3F40A

Crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
MKTQITTRDLVLEFIHALNTENFPAAKKRLNENFTFNGPMGHREGSERYMNDMEKMKFKYVVHKMFEEGNDVCLIYDINMNGKTIAASGLYHLEKGEITSLHVYFDPRPLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_677363.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 1.27 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Structural genomics, unknown function
total genus 28
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f40A00
1ASKA 2HMJB 4J8TA 2HMKB 1OUNA 3M8CA 2CKFB 3UNLA 4HM8B 4KVHA 1U5OA 3OWYA 3EHCA 3OXAA 1OHSA 3NV0B 3FF0A 1JN5A 4WYKB 3DXOA 1STDA 1OF5B 2IMJA 3SOAA 4XB5A 6STDA 3OV4A 3H51A 3NXJA 3BLZA 4ORLA 4OVMA 3E99A 2R4IA 5CXOA 1NU3A 5FW5A 4K1UA 3T8UA 3GRDA 1DMQA 2W2CA 5STDA 1OHPA 5DRVA 3NV0A 2XSHB 1AR0A 2F86B 5BXQA 4R9LA 5HGRA 1W01A 4WYKA 5AIFA 1OF5A 1EA2A 5KP3A 5IG5A 4GB5A 1DMMA 7STDA 3DUKA 5JPUA 3WMDA 3JUNA 3MG3A 3ECFA 2K54A 4HM0B 5CF2A 3FLJA 2INXA 2RFRA 3KKGA 1ZX2A 4XBTA 3SOYA 1ULJB 1JB5A 4L8OA 2RGQA 3GZYB 3NM2A 2YFJB 3NUVA 3MYTA 3B4OA 4OUQA 3B4PA 4LEHA 1OGZA 4XDVA 1ULIB 1JKGB 2BNGA 3EJVA 5CLKA 3I0YA 3EBYA 5KP4A 4HVNA 5IEOA 1OCVA 2F98A 3F9SA 4L8PA 3F7XA 3JUPA 4HZ9B 3S5CA 1HKXA 5IENA 3HK4A 3OWSA 1JB2A 1NWWA 3K7CA 2RCDA 1ISKA 4Q53A 5AEWB 3F14A 1Q42A 3D9RA 3F7SA 5IG4A 3EF8A 1O7MB 1JKGA 3FF2A 1E97A 3KZTA 8CHOA 3GZXB 5IEPA 4XM4A 1ZO2A 1UUVB 1IDPA 3G0KA 2QGUA 2Z7AA 4I4KA 4STDA 3ER7A 1S5AA 2XR8B 2B24B 1QJGA 3FZWA 1C7HA 3DM8A 1W02A 2OWPA 5TGNA 5D81A 1TUHA 3UJMA 1GY7A 5BVBA 1JB4A 5EVHA 5IG0A 1NDOB 4HM2B 3VGNA 4RZMA 2XRXB 3JUQA 3RGRA 5D82A 3A76A 5DREA 2Z76A 3HX8A 1OGXA 3NHXA 2HMMB 1TP6A 4HM3B 3EBTA 2BMOB 4FCMA 5D83A 4HM5B 2JQ5A 4HM6B 3F8HA 2BMQB 4HKVB 4MJDA 4WP5A 1O7NB 5CK6A 2Z77A 4L7KA 1W00A 3GWRA 3VSYA 1OPYA 4PEJA 3BB9A 3JUOA 4CDLA 1BUQA 3JUMA 2UX0A 3FKAA 1GS3A 1GY6A 2GEYA 3EQQB 2A15A 5G2GA 3EN1B 1OHOA 2BMRB 2HMLB 1W6YA 1JN5B 3G16A 3B8LA 4K1VA 4R9KA 3SEDA 2YFLB 4HM4B 2YFIB 1E3VA 1Q40B 3MG2A 1O7GB 2STDA 3F40A 4HM7B 4LMIA 3NBRA 3EN8A 3DZLA 1VZZA 1DMNA 2B1XB 3MKIA 3EC9A 3STDA 5IF6A 3LZAA 3F8XA 3K0ZA 3GZRA 1OH0A 3CPOA 2HMOB 4H3UA 2HMNB 4X2OA 4XBXA 3KSPA 4FCJA 3H3HA 3FGYA 5IERA 1QMAA 1EG9B 1Q40A 3ROBA 1WQLB 2QIYA 4U13A 4R1KA 3MSOA 4X2HA 3FH1A 4HM1B 2CHCA 3B7CA 1K41A 4J9AA 3KE7A 4IIAA 1GY5A 3RGAA 3OX9A 3G8ZA 5AIHA 3CNMA 3DMCA 3IPTA 1O7PB 1E3RA 4WWUC 4XBYA 4HJLB 3OWUA 1UUWB 4XDWA 3CNXA 5AI1A 2PZVA 5AEUB 5KP1A 3T8NA 3FSDA 3MG1A 2F99A 2XSOB 3LYGA 5CF1A 1SJWA 5JPPA 3HZPA 1O7WB 1Z1SA 3Q90A 4N3VA 1GYBA 3MHEA 5IG3A 2GBXB 2GBWB 1O7HB 1A2KA 2I9WA 1CQSA 3EX9A 4HZBB 4LGQA 2GXFA 3CU3A 3GZBA 5AIGA 5AIIA 2GEXA
chains in the Genus database with same CATH superfamily
1ASKA 2GSPA 3S29A 2SARA 3AGOA 2HMJB 4J8TA 3WOEB 1GD4A 1GMQA 1BRIA 1KWIA 2CFWA 3AHSA 3SVAA 2HMKB 1OUNA 3HI7A 2BIRA 1YNVX 3DGNA 1QAFA 1WTHA 1FGOA 3M8CA 2CKFB 3PXMA 3CCS3 2BT3A 1N8R4 1GMPA 3UNLA 4HM8B 4MMYB 4WFOA 4KVHA 1CYVA 1U5OA 4MEIA 3OWYA 1RN7A 3ZG0A 2E2UA 1RGAA 3EHCA 2XFTA 1DYUA 4CPKA 1A2VA 3OXAA 1TIJA 1M9GA 1OHSA 3NV0B 2OQEC 1K28A 1M904 3FF0A 3I563 1JN5A 1LOVA 1ROAA 4J5KA 2OQEA 5EQLA 2L1SA 4JF8A 1YVBI 1EEJA 4K61A 1DVCA 3HIGA 4WYKB 3DXOA 1STDA 1OF5B 2IMJA 3SOAA 1YIT3 4XB5A 6STDA 1GMRA 3OV4A 3H51A 3NXJA 3BLZA 2KF4A 4EV5A 1Q7Y4 1EQKA 3K63A 4ORLA 4OVMA 1BUJA 2E2VA 1IT7A 1BSBA 1LOXA 2CWUA 1EUIC 1RMSA 3E99A 4RNTA 4TX4A 3SX1A 4N6NB 1LOYA 3DGLA 2R4IA 5CXOA 1BRNL 1YIJ3 1NU3A 4AKYA 1UGHI 5FW5A 1N5PA 2R41A 3KCHA 4K1UA 1BSDA 4EBGA 4EXRA 3X41A 3T8UA 1TTOA 3GRDA 1DMQA 2XH9A 2W2CA 5STDA 1QVG2 1OHPA 3QK9A 3LTBA 7RNTA 5DRVA 3NV0A 1BNSA 2XEPA 2XSHB 4RNZA 1NJI4 1AR0A 2F86B 3A5EA 5AYSC 1UGIA 4HAAA 2W03A 1IK3A 1TFKA 4EW5A 5BXQA 4R9LA 3BNCA 5HGRA 1W01A 4WYKA 1VQO3 5AIFA 1RHLA 1OF5A 1EA2A 1STFI 1UI7A 2BO9B 1MOLA 2CC3A 2MF7A 4FCZA 5KP3A 1KQS2 5IG5A 4H61A 4GB5A 1X1WA 1DMMA 7STDA 1W4NA 2OCTA 1FZUA 4LZIA 1CYUA 1I2FA 1RCKA 3DUKA 1B27A 5JPUA 1BRHA 1I3FA 1SIHA 3WMDA 4NREA 2W0QA 3JUNA 4K90B 3X3YA 3MG3A 3PGBA 3BNBA 3ECFA 2K54A 1V58A 2ZA4A 2CFDA 3CCM3 4HM0B 2E2TA 2Z6BA 3FG1A 2UUGC 1VQ83 3QRDA 1TFOA 1LQMB 3V98A 5CF2A 1AQZA 3FLJA 1BVIA 2INXA 2RFRA 2XFSA 3BU4A 3KKGA 3Q3FA 4BTWA 3D3LA 1SARA 1IV7A 1ZX2A 4XBTA 2AADA 3SOYA 9RNTA 3LTAA 2H0GA 1FUWA 1ULJB 1I0XA 1BSCA 1D6YA 1JB5A 1UCIA 4EYCA 4KZ1A 4L8OA 2RGQA 3GZYB 1N9EA 2JDIH 2YFJB 3NM2A 3MYTA 1FUTA 3NUVA 3B4OA 4KFEA 