1IQXA 3GSPA 3AMOA 3CCV3 4IT7A 1G02A 5KP3A 3CCM3 3V98A 1YJN3 4HM1B 1W01A 1DMQA 4R9LA 2GSPA 3B7CA 2WOHA 3DGMA 1BRNL 1AQZA 4EV2A 2OQEC 1LQGC 4I5QA 1WNHA 4FCZA 3RGRA 1W6YA 3F14A 1Q864 4WP5A 1GD4A 5LC7A 3GRDA 4RBNA 1RHLA 1VQN3 4HM0B 1ZGXA 2F5WA 3CNMA 3DXOA 4L7KA 3LT8A 4R1KA 1D6YA 4KVHA 1BUJA 3JUMA 1JBRA 3RNTA 3MPHA 1RN1A 3F7SA 1KQS2 3OV4A 1VQ83 4HM3B 3UNLA 5FW5A 3F9SA 4HOHA 1ROVA 4EV5A 1FW7A 1GY5A 4STDA 2WGOA 1SPUA 5D82A 1A2VA 4WFOA 1I2GA 1IVUA 4BTYA 4H3UA 4HM7B 1RCKA 3NQZA 4IPBA 1PU4A 1JNQA 2H0IA 1CYVA 3KN4A 1JV2B 1VQP3 1K8A4 4HKVB 1Y4KA 3F7XA 1V58A 4BL3A 3GZBA 2SARA 4LEHA 1RGEA 5IEOA 4HM5B 4CJNA 1WMPA 3ER7A 1ROAA 3BB9A 3FZWA 4PEJA 1BNFA 2C11A 1VZZA 1BUQA 1WMNA 1AVKA 3I563 3JUNA 5AIHA 2OOVC 1OHPA 2K3DA 1JN5B 2ZDJA 1GY6A 3ALAA 3S5CA 1M904 4MEIA 5IW9A 2IA7A 1HU9A 2FGTA 5IG4A 2PZVA 4O8SA 2D1WA 2W0QA 1O7PB 3CC43 1YVBI 2D42A 3FH1A 2Y73A 1VQK3 4XBYA 5ELJA 1OF5A 1GS3A 4HBRA 3DGYA 4HJLB 1A2PA 5KP4A 2PNCA 2ML6A 3FG4A 3JVCA 4N6V0 2L1SA 1GY7A 1QMAA 3WA3A 3F8HA 3IPTA 3KZTA 4EC6A 3L0RA 1FGTA 5M18A 2BO9B 2IUJA 4KFFA 3Q1CA 3URPA 1MGRA 1N9JA 1JB2A 1TRQA 4LGQA 1BSEA 1TIJA 3FGYA 4OVMA 5M19A 3BNDA 5GSPA 3D4AA 1FGQA 2CFLA 1W5ZA 3LXUX 3EJVA 3N54B 1RRLA 3KCHA 3BNCA 4U13A 5EEOA 1DMMA 5M1AA 3S28A 3MKIA 1B2MA 1YNVX 3JUPA 3GAXA 3CCR3 3EF8A 4TX4A 1BSDA 4HM6B 5AI1A 2CWUA 2I9WA 5AEUB 5JBSA 4FCJA 1VQ63 4KT3B 1AV4A 3F8XA 1W6CA 1LOVA 3AGOA 2CG1A 1I0XA 3B8LA 1CH0A 1NB5I 1FA3A 1BNJA 1N9EA 3HK4A 4XBTA 2HMMB 3LTCA 3VGNA 1Q7Y4 2IYJA 3WDGB 3EQQB 1R4YA 1LNHA 2LYXA 3MYTA 4CDLA 1SJWA 1BNIA 1DE3A 4WYKB 1I70A 4I4KA 1VQL3 4EXRA 1MWUA 3MSOA 4AKZA 3DY5A 1T5YA 1RDSA 1RGGA 1JB5A 5IEPA 3KE7A 3Q2PA 4WHAA 1BU4A 4HM2B 5LC6A 1DVDA 3NHXA 1GOUA 3F40A 1RMSA 2W04A 3BNBA 1VQ43 1BRJA 4J5GA 6STDA 5IG0A 4FR9A 1JJ22 1T3BA 5DRVA 3A5EA 3CC23 1TUHA 1VQ73 1NDOB 1RGHA 1IT8A 3DGLA 2ZA4A 4GB5A 2F4YA 8CHOA 3SVAA 4XM4A 3CXC2 1RGAA 1NWWA 4K1UA 3NBBA 3M8CA 1ZO2A 1IV7A 4N6MA 4R80A 5HGRA 1BOXA 1PFPA 1X1WA 1OPYA 4AEQA 2CK3H 1AY7A 1AR0A 3CME3 1N8R4 3E99A 3NXJA 5EVHA 1RNBA 1W6GA 2RSXA 2A15A 2CHCA 3KIIA 2ZHXB 2Z6BA 1I2EA 1IDPA 1Z1SA 2RNTA 1OHSA 6RNTA 2YFJB 3DGOA 1G96A 5AIGA 1JBTA 3O8YA 1I0VA 1TTOA 2KRTA 1NO3A 3GZXB 2XSHB 3Q90A 3RDEA 2OTL3 1V74A 2HMJB 1TP6A 2JDIH 2XRXB 4K90B 4J5KA 1KWIA 1UUVB 3SXXA 1BANA 2KCDA 2RFRA 2HMKB 5JPPA 2H0HA 3G713 1ISKA 1Q7HA 1BNRA 1JN5A 3VSYA 1IU7A 4HZ9B 2OQEA 2Q07A 2CW9A 1OUNA 3CU3A 2WGQA 3PCRA 2YFIB 1BNSA 3ZG0A 1YIT3 4IIAA 3X3YA 2RCDA 1QAKA 1IK3A 3GZYB 1N5HA 3HIGA 4FMBA 5CF1A 1VQQA 2CWVA 3MG1A 1HYFA 1Q9EA 1UI8A 3T8NA 4CCVA 4N6NB 2CG0A 1E3VA 1QVG2 2F99A 3MG2A 3CCS3 4GSPA 1BIRA 1TRPA 1KSIA 4EBGA 1FUWA 1T2IA 1LOXA 4HAAA 3D5GA 3NM7A 3HX8A 4BIRA 3X3XA 1UCJA 3CNXA 3SOYA 3EN8A 3FLJA 3AMOB 4JRFA 1Q824 5AIIA 2ML5A 4O3VA 4AKYA 1SIHA 2MC8A 1WQLB 1O7HB 1NJI4 3CD63 1Q42A 2IUKA 4KFDA 5BVBA 2W56A 3LOYA 3FG3A 1IQ8A 3OX9A 4RNZA 1CEWI 1JBSA 1UCKA 1B2XA 1NB3I 1I8VA 1GOVA 1HZ1A 1TJDA 2GXFA 1JZOA 2XR8B 3DGNA 4O02B 1JB4A 3K0ZA 5G1KA 4N3VA 3PGBA 1RGCA 2F5MA 2B24B 1SIIA 2W03A 3Q3FA 2OOVA 1UGIA 5AYSC 3UL6A 5EQLA 1ULJB 4J8TA 3DH2A 1I2FA 7STDA 5CLKA 1T2HA 1EA2A 2H0GA 1K9M4 1X1XA 2IY2A 1BNEA 2FXTA 4XDWA 2BMOB 3DM8A 3EB8A 1EUIC 1QALA 2KXGA 3EHCA 1BSBA 3G8ZA 4BTXA 2K0MA 2B1XB 2CKFB 3FSDA 1YHQ3 1VQO3 1EG9B 4WYKA 4MMYB 1GOYA 1BRSA 1GMRA 1WTHA 2CIUA 4ORLA 1B2SA 3LZAA 4LZIA 1DVCA 4O2HA 3X3ZA 2MF7A 2HMLB 3OWYA 5JPUA 1FYSA 1MGWA 2SBLA 5BXQA 2GEYA 1RGLA 2WO0A 2R41A 3GWRA 1NU3A 1BVIA 3PS8A 3D9RA 3SEDA 3LYGA 3J7Yd 3T0UA 3MHEA 4FMDA 1S5AA 2OTJ3 2P0XA 1YI23 1UUGB 3NV0B 3PYJA 3UJMA 1IYYA 4RNTA 2OCTA 5IG3A 3H3HA 4OUQA 3KSED 1OCVA 4MMXB 2QA43 1R4CA
