3F40A

Crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
MKTQITTRDLVLEFIHALNTENFPAAKKRLNENFTFNGPMGHREGSERYMNDMEKMKFKYVVHKMFEEGNDVCLIYDINMNGKTIAASGLYHLEKGEITSLHVYFDPRPLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_677363.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 1.27 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
molecule tags Structural genomics, unknown function
total genus 28
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f40A00
3MSOA 1O7PB 1DMNA 3MYTA 5IF6A 1OH0A 2INXA 1JB4A 3NHXA 2QGUA 3G0KA 3B4OA 5CF2A 3EN8A 5IEPA 1SJWA 2GBXB 3K7CA 3OX9A 3F40A 3SOAA 2GXFA 3Q90A 3VSYA 4RZMA 4IIAA 1U5OA 3JUNA 4HZBB 3A76A 3GZRA 5BVBA 1W6YA 5D81A 1IDPA 5CK6A 5CF1A 1OF5B 3JUOA 1W01A 5EVHA 3LZAA 4LMIA 1DMMA 4HM2B 3D9RA 1AR0A 4HM7B 4L8PA 3H3HA 3LYGA 2YFIB 3RGRA 3EF8A 1ULIB 5IG0A 4XM4A 4FCMA 3MG3A 2IMJA 5KP4A 5G2GA 3KSPA 2BNGA 1HKXA 8CHOA 3FH1A 3JUQA 5AIFA 3EHCA 1OUNA 4PEJA 4N3VA 1GY5A 3FLJA 1E3VA 2HMMB 3B7CA 3CPOA 5AI1A 3K0ZA 2Z77A 3UJMA 5STDA 3F7XA 3G8ZA 2GEYA 4U13A 1OPYA 3MKIA 3GWRA 4HM4B 3E99A 2F86B 1EG9B 3FF2A 4L7KA 3EBYA 3JUMA 1W02A 2RGQA 1O7WB 4HVNA 3OV4A 1GS3A 2F99A 5BXQA 1QJGA 3EQQB 1W00A 2XSHB 3CU3A 2B24B 1E3RA 3KKGA 5IG4A 1JKGB 1STDA 3MG2A 1JKGA 4R1KA 2OWPA 3NM2A 1EA2A 2PZVA 4GB5A 5FW5A 3FGYA 2STDA 1S5AA 1Z1SA 4I4KA 5CXOA 1OF5A 4XBYA 4OVMA 1ZX2A 3OXAA 3NBRA 2XR8B 3GZBA 1E97A 1BUQA 3EJVA 3T8UA 3IPTA 3S5CA 4WWUC 2I9WA 4H3UA 4ORLA 4XDVA 2K54A 4STDA 5KP1A 3WMDA 3FF0A 1GY7A 4XB5A 3NXJA 1CQSA 2RCDA 2Z7AA 5JPUA 1OGZA 3MHEA 2UX0A 1OHPA 2BMOB 2XSOB 4FCJA 2F98A 2BMQB 2XRXB 5D83A 4X2OA 1QMAA 1OGXA 3VGNA 3F8XA 3KE7A 3SOYA 1GY6A 3EC9A 1O7HB 2HMJB 2A15A 5AIHA 3NUVA 4HM6B 5CLKA 3FSDA 2BMRB 5IERA 3M8CA 4HKVB 1C7HA 5IENA 5DREA 3EN1B 3NV0B 5AIIA 5HGRA 1DMQA 3FKAA 4OUQA 3H51A 3ER7A 3ECFA 1OCVA 3BB9A 3CNXA 2YFLB 3F9SA 5KP3A 1JN5B 5AIGA 1NDOB 1VZZA 5AEWB 1JB5A 2HMLB 3CNMA 4L8OA 1Q40B 5DRVA 1JB2A 1Q40A 3JUPA 3FZWA 1NU3A 1O7NB 3F14A 5TGNA 1TUHA 3MG1A 3F7SA 4WYKB 4HM1B 2CHCA 4WYKA 4LGQA 3B4PA 3DXOA 2GBWB 2GEXA 4WP5A 4LEHA 2JQ5A 3DMCA 4J8TA 3UNLA 1ULJB 4HM3B 1OHOA 2QIYA 1TP6A 3STDA 2CKFB 3DZLA 2HMOB 4HM5B 1Q42A 4KVHA 1GYBA 4K1VA 3BLZA 5IEOA 4J9AA 4Q53A 3HK4A 3RGAA 1UUVB 2W2CA 3G16A 4R9LA 4MJDA 4K1UA 1A2KA 3I0YA 5JPPA 4XBXA 5IG3A 3EX9A 7STDA 2Z76A 1ASKA 3B8LA 1K41A 3OWYA 1UUWB 4XDWA 3DM8A 2B1XB 6STDA 4XBTA 3EBTA 1ISKA 1O7GB 3F8HA 4HM8B 1O7MB 4R9KA 4HZ9B 1OHSA 4HJLB 1NWWA 3NV0A 2YFJB 3GZYB 3ROBA 4X2HA 4CDLA 3OWSA 5IG5A 2HMNB 1ZO2A 5AEUB 3GZXB 2HMKB 5D82A 2RFRA 3HZPA 4HM0B 1JN5A 1WQLB 3KZTA 2R4IA 3T8NA 3DUKA 3SEDA 3GRDA 3HX8A 3OWUA
chains in the Genus database with same CATH superfamily
3MSOA 1O7PB 1DMNA 2H0HA 3MYTA 5IF6A 1OH0A 2INXA 1BSCA 1W4NA 4ILFA 1JB4A 2CWVA 2E2UA 2QGUA 3NHXA 2W56B 1U8CB 3G0KA 1QAKA 3B4OA 3IMAB 5CF2A 3ZFZA 3EN8A 2W56A 1LOXA 5IEPA 7RNTA 1FUWA 1SJWA 3DH2A 1D6YA 2GBXB 2WOHA 3K7CA 3OX9A 3CC73 1M1K4 3F40A 2OQEA 1CYUA 1R4CA 2WGOA 2Z6BA 3SOAA 3WDGB 2GXFA 2CWUA 3GSPA 3Q90A 1A90A 1B2MA 3VSYA 3FG4A 4RZMA 1T2IA 4BTXA 3FG3A 3OWUA 2W03A 4IIAA 3TDGA 1U5OA 1IQXA 3WOEB 1BVIA 3AHWA 3FCSB 2OOVC 1S723 1N9JA 3JUNA 1K8A4 4FCZA 3Q1CA 4HZBB 3CCJ3 1BSEA 1YNVX 1SIIA 3A76A 3NQZA 3GZRA 5BVBA 1Q7HA 1W6YA 1TFKA 1LXEA 5D81A 1IDPA 1TJDA 3K63A 5CK6A 5CF1A 1JZOA 1OF5B 3KFQC 3WA2X 2F4YA 3EE1A 3JUOA 3SLUA 1W01A 5EVHA 1BIRA 1RCLA 3DY5A 3LZAA 4LMIA 1DMMA 1EUIC 3HI7A 5LC7A 4HM2B 2P0MA 2H0GA 1JZDA 3D9RA 1VQN3 3X3ZA 1AR0A 1D6ZA 2XFTA 4HM7B 1UGIA 4IT7A 2AADA 4L8PA 1JBRA 3H3HA 1UI7A 2WOFA 3LYGA 1JNQA 2CFKA 4GL6A 2CFGA 4KFFA 2YFIB 3S29A 1DVCA 3WR2A 1AVKA 2QEX3 1HYFA 3EF8A 3RGRA 2YX9A 4MMZB 1ULIB 1SPUA 3N9HA 1B2ZA 2RBIA 5IG0A 1Y4KA 1NJI4 2KRTA 4XM4A 2F56A 1D6UA 1RGGA 4FCMA 1BSAA 2XF3A 2Y73A 1IU7A 3MG3A 2IMJA 3NBBA 5LC6A 5KP4A 1YI23 1DE3A 5G2GA 3CME3 1FYSA 3KSPA 3PZWA 1RGHA 4KFEA 5IW9A 2CFDA 2BNGA 1YJ93 1HKXA 1YIT3 3CD63 3UL6A 1RN7A 4KZ1A 3V98A 1G96A 1MWTA 4BTWA 8CHOA 2QA43 3FH1A 3LT9A 5GSPA 1BSDA 8RNTA 1A2PA 2P0XA 3JUQA 5AIFA 2KF4A 3EHCA 1OUNA 3G6E3 4PEJA 2FGTA 4N3VA 1MGRA 1C54A 1GY5A 3V92A 3FLJA 4MMXB 1E3VA 2CWTA 2HMMB 4GSPA 1GMQA 1LNIA 5ELJA 2K0MA 2GSPA 1BRIA 3B7CA 3CPOA 3X42A 1VQL3 1BNFA 1SARA 5AI1A 3OW22 1EQKA 4AKYA 1STFI 2CX1A 4EBGA 3K0ZA 2HOHA 2LYXA 2Z77A 3UJMA 5STDA 1FGRA 3F7XA 3G8ZA 4OK0A 4RNYA 3ZG5A 2GEYA 3SYUA 