1NNVA 1WMOA 4CJNA 1G96A 4OUQA 1FW7A 5BU4A 1S723 3PYJA 3B4PA 2WO0A 4LEHA 1OGZA 3CCE3 4MMXB 2D42A 3JVCA 4XDVA 1VQN3 1ULIB 1JKGB 2BNGA 4G1MB 3AGNA 3BNDA 3EJVA 1Q864 2P05A 5CLKA 3D79A 3WHOA 1B3SA 3I0YA 4IT7A 2KCDA 1VQ93 1Y4KA 3CC43 3EBYA 5KP4A 4HVNA 1J2BA 2CWVA 5IEOA 1I8VA 1OCVA 2FGTA 5ELUA 2F98A 3F9SA 5BIRA 2FXTA 1T2HA 1B2XA 3J7Yd 1DE3A 4L8PA 5G1KA 3F7XA 1QAKA 3JUPA 4HZ9B 1PFPA 2XGLA 3S5CA 1HKXA 2P0XA 4R80A 3EE1A 5IENA 1A90A 3ZG5A 1WMPA 3HK4A 1RKYA 1I2GA 2RNTA 1SQWA 2RBIA 2W9PA 2WOFA 4IPBA 4BIRA 1WMNA 2W56B 4FR9A 3OWSA 1JB2A 1NWWA 3DGOA 1N9JA 4EV2A 2ZL8A 3K7CA 4O8SA 1RCLA 3L0RA 2RCDA 1ISKA 4Q53A 5AEWB 4HOHA 3F14A 1Q42A 3D9RA 3LXUX 2O3OA 2CX1A 3F7SA 1M1XB 1MWRA 3UL6A 5IG4A 2Y73A 4N6TA 1DVDA 3EF8A 1O7MB 3FCSB 1JKGA 1VQ73 4N6UA 1BNJA 1V57A 2W04A 2WGQA 1E97A 3FF2A 4N6LA 3CXC2 3CC73 1IVUA 3GAXA 3KZTA 1G02A 1Q9EA 1RGGA 2H0HA 8CHOA 4RNYA 1D6ZA 3GZXB 3CCJ3 1BGSA 1EKMA 2D1WA 5IEPA 2XF3A 3LH4A 1MWUA 1MGRA 4O02B 4XM4A 1ZO2A 1UUVB 2F5MA 3KSED 1IDPA 2LQVA 1BRKA 1AVKA 3G0KA 2GEXA 1YJ93 1NB5I 2QGUA 1QALA 2Z7AA 4I4KA 3KN4A 1W6CA 4HYZA 3WA2X 4STDA 1YGWA 5M1AA 3ER7A 3IJEB 3CMA3 1S5AA 3CME3 2XR8B 2ML5A 1AV4A 1A67A 2B24B 1MGWA 1QJGA 3FZWA 3O8YA 2W56A 2WGOA 1IVVA 1LNIA 4JRFA 1RN4A 4GHOA 1C7HA 2CG0A 1TRPA 1GD3A 3DM8A 1YJW3 2CIUA 2CX0A 5RNTA 1W02A 3CPW2 1YHQ3 2OWPA 2W9QA 5TGNA 1Q824 1N8QA 1UCJA 3SYUA 4LSOA 5D81A 1W7CA 1M1K4 1TUHA 1IVXA 2P09A 3UJMA 1AY7A 3URPA 1GY7A 4KFFA 5BVBA 2OTL3 3MPHA 3N9HA 1JB4A 5EVHA 5IG0A 1NDOB 1VQ53 2Y74A 1RNBA 4HM2B 3VGNA 1X1XA 3CD63 4RZMA 2XRXB 3JUQA 4O3VA 3RGRA 5D82A 3A76A 3ZFZA 5DREA 3EB8A 4KFDA 2Z76A 1WNHA 1OGXA 1RNTA 1B20A 3HX8A 3NHXA 4I5QA 5GSPA 1IU7A 1RRLA 2HMMB 3U97A 1UUGB 2KAAA 2WOHA 1ZS7A 1CEWI 1TP6A 2QEX3 2O9UX 1BSEA 3LTDA 4HM3B 4BL2A 1BOXA 5AYRB 1I3IA 3EBTA 3UB1A 2BMOB 3WR2A 1US1A 1LRAA 4FCMA 3N54B 3WOFB 1N5HA 5D83A 1D6UA 3VF1A 4HM5B 1IYYA 3DGYA 2JQ5A 4HM6B 3F8HA 3DY5A 2BMQB 4HKVB 4MJDA 3Q2PA 4WP5A 1K9M4 1O7NB 5CK6A 1IQXA 6RNTA 3G4S3 2Z77A 4L7KA 2C4BA 2KF6A 4BTXA 1W00A 3D4AA 4J5GA 1RGLA 3X42A 1L5GB 1JZDA 2OOVC 3GWRA 1RSNA 3VSYA 1KC84 2H0IA 1OPYA 1T2IA 5FGOA 1KSIA 4PEJA 3BB9A 2OOVA 3JUOA 2YX9A 2IUJA 1IQ8A 2GU1A 3S28A 4CDLA 1BUQA 2F5WA 3JUMA 2ML6A 3CCQ3 5A0OB 1IT8A 2UX0A 3FKAA 5JBSA 1GS3A 1JBRA 1IQYA 2GEYA 3LT9A 3N8BA 3EQQB 3S67A 2MC8A 2A15A 5G2GA 3UL5A 2LYXA 3EN1B 4DKIA 1OHOA 2BMRB 2HMLB 1W6YA 4FMCA 1JRQA 1JN5B 3G16A 1BIRA 3B8LA 3GSPA 6GSPA 1BANA 1MNLA 4K1VA 4O2HA 4R9KA 3K9MC 3RNTA 3CCV3 3SEDA 2YFLB 4HM4B 1JBSA 2IY2A 2YFIB 2IUKA 1E3VA 3CCL3 4FMAA 2L4VA 1Q40B 3MG2A 1FUSA 1O7GB 2STDA 3F40A 3NQZA 1W6GA 1JJ22 1W2ZA 5ELJA 4HM7B 3X40A 4GL6A 4LMIA 1U8CB 4CCVA 1A2PA 2F56A 1VQQA 3AMOB 3PCSA 1R4YA 3V92A 3NBRA 1B2MA 3EN8A 3DZLA 3MWZA 2V1LA 3X3XA 1VZZA 1DMNA 2B1XB 1UDII 1X1YA 2F4YA 2SBLA 2K0MA 5M18A 3MKIA 3EC9A 1BRSA 3STDA 2OTJ3 1B2UA 5IF6A 4R4KA 1RJOA 1F8NA 1KD14 1NB3I 3F8XA 3K0ZA 1MWSA 3LZAA 3X3ZA 3PCRA 3T0UA 1LVNA 4FMBA 1BSAA 3GZRA 1VQ43 5LC7A 1OH0A 1C54A 1JV2B 2RSXA 2HMOB 2W6JH 3CPOA 4H3UA 4N6OB 1PU4A 2HMNB 2BU4A 1IV9A 3K5TA 3FG4A 4X2OA 1HYFA 2M7OA 1FGMA 2IYJA 3NM7A 3AHWA 4FMDA 5IW9A 1RTUA 4XBXA 3KSPA 3LT8A 4FCJA 3SXXA 1FGRA 2UGIA 1VQM3 3PS8A 4BU4A 1RGEA 1V74A 1HZ1A 3H3HA 3FGYA 2KXGA 5IERA 4EC6A 1GSPA 3D5IA 1QMAA 2CFKA 4NHFA 1EG9B 1Q40A 2FNQA 1ROVA 3D5GA 1PY3A 2KRTA 3ROBA 1UI8A 1WQLB 2P0MA 1B2SA 5G1LA 1VQP3 4HBRA 1T3BA 1BNFA 1YVSA 3I553 2QIYA 3Q1CA 4N6V0 3RDEA 2CK3H 1I0VA 2ZHXB 3AMOA 4U13A 1FA3A 4R1KA 2CH9A 1IVWA 2J8XB 1YI23 2BHMA 3MSOA 1LOWA 2K3DA 3V99A 1I70A 1Q814 1TU5A 4X2HA 1K8A4 1PYLA 3FH1A 4ZM8A 1B2ZA 1BU4A 1RGKA 4HM1B 2CHCA 3IMAB 3ALAA 2CWTA 3NQYA 3B7CA 4AEQA 1K41A 4J9AA 1DETA 3KE7A 1GY5A 4IIAA 4N6MA 4AKZA 1LXEA 5I97A 3HOHA 4NPBA 3RGAA 3OX9A 3G8ZA 5AIHA 7GSPA 1HU9A 3U1WA 1SIIA 3KFQC 1Q7HA 3CNMA 1YJN3 3DMCA 1BNGA 3IPTA 4RBNA 1O7PB 2KF5A 1G0TA 1BAOA 2CG1A 3WODG 1E3RA 2ZDJA 1RN1A 4HJLB 4WWUC 4XBYA 3OWUA 1LNHA 4BL3A 1UUWB 1GOVA 1BRJA 1UCKA 2AAEA 2IA7A 3HIIA 1I2EA 4LYLB 2KF3A 3CNXA 4XDWA 4BTYA 1GOUA 3LMLA 3G713 3OW22 5AI1A 3WDGB 1RGCA 2QA43 2P38A 2PZVA 2CFGA 5AEUB 3DH2A 5KP1A 1FYSA 1OACA 3T8NA 3FSDA 3BIRA 3CCU3 3MG1A 1LQGC 2F99A 1VQ63 3LOYA 2XSOB 1BNIA 3LYGA 5CF1A 1TRQA 1GOYA 4WHAA 1SJWA 1BNRA 3CC23 5JPPA 3HZPA 1W2B2 3G6E3 1O7WB 1Z1SA 3TDGA 5HOHA 3WA3A 2XGNA 3NBJA 2CW9A 3Q90A 1W5ZA 3DGMA 4N3VA 3S27A 1GYBA 3MHEA 4ILFA 4QWTA 3PZWA 5IG3A 5M19A 1X1UA 1NO3A 2GBXB 3KIIA 5LC6A 1MWTA 1JZOA 2Q07A 3BNEA 1RGFA 2GBWB 4OK0A 1VQK3 1K734 1TJDA 1B21A 1FGQA 1QVF2 3SLUA 1RDSA 1UW1A 3FG3A 1VQL3 1RRHA 1O7HB 1UCLA 1A2KA 3NBBA 1ZGXA 1JNQA 1FGTA 2I9WA 1JBTA 5EEOA 1CQSA 1RLSA 1CH0A 3LTCA 1BNEA 3EX9A 4KT3B 4HZBB 1SPUA 1BRGA 4GSPA 2C10A 4LGQA 2PNCA 1AVLA 2CFLA 4MMZB 8RNTA 1R4CA 2GU3A 2GXFA 3CU3A 3NX0A 3CCR3 2HOHA 2C11A 3GZBA 1RGHA 5AIGA 1YGEA 5AIIA 1T5YA 1GY6A