chains in the Genus database with same CATH topology
1W02A 2XFTA 1N8QA 1O7WB 1OGXA 1OF5B 3CMA3 4X2HA 2P0MA 1U5OA 2E2UA 1A67A 3IMAB 3KFQC 1FGOA 2BNGA 1Q40B 4EYCA 3LTAA 5AYRB 3CCL3 3KKGA 1JKGB 4HZBB 1W4NA 1IVXA 3GZRA 4H61A 3S67A 5CF2A 1L5GB 5I97A 5AIFA 1US1A 2CWTA 2GBXB 1STDA 2R4IA 4MMZB 1D6UA 3D3LA 4X2OA 3T8UA 5A0OB 4ZM8A 5D83A 4FMCA 3PZWA 3DUKA 3NUVA 3I0YA 1YJW3 1FGRA 4K61A 2IMJA 5IENA 3UL5A 3BNEA 1LXEA 1IVWA 1OACA 2Y74A 3K5TA 3QK9A 3WOEB 3MG3A 3K9MC 4L8PA 3OWSA 2RGQA 1EQKA 3LH4A 1AVLA 1MOLA 2HMOB 2XGNA 2CFGA 1N5PA 2W6JH 4GL6A 3NBJA 3G6E3 2GU3A 3A76A 3CPW2 1VQ53 1ASKA 4J9AA 3OW22 3FF0A 1IVVA 3EBTA 1ULIB 3HI7A 4LSOA 4WWUC 2GEXA 1QAFA 4KZ1A 4R9KA 3K63A 3N9HA 2WOFA 3CPOA 3LTDA 1O7MB 3NQYA 1KC84 3WOFB 2CH9A 3EE1A 2HMNB 1K41A 4NHFA 2CFWA 3EN1B 3ROBA 2E2TA 1IQYA 4XDVA 5AEWB 1D6ZA 3EBYA 2XFSA 1C7HA 3FF2A 1M1XB 2W9PA 2O9UX 1QVF2 5CXOA 3G0KA 1K28A 1O7NB 3CCQ3 3LTBA 1HKXA 2QIYA 3OWUA 3TDGA 1UUWB 5FGOA 3I553 3CCU3 5IF6A 1RKYA 1RN7A 4N6LA 3HIIA 5TGNA 1UI7A 1YIJ3 2P05A 2XGLA 2Z77A 3JUOA 3JUQA 3V92A 4FMAA 3VF1A 1F8NA 2GBWB 2ZL8A 3QRDA 4HM4B 5CK6A 1IV9A 1MNLA 3DMCA 1S723 1J2BA 2M7OA 3WMDA 2C10A 1GYBA 4XBXA 4LMIA 3H51A 3V99A 3MWZA 1QJGA 1TFKA 1GD3A 4NREA 3HZPA 1VQ93 2XEPA 2CFDA 2JQ5A 3EC9A 1M9GA 1E97A 3NV0A 3CCJ3 3PCSA 3U97A 2F86B 3WA2X 3OXAA 3KSPA 3BLZA 4MJDA 2GU1A 2LQVA 4L8OA 1VQM3 3G16A 2STDA 1M1K4 3S27A 3NBRA 3B4OA 1W00A 1UW1A 3N8BA 5IG5A 4RZMA 3FKAA 1Q40A 2YFLB 2E2VA 5D81A 2V1LA 2P38A 3RGAA 1JKGA 4OK0A 1EKMA 2CC3A 1Q814 1OHOA 1ZX2A 2Z7AA 4QWTA 5DREA 5KP1A 1O7GB 1W7CA 3WODG 1W2B2 3SX1A 2F98A 1RRHA 2FNQA 1LVNA 2INXA 1CQSA 1CYUA 4K1VA 2W56B 2QEX3 1STFI 4XB5A 5ELUA 3X41A 1K734 3X40A 3LT9A 4R4KA 1W2ZA 2L4VA 3UB1A 3NM2A 3NX0A 3SOAA 1E3RA 3X42A 3STDA 2BMRB 3G4S3 3CCE3 3LMLA 4N6OB 1DYUA 4HM8B 4JF8A 2BT3A 4HYZA 4FCMA 4KFEA 2K54A 2YX9A 2UX0A 3EX9A 4Q53A 5STDA 3CC73 1U8CB 2QGUA 1RJOA 2W9QA 2XSOB 3IJEB 4BTWA 1YJ93 1TFOA 1YGEA 3B4PA 3U1WA 4N6TA 3S29A 3K7CA 2W2CA 2XF3A 2Z76A 1KD14 3SLUA 5IERA 1A90A 1JRQA 3FG1A 2BHMA 1WMOA 2BMQB 2XH9A 1OGZA 3PXMA 2P09A 1FGMA 1SQWA 3FCSB 3DZLA 4G1MB 1IT7A 3ECFA 2O3OA 2OWPA 1TU5A 4HVNA 4RNYA 1A2KA 1OH0A 5G2GA 4N6UA 1DMNA 2CFKA 1IQXA 3AMOA 3CCV3 4IT7A 5KP3A 3CCM3 3V98A 1YJN3 4HM1B 1W01A 1DMQA 4R9LA 3B7CA 2WOHA 3DGMA 4EV2A 2OQEC 1WNHA 4FCZA 3RGRA 1W6YA 3F14A 1Q864 4WP5A 1GD4A 5LC7A 3GRDA 4RBNA 1VQN3 4HM0B 3CNMA 3DXOA 4L7KA 4R1KA 3LT8A 1D6YA 4KVHA 3JUMA 3MPHA 3F7SA 1KQS2 3OV4A 1VQ83 4HM3B 3UNLA 5FW5A 3F9SA 4EV5A 1ROVA 1GY5A 4STDA 2WGOA 1SPUA 5D82A 1A2VA 4WFOA 1IVUA 4BTYA 4H3UA 4HM7B 3NQZA 4IPBA 1PU4A 1JNQA 1CYVA 3KN4A 1JV2B 1VQP3 1K8A4 4HKVB 1Y4KA 3F7XA 3GZBA 4LEHA 5IEOA 4HM5B 1WMPA 3ER7A 1ROAA 3BB9A 3FZWA 4PEJA 2C11A 1VZZA 1BUQA 1WMNA 1AVKA 3I563 3JUNA 5AIHA 2OOVC 1OHPA 2ZDJA 1JN5B 3S5CA 1GY6A 3ALAA 1M904 4MEIA 5IW9A 2IA7A 1HU9A 2FGTA 5IG4A 2PZVA 4O8SA 2D1WA 2W0QA 1O7PB 3CC43 1YVBI 2D42A 3FH1A 2Y73A 1VQK3 4XBYA 5ELJA 1OF5A 1GS3A 4HBRA 4HJLB 5KP4A 2PNCA 2ML6A 3FG4A 3JVCA 4N6V0 1GY7A 1QMAA 3WA3A 3F8HA 3IPTA 3KZTA 4EC6A 3L0RA 1FGTA 2BO9B 2IUJA 4KFFA 3Q1CA 1N9JA 1JB2A 4LGQA 1TIJA 3FGYA 4OVMA 3BNDA 1FGQA 2CFLA 1W5ZA 3LXUX 3EJVA 3N54B 1RRLA 4U13A 3BNCA 5EEOA 3S28A 1DMMA 3MKIA 3JUPA 3GAXA 3CCR3 3EF8A 4TX4A 4HM6B 5AI1A 2CWUA 2I9WA 5AEUB 5JBSA 4FCJA 1VQ63 1AV4A 3F8XA 1W6CA 2CG1A 3B8LA 1NB5I 1FA3A 1N9EA 3HK4A 4XBTA 2HMMB 3LTCA 3VGNA 1Q7Y4 3WDGB 3EQQB 1LNHA 2LYXA 3MYTA 4CDLA 1SJWA 4WYKB 1VQL3 4I4KA 4EXRA 3MSOA 4AKZA 3DY5A 1T5YA 5IEPA 1JB5A 3KE7A 3Q2PA 4WHAA 4HM2B 5LC6A 1DVDA 3NHXA 3F40A 2W04A 3BNBA 1VQ43 6STDA 5IG0A 4FR9A 1JJ22 5DRVA 3CC23 1TUHA 1VQ73 1NDOB 3DGLA 1IT8A 4GB5A 8CHOA 3SVAA 