4U13A 1OPYA 5A0OB 1I0XA 3MKIA 1I2EA 3GWRA 3NM7A 1VQK3 1L5GB 4AKZA 2OOVA 1US1A 1W6GA 3V99A 1VQ63 1NB5I 1I3FA 1RTUA 4R80A 1LVNA 3PCRA 1VQ43 1PFPA 2V1LA 1VQ93 5HOHA 3D5IA 1BGSA 2XH9A 4HM4B 1FGTA 3E99A 4BU4A 1BNIA 2CFWA 2F86B 1UCJA 3HIIA 1EG9B 1FUTA 3FF2A 1BNSA 4KT3B 1JV2B 1N5HA 4L7KA 1UI8A 1BUJA 3EBYA 2H0IA 1VQ73 1NB3I 4JF8A 3JUMA 1I2FA 1LOWA 1LNHA 1W02A 2RGQA 3NX0A 3UL5A 1QVG2 1O7WB 4HVNA 2E2VA 3X3XA 2O3OA 3OV4A 1GS3A 1B2SA 2RNTA 3UB1A 2OTJ3 1IVUA 2F99A 3NBJA 5BXQA 1A2VA 1WNHA 1QJGA 1RGFA 1PY3A 1UCKA 1W5ZA 1V58A 2IYJA 3BU4A 3EQQB 1W00A 3K5TA 4FMDA 1BNGA 2XSHB 3CU3A 4RBNA 1I70A 2F5MA 1GOVA 2B24B 1E3RA 5EQLA 3KKGA 4K90B 5IG4A 1BRGA 4N6LA 3CCL3 1JKGB 1RGEA 1RN4A 1STDA 3MG2A 1CEWI 3CMA3 1IYYA 4MMYB 2CFLA 1JKGA 9RNTA 4NHFA 4R1KA 1Q864 1RDSA 3KCHA 1AQZA 2OWPA 4WFOA 1W6CA 4FR9A 3S28A 3NM2A 1EA2A 1M1XB 1RRHA 2ZDJA 3U97A 2IA7A 2PZVA 2W9QA 1J2BA 4GB5A 1YVSA 3IJEB 1IT8A 5FW5A 2KCDA 3G713 3FGYA 2STDA 1S5AA 1Z1SA 4I4KA 4EXRA 1UDII 3BNBA 3LXUX 5CXOA 7GSPA 1OF5A 3N8BA 1RN1A 4IPBA 2CG0A 4XBYA 2MF7A 4OVMA 1YIJ3 1ZX2A 3U1WA 1OACA 1GOYA 1SIHA 1T5YA 2C10A 3AGOA 3OXAA 3NBRA 3S67A 4EYCA 4ZM8A 3DGNA 1G02A 4WHAA 2CG1A 3KSED 2XR8B 1VQO3 1FW7A 3LT8A 3GZBA 3MPHA 1E97A 1BUQA 1I8VA 3CPW2 4N6NB 1BANA 1JRQA 1Q9EA 3EJVA 3DGYA 3T8UA 4CJNA 2ZA4A 3IPTA 1BRSA 1RCKA 2P38A 3S5CA 1MNLA 1BSBA 2P09A 4WWUC 2I9WA 3N54B 4H3UA 1AVLA 4ORLA 3RNTA 3CCM3 4XDVA 2K54A 1FGMA 2FXTA 4STDA 1W2ZA 2MC8A 5KP1A 1RNTA 1RSNA 3KIIA 3WMDA 1RKYA 1GMRA 3LTCA 3FF0A 1GY7A 2KF6A 4XB5A 1LOYA 1UUGB 1BRKA 3NXJA 1HU9A 1CQSA 3WA3A 2GU1A 2RCDA 3NQYA 3LMLA 4EW5A 2Z7AA 1FA3A 5JPUA 1OGZA 3MHEA 1YJW3 4G1MB 1KWIA 1YGWA 2UX0A 1OHPA 5M19A 1CH0A 3PGBA 1B3SA 1V57A 4RNZA 2D42A 4O3VA 2BMOB 4EV2A 2ZL8A 2XSOB 3CCS3 3CCV3 4FCJA 1KQS2 1DYUA 1FGQA 1DETA 1UGHI 1X1XA 2F98A 2BMQB 1V74A 1LQGC 1B27A 1UCLA 1NO3A 1YVBI 2BO9B 2XRXB 5D83A 3G4S3 1TU5A 3X40A 4R4KA 4JRFA 3RDEA 5AYSC 4BTYA 3CCR3 2CK3H 4X2OA 1WMNA 1OGXA 1QMAA 1RJOA 4K61A 1SQWA 3VGNA 3F8XA 3KE7A 1FZUA 3SOYA 3I553 1RRLA 3DGOA 1IV7A 1GY6A 3EC9A 1O7HB 2HMJB 2IY2A 2K3DA 3WODG 2A15A 5AIHA 1BNRA 1X1YA 1W2B2 3LOYA 1VQ53 3NUVA 4HM6B 2IUKA 3FSDA 2BMRB 5CLKA 4LZIA 5IERA 5RNTA 3CCU3 3CC43 3M8CA 4HKVB 1C7HA 1TRPA 2PNCA 3D79A 4N6MA 3A5EA 4N6UA 5DREA 1ZS7A 3EN1B 5IENA 3CXC2 2BIRA 4RNTA 1IVXA 4BL3A 3BNEA 3NV0B 1T2HA 1GOUA 1MGWA 1G0TA 5AIIA 3VF1A 4N6OB 4AEQA 5HGRA 1DMQA 1IVWA 1BRHA 2W04A 4O2HA 4QWTA 3FKAA 3BNDA 1VQP3 3BIRA 4LYLB 4OUQA 1KC84 2SBLA 1JBTA 3H51A 2L1SA 1W7CA 4BL2A 1ROAA 3ER7A 3WHOA 3ECFA 2W6JH 1OCVA 1NNVA 3BB9A 3DGLA 2KF5A 4O8SA 3CNXA 3WOFB 2YFLB 3F9SA 3KN4A 5KP3A 1PU4A 1JN5B 1WMOA 2GU3A 3Q2PA 1Q824 4NPBA 5AIGA 1ZGXA 3URPA 1TRQA 1IT7A 2L4VA 1NDOB 1VZZA 4N6V0 4H61A 3X3YA 2JDIH 1GSPA 5AEWB 3LTDA 1JB5A 2KXGA 5BIRA 1MWUA 1ROVA 3PXMA 1IK3A 2HMLB 3CNMA 1IV9A 1BRJA 4L8OA 3SVAA 2IUJA 2R41A 1Q40B 3HOHA 5DRVA 1JB2A 1Q7Y4 1B2UA 1Q40A 3JUPA 1N8R4 3QRDA 3FZWA 1NU3A 1O7NB 1N9EA 1X1WA 1VQM3 3F14A 3K9MC 5TGNA 1QVF2 1TUHA 4GHOA 2XEPA 3MG1A 1BOXA 3F7SA 3FG1A 4WYKB 2UUGC 4HM1B 3PYJA 2CW9A 6GSPA 1RMSA 2CHCA 4HBRA 4WYKA 4LGQA 2WO0A 3B4PA 4BIRA 1RGLA 1UCIA 3DXOA 3SX1A 2GBWB 2GEXA 2WGQA 4N6TA 4WP5A 1YGEA 5G1LA 4LEHA 1N5PA 6RNTA 2JQ5A 2CX0A 4NREA 3AMOB 1Q814 1K9M4 4EC6A 3DMCA 5EEOA 5AYRB 1KSIA 3AMOA 4J8TA 3UNLA 1ULJB 1RGCA 4HM3B 1OHOA 3S27A 3CCQ3 2QIYA 4FMCA 1TP6A 3STDA 3CC23 2CKFB 3PS8A 3DZLA 1RGKA 2HMOB 1MOLA 1B2XA 2AAEA 3AGNA 4HM5B 2O9UX 1IVVA 1RHLA 3CCE3 1MWRA 2SARA 1GMPA 1Q42A 4KVHA 5M1AA 2E2TA 2D1WA 1EEJA 3D4AA 5FGOA 1GYBA 4MEIA 4K1VA 3BLZA 5IEOA 4J5GA 4J9AA 1I0VA 3SXXA 4Q53A 4HYZA 1AY7A 1KD14 3HK4A 1FGOA 3RGAA 1UUVB 2W2CA 1F8NA 1GD4A 4LSOA 5I97A 1QALA 1FUSA 3G16A 3O8YA 4R9LA 1JBSA 1TFOA 2ML5A 1B21A 2LQVA 4FMBA 2ML6A 4J5KA 3J7Yd 1WMPA 2OQEC 1PYLA 1YJN3 4MJDA 2BT3A 4K1UA 2FNQA 1IQ8A 2Y74A 1LQMB 1A2KA 3BNCA 1CYVA 4HOHA 1A67A 1DVDA 3QK9A 3I0YA 5JPPA 1N8QA 4XBXA 1R4YA 5IG3A 3DGMA 1M9GA 3EX9A 7STDA 1AV4A 2CIUA 2Z76A 1ASKA 2RSXA 2P05A 3GAXA 3AHSA 3MWZA 2XGNA 3B8LA 1MWSA 1K41A 2CC3A 2OCTA 2BHMA 4CPKA 1BU4A 3OWYA 1BNJA 2F5WA 2C11A 2KF3A 1UUWB 3PCSA 1WTHA 4CCVA 1HZ1A 4XDWA 3DM8A 1M904 2B1XB 6STDA 2M7OA 1BNEA 3L0RA 4KFDA 1I3IA 4XBTA 1UW1A 3ZG0A 3HIGA 3ALAA 1BRNL 4HAAA 3EBTA 4DKIA 2Q07A 1ISKA 1O7GB 4O02B 1IQYA 1VQ83 2XGLA 3F8HA 1EKMA 4HM8B 1GD3A 1O7MB 2C4BA 2J8XB 5M18A 1JJ22 4R9KA 1K734 3LTBA 4HZ9B 1OHSA 4HJLB 1NWWA 1T3BA 3X41A 3NV0A 4TX4A 5JBSA 2YFJB 3GZYB 3Q3FA 3ROBA 3I563 4X2HA 4CDLA 1X1UA 3OWSA 5IG5A 3LTAA 2OTL3 1QAFA 2KAAA 2HMNB 1ZO2A 5AEUB 1TIJA 3GZXB 1YHQ3 5BU4A 1RLSA 4I5QA 2HMKB 5D82A 1RGAA 4EV5A 5ELUA 3T0UA 2RFRA 3HZPA 4HM0B 5G1KA 2UGIA 1JN5A 1B20A 1I2GA 1TTOA 1RNBA 2BU4A 1K28A 1WQLB 3EB8A 3JVCA 1LOVA 1LRAA 2R4IA 2W9PA 3KZTA 2W0QA 3LH4A 3T8NA 2ZHXB 1BAOA 3DUKA 2XFSA 3SEDA 3D5GA 3D3LA 3GRDA 3HX8A 4FMAA 1VQQA 2CH9A