chains in the Genus database with same CATH topology
1ASKA 3S29A 2HMJB 4J8TA 3WOEB 1GD4A 1KWIA 2CFWA 3SVAA 2HMKB 1OUNA 3HI7A 3DGNA 3M8CA 3PXMA 1QAFA 1WTHA 1FGOA 3CCS3 2CKFB 2BT3A 1N8R4 3UNLA 4HM8B 4MMYB 4WFOA 4KVHA 1CYVA 1U5OA 4MEIA 3OWYA 1RN7A 2E2UA 3EHCA 2XFTA 1DYUA 1A2VA 3OXAA 1TIJA 1M9GA 1OHSA 3NV0B 2OQEC 1K28A 1M904 3FF0A 3I563 1JN5A 1ROAA 2OQEA 5EQLA 4JF8A 1YVBI 4K61A 1DVCA 3HIGA 4WYKB 3DXOA 1STDA 1OF5B 2IMJA 3SOAA 1YIT3 4XB5A 6STDA 3OV4A 3H51A 3NXJA 3BLZA 1EQKA 4EV5A 1Q7Y4 3K63A 4ORLA 4OVMA 2E2VA 1IT7A 1LOXA 2CWUA 3E99A 4TX4A 3SX1A 4N6NB 3DGLA 2R4IA 5CXOA 1YIJ3 1NU3A 4AKYA 5FW5A 1N5PA 4K1UA 4EBGA 4EXRA 3X41A 3T8UA 3GRDA 1DMQA 2XH9A 2W2CA 5STDA 1QVG2 1OHPA 3QK9A 3LTBA 5DRVA 3NV0A 2XEPA 2XSHB 4RNZA 1NJI4 1AR0A 2F86B 5AYSC 2W03A 1IK3A 1TFKA 5BXQA 4R9LA 3BNCA 5HGRA 1W01A 4WYKA 1VQO3 5AIFA 4FCZA 1OF5A 1EA2A 1STFI 1UI7A 2BO9B 1MOLA 2CC3A 2MF7A 5KP3A 1KQS2 5IG5A 4H61A 4GB5A 1DMMA 7STDA 1W4NA 2OCTA 4LZIA 1CYUA 3DUKA 5JPUA 1SIHA 3WMDA 4NREA 2W0QA 3JUNA 4K90B 3X3YA 3MG3A 3PGBA 3BNBA 3ECFA 2K54A 2CFDA 3CCM3 4HM0B 2E2TA 2Z6BA 3FG1A 1VQ83 3QRDA 1TFOA 3V98A 5CF2A 3FLJA 2INXA 2RFRA 2XFSA 3KKGA 4BTWA 3D3LA 1ZX2A 1IV7A 4XBTA 3SOYA 3LTAA 1FUWA 1ULJB 1D6YA 1JB5A 4EYCA 4KZ1A 4L8OA 2RGQA 3GZYB 1N9EA 2JDIH 2YFJB 3NM2A 3MYTA 3NUVA 3B4OA 4KFEA 1WMOA 1G96A 4OUQA 1S723 3PYJA 3B4PA 2WO0A 4LEHA 1OGZA 3CCE3 4MMXB 2D42A 3JVCA 4XDVA 1ULIB 1JKGB 2BNGA 4G1MB 3BNDA 3EJVA 1Q864 2P05A 5CLKA 3I0YA 4IT7A 2KCDA 1VQ93 1Y4KA 3CC43 3EBYA 5KP4A 4HVNA 1J2BA 2CWVA 5IEOA 2FGTA 1OCVA 5ELUA 3J7Yd 2F98A 3F9SA 2FXTA 4L8PA 3F7XA 1QAKA 3JUPA 4HZ9B 1PFPA 2XGLA 3S5CA 1HKXA 2P0XA 4R80A 3EE1A 5IENA 1A90A 1WMPA 3HK4A 1RKYA 1SQWA 4IPBA 2W9PA 2WOFA 1WMNA 2W56B 4FR9A 3OWSA 1JB2A 1NWWA 3DGOA 1N9JA 4EV2A 2ZL8A 3K7CA 4O8SA 3L0RA 2RCDA 1ISKA 4Q53A 5AEWB 3F14A 1Q42A 3D9RA 3LXUX 2O3OA 3F7SA 1M1XB 5IG4A 3UL6A 2Y73A 4N6TA 1DVDA 3EF8A 1O7MB 3FCSB 1JKGA 1VQ73 4N6UA 2WGQA 2W04A 3FF2A 1E97A 4N6LA 3CXC2 3CC73 1IVUA 3GAXA 3KZTA 8CHOA 4RNYA 1D6ZA 3GZXB 3CCJ3 1EKMA 2D1WA 5IEPA 2XF3A 3LH4A 4XM4A 4O02B 1ZO2A 1UUVB 3KSED 1IDPA 2LQVA 1AVKA 1NB5I 3G0KA 1YJ93 2QGUA 1QALA 2Z7AA 4I4KA 3KN4A 1W6CA 4HYZA 3WA2X 4STDA 3ER7A 3IJEB 3CMA3 1S5AA 3CME3 2XR8B 2ML5A 1AV4A 1A67A 2B24B 1QJGA 3FZWA 3O8YA 2W56A 2WGOA 1IVVA 4JRFA 1C7HA 2CG0A 1GD3A 3DM8A 1YJW3 2CIUA 1W02A 3CPW2 1YHQ3 2OWPA 2W9QA 5TGNA 1Q824 1N8QA 4LSOA 5D81A 1W7CA 1M1K4 1TUHA 2P09A 1IVXA 3UJMA 1GY7A 4KFFA 5BVBA 2OTL3 3MPHA 3N9HA 1JB4A 5EVHA 5IG0A 1NDOB 1VQ53 2Y74A 4HM2B 3VGNA 3CD63 4RZMA 2XRXB 3JUQA 4O3VA 3RGRA 5D82A 3A76A 5DREA 3EB8A 4KFDA 2Z76A 1WNHA 1OGXA 3HX8A 3NHXA 1VQN3 3U97A 1IU7A 1RRLA 2HMMB 2WOHA 1CEWI 1TP6A 2QEX3 2O9UX 3LTDA 4HM3B 5AYRB 3EBTA 3UB1A 2BMOB 1US1A 4FCMA 3N54B 3WOFB 1N5HA 5D83A 1D6UA 3VF1A 4HM5B 2JQ5A 4HM6B 3F8HA 3DY5A 2BMQB 4HKVB 4MJDA 3Q2PA 4WP5A 1K9M4 1O7NB 5CK6A 1IQXA 3G4S3 2Z77A 4L7KA 4BTXA 1W00A 3X42A 1L5GB 2OOVC 3GWRA 3VSYA 1KC84 1OPYA 5FGOA 1KSIA 4PEJA 3BB9A 2OOVA 3JUOA 2YX9A 2IUJA 1IQ8A 2GU1A 3S28A 4CDLA 1BUQA 3JUMA 2ML6A 3CCQ3 5A0OB 1IT8A 2UX0A 3FKAA 5JBSA 1GS3A 1GY6A 1IQYA 2GEYA 3LT9A 3N8BA 3EQQB 3S67A 2MC8A 2A15A 5G2GA 3UL5A 2LYXA 3EN1B 1OHOA 2BMRB 2HMLB 1W6YA 4FMCA 1JRQA 1JN5B 3G16A 3B8LA 1MNLA 4K1VA 4O2HA 4R9KA 3K9MC 3CCV3 3SEDA 2YFLB 4HM4B 2YFIB 2IUKA 1E3VA 3CCL3 4FMAA 2L4VA 1Q40B 3MG2A 1O7GB 2STDA 3F40A 3NQZA 1W6GA 1JJ22 1W2ZA 5ELJA 4HM7B 3X40A 4GL6A 4LMIA 1U8CB 4CCVA 3AMOB 3PCSA 3V92A 3NBRA 3EN8A 3DZLA 3MWZA 2V1LA 3X3XA 1VZZA 1DMNA 2B1XB 2SBLA 2K0MA 3MKIA 3EC9A 2OTJ3 3STDA 5IF6A 4R4KA 1RJOA 1F8NA 1KD14 1NB3I 3F8XA 3K0ZA 3LZAA 3X3ZA 3PCRA 3T0UA 1LVNA 4FMBA 3GZRA 1VQ43 5LC7A 1OH0A 1JV2B 2RSXA 2HMOB 2W6JH 3CPOA 4H3UA 4N6OB 1PU4A 2HMNB 1IV9A 3K5TA 3FG4A 4X2OA 2M7OA 1FGMA 5IW9A 3NM7A 4FMDA 4XBXA 3KSPA 3LT8A 4FCJA 3SXXA 1FGRA 1VQM3 3PS8A 1V74A 3H3HA 3FGYA 