4XM4A 3CXC2 4N6MA 1NWWA 4K1UA 3NBBA 3M8CA 1ZO2A 1IV7A 4R80A 5HGRA 1PFPA 1OPYA 4AEQA 2CK3H 1N8R4 1AR0A 3CME3 3E99A 3NXJA 5EVHA 1W6GA 2RSXA 2A15A 2CHCA 3KIIA 2Z6BA 1IDPA 1Z1SA 1OHSA 2YFJB 3DGOA 1G96A 5AIGA 3O8YA 2KRTA 1NO3A 3GZXB 2XSHB 3Q90A 3RDEA 2OTL3 1V74A 2HMJB 1TP6A 2JDIH 2XRXB 4K90B 1KWIA 1UUVB 3SXXA 5JPPA 2KCDA 2RFRA 2HMKB 3G713 1ISKA 1JN5A 3VSYA 1IU7A 4HZ9B 2OQEA 2Q07A 2CW9A 1OUNA 3CU3A 3PCRA 2YFIB 1YIT3 4IIAA 3X3YA 2RCDA 1QAKA 1IK3A 3GZYB 1N5HA 3HIGA 4FMBA 5CF1A 2CWVA 3MG1A 1UI8A 3T8NA 4CCVA 4N6NB 2CG0A 1E3VA 1QVG2 2F99A 3MG2A 3CCS3 1KSIA 4EBGA 1FUWA 1LOXA 3NM7A 3HX8A 3X3XA 3CNXA 3SOYA 3EN8A 3FLJA 3AMOB 4JRFA 1Q824 5AIIA 2ML5A 4O3VA 4AKYA 1SIHA 2MC8A 1WQLB 1O7HB 1NJI4 3CD63 1Q42A 2IUKA 4KFDA 5BVBA 2W56A 3LOYA 3FG3A 1IQ8A 3OX9A 4RNZA 1CEWI 1NB3I 2XR8B 4O02B 3DGNA 2GXFA 1JB4A 3K0ZA 4N3VA 3PGBA 2W03A 2B24B 1SIIA 1R4CA 2OOVA 5AYSC 3UL6A 5EQLA 1ULJB 4J8TA 7STDA 5CLKA 1EA2A 1K9M4 2FXTA 4XDWA 2BMOB 3DM8A 3EB8A 1QALA 2KXGA 3EHCA 3G8ZA 4BTXA 2K0MA 2B1XB 2CKFB 3FSDA 1YHQ3 1VQO3 1EG9B 4WYKA 4MMYB 2CIUA 1WTHA 4ORLA 3LZAA 4LZIA 1DVCA 4O2HA 3X3ZA 2MF7A 2HMLB 3OWYA 5JPUA 2SBLA 5BXQA 2GEYA 2WO0A 3GWRA 1NU3A 3PS8A 3D9RA 3SEDA 3LYGA 3J7Yd 3T0UA 3MHEA 4FMDA 1S5AA 2OTJ3 2P0XA 1YI23 3NV0B 3PYJA 3UJMA 2OCTA 5IG3A 3H3HA 4OUQA 3KSED 1OCVA 4MMXB 2QA43 2WGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W02 A;  1O7W B;  1OGX A;  1OF5 B;  4X2H A;  1U5O A;  2BNG A;  1Q40 B;  3KKG A;  1JKG B;  4HZB B;  3GZR A;  5CF2 A;  5AIF A;  2GBX B;  1STD A;  2R4I A;  4X2O A;  3T8U A;  5D83 A;  3DUK A;  3NUV A;  3I0Y A;  2IMJ A;  3MG3 A;  4L8P A;  3OWS A;  2RGQ A;  2HMO B;  3A76 A;  1ASK A;  4J9A A;  3FF0 A;  3EBT A;  1ULI B;  4WWU C;  2GEX A;  4R9K A;  3CPO A;  1O7M B;  2HMN B;  1K41 A;  3EN1 B;  3ROB A;  4XDV A;  5AEW B;  3EBY A;  1C7H A;  3FF2 A;  5CXO A;  3G0K A;  1O7N B;  1HKX A;  2QIY A;  3OWU A;  1UUW B;  5IF6 A;  5TGN A;  2Z77 A;  3JUO A;  3JUQ A;  2GBW B;  4HM4 B;  5CK6 A;  3DMC A;  3WMD A;  1GYB A;  4XBX A;  4LMI A;  3H51 A;  1QJG A;  3HZP A;  2JQ5 A;  3EC9 A;  1E97 A;  3NV0 A;  2F86 B;  3OXA A;  4MJD A;  3KSP A;  3BLZ A;  4L8O A;  3G16 A;  2STD A;  3NBR A;  3B4O A;  1W00 A;  5IG5 A;  4RZM A;  3FKA A;  1Q40 A;  2YFL B;  5D81 A;  3RGA A;  1JKG A;  1OHO A;  1ZX2 A;  2Z7A A;  5DRE A;  5KP1 A;  1O7G B;  2F98 A;  2INX A;  1CQS A;  4K1V A;  4XB5 A;  3NM2 A;  3SOA A;  1E3R A;  3STD A;  2BMR B;  4HM8 B;  4FCM A;  5STD A;  2K54 A;  3EX9 A;  2UX0 A;  4Q53 A;  2QGU A;  2XSO B;  3B4P A;  3K7C A;  2W2C A;  2Z76 A;  5IER A;  2BMQ B;  1OGZ A;  3DZL A;  3ECF A;  2OWP A;  4HVN A;  1A2K A;  1OH0 A;  5G2G A;  1DMN A;  5KP3 A;  4HM1 B;  1W01 A;  1DMQ A;  4R9L A;  3B7C A;  3RGR A;  1W6Y A;  3F14 A;  4WP5 A;  3GRD A;  4HM0 B;  3CNM A;  3DXO A;  4L7K A;  4R1K A;  4KVH A;  3JUM A;  3F7S A;  3OV4 A;  4HM3 B;  3UNL A;  5FW5 A;  3F9S A;  1GY5 A;  4STD A;  5D82 A;  4H3U A;  4HM7 B;  4HKV B;  3F7X A;  3GZB A;  4LEH A;  5IEO A;  4HM5 B;  3ER7 A;  3BB9 A;  3FZW A;  4PEJ A;  1VZZ A;  1BUQ A;  3JUN A;  5AIH A;  3S5C A;  1OHP A;  1JN5 B;  1GY6 A;  5IG4 A;  2PZV A;  1O7P B;  3FH1 A;  4XBY A;  1OF5 A;  1GS3 A;  4HJL B;  5KP4 A;  1GY7 A;  1QMA A;  3F8H A;  3IPT A;  3KZT A;  4LGQ A;  1JB2 A;  3FGY A;  4OVM A;  3EJV A;  4U13 A;  1DMM A;  3MKI A;  3JUP A;  3EF8 A;  4HM6 B;  5AI1 A;  5AEU B;  2I9W A;  4FCJ A;  3F8X A;  3B8L A;  3HK4 A;  4XBT A;  2HMM B;  3VGN A;  3EQQ B;  3MYT A;  4CDL A;  1SJW A;  4WYK B;  4I4K A;  3MSO A;  5IEP A;  1JB5 A;  3KE7 A;  4HM2 B;  3NHX A;  3F40 A;  6STD A;  5IG0 A;  5DRV A;  1TUH A;  1NDO B;  4GB5 