chains in the Genus database with same CATH topology
3MSOA 1O7PB 1DMNA 3MYTA 5IF6A 1OH0A 2INXA 1W4NA 1JB4A 2CWVA 2E2UA 2QGUA 3NHXA 2W56B 1U8CB 3G0KA 1QAKA 3B4OA 3IMAB 5CF2A 3EN8A 2W56A 1LOXA 5IEPA 1FUWA 1SJWA 1D6YA 2GBXB 2WOHA 3K7CA 3OX9A 3CC73 1M1K4 3F40A 2OQEA 1CYUA 1R4CA 2WGOA 2Z6BA 3SOAA 3WDGB 2GXFA 2CWUA 3Q90A 1A90A 3VSYA 3FG4A 4RZMA 4BTXA 3FG3A 3OWUA 2W03A 4IIAA 3TDGA 1U5OA 1IQXA 3WOEB 3FCSB 2OOVC 1S723 1N9JA 3JUNA 1K8A4 4FCZA 3Q1CA 4HZBB 3CCJ3 1SIIA 3A76A 3NQZA 3GZRA 5BVBA 1W6YA 1TFKA 1LXEA 5D81A 1IDPA 3K63A 5CK6A 5CF1A 1OF5B 3KFQC 3WA2X 3EE1A 3JUOA 3SLUA 1W01A 5EVHA 3DY5A 3LZAA 4LMIA 1DMMA 3HI7A 5LC7A 4HM2B 2P0MA 3D9RA 1VQN3 3X3ZA 1AR0A 1D6ZA 2XFTA 4HM7B 4IT7A 4L8PA 3H3HA 1UI7A 2WOFA 3LYGA 1JNQA 2CFKA 4GL6A 2CFGA 4KFFA 2YFIB 3S29A 1DVCA 1AVKA 2QEX3 3RGRA 3EF8A 2YX9A 4MMZB 1ULIB 1SPUA 3N9HA 5IG0A 1Y4KA 1NJI4 2KRTA 4XM4A 4FCMA 1D6UA 2XF3A 2Y73A 1IU7A 3MG3A 2IMJA 3NBBA 5LC6A 5KP4A 1YI23 5G2GA 3CME3 3KSPA 3PZWA 4KFEA 5IW9A 2CFDA 2BNGA 1YJ93 1HKXA 1YIT3 3CD63 3UL6A 1RN7A 4KZ1A 3V98A 1G96A 4BTWA 8CHOA 2QA43 3FH1A 3LT9A 2P0XA 3JUQA 5AIFA 3EHCA 1OUNA 3G6E3 4PEJA 2FGTA 4N3VA 1GY5A 3V92A 3FLJA 4MMXB 1E3VA 2CWTA 2HMMB 5ELJA 2K0MA 3B7CA 3CPOA 3X42A 1VQL3 5AI1A 3OW22 1EQKA 4AKYA 1STFI 4EBGA 3K0ZA 2LYXA 2Z77A 3UJMA 5STDA 1FGRA 3F7XA 3G8ZA 4OK0A 4RNYA 2GEYA 4U13A 1OPYA 5A0OB 3MKIA 3NM7A 3GWRA 1VQK3 1L5GB 4AKZA 2OOVA 1US1A 1W6GA 3V99A 1VQ63 1NB5I 4R80A 1LVNA 3PCRA 1VQ43 1PFPA 2V1LA 1VQ93 2XH9A 4HM4B 1FGTA 3E99A 2CFWA 2F86B 3HIIA 1EG9B 3FF2A 1JV2B 1N5HA 4L7KA 1UI8A 3EBYA 1VQ73 1NB3I 4JF8A 3JUMA 1LNHA 1W02A 2RGQA 3NX0A 3UL5A 1QVG2 1O7WB 4HVNA 2E2VA 3X3XA 2O3OA 3OV4A 1GS3A 3UB1A 2OTJ3 1IVUA 2F99A 3NBJA 5BXQA 1A2VA 1WNHA 1QJGA 1W5ZA 4FMDA 3K5TA 3EQQB 1W00A 4RBNA 2XSHB 3CU3A 2B24B 1E3RA 5EQLA 3KKGA 4K90B 5IG4A 4N6LA 3CCL3 1JKGB 1STDA 3MG2A 1CEWI 3CMA3 4MMYB 2CFLA 1JKGA 4NHFA 4R1KA 1Q864 4WFOA 2OWPA 1W6CA 4FR9A 3S28A 3NM2A 1EA2A 1M1XB 1RRHA 2ZDJA 3U97A 2IA7A 2PZVA 2W9QA 1J2BA 4GB5A 3IJEB 1IT8A 5FW5A 2KCDA 3G713 3FGYA 2STDA 1S5AA 1Z1SA 4I4KA 4EXRA 3BNBA 3LXUX 5CXOA 1OF5A 3N8BA 4IPBA 2CG0A 4XBYA 2MF7A 4OVMA 1YIJ3 1ZX2A 3U1WA 1OACA 1SIHA 1T5YA 2C10A 3OXAA 3S67A 3NBRA 4EYCA 4ZM8A 3DGNA 4WHAA 2CG1A 3KSED 2XR8B 1VQO3 3LT8A 3GZBA 3MPHA 1E97A 1BUQA 3CPW2 4N6NB 3EJVA 1JRQA 3T8UA 3IPTA 2P38A 3S5CA 1MNLA 2P09A 4WWUC 2I9WA 3N54B 4H3UA 1AVLA 4ORLA 3CCM3 4XDVA 2K54A 1FGMA 2FXTA 4STDA 1W2ZA 2MC8A 5KP1A 3KIIA 3WMDA 1RKYA 3LTCA 3FF0A 1GY7A 4XB5A 3NXJA 1HU9A 1CQSA 3WA3A 2GU1A 2RCDA 3NQYA 3LMLA 2Z7AA 1FA3A 5JPUA 1OGZA 3MHEA 1YJW3 4G1MB 1KWIA 2UX0A 1OHPA 3PGBA 4RNZA 2D42A 4O3VA 2BMOB 4EV2A 2ZL8A 2XSOB 3CCS3 3CCV3 4FCJA 1KQS2 1DYUA 1FGQA 4H61A 2XRXB 2F98A 2BMQB 1V74A 1YVBI 2BO9B 1NO3A 5D83A 3G4S3 1TU5A 3X40A 4R4KA 4JRFA 3RDEA 5AYSC 4BTYA 3CCR3 2CK3H 4X2OA 1WMNA 1OGXA 1QMAA 1RJOA 4K61A 1SQWA 3VGNA 3F8XA 3KE7A 3SOYA 3I553 1RRLA 3DGOA 1IV7A 1GY6A 3EC9A 1O7HB 2HMJB 3WODG 2A15A 5AIHA 1VQ53 1W2B2 3LOYA 3NUVA 4HM6B 2IUKA 3FSDA 2BMRB 5CLKA 4LZIA 5IERA 3CC43 3CCU3 3M8CA 4HKVB 1C7HA 2PNCA 4N6MA 4N6UA 5IENA 5DREA 3CXC2 3EN1B 1IVXA 3BNEA 3NV0B 4AEQA 5AIIA 3VF1A 4N6OB 5HGRA 1DMQA 1IVWA 2W04A 4O2HA 4QWTA 3FKAA 3BNDA 1VQP3 4OUQA 1KC84 2SBLA 3H51A 1W7CA 1ROAA 3ER7A 3ECFA 2W6JH 1OCVA 3BB9A 3DGLA 4O8SA 3CNXA 3WOFB 2YFLB 3F9SA 3KN4A 5KP3A 1PU4A 1JN5B 1WMOA 2GU3A 3Q2PA 1Q824 5AIGA 1IT7A 2L4VA 1NDOB 1VZZA 4N6V0 3X3YA 2JDIH 5AEWB 3LTDA 1JB5A 2KXGA 1IK3A 1ROVA 3PXMA 2HMLB 3CNMA 1IV9A 4L8OA 3SVAA 2IUJA 1Q40B 5DRVA 1JB2A 1Q7Y4 1Q40A 3JUPA 1N8R4 3QRDA 3FZWA 1NU3A 1O7NB 1N9EA 1VQM3 3F14A 3K9MC 5TGNA 1QVF2 1TUHA 2XEPA 3MG1A 3F7SA 3FG1A 4WYKB 4HM1B 3PYJA 2CW9A 2CHCA 4HBRA 4WYKA 4LGQA 2WO0A 3B4PA 3SX1A 3DXOA 2GBWB 2GEXA 2WGQA 4N6TA 4WP5A 1YGEA 4LEHA 1N5PA 1Q814 2JQ5A 1K9M4 4NREA 3AMOB 4EC6A 3DMCA 5EEOA 5AYRB 1KSIA 3AMOA 