2KXGA 5IERA 4EC6A 1QMAA 2CFKA 4NHFA 1EG9B 1Q40A 2FNQA 1ROVA 2KRTA 3ROBA 1UI8A 1WQLB 2P0MA 1VQP3 4HBRA 3I553 2QIYA 3Q1CA 4N6V0 3RDEA 2CK3H 3AMOA 4U13A 1FA3A 4R1KA 2CH9A 1IVWA 1YI23 2BHMA 3MSOA 3V99A 1Q814 1TU5A 4X2HA 1K8A4 3FH1A 4ZM8A 4HM1B 2CHCA 3IMAB 3ALAA 2CWTA 3NQYA 3B7CA 4AEQA 1K41A 4J9AA 3KE7A 4IIAA 1GY5A 4N6MA 4AKZA 1LXEA 5I97A 3RGAA 3OX9A 3G8ZA 5AIHA 1HU9A 3U1WA 1SIIA 3KFQC 3CNMA 1YJN3 3DMCA 3IPTA 4RBNA 1O7PB 2CG1A 3WODG 1E3RA 2ZDJA 4WWUC 4HJLB 4XBYA 3OWUA 1LNHA 1UUWB 3HIIA 2IA7A 4BTYA 4XDWA 3CNXA 3OW22 3LMLA 3G713 5AI1A 3WDGB 2QA43 2P38A 2PZVA 2CFGA 5AEUB 5KP1A 1OACA 3T8NA 3FSDA 3CCU3 3MG1A 2F99A 1VQ63 3LOYA 2XSOB 3LYGA 5CF1A 4WHAA 1SJWA 3CC23 5JPPA 3HZPA 1W2B2 3G6E3 1O7WB 1Z1SA 3TDGA 3WA3A 2XGNA 3NBJA 2CW9A 3Q90A 1W5ZA 3DGMA 4N3VA 3S27A 1GYBA 3MHEA 4QWTA 3PZWA 5IG3A 1NO3A 2GBXB 3KIIA 5LC6A 2Q07A 3BNEA 2GBWB 4OK0A 1VQK3 1K734 1FGQA 1QVF2 3SLUA 1VQL3 1UW1A 3FG3A 1RRHA 1O7HB 1A2KA 3NBBA 1JNQA 1FGTA 2I9WA 5EEOA 1CQSA 3LTCA 3EX9A 4HZBB 1SPUA 2C10A 4LGQA 2PNCA 1AVLA 2CFLA 4MMZB 1R4CA 2GU3A 2GXFA 3CU3A 3NX0A 3CCR3 2C11A 3GZBA 5AIGA 1YGEA 5AIIA 1T5YA 2GEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASK A;  2HMJ B;  4J8T A;  2HMK B;  1OUN A;  3M8C A;  2CKF B;  3UNL A;  4HM8 B;  4KVH A;  1U5O A;  3OWY A;  3EHC A;  3OXA A;  1OHS A;  3NV0 B;  3FF0 A;  1JN5 A;  4WYK B;  3DXO A;  1STD A;  1OF5 B;  2IMJ A;  3SOA A;  4XB5 A;  6STD A;  3OV4 A;  3H51 A;  3NXJ A;  3BLZ A;  4ORL A;  4OVM A;  3E99 A;  2R4I A;  5CXO A;  1NU3 A;  5FW5 A;  4K1U A;  3T8U A;  3GRD A;  1DMQ A;  2W2C A;  5STD A;  1OHP A;  5DRV A;  3NV0 A;  2XSH B;  1AR0 A;  2F86 B;  5BXQ A;  4R9L A;  5HGR A;  1W01 A;  4WYK A;  5AIF A;  1OF5 A;  1EA2 A;  5KP3 A;  5IG5 A;  4GB5 A;  1DMM A;  7STD A;  3DUK A;  5JPU A;  3WMD A;  3JUN A;  3MG3 A;  3ECF A;  2K54 A;  4HM0 B;  5CF2 A;  3FLJ A;  2INX A;  2RFR A;  3KKG A;  1ZX2 A;  4XBT A;  3SOY A;  1ULJ B;  1JB5 A;  4L8O A;  2RGQ A;  3GZY B;  3NM2 A;  2YFJ B;  3NUV A;  3MYT A;  3B4O A;  4OUQ A;  3B4P A;  4LEH A;  1OGZ A;  4XDV A;  1ULI B;  1JKG B;  2BNG A;  3EJV A;  5CLK A;  3I0Y A;  3EBY A;  5KP4 A;  4HVN A;  5IEO A;  1OCV A;  2F98 A;  3F9S A;  4L8P A;  3F7X A;  3JUP A;  4HZ9 B;  3S5C A;  1HKX A;  5IEN A;  3HK4 A;  3OWS A;  1JB2 A;  1NWW A;  3K7C A;  2RCD A;  1ISK A;  4Q53 A;  5AEW B;  3F14 A;  1Q42 A;  3D9R A;  3F7S A;  5IG4 A;  3EF8 A;  1O7M B;  1JKG A;  3FF2 A;  1E97 A;  3KZT A;  8CHO A;  3GZX B;  5IEP A;  4XM4 A;  1ZO2 A;  1UUV B;  1IDP A;  3G0K A;  2QGU A;  2Z7A A;  4I4K A;  4STD A;  3ER7 A;  1S5A A;  2XR8 B;  2B24 B;  1QJG A;  3FZW A;  1C7H A;  3DM8 A;  1W02 A;  2OWP A;  5TGN A;  5D81 A;  1TUH A;  3UJM A;  1GY7 A;  5BVB A;  1JB4 A;  5EVH A;  5IG0 A;  1NDO B;  4HM2 B;  3VGN A;  4RZM A;  2XRX B;  3JUQ A;  3RGR A;  5D82 A;  3A76 A;  5DRE A;  2Z76 A;  3HX8 A;  1OGX A;  3NHX A;  2HMM B;  1TP6 A;  4HM3 B;  3EBT A;  2BMO B;  4FCM A;  5D83 A;  4HM5 B;  2JQ5 A;  4HM6 B;  3F8H A;  2BMQ B;  4HKV B;  4MJD A;  4WP5 A;  1O7N B;  5CK6 A;  2Z77 A;  4L7K A;  1W00 A;  3GWR A;  3VSY A;  1OPY A;  4PEJ A;  3BB9 A;  3JUO A;  4CDL A;  1BUQ A;  3JUM A;  2UX0 A;  3FKA A;  1GS3 A;  1GY6 A;  2GEY A;  3EQQ B;  2A15 A;  5G2G A;  3EN1 B;  1OHO A;  2BMR B;  2HML B;  1W6Y A;  1JN5 B;  3G16 A;  3B8L A;  4K1V A;  4R9K A;  3SED A;  2YFL B;  4HM4 B;  2YFI B;  1E3V A;  1Q40 B;  3MG2 A;  1O7G B;  2STD A;  3F40 A;  4HM7 B;  4LMI A;  3NBR A;  3EN8 A;  3DZL A;  1VZZ A;  1DMN A;  2B1X B;  3MKI A;  3EC9 A;  3STD A;  5IF6 A;  3LZA A;  3F8X A;  3K0Z A;  3GZR A;  1OH0 A;  3CPO A;  2HMO B;  4H3U A;  2HMN B;  4X2O A;  4XBX A;  3KSP A;  4FCJ A;  3H3H A;  3FGY A;  5IER A;  1QMA A;  1EG9 B;  1Q40 A;  3ROB A;  1WQL B;  2QIY A;  4U13 A;  4R1K A;  3MSO A;  4X2H A;  3FH1 A;  4HM1 B;  2CHC A;  3B7C A;  1K41 A;  4J9A A;  3KE7 A;  4IIA A;  1GY5 A;  3RGA A;  3OX9 A;  3G8Z A;  5AIH A;  3CNM A;  3DMC A;  3IPT A;  1O7P B;  1E3R A;  4WWU C;  4XBY A;  4HJL B;  3OWU A;  1UUW B;  4XDW A;  3CNX A;  5AI1 A;  2PZV A;  5AEU B;  5KP1 A;  3T8N A;  3FSD A;  3MG1 A;  2F99 A;  2XSO B;  3LYG A;  5CF1 A;  1SJW A;  5JPP A;  3HZP A;  1O7W B;  1Z1S A;  3Q90 A;  4N3V A;  1GYB A;  3MHE A;  5IG3 A;  2GBX B;  2GBW B;  1O7H B;  1A2K A;  2I9W A;  1CQS A;  3EX9 A;  4HZB B;  4LGQ A;  2GXF A;  3CU3 A;  3GZB A;  5AIG A;  5AII A;  2GEX A; 