A;  8CHO A;  4XM4 A;  1NWW A;  4K1U A;  5HGR A;  3M8C A;  1ZO2 A;  1OPY A;  1AR0 A;  3E99 A;  5EVH A;  3NXJ A;  2A15 A;  2CHC A;  1IDP A;  1Z1S A;  1OHS A;  2YFJ B;  5AIG A;  3Q90 A;  3GZX B;  2XSH B;  2HMJ B;  1TP6 A;  2XRX B;  1UUV B;  5JPP A;  2RFR A;  1ISK A;  2HMK B;  1JN5 A;  3VSY A;  4HZ9 B;  1OUN A;  3CU3 A;  2YFI B;  4IIA A;  2RCD A;  3GZY B;  5CF1 A;  3MG1 A;  3T8N A;  1E3V A;  2F99 A;  3MG2 A;  3HX8 A;  3CNX A;  3SOY A;  3EN8 A;  3FLJ A;  5AII A;  1WQL B;  1O7H B;  1Q42 A;  5BVB A;  5IEN A;  3OX9 A;  2XR8 B;  2GXF A;  1JB4 A;  3K0Z A;  4N3V A;  2B24 B;  1ULJ B;  4J8T A;  7STD A;  5CLK A;  1EA2 A;  4XDW A;  2BMO B;  3DM8 A;  3G8Z A;  3EHC A;  2B1X B;  2CKF B;  3FSD A;  1EG9 B;  4WYK A;  4ORL A;  3LZA A;  2HML B;  3OWY A;  5JPU A;  5BXQ A;  2GEY A;  3GWR A;  1NU3 A;  3D9R A;  3SED A;  3LYG A;  3MHE A;  1S5A A;  3NV0 B;  3UJM A;  5IG3 A;  3H3H A;  4OUQ A;  1OCV A; 
#chains in the Genus database with same CATH topology
 1RLS A;  1W02 A;  2XFT A;  1N8Q A;  2KF6 A;  1O7W B;  1OGX A;  1OF5 B;  3CMA 3;  4X2H A;  2P0M A;  1U5O A;  2E2U A;  1A67 A;  3IMA B;  3KFQ C;  1FGO A;  2BNG A;  1Q40 B;  4EYC A;  3LTA A;  1I3F A;  5AYR B;  2CX0 A;  1B27 A;  1GMQ A;  3AGN A;  3KKG A;  3CCL 3;  1BGS A;  5BIR A;  1JKG B;  1LOY A;  1W4N A;  4HZB B;  3HOH A;  1IVX A;  3GZR A;  4H61 A;  3S67 A;  5CF2 A;  1L5G B;  5I97 A;  5AIF A;  3WR2 A;  1LRA A;  1US1 A;  2CWT A;  1STD A;  2GBX B;  2J8X B;  2R4I A;  1D6U A;  4MMZ B;  3D3L A;  4X2O A;  3T8U A;  5A0O B;  1FUT A;  2F56 A;  4ZM8 A;  7GSP A;  5D83 A;  4FMC A;  4ILF A;  1MWS A;  3PZW A;  1FUS A;  3DUK A;  1RGF A;  3NUV A;  5BU4 A;  3I0Y A;  1YJW 3;  1FGR A;  2KAA A;  4K61 A;  1EEJ A;  2IMJ A;  1BRH A;  3UL5 A;  5IEN A;  1GSP A;  3BNE A;  1LNI A;  1LXE A;  1RN4 A;  1IVW A;  1OAC A;  2Y74 A;  3K5T A;  3QK9 A;  3WOE B;  3MG3 A;  3K9M C;  4L8P A;  3OWS A;  2RGQ A;  1EQK A;  3LH4 A;  1AVL A;  1MOL A;  2HMO B;  2XGN A;  2CFG A;  1LQM B;  1BAO A;  1N5P A;  2W6J H;  4GL6 A;  3NBJ A;  3G6E 3;  2GU3 A;  3A76 A;  3CPW 2;  1VQ5 3;  1NNV A;  1ASK A;  2UUG C;  4J9A A;  3OW2 2;  1BSA A;  2KF3 A;  3FF0 A;  1IVV A;  2BIR A;  3EBT A;  2KF4 A;  1BRI A;  1ULI B;  1BRG A;  3HI7 A;  4LSO A;  2GEX A;  1QAF A;  4KZ1 A;  4R9K A;  3K63 A;  4WWU C;  3N9H A;  2WOF A;  1BRK A;  3CPO A;  3AHS A;  1O7M B;  3LTD A;  3NQY A;  4LYL B;  1KC8 4;  3WOF B;  2CH9 A;  3EE1 A;  2HMN B;  1K41 A;  4NHF A;  2CFW A;  3EN1 B;  1UCL A;  3ROB A;  2E2T A;  1IQY A;  4XDV A;  5AEW B;  1D6Z A;  3EBY A;  2XFS A;  8RNT A;  1FZU A;  1C7H A;  3FF2 A;  1M1X B;  2W9P A;  1B2Z A;  7RNT A;  2O9U X;  1QVF 2;  5CXO A;  4DKI A;  3G0K A;  1K28 A;  1O7N B;  1C54 A;  3CCQ 3;  3LTB A;  1HKX A;  2QIY A;  3OWU A;  1B3S A;  3D5I A;  3TDG A;  1UUW B;  5FGO A;  3I55 3;  3CCU 3;  5IF6 A;  1RKY A;  1RN7 A;  4N6L A;  3HII A;  5TGN A;  1UI7 A;  1YIJ 3;  3WHO A;  2P05 A;  2XGL A;  2Z77 A;  3JUO A;  3JUQ A;  3V92 A;  4FMA A;  3VF1 A;  1F8N A;  2GBW B;  2ZL8 A;  3QRD A;  9RNT A;  4HM4 B;  5CK6 A;  1IV9 A;  1MNL A;  3DMC A;  1S72 3;  1J2B A;  2M7O A;  1B20 A;  3WMD A;  2C10 A;  1MWR A;  1PYL A;  1GYB A;  1MWT A;  4XBX A;  5G1L A;  1RTU A;  2UGI A;  4LMI A;  3H51 A;  2CX1 A;  3V99 A;  3MWZ A;  3D79 A;  1QJG A;  1X1U A;  1TFK A;  1GD3 A;  1YGW A;  4NRE A;  4GHO A;  3HZP A;  1VQ9 3;  2XEP A;  2CFD A;  2JQ5 A;  3EC9 A;  1M9G A;  1SAR A;  1E97 A;  3NV0 A;  3CCJ 3;  3PCS A;  3U97 A;  2F86 B;  2HOH A;  3WA2 X;  3OXA A;  3AHW A;  3KSP A;  1RSN A;  3BLZ A;  4MJD A;  4BU4 A;  2GU1 A;  2LQV A;  4L8O A;  3SYU A;  1VQM 3;  