4J8TA 3UNLA 1ULJB 4HM3B 1OHOA 3S27A 3CCQ3 2QIYA 4FMCA 1TP6A 3STDA 3CC23 2CKFB 3PS8A 3DZLA 2HMOB 1MOLA 4HM5B 2O9UX 1IVVA 3CCE3 1Q42A 4KVHA 2E2TA 2D1WA 5FGOA 1GYBA 4MEIA 4K1VA 3BLZA 5IEOA 4J9AA 3SXXA 4Q53A 4HYZA 1KD14 3HK4A 1FGOA 3RGAA 1UUVB 2W2CA 1F8NA 1GD4A 4LSOA 5I97A 1QALA 3G16A 3O8YA 4R9LA 1TFOA 2ML5A 4FMBA 2LQVA 3J7Yd 2ML6A 1WMPA 2OQEC 1YJN3 4MJDA 2BT3A 4K1UA 2FNQA 1IQ8A 2Y74A 1A2KA 3BNCA 1CYVA 1A67A 1DVDA 3QK9A 3I0YA 5JPPA 1N8QA 4XBXA 5IG3A 3DGMA 1M9GA 3EX9A 7STDA 1AV4A 2CIUA 2Z76A 1ASKA 2RSXA 2P05A 3GAXA 3MWZA 2XGNA 3B8LA 1K41A 2CC3A 2OCTA 2BHMA 3OWYA 2C11A 1UUWB 3PCSA 1WTHA 4CCVA 4XDWA 3DM8A 1M904 2B1XB 6STDA 2M7OA 3L0RA 4KFDA 4XBTA 1UW1A 3HIGA 3ALAA 3EBTA 2Q07A 1ISKA 1O7GB 4O02B 1IQYA 1VQ83 2XGLA 3F8HA 1EKMA 4HM8B 1GD3A 1O7MB 1JJ22 4R9KA 1K734 3LTBA 4HZ9B 1OHSA 4HJLB 1NWWA 3X41A 3NV0A 4TX4A 5JBSA 2YFJB 3GZYB 3ROBA 3I563 4X2HA 4CDLA 3OWSA 5IG5A 3LTAA 2OTL3 1QAFA 2HMNB 1ZO2A 5AEUB 1TIJA 3GZXB 1YHQ3 2HMKB 5D82A 4EV5A 5ELUA 3T0UA 2RFRA 3HZPA 4HM0B 1JN5A 1K28A 1WQLB 3EB8A 3JVCA 2W9PA 2R4IA 3KZTA 3LH4A 2W0QA 3T8NA 3DUKA 2XFSA 3SEDA 3D3LA 3GRDA 3HX8A 4FMAA 2CH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSO A;  1O7P B;  1DMN A;  3MYT A;  5IF6 A;  1OH0 A;  2INX A;  1JB4 A;  3NHX A;  2QGU A;  3G0K A;  3B4O A;  5CF2 A;  3EN8 A;  5IEP A;  1SJW A;  2GBX B;  3K7C A;  3OX9 A;  3F40 A;  3SOA A;  2GXF A;  3Q90 A;  3VSY A;  4RZM A;  4IIA A;  1U5O A;  3JUN A;  4HZB B;  3A76 A;  3GZR A;  5BVB A;  1W6Y A;  5D81 A;  1IDP A;  5CK6 A;  5CF1 A;  1OF5 B;  3JUO A;  1W01 A;  5EVH A;  3LZA A;  4LMI A;  1DMM A;  4HM2 B;  3D9R A;  1AR0 A;  4HM7 B;  4L8P A;  3H3H A;  3LYG A;  2YFI B;  3RGR A;  3EF8 A;  1ULI B;  5IG0 A;  4XM4 A;  4FCM A;  3MG3 A;  2IMJ A;  5KP4 A;  5G2G A;  3KSP A;  2BNG A;  1HKX A;  8CHO A;  3FH1 A;  3JUQ A;  5AIF A;  3EHC A;  1OUN A;  4PEJ A;  4N3V A;  1GY5 A;  3FLJ A;  1E3V A;  2HMM B;  3B7C A;  3CPO A;  5AI1 A;  3K0Z A;  2Z77 A;  3UJM A;  5STD A;  3F7X A;  3G8Z A;  2GEY A;  4U13 A;  1OPY A;  3MKI A;  3GWR A;  4HM4 B;  3E99 A;  2F86 B;  1EG9 B;  3FF2 A;  4L7K A;  3EBY A;  3JUM A;  1W02 A;  2RGQ A;  1O7W B;  4HVN A;  3OV4 A;  1GS3 A;  2F99 A;  5BXQ A;  1QJG A;  3EQQ B;  1W00 A;  2XSH B;  3CU3 A;  2B24 B;  1E3R A;  3KKG A;  5IG4 A;  1JKG B;  1STD A;  3MG2 A;  1JKG A;  4R1K A;  2OWP A;  3NM2 A;  1EA2 A;  2PZV A;  4GB5 A;  5FW5 A;  3FGY A;  2STD A;  1S5A A;  1Z1S A;  4I4K A;  5CXO A;  1OF5 A;  4XBY A;  4OVM A;  1ZX2 A;  3OXA A;  3NBR A;  2XR8 B;  3GZB A;  1E97 A;  1BUQ A;  3EJV A;  3T8U A;  3IPT A;  3S5C A;  4WWU C;  2I9W A;  4H3U A;  4ORL A;  4XDV A;  2K54 A;  4STD A;  5KP1 A;  3WMD A;  3FF0 A;  1GY7 A;  4XB5 A;  3NXJ A;  1CQS A;  2RCD A;  2Z7A A;  5JPU A;  1OGZ A;  3MHE A;  2UX0 A;  1OHP A;  2BMO B;  2XSO B;  4FCJ A;  2F98 A;  2BMQ B;  2XRX B;  5D83 A;  4X2O A;  1QMA A;  1OGX A;  3VGN A;  3F8X A;  3KE7 A;  3SOY A;  1GY6 A;  3EC9 A;  1O7H B;  2HMJ B;  2A15 A;  5AIH A;  3NUV A;  4HM6 B;  5CLK A;  3FSD A;  2BMR B;  5IER A;  3M8C A;  4HKV B;  1C7H A;  5IEN A;  5DRE A;  3EN1 B;  3NV0 B;  5AII A;  5HGR A;  1DMQ A;  3FKA A;  4OUQ A;  3H51 A;  3ER7 A;  3ECF A;  1OCV A;  3BB9 A;  3CNX A;  2YFL B;  3F9S A;  5KP3 A;  1JN5 B;  5AIG A;  1NDO B;  1VZZ A;  5AEW B;  1JB5 A;  2HML B;  3CNM A;  4L8O A;  1Q40 B;  5DRV A;  1JB2 A;  1Q40 A;  3JUP A;  3FZW A;  1NU3 A;  1O7N B;  3F14 A;  5TGN A;  1TUH A;  3MG1 A;  3F7S A;  4WYK B;  4HM1 B;  2CHC A;  4WYK A;  4LGQ A;  3B4P A;  3DXO A;  2GBW B;  2GEX A;  4WP5 A;  4LEH A;  2JQ5 A;  3DMC A;  4J8T A;  3UNL A;  1ULJ B;  4HM3 B;  1OHO A;  2QIY A;  1TP6 A;  3STD A;  2CKF B;  3DZL A;  2HMO B;  4HM5 B;  1Q42 A;  4KVH A;  1GYB A;  4K1V A;  3BLZ A;  5IEO A;  4J9A A;  4Q53 A;  3HK4 A;  3RGA A;  1UUV B;  2W2C A;  3G16 A;  4R9L A;  4MJD A;  4K1U A;  1A2K A;  3I0Y A;  5JPP A;  4XBX A;  5IG3 A;  3EX9 A;  7STD A;  2Z76 A;  1ASK A;  3B8L A;  1K41 A;  3OWY A;  1UUW B;  4XDW A;  3DM8 A;  2B1X B;  6STD A;  4XBT A;  3EBT A;  1ISK A;  1O7G B;  3F8H A;  4HM8 B;  1O7M B;  4R9K A;  4HZ9 B;  1OHS A;  4HJL B;  1NWW A;  3NV0 A;  2YFJ B;  3GZY B;  3ROB A;  4X2H A;  4CDL A;  3OWS A;  5IG5 A;  2HMN B;  1ZO2 A;  5AEU B;  3GZX B;  2HMK B;  5D82 A;  2RFR A;  3HZP A;  4HM0 B;  1JN5 A;  1WQL B;  3KZT A;  2R4I A;  3T8N A;  3DUK A;  3SED A;  3GRD A;  3HX8 A;  3OWU A; 