#chains in the Genus database with same CATH topology
 1ASK A;  2GSP A;  3S29 A;  2SAR A;  3AGO A;  2HMJ B;  4J8T A;  3WOE B;  1GD4 A;  1GMQ A;  1BRI A;  1KWI A;  2CFW A;  3AHS A;  3SVA A;  2HMK B;  1OUN A;  3HI7 A;  2BIR A;  1YNV X;  3DGN A;  1QAF A;  1WTH A;  1FGO A;  3M8C A;  2CKF B;  3PXM A;  3CCS 3;  2BT3 A;  1N8R 4;  1GMP A;  3UNL A;  4HM8 B;  4MMY B;  4WFO A;  4KVH A;  1CYV A;  1U5O A;  4MEI A;  3OWY A;  1RN7 A;  3ZG0 A;  2E2U A;  1RGA A;  3EHC A;  2XFT A;  1DYU A;  4CPK A;  1A2V A;  3OXA A;  1TIJ A;  1M9G A;  1OHS A;  3NV0 B;  2OQE C;  1K28 A;  1M90 4;  3FF0 A;  3I56 3;  1JN5 A;  1LOV A;  1ROA A;  4J5K A;  2OQE A;  5EQL A;  2L1S A;  4JF8 A;  1YVB I;  1EEJ A;  4K61 A;  1DVC A;  3HIG A;  4WYK B;  3DXO A;  1STD A;  1OF5 B;  2IMJ A;  3SOA A;  1YIT 3;  4XB5 A;  6STD A;  1GMR A;  3OV4 A;  3H51 A;  3NXJ A;  3BLZ A;  2KF4 A;  4EV5 A;  1Q7Y 4;  1EQK A;  3K63 A;  4ORL A;  4OVM A;  1BUJ A;  2E2V A;  1IT7 A;  1BSB A;  1LOX A;  2CWU A;  1EUI C;  1RMS A;  3E99 A;  4RNT A;  4TX4 A;  3SX1 A;  4N6N B;  1LOY A;  3DGL A;  2R4I A;  5CXO A;  1BRN L;  1YIJ 3;  1NU3 A;  4AKY A;  1UGH I;  5FW5 A;  1N5P A;  2R41 A;  3KCH A;  4K1U A;  1BSD A;  4EBG A;  4EXR A;  3X41 A;  3T8U A;  1TTO A;  3GRD A;  1DMQ A;  2XH9 A;  2W2C A;  5STD A;  1QVG 2;  1OHP A;  3QK9 A;  3LTB A;  7RNT A;  5DRV A;  3NV0 A;  1BNS A;  2XEP A;  2XSH B;  4RNZ A;  1NJI 4;  1AR0 A;  2F86 B;  3A5E A;  5AYS C;  1UGI A;  4HAA A;  2W03 A;  1IK3 A;  1TFK A;  4EW5 A;  5BXQ A;  4R9L A;  3BNC A;  5HGR A;  1W01 A;  4WYK A;  1VQO 3;  5AIF A;  1RHL A;  1OF5 A;  1EA2 A;  1STF I;  1UI7 A;  2BO9 B;  1MOL A;  2CC3 A;  2MF7 A;  4FCZ A;  5KP3 A;  1KQS 2;  5IG5 A;  4H61 A;  4GB5 A;  1X1W A;  1DMM A;  7STD A;  1W4N A;  2OCT A;  1FZU A;  4LZI A;  1CYU A;  1I2F A;  1RCK A;  3DUK A;  1B27 A;  5JPU A;  1BRH A;  1I3F A;  1SIH A;  3WMD A;  4NRE A;  2W0Q A;  3JUN A;  4K90 B;  3X3Y A;  3MG3 A;  3PGB A;  3BNB A;  3ECF A;  2K54 A;  1V58 A;  2ZA4 A;  2CFD A;  3CCM 3;  4HM0 B;  2E2T A;  2Z6B A;  3FG1 A;  2UUG C;  1VQ8 3;  3QRD A;  1TFO A;  1LQM B;  3V98 A;  5CF2 A;  1AQZ A;  3FLJ A;  1BVI A;  2INX A;  2RFR A;  2XFS A;  3BU4 A;  3KKG A;  3Q3F A;  4BTW A;  3D3L A;  1SAR A;  1IV7 A;  1ZX2 A;  4XBT A;  2AAD A;  3SOY A;  9RNT A;  3LTA A;  2H0G A;  1FUW A;  1ULJ B;  1I0X A;  1BSC A;  1D6Y A;  1JB5 A;  1UCI A;  4EYC A;  4KZ1 A;  4L8O A;  2RGQ A;  3GZY B;  1N9E A;  2JDI H;  2YFJ B;  3NM2 A;  3MYT A;  1FUT A;  3NUV A;  3B4O A;  4KFE A;  1NNV A;  1WMO A;  4CJN A;  1G96 A;  4OUQ A;  1FW7 A;  5BU4 A;  1S72 3;  3PYJ A;  3B4P A;  2WO0 A;  4LEH A;  1OGZ A;  3CCE 3;  4MMX B;  2D42 A;  3JVC A;  4XDV A;  1VQN 3;  1ULI B;  1JKG B;  2BNG A;  4G1M B;  3AGN A;  3BND A;  3EJV A;  1Q86 4;  2P05 A;  5CLK A;  3D79 A;  3WHO A;  1B3S A;  3I0Y A;  4IT7 A;  2KCD A;  1VQ9 3;  1Y4K A;  3CC4 3;  3EBY A;  5KP4 A;  4HVN A;  1J2B A;  2CWV A;  5IEO A;  1I8V A;  1OCV A;  2FGT A;  5ELU A;  2F98 A;  3F9S A;  5BIR A;  2FXT A;  1T2H A;  1B2X A;  3J7Y d;  1DE3 A;  4L8P A;  5G1K A;  3F7X A;  1QAK A;  3JUP A;  4HZ9 B;  1PFP A;  2XGL A;  3S5C A;  1HKX A;  2P0X A;  4R80 A;  3EE1 A;  5IEN A;  1A90 A;  3ZG5 A;  1WMP A;  3HK4 A;  1RKY A;  1I2G A;  2RNT A;  1SQW A;  2RBI A;  2W9P A;  2WOF A;  4IPB A;  4BIR A;  1WMN A;  2W56 B;  4FR9 A;  3OWS A;  1JB2 A;  1NWW A;  3DGO A;  1N9J A;  4EV2 A;  2ZL8 A;  3K7C A;  4O8S A;  1RCL A;  3L0R A;  2RCD A;  1ISK A;  4Q53 A;  5AEW B;  4HOH A;  3F14 A;  1Q42 A;  3D9R A;  3LXU X;  2O3O A;  2CX1 A;  3F7S A;  1M1X B;  1MWR A;  3UL6 A;  5IG4 A;  2Y73 A;  4N6T A;  1DVD A;  3EF8 A;  1O7M B;  3FCS B;  1JKG A;  1VQ7 3;  4N6U A;  1BNJ A;  1V57 A;  2W04 A;  2WGQ A;  1E97 A;  3FF2 A;  4N6L A;  3CXC 2;  3CC7 3;  1IVU A;  3GAX A;  3KZT A;  1G02 A;  1Q9E A;  1RGG A;  2H0H A;  8CHO A;  4RNY A;  1D6Z A;  3GZX B;  3CCJ 3;  1BGS A;  1EKM A;  2D1W A;  5IEP A;  2XF3 A;  3LH4 A;  1MWU A;  1MGR A;  4O02 B;  4XM4 A;  1ZO2 A;  1UUV B;  2F5M A;  3KSE D;  1IDP A;  2LQV A;  1BRK A;  1AVK A;  3G0K A;  2GEX A;  1YJ9 3;  1NB5 I;  2QGU A;  1QAL A;  2Z7A A;  4I4K A;  3KN4 A;  1W6C A;  4HYZ A;  3WA2 X;  4STD A;  1YGW A;  5M1A A;  3ER7 A;  3IJE B;  3CMA 3;  1S5A A;  3CME 3;  2XR8 B;  