3G16 A;  2STD A;  1M1K 4;  3S27 A;  1X1Y A;  3NBR A;  3B4O A;  6GSP A;  1W00 A;  1UW1 A;  3N8B A;  5IG5 A;  4RZM A;  3FKA A;  1Q40 A;  2YFL B;  1I3I A;  2E2V A;  5D81 A;  2V1L A;  1UCI A;  2P38 A;  1YVS A;  3RGA A;  3ZFZ A;  4BL2 A;  3BU4 A;  1JKG A;  4OK0 A;  4EW5 A;  1EKM A;  2CC3 A;  1Q81 4;  1OHO A;  1ZX2 A;  2Z7A A;  4QWT A;  5DRE A;  5KP1 A;  1O7G B;  1W7C A;  1ZS7 A;  3WOD G;  1W2B 2;  1GMP A;  2BU4 A;  3SX1 A;  1DET A;  2F98 A;  1RRH A;  2FNQ A;  1LVN A;  2INX A;  1CQS A;  1CYU A;  4K1V A;  2W56 B;  2QEX 3;  1RGK A;  1STF I;  1G0T A;  4XB5 A;  5ELU A;  4NPB A;  3X41 A;  1K73 4;  3X40 A;  3LT9 A;  4R4K A;  1W2Z A;  1B2U A;  2L4V A;  3ZG5 A;  3UB1 A;  3NM2 A;  3NX0 A;  3SOA A;  1E3R A;  1UGH I;  3X42 A;  2AAE A;  3STD A;  2BMR B;  4CPK A;  3G4S 3;  3CCE 3;  1B21 A;  3LML A;  4N6O B;  1DYU A;  1V57 A;  4HM8 B;  4JF8 A;  2BT3 A;  4HYZ A;  4FCM A;  1LOW A;  4KFE A;  2K54 A;  2YX9 A;  2UX0 A;  3EX9 A;  1UDI I;  4Q53 A;  5STD A;  1U8C B;  2KF5 A;  1RJO A;  2QGU A;  2W9Q A;  2RBI A;  2XSO B;  3IJE B;  4BTW A;  1YJ9 3;  1TFO A;  1YGE A;  3B4P A;  3U1W A;  4N6T A;  1BSC A;  1RNT A;  3S29 A;  3K7C A;  2W2C A;  2XF3 A;  2Z76 A;  1KD1 4;  5RNT A;  3SLU A;  5IER A;  3BIR A;  1A90 A;  1JRQ A;  3FG1 A;  2BHM A;  1WMO A;  2BMQ B;  2XH9 A;  1OGZ A;  2AAD A;  3PXM A;  2P09 A;  1FGM A;  1SQW A;  2C4B A;  3DZL A;  3FCS B;  1IT7 A;  4G1M B;  3ECF A;  1RCL A;  2O3O A;  2OWP A;  5HOH A;  1TU5 A;  4HVN A;  4RNY A;  1A2K A;  3CC7 3;  1OH0 A;  5G2G A;  1BNG A;  1JZD A;  4N6U A;  1DMN A;  1PY3 A;  2CFK A;  1IQX A;  3GSP A;  3AMO A;  3CCV 3;  4IT7 A;  1G02 A;  5KP3 A;  3CCM 3;  3V98 A;  1YJN 3;  4HM1 B;  1W01 A;  1DMQ A;  4R9L A;  2GSP A;  3B7C A;  2WOH A;  3DGM A;  1BRN L;  1AQZ A;  4EV2 A;  2OQE C;  1LQG C;  4I5Q A;  1WNH A;  4FCZ A;  3RGR A;  1W6Y A;  3F14 A;  1Q86 4;  4WP5 A;  1GD4 A;  5LC7 A;  3GRD A;  4RBN A;  1RHL A;  1VQN 3;  4HM0 B;  1ZGX A;  2F5W A;  3CNM A;  3DXO A;  4L7K A;  3LT8 A;  4R1K A;  1D6Y A;  4KVH A;  1BUJ A;  3JUM A;  1JBR A;  3RNT A;  3MPH A;  1RN1 A;  3F7S A;  1KQS 2;  3OV4 A;  1VQ8 3;  4HM3 B;  3UNL A;  5FW5 A;  3F9S A;  4HOH A;  1ROV A;  4EV5 A;  1FW7 A;  1GY5 A;  4STD A;  2WGO A;  1SPU A;  5D82 A;  1A2V A;  4WFO A;  1I2G A;  1IVU A;  4BTY A;  4H3U A;  4HM7 B;  1RCK A;  3NQZ A;  4IPB A;  1PU4 A;  1JNQ A;  2H0I A;  1CYV A;  3KN4 A;  1JV2 B;  1VQP 3;  1K8A 4;  4HKV B;  1Y4K A;  3F7X A;  1V58 A;  4BL3 A;  3GZB A;  2SAR A;  4LEH A;  1RGE A;  5IEO A;  4HM5 B;  4CJN A;  1WMP A;  3ER7 A;  1ROA A;  3BB9 A;  3FZW A;  4PEJ A;  1BNF A;  2C11 A;  1VZZ A;  1BUQ A;  1WMN A;  1AVK A;  3I56 3;  3JUN A;  5AIH A;  2OOV C;  1OHP A;  2K3D A;  1JN5 B;  2ZDJ A;  1GY6 A;  3ALA A;  3S5C A;  1M90 4;  4MEI A;  5IW9 A;  2IA7 A;  1HU9 A;  2FGT A;  5IG4 A;  2PZV A;  4O8S A;  2D1W A;  2W0Q A;  1O7P B;  3CC4 3;  1YVB I;  2D42 A;  3FH1 A;  2Y73 A;  1VQK 3;  4XBY A;  5ELJ A;  1OF5 A;  1GS3 A;  4HBR A;  3DGY A;  4HJL B;  1A2P A;  5KP4 A;  2PNC A;  2ML6 A;  3FG4 A;  3JVC A;  4N6V 0;  2L1S A;  1GY7 A;  1QMA A;  3WA3 A;  3F8H A;  3IPT A;  3KZT A;  4EC6 A;  3L0R A;  1FGT A;  5M18 A;  2BO9 B;  2IUJ A;  4KFF A;  3Q1C A;  3URP A;  1MGR A;  1N9J A;  1JB2 A;  1TRQ A;  4LGQ A;  1BSE A;  1TIJ A;  3FGY A;  4OVM A;  5M19 A;  3BND A;  5GSP A;  3D4A A;  1FGQ A;  2CFL A;  1W5Z A;  3LXU X;  3EJV A;  3N54 B;  1RRL A;  3KCH A;  3BNC A;  4U13 A;  5EEO A;  1DMM A;  5M1A A;  3S28 A;  3MKI A;  1B2M A;  1YNV X;  3JUP A;  3GAX A;  3CCR 3;  3EF8 A;  4TX4 A;  1BSD A;  4HM6 B;  5AI1 A;  2CWU A;  2I9W A;  5AEU B;  5JBS A;  