#chains in the Genus database with same CATH topology
 3MSO A;  1O7P B;  1DMN A;  2H0H A;  3MYT A;  5IF6 A;  1OH0 A;  2INX A;  1BSC A;  1W4N A;  4ILF A;  1JB4 A;  2CWV A;  2E2U A;  2QGU A;  3NHX A;  2W56 B;  1U8C B;  3G0K A;  1QAK A;  3B4O A;  3IMA B;  5CF2 A;  3ZFZ A;  3EN8 A;  2W56 A;  1LOX A;  5IEP A;  7RNT A;  1FUW A;  1SJW A;  3DH2 A;  1D6Y A;  2GBX B;  2WOH A;  3K7C A;  3OX9 A;  3CC7 3;  1M1K 4;  3F40 A;  2OQE A;  1CYU A;  1R4C A;  2WGO A;  2Z6B A;  3SOA A;  3WDG B;  2GXF A;  2CWU A;  3GSP A;  3Q90 A;  1A90 A;  1B2M A;  3VSY A;  3FG4 A;  4RZM A;  1T2I A;  4BTX A;  3FG3 A;  3OWU A;  2W03 A;  4IIA A;  3TDG A;  1U5O A;  1IQX A;  3WOE B;  1BVI A;  3AHW A;  3FCS B;  2OOV C;  1S72 3;  1N9J A;  3JUN A;  1K8A 4;  4FCZ A;  3Q1C A;  4HZB B;  3CCJ 3;  1BSE A;  1YNV X;  1SII A;  3A76 A;  3NQZ A;  3GZR A;  5BVB A;  1Q7H A;  1W6Y A;  1TFK A;  1LXE A;  5D81 A;  1IDP A;  1TJD A;  3K63 A;  5CK6 A;  5CF1 A;  1JZO A;  1OF5 B;  3KFQ C;  3WA2 X;  2F4Y A;  3EE1 A;  3JUO A;  3SLU A;  1W01 A;  5EVH A;  1BIR A;  1RCL A;  3DY5 A;  3LZA A;  4LMI A;  1DMM A;  1EUI C;  3HI7 A;  5LC7 A;  4HM2 B;  2P0M A;  2H0G A;  1JZD A;  3D9R A;  1VQN 3;  3X3Z A;  1AR0 A;  1D6Z A;  2XFT A;  4HM7 B;  1UGI A;  4IT7 A;  2AAD A;  4L8P A;  1JBR A;  3H3H A;  1UI7 A;  2WOF A;  3LYG A;  1JNQ A;  2CFK A;  4GL6 A;  2CFG A;  4KFF A;  2YFI B;  3S29 A;  1DVC A;  3WR2 A;  1AVK A;  2QEX 3;  1HYF A;  3EF8 A;  3RGR A;  2YX9 A;  4MMZ B;  1ULI B;  1SPU A;  3N9H A;  1B2Z A;  2RBI A;  5IG0 A;  1Y4K A;  1NJI 4;  2KRT A;  4XM4 A;  2F56 A;  1D6U A;  1RGG A;  4FCM A;  1BSA A;  2XF3 A;  2Y73 A;  1IU7 A;  3MG3 A;  2IMJ A;  3NBB A;  5LC6 A;  5KP4 A;  1YI2 3;  1DE3 A;  5G2G A;  3CME 3;  1FYS A;  3KSP A;  3PZW A;  1RGH A;  4KFE A;  5IW9 A;  2CFD A;  2BNG A;  1YJ9 3;  1HKX A;  1YIT 3;  3CD6 3;  3UL6 A;  1RN7 A;  4KZ1 A;  3V98 A;  1G96 A;  1MWT A;  4BTW A;  8CHO A;  2QA4 3;  3FH1 A;  3LT9 A;  5GSP A;  1BSD A;  8RNT A;  1A2P A;  2P0X A;  3JUQ A;  5AIF A;  2KF4 A;  3EHC A;  1OUN A;  3G6E 3;  4PEJ A;  2FGT A;  4N3V A;  1MGR A;  1C54 A;  1GY5 A;  3V92 A;  3FLJ A;  4MMX B;  1E3V A;  2CWT A;  2HMM B;  4GSP A;  1GMQ A;  1LNI A;  5ELJ A;  2K0M A;  2GSP A;  1BRI A;  3B7C A;  3CPO A;  3X42 A;  1VQL 3;  1BNF A;  1SAR A;  5AI1 A;  3OW2 2;  1EQK A;  4AKY A;  1STF I;  2CX1 A;  4EBG A;  3K0Z A;  2HOH A;  2LYX A;  2Z77 A;  3UJM A;  5STD A;  1FGR A;  3F7X A;  3G8Z A;  4OK0 A;  4RNY A;  3ZG5 A;  2GEY A;  3SYU A;  4U13 A;  1OPY A;  5A0O B;  1I0X A;  3MKI A;  1I2E A;  3GWR A;  3NM7 A;  1VQK 3;  1L5G B;  4AKZ A;  2OOV A;  1US1 A;  1W6G A;  3V99 A;  1VQ6 3;  1NB5 I;  1I3F A;  1RTU A;  4R80 A;  1LVN A;  3PCR A;  1VQ4 3;  1PFP A;  2V1L A;  1VQ9 3;  5HOH A;  3D5I A;  1BGS A;  2XH9 A;  4HM4 B;  1FGT A;  3E99 A;  4BU4 A;  1BNI A;  2CFW A;  2F86 B;  1UCJ A;  3HII A;  1EG9 B;  1FUT A;  3FF2 A;  1BNS A;  4KT3 B;  1JV2 B;  1N5H A;  4L7K A;  1UI8 A;  1BUJ A;  3EBY A;  2H0I A;  1VQ7 3;  1NB3 I;  4JF8 A;  3JUM A;  1I2F A;  1LOW A;  1LNH A;  1W02 A;  2RGQ A;  3NX0 A;  3UL5 A;  1QVG 2;  1O7W B;  4HVN A;  2E2V A;  3X3X A;  2O3O A;  3OV4 A;  1GS3 A;  1B2S A;  2RNT A;  3UB1 A;  2OTJ 3;  1IVU A;  2F99 A;  3NBJ A;  5BXQ A;  1A2V A;  1WNH A;  1QJG A;  1RGF A;  1PY3 A;  1UCK A;  1W5Z A;  1V58 A;  2IYJ A;  3BU4 A;  3EQQ B;  1W00 A;  3K5T A;  4FMD A;  1BNG A;  2XSH B;  3CU3 A;  4RBN A;  1I70 A;  2F5M A;  1GOV A;  2B24 B;  1E3R A;  5EQL A;  3KKG A;  4K90 B;  5IG4 A;  1BRG A;  4N6L A;  3CCL 3;  1JKG B;  1RGE A;  1RN4 A;  1STD A;  3MG2 A;  1CEW I;  3CMA 3;  1IYY A;  4MMY B;  2CFL A;  1JKG A;  9RNT A;  4NHF A;  4R1K A;  1Q86 4;  1RDS A;  3KCH A;  1AQZ A;  2OWP A;  4WFO A;  1W6C A;  4FR9 A;  3S28 A;  3NM2 A;  1EA2 A;  1M1X B;  1RRH A;  2ZDJ A;  3U97 A;  2IA7 A;  2PZV A;  2W9Q A;  1J2B A;  4GB5 A;  1YVS A;  3IJE B;  1IT8 A;  5FW5 A;  2KCD A;  3G71 3;  3FGY A;  2STD A;  1S5A A;  1Z1S A;  4I4K A;  4EXR A;  1UDI I;  3BNB A;  3LXU X;  5CXO A;  7GSP A;  1OF5 A;  3N8B A;  1RN1 A;  4IPB A;  2CG0 A;  4XBY A;  2MF7 A;  4OVM A;  1YIJ 3;  1ZX2 A;  3U1W A;  1OAC A;  1GOY A;  1SIH A;  1T5Y A;  2C10 A;  3AGO A;  3OXA A;  3NBR A;  3S67 A;  4EYC A;  4ZM8 A;  3DGN A;  1G02 A;  4WHA