2ML5 A;  1AV4 A;  1A67 A;  2B24 B;  1MGW A;  1QJG A;  3FZW A;  3O8Y A;  2W56 A;  2WGO A;  1IVV A;  1LNI A;  4JRF A;  1RN4 A;  4GHO A;  1C7H A;  2CG0 A;  1TRP A;  1GD3 A;  3DM8 A;  1YJW 3;  2CIU A;  2CX0 A;  5RNT A;  1W02 A;  3CPW 2;  1YHQ 3;  2OWP A;  2W9Q A;  5TGN A;  1Q82 4;  1N8Q A;  1UCJ A;  3SYU A;  4LSO A;  5D81 A;  1W7C A;  1M1K 4;  1TUH A;  1IVX A;  2P09 A;  3UJM A;  1AY7 A;  3URP A;  1GY7 A;  4KFF A;  5BVB A;  2OTL 3;  3MPH A;  3N9H A;  1JB4 A;  5EVH A;  5IG0 A;  1NDO B;  1VQ5 3;  2Y74 A;  1RNB A;  4HM2 B;  3VGN A;  1X1X A;  3CD6 3;  4RZM A;  2XRX B;  3JUQ A;  4O3V A;  3RGR A;  5D82 A;  3A76 A;  3ZFZ A;  5DRE A;  3EB8 A;  4KFD A;  2Z76 A;  1WNH A;  1OGX A;  1RNT A;  1B20 A;  3HX8 A;  3NHX A;  4I5Q A;  5GSP A;  1IU7 A;  1RRL A;  2HMM B;  3U97 A;  1UUG B;  2KAA A;  2WOH A;  1ZS7 A;  1CEW I;  1TP6 A;  2QEX 3;  2O9U X;  1BSE A;  3LTD A;  4HM3 B;  4BL2 A;  1BOX A;  5AYR B;  1I3I A;  3EBT A;  3UB1 A;  2BMO B;  3WR2 A;  1US1 A;  1LRA A;  4FCM A;  3N54 B;  3WOF B;  1N5H A;  5D83 A;  1D6U A;  3VF1 A;  4HM5 B;  1IYY A;  3DGY A;  2JQ5 A;  4HM6 B;  3F8H A;  3DY5 A;  2BMQ B;  4HKV B;  4MJD A;  3Q2P A;  4WP5 A;  1K9M 4;  1O7N B;  5CK6 A;  1IQX A;  6RNT A;  3G4S 3;  2Z77 A;  4L7K A;  2C4B A;  2KF6 A;  4BTX A;  1W00 A;  3D4A A;  4J5G A;  1RGL A;  3X42 A;  1L5G B;  1JZD A;  2OOV C;  3GWR A;  1RSN A;  3VSY A;  1KC8 4;  2H0I A;  1OPY A;  1T2I A;  5FGO A;  1KSI A;  4PEJ A;  3BB9 A;  2OOV A;  3JUO A;  2YX9 A;  2IUJ A;  1IQ8 A;  2GU1 A;  3S28 A;  4CDL A;  1BUQ A;  2F5W A;  3JUM A;  2ML6 A;  3CCQ 3;  5A0O B;  1IT8 A;  2UX0 A;  3FKA A;  5JBS A;  1GS3 A;  1JBR A;  1IQY A;  2GEY A;  3LT9 A;  3N8B A;  3EQQ B;  3S67 A;  2MC8 A;  2A15 A;  5G2G A;  3UL5 A;  2LYX A;  3EN1 B;  4DKI A;  1OHO A;  2BMR B;  2HML B;  1W6Y A;  4FMC A;  1JRQ A;  1JN5 B;  3G16 A;  1BIR A;  3B8L A;  3GSP A;  6GSP A;  1BAN A;  1MNL A;  4K1V A;  4O2H A;  4R9K A;  3K9M C;  3RNT A;  3CCV 3;  3SED A;  2YFL B;  4HM4 B;  1JBS A;  2IY2 A;  2YFI B;  2IUK A;  1E3V A;  3CCL 3;  4FMA A;  2L4V A;  1Q40 B;  3MG2 A;  1FUS A;  1O7G B;  2STD A;  3F40 A;  3NQZ A;  1W6G A;  1JJ2 2;  1W2Z A;  5ELJ A;  4HM7 B;  3X40 A;  4GL6 A;  4LMI A;  1U8C B;  4CCV A;  1A2P A;  2F56 A;  1VQQ A;  3AMO B;  3PCS A;  1R4Y A;  3V92 A;  3NBR A;  1B2M A;  3EN8 A;  3DZL A;  3MWZ A;  2V1L A;  3X3X A;  1VZZ A;  1DMN A;  2B1X B;  1UDI I;  1X1Y A;  2F4Y A;  2SBL A;  2K0M A;  5M18 A;  3MKI A;  3EC9 A;  1BRS A;  3STD A;  2OTJ 3;  1B2U A;  5IF6 A;  4R4K A;  1RJO A;  1F8N A;  1KD1 4;  1NB3 I;  3F8X A;  3K0Z A;  1MWS A;  3LZA A;  3X3Z A;  3PCR A;  3T0U A;  1LVN A;  4FMB A;  1BSA A;  3GZR A;  1VQ4 3;  5LC7 A;  1OH0 A;  1C54 A;  1JV2 B;  2RSX A;  2HMO B;  2W6J H;  3CPO A;  4H3U A;  4N6O B;  1PU4 A;  2HMN B;  2BU4 A;  1IV9 A;  3K5T A;  3FG4 A;  4X2O A;  1HYF A;  2M7O A;  1FGM A;  2IYJ A;  3NM7 A;  3AHW A;  4FMD A;  5IW9 A;  1RTU A;  4XBX A;  3KSP A;  3LT8 A;  4FCJ A;  3SXX A;  1FGR A;  2UGI A;  1VQM 3;  3PS8 A;  4BU4 A;  1RGE A;  1V74 A;  1HZ1 A;  3H3H A;  3FGY A;  2KXG A;  5IER A;  4EC6 A;  1GSP A;  3D5I A;  1QMA A;  2CFK A;  4NHF A;  1EG9 B;  1Q40 A;  2FNQ A;  1ROV A;  3D5G A;  1PY3 A;  2KRT A;  3ROB A;  1UI8 A;  1WQL B;  2P0M A;  1B2S A;  5G1L A;  1VQP 3;  4HBR A;  1T3B A;  1BNF A;  1YVS A;  3I55 3;  2QIY A;  3Q1C A;  4N6V 0;  3RDE A;  2CK3 H;  1I0V A;  2ZHX B;  3AMO A;  4U13 A;  1FA3 A;  4R1K A;  2CH9 A;  1IVW A;  2J8X B;  1YI2 3;  2BHM A;  3MSO A;  1LOW A;  2K3D A;  3V99 A;  1I70 A;  1Q81 4;  1TU5 A;  4X2H A;  1K8A 4;  1PYL A;  3FH1 A;  4ZM8 A;  1B2Z A;  1BU4 A;  1RGK A;  4HM1 B;  2CHC A;  3IMA B;  3ALA A;  2CWT A;  3NQY A;  3B7C A;  4AEQ A;  1K41 A;  4J9A A;  1DET A;  3KE7 A;  1GY5 A;  4IIA A;  4N6M A;  4AKZ A;  1LXE A;  5I97 A;  3HOH A;  4NPB A;  3RGA A;  3OX9 A;  3G8Z A;  5AIH A;  7GSP A;  1HU9 A;  3U1W A;  1SII A;  3KFQ C;  1Q7H A;  3CNM A;  1YJN 3;  3DMC A;  1BNG A;  3IPT A;  4RBN A;  1O7P B;  2KF5 A;  1G0T A;  1BAO A;  2CG1 A;  3WOD G;  1E3R A;  2ZDJ A;  1RN1 A;  4HJL B;  4WWU C;  4XBY A;  3OWU A;  1LNH A;  4BL3 A;  1UUW B;  1GOV A;  1BRJ A;  1UCK A;  2AAE A;  2IA7 A;  3HII A;  1I2E A;  4LYL B;  2KF3 A;  3CNX A;  4XDW A;  4BTY A;  1GOU A;  3LML A;  3G71 3;  3OW2 2;  5AI1 A;  3WDG B;  1RGC A;  2QA4 3;  2P38 A;  2PZV A;  2CFG A;  5AEU B;  3DH2 A;  5KP1 A;  1FYS A;  1OAC A;  3T8N A;  3FSD A;  3BIR A;  3CCU 3;  3MG1 A;  1LQG C;  2F99 A;  1VQ6 3;  3LOY A;  2XSO B;  1BNI A;  3LYG A;  5CF1 A;  1TRQ A;  1GOY A;  4WHA A;  1SJW A;  1BNR A;  3CC2 3;  5JPP A;  3HZP A;  1W2B 2;  3G6E 3;  1O7W B;  1Z1S A;  3TDG A;  5HOH A;  3WA3 A;  2XGN A;  3NBJ A;  2CW9 A;  3Q90 A;  1W5Z A;  3DGM A;  4N3V A;  3S27 A;  1GYB A;  3MHE A;  4ILF A;  4QWT A;  3PZW A;  5IG3 A;  5M19 A;  1X1U A;  1NO3 A;  2GBX B;  3KII A;  5LC6 A;  1MWT A;  1JZO A;  2Q07 A;  3BNE A;  1RGF A;  2GBW B;  4OK0 A;  1VQK 3;  1K73 4;  1TJD A;  1B21 A;  1FGQ A;  1QVF 2;  3SLU A;  1RDS A;  1UW1 A;  3FG3 A;  1VQL 3;  1RRH A;  1O7H B;  1UCL A;  1A2K A;  3NBB A;  1ZGX A;  1JNQ A;  1FGT A;  2I9W A;  1JBT A;  5EEO A;  1CQS A;  1RLS A;  1CH0 A;  3LTC A;  1BNE A;  3EX9 A;  4KT3 B;  4HZB B;  1SPU A;  1BRG A;  4GSP A;  2C10 A;  4LGQ A;  2PNC A;  1AVL A;  2CFL A;  4MMZ B;  8RNT A;  1R4C A;  2GU3 A;  2GXF A;  3CU3 A;  3NX0 A;  3CCR 3;  2HOH A;  2C11 A;  3GZB A;  1RGH A;  5AIG A;  1YGE A;  5AII A;  1T5Y A;  1GY6 A; 
#chains in the Genus database with same CATH homology
 1ASK A;  3S29 A;  2HMJ B;  4J8T A;  3WOE B;  1GD4 A;  1KWI A;  2CFW A;  3SVA A;  2HMK B;  1OUN A;  3HI7 A;  3DGN A;  3M8C A;  3PXM A;  1QAF A;  1WTH A;  1FGO A;  3CCS 3;  2CKF B;  2BT3 A;  1N8R 4;  3UNL A;  4HM8 B;  4MMY B;  4WFO A;  4KVH A;  1CYV A;  1U5O A;  4MEI A;  3OWY A;  1RN7 A;  2E2U A;  3EHC A;  2XFT A;  1DYU A;  1A2V A;  3OXA A;  1TIJ A;  1M9G A;  1OHS A;  3NV0 B;  2OQE C;  1K28 A;  1M90 4;  3FF0 A;  3I56 3;  1JN5 A;  1ROA A;  2OQE A;  5EQL A;  4JF8 A;  1YVB I;  4K61 A;  1DVC A;  3HIG A;  4WYK B;  3DXO A;  1STD A;  1OF5 B;  2IMJ A;  3SOA A;  1YIT 3;  4XB5 A;  6STD A;  3OV4 A;  3H51 A;  3NXJ A;  3BLZ A;  1EQK A;  4EV5 A;  1Q7Y 4;  3K63 A;  4ORL A;  4OVM A;  2E2V A;  1IT7 A;  1LOX A;  2CWU A;  3E99 A;  4TX4 A;  3SX1 A;  4N6N B;  3DGL A;  2R4I A;  5CXO A;  1YIJ 3;  1NU3 A;  4AKY A;  5FW5 A;  1N5P A;  4K1U A;  4EBG A;  4EXR A;  3X41 A;  3T8U A;  3GRD A;  1DMQ A;  2XH9 A;  2W2C A;  5STD A;  1QVG 2;  1OHP A;  3QK9 A;  3LTB A;  5DRV A;  3NV0 A;  2XEP A;  2XSH B;  4RNZ A;  1NJI 4;  1AR0 A;  2F86 B;  5AYS C;  2W03 A;  1IK3 A;  1TFK A;  5BXQ A;  4R9L A;  3BNC A;  5HGR A;  1W01 A;  4WYK A;  1VQO 3;  5AIF A;  4FCZ A;  1OF5 A;  1EA2 A;  1STF I;  1UI7 A;  2BO9 B;  1MOL A;  2CC3 A;  2MF7 A;  5KP3 A;  1KQS 2;  5IG5 A;  4H61 A;  4GB5 A;  1DMM A;  7STD A;  1W4N A;  2OCT A;  4LZI A;  1CYU A;  3DUK A;  5JPU A;  1SIH A;  3WMD A;  4NRE A;  2W0Q A;  3JUN A;  4K90 B;  3X3Y A;  3MG3 A;  3PGB A;  3BNB A;  3ECF A;  2K54 A;  2CFD A;  3CCM 3;  4HM0 B;  2E2T A;  2Z6B A;  3FG1 A;  1VQ8 3;  3QRD A;  1TFO A;  3V98 A;  5CF2 A;  3FLJ A;  2INX A;  2RFR A;  2XFS A;  3KKG A;  4BTW A;  3D3L A;  1ZX2 A;  1IV7 A;  4XBT A;  3SOY A;  3LTA A;  1FUW A;  1ULJ B;  1D6Y A;  1JB5 A;  4EYC A;  4KZ1 A;  4L8O A;  2RGQ A;  3GZY B;  1N9E A;  2JDI H;  2YFJ B;  3NM2 A;  3MYT A;  3NUV A;  3B4O A;  4KFE A;  1WMO A;  1G96 A;  4OUQ A;  1S72 3;  3PYJ A;  3B4P A;  2WO0 A;  4LEH A;  1OGZ A;  3CCE 3;  4MMX B;  2D42 A;  3JVC A;  4XDV A;  1ULI B;  1JKG B;  2BNG A;  4G1M B;  3BND A;  3EJV A;  1Q86 4;  2P05 A;  5CLK A;  3I0Y A;  4IT7 A;  2KCD A;  1VQ9 3;  1Y4K A;  3CC4 3;  3EBY A;  5KP4 A;  4HVN A;  1J2B A;  2CWV A;  5IEO A;  2FGT A;  1OCV A;  5ELU A;  3J7Y d;  2F98 A;  3F9S A;  2FXT A;  4L8P A;  3F7X A;  1QAK A;  3JUP A;  4HZ9 B;  1PFP A;  2XGL A;  3S5C A;  1HKX A;  2P0X A;  4R80 A;  3EE1 A;  5IEN A;  1A90 A;  1WMP A;  3HK4 A;  1RKY A;  1SQW A;  4IPB A;  2W9P A;  2WOF A;  1WMN A;  2W56 B;  4FR9 A;  3OWS A;  1JB2 A;  1NWW A;  3DGO A;  1N9J A;  4EV2 A;  2ZL8 A;  3K7C A;  4O8S A;  3L0R A;  2RCD A;  1ISK A;  4Q53 A;  5AEW B;  3F14 A;  1Q42 A;  3D9R A;  3LXU X;  2O3O A;  3F7S A;  1M1X B;  5IG4 A;  3UL6 A;  2Y73 A;  4N6T A;  1DVD A;  3EF8 A;  1O7M B;  3FCS B;  1JKG A;  1VQ7 3;  4N6U A;  2WGQ A;  2W04 A;  3FF2 A;  1E97 A;  4N6L A;  3CXC 2;  3CC7 3;  1IVU A;  3GAX A;  3KZT A;  8CHO A;  4RNY A;  1D6Z A;  3GZX B;  3CCJ 3;  1EKM A;  2D1W A;  5IEP A;  2XF3 A;  3LH4 A;  4XM4 A;  4O02 B;  1ZO2 A;  1UUV B;  3KSE D;  1IDP A;  2LQV A;  1AVK A;  1NB5 I;  3G0K A;  1YJ9 