4FCJ A;  1VQ6 3;  4KT3 B;  1AV4 A;  3F8X A;  1W6C A;  1LOV A;  3AGO A;  2CG1 A;  1I0X A;  3B8L A;  1CH0 A;  1NB5 I;  1FA3 A;  1BNJ A;  1N9E A;  3HK4 A;  4XBT A;  2HMM B;  3LTC A;  3VGN A;  1Q7Y 4;  2IYJ A;  3WDG B;  3EQQ B;  1R4Y A;  1LNH A;  2LYX A;  3MYT A;  4CDL A;  1SJW A;  1BNI A;  1DE3 A;  4WYK B;  1I70 A;  4I4K A;  1VQL 3;  4EXR A;  1MWU A;  3MSO A;  4AKZ A;  3DY5 A;  1T5Y A;  1RDS A;  1RGG A;  1JB5 A;  5IEP A;  3KE7 A;  3Q2P A;  4WHA A;  1BU4 A;  4HM2 B;  5LC6 A;  1DVD A;  3NHX A;  1GOU A;  3F40 A;  1RMS A;  2W04 A;  3BNB A;  1VQ4 3;  1BRJ A;  4J5G A;  6STD A;  5IG0 A;  4FR9 A;  1JJ2 2;  1T3B A;  5DRV A;  3A5E A;  3CC2 3;  1TUH A;  1VQ7 3;  1NDO B;  1RGH A;  1IT8 A;  3DGL A;  2ZA4 A;  4GB5 A;  2F4Y A;  8CHO A;  3SVA A;  4XM4 A;  3CXC 2;  1RGA A;  1NWW A;  4K1U A;  3NBB A;  3M8C A;  1ZO2 A;  1IV7 A;  4N6M A;  4R80 A;  5HGR A;  1BOX A;  1PFP A;  1X1W A;  1OPY A;  4AEQ A;  2CK3 H;  1AY7 A;  1AR0 A;  3CME 3;  1N8R 4;  3E99 A;  3NXJ A;  5EVH A;  1RNB A;  1W6G A;  2RSX A;  2A15 A;  2CHC A;  3KII A;  2ZHX B;  2Z6B A;  1I2E A;  1IDP A;  1Z1S A;  2RNT A;  1OHS A;  6RNT A;  2YFJ B;  3DGO A;  1G96 A;  5AIG A;  1JBT A;  3O8Y A;  1I0V A;  1TTO A;  2KRT A;  1NO3 A;  3GZX B;  2XSH B;  3Q90 A;  3RDE A;  2OTL 3;  1V74 A;  2HMJ B;  1TP6 A;  2JDI H;  2XRX B;  4K90 B;  4J5K A;  1KWI A;  1UUV B;  3SXX A;  1BAN A;  2KCD A;  2RFR A;  2HMK B;  5JPP A;  2H0H A;  3G71 3;  1ISK A;  1Q7H A;  1BNR A;  1JN5 A;  3VSY A;  1IU7 A;  4HZ9 B;  2OQE A;  2Q07 A;  2CW9 A;  1OUN A;  3CU3 A;  2WGQ A;  3PCR A;  2YFI B;  1BNS A;  3ZG0 A;  1YIT 3;  4IIA A;  3X3Y A;  2RCD A;  1QAK A;  1IK3 A;  3GZY B;  1N5H A;  3HIG A;  4FMB A;  5CF1 A;  1VQQ A;  2CWV A;  3MG1 A;  1HYF A;  1Q9E A;  1UI8 A;  3T8N A;  4CCV A;  4N6N B;  2CG0 A;  1E3V A;  1QVG 2;  2F99 A;  3MG2 A;  3CCS 3;  4GSP A;  1BIR A;  1TRP A;  1KSI A;  4EBG A;  1FUW A;  1T2I A;  1LOX A;  4HAA A;  3D5G A;  3NM7 A;  3HX8 A;  4BIR A;  3X3X A;  1UCJ A;  3CNX A;  3SOY A;  3EN8 A;  3FLJ A;  3AMO B;  4JRF A;  1Q82 4;  5AII A;  2ML5 A;  4O3V A;  4AKY A;  1SIH A;  2MC8 A;  1WQL B;  1O7H B;  1NJI 4;  3CD6 3;  1Q42 A;  2IUK A;  4KFD A;  5BVB A;  2W56 A;  3LOY A;  3FG3 A;  1IQ8 A;  3OX9 A;  4RNZ A;  1CEW I;  1JBS A;  1UCK A;  1B2X A;  1NB3 I;  1I8V A;  1GOV A;  1HZ1 A;  1TJD A;  2GXF A;  1JZO A;  2XR8 B;  3DGN A;  4O02 B;  1JB4 A;  3K0Z A;  5G1K A;  4N3V A;  3PGB A;  1RGC A;  2F5M A;  2B24 B;  1SII A;  2W03 A;  3Q3F A;  2OOV A;  1UGI A;  5AYS C;  3UL6 A;  5EQL A;  1ULJ B;  4J8T A;  3DH2 A;  1I2F A;  7STD A;  5CLK A;  1T2H A;  1EA2 A;  2H0G A;  1K9M 4;  1X1X A;  2IY2 A;  1BNE A;  2FXT A;  4XDW A;  2BMO B;  3DM8 A;  3EB8 A;  1EUI C;  1QAL A;  2KXG A;  3EHC A;  1BSB A;  3G8Z A;  4BTX A;  2K0M A;  2B1X B;  2CKF B;  3FSD A;  1YHQ 3;  1VQO 3;  1EG9 B;  4WYK A;  4MMY B;  1GOY A;  1BRS A;  1GMR A;  1WTH A;  2CIU A;  4ORL A;  1B2S A;  3LZA A;  4LZI A;  1DVC A;  4O2H A;  3X3Z A;  2MF7 A;  2HML B;  3OWY A;  5JPU A;  1FYS A;  1MGW A;  2SBL A;  5BXQ A;  2GEY A;  1RGL A;  2WO0 A;  2R41 A;  3GWR A;  1NU3 A;  1BVI A;  3PS8 A;  3D9R A;  3SED A;  3LYG A;  3J7Y d;  3T0U A;  3MHE A;  4FMD A;  1S5A A;  2OTJ 3;  2P0X A;  1YI2 3;  1UUG B;  3NV0 B;  3PYJ A;  3UJM A;  1IYY A;  4RNT A;  2OCT A;  5IG3 A;  3H3H A;  4OUQ A;  3KSE D;  1OCV A;  4MMX B;  2QA4 3;  1R4C A; 
#chains in the Genus database with same CATH homology
 1W02 A;  2XFT A;  1N8Q A;  1O7W B;  1OGX A;  1OF5 B;  3CMA 3;  4X2H A;  2P0M A;  1U5O A;  2E2U A;  1A67 A;  3IMA B;  3KFQ C;  1FGO A;  2BNG A;  1Q40 B;  4EYC A;  3LTA A;  5AYR B;  3CCL 3;  3KKG A;  1JKG B;  4HZB B;  1W4N A;  1IVX A;  3GZR A;  4H61 A;  3S67 A;  5CF2 A;  1L5G B;  5I97 A;  5AIF A;  1US1 A;  2CWT A;  2GBX B;  1STD A;  2R4I A;  4MMZ B;  1D6U A;  3D3L A;  4X2O A;  3T8U A;  5A0O B;  4ZM8 A;  5D83 A;  4FMC A;  3PZW A;  3DUK A;  3NUV A;  3I0Y A;  1YJW 3;  1FGR A;  4K61 A;  2IMJ A;  5IEN A;  3UL5 A;  3BNE A;  1LXE A;  1IVW A;  1OAC A;  2Y74 A;  3K5T A;  3QK9 A;  3WOE B;  3MG3 A;  3K9M C;  4L8P A;  3OWS A;  2RGQ A;  1EQK A;  3LH4 A;  1AVL A;  1MOL A;  2HMO B;  2XGN A;  2CFG A;  1N5P A;  2W6J H;  4GL6 A;  3NBJ A;  3G6E 3;  2GU3 A;  3A76 A;  3CPW 2;  1VQ5 3;  1ASK A;  4J9A A;  3OW2 2;  3FF0 A;  1IVV A;  3EBT A;  1ULI B;  3HI7 A;  4LSO A;  4WWU C;  2GEX A;  1QAF A;  4KZ1 A;  4R9K A;  3K63 A;  3N9H A;  2WOF A;  3CPO A;  3LTD A;  1O7M B;  3NQY A;  1KC8 4;  3WOF B;  2CH9 A;  3EE1 A;  2HMN B;  1K41 A;  4NHF A;  2CFW A;  3EN1 B;  3ROB A;  2E2T A;  1IQY A;  4XDV A;  5AEW B;  1D6Z A;  3EBY A;  2XFS A;  1C7H A;  3FF2 A;  1M1X B;  2W9P A;  2O9U X;  1QVF 2;  5CXO A;  3G0K A;  1K28 A;  1O7N B;  3CCQ 3;  3LTB A;  1HKX A;  2QIY A;  3OWU A;  3TDG A;  1UUW B;  5FGO A;  3I55 3;  3CCU 3;  5IF6 A;  1RKY A;  1RN7 A;  4N6L A;  3HII A;  5TGN A;  1UI7 A;  1YIJ 3;  2P05 A;  2XGL A;  2Z77 A;  3JUO A;  3JUQ A;  3V92 A;  4FMA A;  3VF1 A;  1F8N A;  2GBW B;  2ZL8 A;  3QRD A;  4HM4 B;  5CK6 A;  1IV9 A;  1MNL A;  3DMC A;  1S72 3;  1J2B A;  2M7O A;  3WMD A;  2C10 A;  1GYB A;  4XBX A;  4LMI A;  3H51 A;  3V99 A;  3MWZ A;  1QJG A;  1TFK A;  1GD3 A;  4NRE A;  3HZP A;  1VQ9 3;  2XEP A;  2CFD A;  2JQ5 A;  3EC9 A;  1M9G A;  1E97 A;  3NV0 A;  3CCJ 3;  3PCS A;  3U97 A;  2F86 B;  3WA2 X;  3OXA A;  3KSP A;  3BLZ A;  4MJD A;  2GU1 A;  2LQV A;  4L8O A;  1VQM 3;  3G16 A;  2STD A;  1M1K 4;  3S27 A;  3NBR A;  3B4O A;  1W00 A;  1UW1 A;  3N8B A;  5IG5 A;  4RZM A;  3FKA A;  1Q40 A;  2YFL B;  2E2V A;  5D81 A;  2V1L A;  2P38 A;  3RGA A;  1JKG A;  4OK0 A;  1EKM A;  2CC3 A;  1Q81 4;  1OHO A;  1ZX2 A;  2Z7A A;  4QWT A;  5DRE A;  5KP1 A;  1O7G B;  1W7C A;  3WOD G;  1W2B 2;  3SX1 A;  2F98 A;  1RRH A;  2FNQ A;  1LVN A;  2INX A;  1CQS A;  1CYU A;  4K1V A;  2W56 B;  2QEX 3;  1STF I;  4XB5 A;  5ELU A;  3X41 A;  1K73 4;  3X40 A;  3LT9 A;  4R4K A;  1W2Z A;  2L4V A;  3UB1 A;  3NM2 A;  3NX0 A;  3SOA A;  1E3R A;  3X42 A;  3STD A;  2BMR B;  3G4S 3;  3CCE 3;  3LML A;  4N6O B;  1DYU A;  4HM8 B;  4JF8 A;  2BT3 A;  4HYZ A;  4FCM A;  4KFE A;  2K54 A;  2YX9 A;  2UX0 A;  3EX9 A;  4Q53 A;  5STD A;  3CC7 3;  1U8C B;  2QGU A;  1RJO A;  2W9Q A;  2XSO B;  3IJE B;  4BTW A;  1YJ9 3;  1TFO A;  1YGE A;  3B4P A;  3U1W A;  4N6T A;  3S29 A;  3K7C A;  2W2C A;  2XF3 A;  2Z76 A;  1KD1 4;  3SLU A;  5IER A;  1A90 A;  1JRQ A;  3FG1 A;  2BHM A;  1WMO A;  2BMQ B;  2XH9 A;  1OGZ A;  3PXM A;  2P09 A;  1FGM A;  1SQW A;  3FCS B;  3DZL A;  4G1M B;  1IT7 A;  3ECF A;  2O3O A;  2OWP A;  1TU5 A;  4HVN A;  4RNY A;  1A2K A;  1OH0 A;  5G2G A;  4N6U A;  1DMN A;  2CFK A;  1IQX A;  3AMO A;  3CCV 3;  4IT7 A;  5KP3 A;  3CCM 3;  3V98 A;  1YJN 3;  4HM1 B;  1W01 A;  1DMQ A;  4R9L A;  3B7C A;  2WOH A;  3DGM A;  4EV2 A;  2OQE C;  1WNH A;  4FCZ A;  3RGR A;  1W6Y A;  3F14 A;  1Q86 4;  4WP5 A;  1GD4 A;  5LC7 A;  3GRD A;  4RBN A;  1VQN 3;  4HM0 B;  3CNM A;  3DXO A;  4L7K A;  4R1K A;  3LT8 A;  1D6Y A;  4KVH A;  3JUM A;  3MPH A;  3F7S A;  1KQS 2;  3OV4 A;  1VQ8 3;  4HM3 B;  3UNL A;  5FW5 A;  3F9S A;  4EV5 A;  1ROV A;  1GY5 A;  4STD A;  2WGO A;  1SPU A;  5D82 A;  1A2V A;  4WFO A;  1IVU A;  4BTY A;  4H3U A;  4HM7 B;  3NQZ A;  4IPB A;  1PU4 A;  1JNQ A;  1CYV A;  3KN4 A;  1JV2 B;  1VQP 3;  1K8A 4;  4HKV B;  1Y4K A;  3F7X A;  3GZB A;  4LEH A;  5IEO A;  4HM5 B;  1WMP A;  3ER7 A;  1ROA A;  3BB9 A;  3FZW A;  4PEJ A;  2C11 A;  1VZZ A;  1BUQ A;  1WMN A;  1AVK A;  3I56 3;  3JUN A;  5AIH A;  2OOV C;  1OHP A;  2ZDJ A;  1JN5 B;  3S5C A;  1GY6 A;  3ALA A;  1M90 4;  4MEI A;  5IW9 A;  2IA7 A;  1HU9 A;  2FGT A;  5IG4 A;  2PZV A;  4O8S A;  2D1W A;  2W0Q A;  1O7P B;  3CC4 3;  1YVB I;  2D42 A;  3FH1 A;  2Y73 A;  1VQK 3;  4XBY A;  5ELJ A;  1OF5 A;  1GS3 A;  4HBR A;  4HJL B;  5KP4 A;  2PNC A;  2ML6 A;  3FG4 A;  3JVC A;  4N6V 0;  1GY7 A;  1QMA A;  3WA3 A;  3F8H A;  3IPT A;  3KZT A;  4EC6 A;  3L0R A;  1FGT A;  2BO9 B;  2IUJ A;  4KFF A;  3Q1C A;  1N9J A;  1JB2 A;  4LGQ A;  1TIJ A;  3FGY A;  4OVM A;  3BND A;  1FGQ A;  2CFL A;  1W5Z A;  3LXU X;  3EJV A;  3N54 B;  1RRL A;  4U13 A;  3BNC A;  5EEO A;  3S28 A;  1DMM A;  3MKI A;  3JUP A;  3GAX A;  3CCR 3;  3EF8 A;  4TX4 A;  4HM6 B;  5AI1 A;  2CWU A;  2I9W A;  5AEU B;  5JBS A;  4FCJ A;  1VQ6 3;  1AV4 A;  3F8X A;  1W6C A;  2CG1 A;  3B8L A;  1NB5 I;  1FA3 A;  1N9E A;  3HK4 A;  4XBT A;  2HMM B;  3LTC A;  3VGN A;  1Q7Y 4;  3WDG B;  3EQQ B;  1LNH A;  2LYX A;  3MYT A;  4CDL A;  1SJW A;  4WYK B;  1VQL 3;  4I4K A;  4EXR A;  3MSO A;  4AKZ A;  3DY5 A;  1T5Y A;  5IEP A;  1JB5 A;  3KE7 A;  3Q2P A;  4WHA A;  4HM2 B;  5LC6 A;  1DVD A;  3NHX A;  3F40 A;  2W04 A;  3BNB A;  1VQ4 3;  6STD A;  5IG0 A;  4FR9 A;  1JJ2 2;  5DRV A;  3CC2 3;  1TUH A;  1VQ7 3;  1NDO B;  3DGL A;  1IT8 A;  4GB5 A;  8CHO A;  3SVA A;  4XM4 A;  3CXC 2;  4N6M A;  1NWW A;  4K1U A;  3NBB A;  3M8C A;  1ZO2 A;  1IV7 A;  4R80 A;  5HGR A;  1PFP A;  1OPY A;  4AEQ A;  2CK3 H;  1N8R 4;  1AR0 A;  3CME 3;  3E99 A;  3NXJ A;  5EVH A;  1W6G A;  2RSX A;  2A15 A;  2CHC A;  3KII A;  2Z6B A;  1IDP A;  1Z1S A;  1OHS A;  2YFJ B;  3DGO A;  1G96 A;  5AIG A;  3O8Y A;  2KRT A;  1NO3 A;  3GZX B;  2XSH B;  3Q90 A;  3RDE A;  2OTL 3;  1V74 A;  2HMJ B;  1TP6 A;  2JDI H;  2XRX B;  4K90 B;  1KWI A;  1UUV B;  3SXX A;  5JPP A;  2KCD A;  2RFR A;  2HMK B;  3G71 3;  1ISK A;  1JN5 A;  3VSY A;  1IU7 A;  4HZ9 B;  2OQE A;  2Q07 A;  2CW9 A;  1OUN A;  3CU3 A;  3PCR A;  2YFI B;  1YIT 3;  4IIA A;  3X3Y A;  2RCD A;  1QAK A;  1IK3 A;  3GZY B;  1N5H A;  3HIG A;  4FMB A;  5CF1 A;  2CWV A;  3MG1 A;  1UI8 A;  3T8N A;  4CCV A;  4N6N B;  2CG0 A;  1E3V A;  1QVG 2;  2F99 A;  3MG2 A;  3CCS 3;  1KSI A;  4EBG A;  1FUW A;  1LOX A;  3NM7 A;  3HX8 A;  3X3X A;  3CNX A;  3SOY A;  3EN8 A;  3FLJ A;  3AMO B;  4JRF A;  1Q82 4;  5AII A;  2ML5 A;  4O3V A;  4AKY A;  1SIH A;  2MC8 A;  1WQL B;  1O7H B;  1NJI 4;  3CD6 3;  1Q42 A;  2IUK A;  4KFD A;  5BVB A;  2W56 A;  3LOY A;  3FG3 A;  1IQ8 A;  3OX9 A;  4RNZ A;  1CEW I;  1NB3 I;  2XR8 B;  4O02 B;  3DGN A;  2GXF A;  1JB4 A;  3K0Z A;  4N3V A;  3PGB A;  2W03 A;  2B24 B;  1SII A;  1R4C A;  2OOV A;  5AYS C;  3UL6 A;  5EQL A;  1ULJ B;  4J8T A;  7STD A;  5CLK A;  1EA2 A;  1K9M 4;  2FXT A;  4XDW A;  2BMO B;  3DM8 A;  3EB8 A;  1QAL A;  2KXG A;  3EHC A;  3G8Z A;  4BTX A;  2K0M A;  2B1X B;  2CKF B;  3FSD A;  1YHQ 3;  1VQO 3;  1EG9 B;  4WYK A;  4MMY B;  2CIU A;  1WTH A;  4ORL A;  3LZA A;  4LZI A;  1DVC A;  4O2H A;  3X3Z A;  2MF7 A;  2HML B;  3OWY A;  5JPU A;  2SBL A;  5BXQ A;  2GEY A;  2WO0 A;  3GWR A;  1NU3 A;  3PS8 A;  3D9R A;  3SED A;  3LYG A;  3J7Y d;  3T0U A;  3MHE A;  4FMD A;  1S5A A;  2OTJ 3;  2P0X A;  1YI2 3;  3NV0 B;  3PYJ A;  3UJM A;  2OCT A;  5IG3 A;  3H3H A;  4OUQ A;  3KSE D;  1OCV A;  4MMX B;  2QA4 3;  2WGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...