A;  2CG1 A;  3KSE D;  2XR8 B;  1VQO 3;  1FW7 A;  3LT8 A;  3GZB A;  3MPH A;  1E97 A;  1BUQ A;  1I8V A;  3CPW 2;  4N6N B;  1BAN A;  1JRQ A;  1Q9E A;  3EJV A;  3DGY A;  3T8U A;  4CJN A;  2ZA4 A;  3IPT A;  1BRS A;  1RCK A;  2P38 A;  3S5C A;  1MNL A;  1BSB A;  2P09 A;  4WWU C;  2I9W A;  3N54 B;  4H3U A;  1AVL A;  4ORL A;  3RNT A;  3CCM 3;  4XDV A;  2K54 A;  1FGM A;  2FXT A;  4STD A;  1W2Z A;  2MC8 A;  5KP1 A;  1RNT A;  1RSN A;  3KII A;  3WMD A;  1RKY A;  1GMR A;  3LTC A;  3FF0 A;  1GY7 A;  2KF6 A;  4XB5 A;  1LOY A;  1UUG B;  1BRK A;  3NXJ A;  1HU9 A;  1CQS A;  3WA3 A;  2GU1 A;  2RCD A;  3NQY A;  3LML A;  4EW5 A;  2Z7A A;  1FA3 A;  5JPU A;  1OGZ A;  3MHE A;  1YJW 3;  4G1M B;  1KWI A;  1YGW A;  2UX0 A;  1OHP A;  5M19 A;  1CH0 A;  3PGB A;  1B3S A;  1V57 A;  4RNZ A;  2D42 A;  4O3V A;  2BMO B;  4EV2 A;  2ZL8 A;  2XSO B;  3CCS 3;  3CCV 3;  4FCJ A;  1KQS 2;  1DYU A;  1FGQ A;  1DET A;  1UGH I;  1X1X A;  2F98 A;  2BMQ B;  1V74 A;  1LQG C;  1B27 A;  1UCL A;  1NO3 A;  1YVB I;  2BO9 B;  2XRX B;  5D83 A;  3G4S 3;  1TU5 A;  3X40 A;  4R4K A;  4JRF A;  3RDE A;  5AYS C;  4BTY A;  3CCR 3;  2CK3 H;  4X2O A;  1WMN A;  1OGX A;  1QMA A;  1RJO A;  4K61 A;  1SQW A;  3VGN A;  3F8X A;  3KE7 A;  1FZU A;  3SOY A;  3I55 3;  1RRL A;  3DGO A;  1IV7 A;  1GY6 A;  3EC9 A;  1O7H B;  2HMJ B;  2IY2 A;  2K3D A;  3WOD G;  2A15 A;  5AIH A;  1BNR A;  1X1Y A;  1W2B 2;  3LOY A;  1VQ5 3;  3NUV A;  4HM6 B;  2IUK A;  3FSD A;  2BMR B;  5CLK A;  4LZI A;  5IER A;  5RNT A;  3CCU 3;  3CC4 3;  3M8C A;  4HKV B;  1C7H A;  1TRP A;  2PNC A;  3D79 A;  4N6M A;  3A5E A;  4N6U A;  5DRE A;  1ZS7 A;  3EN1 B;  5IEN A;  3CXC 2;  2BIR A;  4RNT A;  1IVX A;  4BL3 A;  3BNE A;  3NV0 B;  1T2H A;  1GOU A;  1MGW A;  1G0T A;  5AII A;  3VF1 A;  4N6O B;  4AEQ A;  5HGR A;  1DMQ A;  1IVW A;  1BRH A;  2W04 A;  4O2H A;  4QWT A;  3FKA A;  3BND A;  1VQP 3;  3BIR A;  4LYL B;  4OUQ A;  1KC8 4;  2SBL A;  1JBT A;  3H51 A;  2L1S A;  1W7C A;  4BL2 A;  1ROA A;  3ER7 A;  3WHO A;  3ECF A;  2W6J H;  1OCV A;  1NNV A;  3BB9 A;  3DGL A;  2KF5 A;  4O8S A;  3CNX A;  3WOF B;  2YFL B;  3F9S A;  3KN4 A;  5KP3 A;  1PU4 A;  1JN5 B;  1WMO A;  2GU3 A;  3Q2P A;  1Q82 4;  4NPB A;  5AIG A;  1ZGX A;  3URP A;  1TRQ A;  1IT7 A;  2L4V A;  1NDO B;  1VZZ A;  4N6V 0;  4H61 A;  3X3Y A;  2JDI H;  1GSP A;  5AEW B;  3LTD A;  1JB5 A;  2KXG A;  5BIR A;  1MWU A;  1ROV A;  3PXM A;  1IK3 A;  2HML B;  3CNM A;  1IV9 A;  1BRJ A;  4L8O A;  3SVA A;  2IUJ A;  2R41 A;  1Q40 B;  3HOH A;  5DRV A;  1JB2 A;  1Q7Y 4;  1B2U A;  1Q40 A;  3JUP A;  1N8R 4;  3QRD A;  3FZW A;  1NU3 A;  1O7N B;  1N9E A;  1X1W A;  1VQM 3;  3F14 A;  3K9M C;  5TGN A;  1QVF 2;  1TUH A;  4GHO A;  2XEP A;  3MG1 A;  1BOX A;  3F7S A;  3FG1 A;  4WYK B;  2UUG C;  4HM1 B;  3PYJ A;  2CW9 A;  6GSP A;  1RMS A;  2CHC A;  4HBR A;  4WYK A;  4LGQ A;  2WO0 A;  3B4P A;  4BIR A;  1RGL A;  1UCI A;  3DXO A;  3SX1 A;  2GBW B;  2GEX A;  2WGQ A;  4N6T A;  4WP5 A;  1YGE A;  5G1L A;  4LEH A;  1N5P A;  6RNT A;  2JQ5 A;  2CX0 A;  4NRE A;  3AMO B;  1Q81 4;  1K9M 4;  4EC6 A;  3DMC A;  5EEO A;  5AYR B;  1KSI A;  3AMO A;  4J8T A;  3UNL A;  1ULJ B;  1RGC A;  4HM3 B;  1OHO A;  3S27 A;  3CCQ 3;  2QIY A;  4FMC A;  1TP6 A;  3STD A;  3CC2 3;  2CKF B;  3PS8 A;  3DZL A;  1RGK A;  2HMO B;  1MOL A;  1B2X A;  2AAE A;  3AGN A;  4HM5 B;  2O9U X;  1IVV A;  1RHL A;  3CCE 3;  1MWR A;  2SAR A;  1GMP A;  1Q42 A;  4KVH A;  5M1A A;  2E2T A;  2D1W A;  1EEJ A;  3D4A A;  5FGO A;  1GYB A;  4MEI A;  4K1V A;  3BLZ A;  5IEO A;  4J5G A;  4J9A A;  1I0V A;  3SXX A;  4Q53 A;  4HYZ A;  1AY7 A;  1KD1 4;  3HK4 A;  1FGO A;  3RGA A;  1UUV B;  2W2C A;  1F8N A;  1GD4 A;  4LSO A;  5I97 A;  1QAL A;  1FUS A;  3G16 A;  3O8Y A;  4R9L A;  1JBS A;  1TFO A;  2ML5 A;  1B21 A;  2LQV A;  4FMB A;  2ML6 A;  4J5K A;  3J7Y d;  1WMP A;  2OQE C;  1PYL A;  1YJN 3;  4MJD A;  2BT3 A;  4K1U A;  2FNQ A;  1IQ8 A;  2Y74 A;  1LQM B;  1A2K A;  3BNC A;  1CYV A;  4HOH A;  1A67 A;  1DVD A;  3QK9 A;  3I0Y A;  5JPP A;  1N8Q A;  4XBX A;  1R4Y A;  5IG3 A;  3DGM A;  1M9G A;  3EX9 A;  7STD A;  1AV4 A;  2CIU A;  2Z76 A;  1ASK A;  2RSX A;  2P05 A;  3GAX A;  3AHS A;  3MWZ A;  2XGN A;  3B8L A;  1MWS A;  1K41 A;  2CC3 A;  2OCT A;  2BHM A;  4CPK A;  1BU4 A;  3OWY A;  1BNJ A;  2F5W A;  2C11 A;  2KF3 A;  1UUW B;  3PCS A;  1WTH A;  4CCV A;  1HZ1 A;  4XDW A;  3DM8 A;  1M90 4;  2B1X B;  6STD A;  2M7O A;  1BNE A;  3L0R A;  4KFD A;  1I3I A;  4XBT A;  1UW1 A;  3ZG0 A;  3HIG A;  3ALA A;  1BRN L;  4HAA A;  3EBT A;  4DKI A;  2Q07 A;  1ISK A;  1O7G B;  4O02 B;  1IQY A;  1VQ8 3;  2XGL A;  3F8H A;  1EKM A;  4HM8 B;  1GD3 A;  1O7M B;  2C4B A;  2J8X B;  5M18 A;  1JJ2 2;  4R9K A;  1K73 4;  3LTB A;  4HZ9 B;  1OHS A;  4HJL B;  1NWW A;  1T3B A;  3X41 A;  3NV0 A;  4TX4 A;  5JBS A;  2YFJ B;  3GZY B;  3Q3F A;  3ROB A;  3I56 3;  4X2H A;  4CDL A;  1X1U A;  3OWS A;  5IG5 A;  3LTA A;  2OTL 3;  1QAF A;  2KAA A;  2HMN B;  1ZO2 A;  5AEU B;  1TIJ A;  3GZX B;  1YHQ 3;  5BU4 A;  1RLS A;  4I5Q A;  2HMK B;  5D82 A;  1RGA A;  4EV5 A;  5ELU A;  3T0U A;  2RFR A;  3HZP A;  4HM0 B;  5G1K A;  2UGI A;  1JN5 A;  1B20 A;  1I2G A;  1TTO A;  1RNB A;  2BU4 A;  1K28 A;  1WQL B;  3EB8 A;  3JVC A;  1LOV A;  1LRA A;  2R4I A;  2W9P A;  3KZT A;  2W0Q A;  3LH4 A;  3T8N A;  2ZHX B;  1BAO A;  3DUK A;  2XFS A;  3SED A;  3D5G A;  3D3L A;  3GRD A;  3HX8 A;  4FMA A;  1VQQ A;  2CH9 A; 
#chains in the Genus database with same CATH homology
 3MSO A;  1O7P B;  1DMN A;  3MYT A;  5IF6 A;  1OH0 A;  2INX A;  1W4N A;  1JB4 A;  2CWV A;  2E2U A;  2QGU A;  3NHX A;  2W56 B;  1U8C B;  3G0K A;  1QAK A;  3B4O A;  3IMA B;  5CF2 A;  3EN8 A;  2W56 A;  1LOX A;  5IEP A;  1FUW A;  1SJW A;  1D6Y A;  2GBX B;  2WOH A;  3K7C A;  3OX9 A;  3CC7 3;  1M1K 4;  3F40 A;  2OQE A;  1CYU A;  1R4C A;  2WGO A;  2Z6B A;  3SOA A;  3WDG B;  2GXF A;  2CWU A;  3Q90 A;  1A90 A;  3VSY A;  3FG4 A;  4RZM A;  4BTX A;  3FG3 A;  3OWU A;  2W03 A;  4IIA A;  3TDG A;  1U5O A;  1IQX A;  3WOE B;  3FCS B;  2OOV C;  1S72 3;  1N9J A;  3JUN A;  1K8A 4;  4FCZ A;  3Q1C A;  4HZB B;  3CCJ 3;  1SII A;  3A76 A;  3NQZ A;  3GZR A;  5BVB A;  1W6Y A;  1TFK A;  1LXE A;  5D81 A;  1IDP A;  3K63 A;  5CK6 A;  5CF1 A;  1OF5 B;  3KFQ C;  3WA2 X;  3EE1 A;  3JUO A;  3SLU A;  1W01 A;  5EVH A;  3DY5 A;  3LZA A;  4LMI A;  1DMM A;  3HI7 A;  5LC7 A;  4HM2 B;  2P0M A;  3D9R A;  1VQN 3;  3X3Z A;  1AR0 A;  1D6Z A;  2XFT A;  4HM7 B;  4IT7 A;  4L8P A;  3H3H A;  1UI7 A;  2WOF A;  3LYG A;  1JNQ A;  2CFK A;  4GL6 A;  2CFG A;  4KFF A;  2YFI B;  3S29 A;  1DVC A;  1AVK A;  2QEX 3;  3RGR A;  3EF8 A;  2YX9 A;  4MMZ B;  1ULI B;  1SPU A;  3N9H A;  5IG0 A;  1Y4K A;  1NJI 4;  2KRT A;  4XM4 A;  4FCM A;  1D6U A;  2XF3 A;  2Y73 A;  1IU7 A;  3MG3 A;  2IMJ A;  3NBB A;  5LC6 A;  5KP4 A;  1YI2 3;  5G2G A;  3CME 3;  3KSP A;  3PZW A;  4KFE A;  5IW9 A;  2CFD A;  2BNG A;  1YJ9 3;  1HKX A;  1YIT 3;  3CD6 3;  3UL6 A;  1RN7 A;  4KZ1 A;  3V98 A;  1G96 A;  4BTW A;  8CHO A;  2QA4 3;  3FH1 A;  3LT9 A;  2P0X A;  3JUQ A;  5AIF A;  3EHC A;  1OUN A;  3G6E 3;  4PEJ A;  2FGT A;  4N3V A;  1GY5 A;  3V92 A;  3FLJ A;  4MMX B;  1E3V A;  2CWT A;  2HMM B;  5ELJ A;  2K0M A;  3B7C A;  3CPO A;  3X42 A;  1VQL 3;  5AI1 A;  3OW2 2;  1EQK A;  4AKY A;  1STF I;  4EBG A;  3K0Z A;  2LYX A;  2Z77 A;  3UJM A;  5STD A;  1FGR A;  3F7X A;  3G8Z A;  4OK0 A;  4RNY A;  2GEY A;  4U13 A;  1OPY A;  5A0O B;  3MKI A;  3NM7 A;  3GWR A;  1VQK 3;  1L5G B;  4AKZ A;  2OOV A;  1US1 A;  1W6G A;  3V99 A;  1VQ6 3;  1NB5 I;  4R80 A;  1LVN A;  3PCR A;  1VQ4 3;  1PFP A;  2V1L A;  1VQ9 3;  2XH9 A;  4HM4 B;  1FGT A;  3E99 A;  2CFW A;  2F86 B;  3HII A;  1EG9 B;  3FF2 A;  1JV2 B;  1N5H A;  4L7K A;  1UI8 A;  3EBY A;  1VQ7 3;  1NB3 I;  4JF8 A;  3JUM A;  1LNH A;  1W02 A;  2RGQ A;  3NX0 A;  3UL5 A;  1QVG 2;  1O7W B;  4HVN A;  2E2V A;  3X3X A;  2O3O A;  3OV4 A;  1GS3 A;  3UB1 A;  2OTJ 3;  1IVU A;  2F99 A;  3NBJ A;  5BXQ A;  1A2V A;  1WNH A;  1QJG A;  1W5Z A;  4FMD A;  3K5T A;  3EQQ B;  1W00 A;  4RBN A;  2XSH B;  3CU3 A;  2B24 B;  1E3R A;  5EQL A;  3KKG A;  4K90 B;  5IG4 A;  4N6L A;  3CCL 3;  1JKG B;  1STD A;  3MG2 A;  1CEW I;  3CMA 3;  4MMY B;  2CFL A;  1JKG A;  4NHF A;  4R1K A;  1Q86 4;  4WFO A;  2OWP A;  1W6C A;  4FR9 A;  3S28 A;  3NM2 A;  1EA2 A;  1M1X B;  1RRH A;  2ZDJ A;  3U97 A;  2IA7 A;  2PZV A;  2W9Q A;  1J2B A;  4GB5 A;  3IJE B;  1IT8 A;  5FW5 A;  2KCD A;  3G71 3;  3FGY A;  2STD A;  1S5A A;  1Z1S A;  4I4K A;  4EXR A;  3BNB A;  3LXU X;  5CXO A;  1OF5 A;  3N8B A;  4IPB A;  2CG0 A;  4XBY A;  2MF7 