3;  2QGU A;  1QAL A;  2Z7A A;  4I4K A;  3KN4 A;  1W6C A;  4HYZ A;  3WA2 X;  4STD A;  3ER7 A;  3IJE B;  3CMA 3;  1S5A A;  3CME 3;  2XR8 B;  2ML5 A;  1AV4 A;  1A67 A;  2B24 B;  1QJG A;  3FZW A;  3O8Y A;  2W56 A;  2WGO A;  1IVV A;  4JRF A;  1C7H A;  2CG0 A;  1GD3 A;  3DM8 A;  1YJW 3;  2CIU A;  1W02 A;  3CPW 2;  1YHQ 3;  2OWP A;  2W9Q A;  5TGN A;  1Q82 4;  1N8Q A;  4LSO A;  5D81 A;  1W7C A;  1M1K 4;  1TUH A;  2P09 A;  1IVX A;  3UJM A;  1GY7 A;  4KFF A;  5BVB A;  2OTL 3;  3MPH A;  3N9H A;  1JB4 A;  5EVH A;  5IG0 A;  1NDO B;  1VQ5 3;  2Y74 A;  4HM2 B;  3VGN A;  3CD6 3;  4RZM A;  2XRX B;  3JUQ A;  4O3V A;  3RGR A;  5D82 A;  3A76 A;  5DRE A;  3EB8 A;  4KFD A;  2Z76 A;  1WNH A;  1OGX A;  3HX8 A;  3NHX A;  1VQN 3;  3U97 A;  1IU7 A;  1RRL A;  2HMM B;  2WOH A;  1CEW I;  1TP6 A;  2QEX 3;  2O9U X;  3LTD A;  4HM3 B;  5AYR B;  3EBT A;  3UB1 A;  2BMO B;  1US1 A;  4FCM A;  3N54 B;  3WOF B;  1N5H A;  5D83 A;  1D6U A;  3VF1 A;  4HM5 B;  2JQ5 A;  4HM6 B;  3F8H A;  3DY5 A;  2BMQ B;  4HKV B;  4MJD A;  3Q2P A;  4WP5 A;  1K9M 4;  1O7N B;  5CK6 A;  1IQX A;  3G4S 3;  2Z77 A;  4L7K A;  4BTX A;  1W00 A;  3X42 A;  1L5G B;  2OOV C;  3GWR A;  3VSY A;  1KC8 4;  1OPY A;  5FGO A;  1KSI A;  4PEJ A;  3BB9 A;  2OOV A;  3JUO A;  2YX9 A;  2IUJ A;  1IQ8 A;  2GU1 A;  3S28 A;  4CDL A;  1BUQ A;  3JUM A;  2ML6 A;  3CCQ 3;  5A0O B;  1IT8 A;  2UX0 A;  3FKA A;  5JBS A;  1GS3 A;  1GY6 A;  1IQY A;  2GEY A;  3LT9 A;  3N8B A;  3EQQ B;  3S67 A;  2MC8 A;  2A15 A;  5G2G A;  3UL5 A;  2LYX A;  3EN1 B;  1OHO A;  2BMR B;  2HML B;  1W6Y A;  4FMC A;  1JRQ A;  1JN5 B;  3G16 A;  3B8L A;  1MNL A;  4K1V A;  4O2H A;  4R9K A;  3K9M C;  3CCV 3;  3SED A;  2YFL B;  4HM4 B;  2YFI B;  2IUK A;  1E3V A;  3CCL 3;  4FMA A;  2L4V A;  1Q40 B;  3MG2 A;  1O7G B;  2STD A;  3F40 A;  3NQZ A;  1W6G A;  1JJ2 2;  1W2Z A;  5ELJ A;  4HM7 B;  3X40 A;  4GL6 A;  4LMI A;  1U8C B;  4CCV A;  3AMO B;  3PCS A;  3V92 A;  3NBR A;  3EN8 A;  3DZL A;  3MWZ A;  2V1L A;  3X3X A;  1VZZ A;  1DMN A;  2B1X B;  2SBL A;  2K0M A;  3MKI A;  3EC9 A;  2OTJ 3;  3STD A;  5IF6 A;  4R4K A;  1RJO A;  1F8N A;  1KD1 4;  1NB3 I;  3F8X A;  3K0Z A;  3LZA A;  3X3Z A;  3PCR A;  3T0U A;  1LVN A;  4FMB A;  3GZR A;  1VQ4 3;  5LC7 A;  1OH0 A;  1JV2 B;  2RSX A;  2HMO B;  2W6J H;  3CPO A;  4H3U A;  4N6O B;  1PU4 A;  2HMN B;  1IV9 A;  3K5T A;  3FG4 A;  4X2O A;  2M7O A;  1FGM A;  5IW9 A;  3NM7 A;  4FMD A;  4XBX A;  3KSP A;  3LT8 A;  4FCJ A;  3SXX A;  1FGR A;  1VQM 3;  3PS8 A;  1V74 A;  3H3H A;  3FGY A;  2KXG A;  5IER A;  4EC6 A;  1QMA A;  2CFK A;  4NHF A;  1EG9 B;  1Q40 A;  2FNQ A;  1ROV A;  2KRT A;  3ROB A;  1UI8 A;  1WQL B;  2P0M A;  1VQP 3;  4HBR A;  3I55 3;  2QIY A;  3Q1C A;  4N6V 0;  3RDE A;  2CK3 H;  3AMO A;  4U13 A;  1FA3 A;  4R1K A;  2CH9 A;  1IVW A;  1YI2 3;  2BHM A;  3MSO A;  3V99 A;  1Q81 4;  1TU5 A;  4X2H A;  1K8A 4;  3FH1 A;  4ZM8 A;  4HM1 B;  2CHC A;  3IMA B;  3ALA A;  2CWT A;  3NQY A;  3B7C A;  4AEQ A;  1K41 A;  4J9A A;  3KE7 A;  4IIA A;  1GY5 A;  4N6M A;  4AKZ A;  1LXE A;  5I97 A;  3RGA A;  3OX9 A;  3G8Z A;  5AIH A;  1HU9 A;  3U1W A;  1SII A;  3KFQ C;  3CNM A;  1YJN 3;  3DMC A;  3IPT A;  4RBN A;  1O7P B;  2CG1 A;  3WOD G;  1E3R A;  2ZDJ A;  4WWU C;  4HJL B;  4XBY A;  3OWU A;  1LNH A;  1UUW B;  3HII A;  2IA7 A;  4BTY A;  4XDW A;  3CNX A;  3OW2 2;  3LML A;  3G71 3;  5AI1 A;  3WDG B;  2QA4 3;  2P38 A;  2PZV A;  2CFG A;  5AEU B;  5KP1 A;  1OAC A;  3T8N A;  3FSD A;  3CCU 3;  3MG1 A;  2F99 A;  1VQ6 3;  3LOY A;  2XSO B;  3LYG A;  5CF1 A;  4WHA A;  1SJW A;  3CC2 3;  5JPP A;  3HZP A;  1W2B 2;  3G6E 3;  1O7W B;  1Z1S A;  3TDG A;  3WA3 A;  2XGN A;  3NBJ A;  2CW9 A;  3Q90 A;  1W5Z A;  3DGM A;  4N3V A;  3S27 A;  1GYB A;  3MHE A;  4QWT A;  3PZW A;  5IG3 A;  1NO3 A;  2GBX B;  3KII A;  5LC6 A;  2Q07 A;  3BNE A;  2GBW B;  4OK0 A;  1VQK 3;  1K73 4;  1FGQ A;  1QVF 2;  3SLU A;  1VQL 3;  1UW1 A;  3FG3 A;  1RRH A;  1O7H B;  1A2K A;  3NBB A;  1JNQ A;  1FGT A;  2I9W A;  5EEO A;  1CQS A;  3LTC A;  3EX9 A;  4HZB B;  1SPU A;  2C10 A;  4LGQ A;  2PNC A;  1AVL A;  2CFL A;  4MMZ B;  1R4C A;  2GU3 A;  2GXF A;  3CU3 A;  3NX0 A;  3CCR 3;  2C11 A;  3GZB A;  5AIG A;  1YGE A;  5AII A;  1T5Y A;  2GEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...