A;  4OVM A;  1YIJ 3;  1ZX2 A;  3U1W A;  1OAC A;  1SIH A;  1T5Y A;  2C10 A;  3OXA A;  3S67 A;  3NBR A;  4EYC A;  4ZM8 A;  3DGN A;  4WHA A;  2CG1 A;  3KSE D;  2XR8 B;  1VQO 3;  3LT8 A;  3GZB A;  3MPH A;  1E97 A;  1BUQ A;  3CPW 2;  4N6N B;  3EJV A;  1JRQ A;  3T8U A;  3IPT A;  2P38 A;  3S5C A;  1MNL A;  2P09 A;  4WWU C;  2I9W A;  3N54 B;  4H3U A;  1AVL A;  4ORL A;  3CCM 3;  4XDV A;  2K54 A;  1FGM A;  2FXT A;  4STD A;  1W2Z A;  2MC8 A;  5KP1 A;  3KII A;  3WMD A;  1RKY A;  3LTC A;  3FF0 A;  1GY7 A;  4XB5 A;  3NXJ A;  1HU9 A;  1CQS A;  3WA3 A;  2GU1 A;  2RCD A;  3NQY A;  3LML A;  2Z7A A;  1FA3 A;  5JPU A;  1OGZ A;  3MHE A;  1YJW 3;  4G1M B;  1KWI A;  2UX0 A;  1OHP A;  3PGB A;  4RNZ A;  2D42 A;  4O3V A;  2BMO B;  4EV2 A;  2ZL8 A;  2XSO B;  3CCS 3;  3CCV 3;  4FCJ A;  1KQS 2;  1DYU A;  1FGQ A;  4H61 A;  2XRX B;  2F98 A;  2BMQ B;  1V74 A;  1YVB I;  2BO9 B;  1NO3 A;  5D83 A;  3G4S 3;  1TU5 A;  3X40 A;  4R4K A;  4JRF A;  3RDE A;  5AYS C;  4BTY A;  3CCR 3;  2CK3 H;  4X2O A;  1WMN A;  1OGX A;  1QMA A;  1RJO A;  4K61 A;  1SQW A;  3VGN A;  3F8X A;  3KE7 A;  3SOY A;  3I55 3;  1RRL A;  3DGO A;  1IV7 A;  1GY6 A;  3EC9 A;  1O7H B;  2HMJ B;  3WOD G;  2A15 A;  5AIH A;  1VQ5 3;  1W2B 2;  3LOY A;  3NUV A;  4HM6 B;  2IUK A;  3FSD A;  2BMR B;  5CLK A;  4LZI A;  5IER A;  3CC4 3;  3CCU 3;  3M8C A;  4HKV B;  1C7H A;  2PNC A;  4N6M A;  4N6U A;  5IEN A;  5DRE A;  3CXC 2;  3EN1 B;  1IVX A;  3BNE A;  3NV0 B;  4AEQ A;  5AII A;  3VF1 A;  4N6O B;  5HGR A;  1DMQ A;  1IVW A;  2W04 A;  4O2H A;  4QWT A;  3FKA A;  3BND A;  1VQP 3;  4OUQ A;  1KC8 4;  2SBL A;  3H51 A;  1W7C A;  1ROA A;  3ER7 A;  3ECF A;  2W6J H;  1OCV A;  3BB9 A;  3DGL A;  4O8S A;  3CNX A;  3WOF B;  2YFL B;  3F9S A;  3KN4 A;  5KP3 A;  1PU4 A;  1JN5 B;  1WMO A;  2GU3 A;  3Q2P A;  1Q82 4;  5AIG A;  1IT7 A;  2L4V A;  1NDO B;  1VZZ A;  4N6V 0;  3X3Y A;  2JDI H;  5AEW B;  3LTD A;  1JB5 A;  2KXG A;  1IK3 A;  1ROV A;  3PXM A;  2HML B;  3CNM A;  1IV9 A;  4L8O A;  3SVA A;  2IUJ A;  1Q40 B;  5DRV A;  1JB2 A;  1Q7Y 4;  1Q40 A;  3JUP A;  1N8R 4;  3QRD A;  3FZW A;  1NU3 A;  1O7N B;  1N9E A;  1VQM 3;  3F14 A;  3K9M C;  5TGN A;  1QVF 2;  1TUH A;  2XEP A;  3MG1 A;  3F7S A;  3FG1 A;  4WYK B;  4HM1 B;  3PYJ A;  2CW9 A;  2CHC A;  4HBR A;  4WYK A;  4LGQ A;  2WO0 A;  3B4P A;  3SX1 A;  3DXO A;  2GBW B;  2GEX A;  2WGQ A;  4N6T A;  4WP5 A;  1YGE A;  4LEH A;  1N5P A;  1Q81 4;  2JQ5 A;  1K9M 4;  4NRE A;  3AMO B;  4EC6 A;  3DMC A;  5EEO A;  5AYR B;  1KSI A;  3AMO A;  4J8T A;  3UNL A;  1ULJ B;  4HM3 B;  1OHO A;  3S27 A;  3CCQ 3;  2QIY A;  4FMC A;  1TP6 A;  3STD A;  3CC2 3;  2CKF B;  3PS8 A;  3DZL A;  2HMO B;  1MOL A;  4HM5 B;  2O9U X;  1IVV A;  3CCE 3;  1Q42 A;  4KVH A;  2E2T A;  2D1W A;  5FGO A;  1GYB A;  4MEI A;  4K1V A;  3BLZ A;  5IEO A;  4J9A A;  3SXX A;  4Q53 A;  4HYZ A;  1KD1 4;  3HK4 A;  1FGO A;  3RGA A;  1UUV B;  2W2C A;  1F8N A;  1GD4 A;  4LSO A;  5I97 A;  1QAL A;  3G16 A;  3O8Y A;  4R9L A;  1TFO A;  2ML5 A;  4FMB A;  2LQV A;  3J7Y d;  2ML6 A;  1WMP A;  2OQE C;  1YJN 3;  4MJD A;  2BT3 A;  4K1U A;  2FNQ A;  1IQ8 A;  2Y74 A;  1A2K A;  3BNC A;  1CYV A;  1A67 A;  1DVD A;  3QK9 A;  3I0Y A;  5JPP A;  1N8Q A;  4XBX A;  5IG3 A;  3DGM A;  1M9G A;  3EX9 A;  7STD A;  1AV4 A;  2CIU A;  2Z76 A;  1ASK A;  2RSX A;  2P05 A;  3GAX A;  3MWZ A;  2XGN A;  3B8L A;  1K41 A;  2CC3 A;  2OCT A;  2BHM A;  3OWY A;  2C11 A;  1UUW B;  3PCS A;  1WTH A;  4CCV A;  4XDW A;  3DM8 A;  1M90 4;  2B1X B;  6STD A;  2M7O A;  3L0R A;  4KFD A;  4XBT A;  1UW1 A;  3HIG A;  3ALA A;  3EBT A;  2Q07 A;  1ISK A;  1O7G B;  4O02 B;  1IQY A;  1VQ8 3;  2XGL A;  3F8H A;  1EKM A;  4HM8 B;  1GD3 A;  1O7M B;  1JJ2 2;  4R9K A;  1K73 4;  3LTB A;  4HZ9 B;  1OHS A;  4HJL B;  1NWW A;  3X41 A;  3NV0 A;  4TX4 A;  5JBS A;  2YFJ B;  3GZY B;  3ROB A;  3I56 3;  4X2H A;  4CDL A;  3OWS A;  5IG5 A;  3LTA A;  2OTL 3;  1QAF A;  2HMN B;  1ZO2 A;  5AEU B;  1TIJ A;  3GZX B;  1YHQ 3;  2HMK B;  5D82 A;  4EV5 A;  5ELU A;  3T0U A;  2RFR A;  3HZP A;  4HM0 B;  1JN5 A;  1K28 A;  1WQL B;  3EB8 A;  3JVC A;  2W9P A;  2R4I A;  3KZT A;  3LH4 A;  2W0Q A;  3T8N A;  3DUK A;  2XFS A;  3SED A;  3D3L A;  3GRD A;  3HX8 A;  4FMA A;  2CH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...