3F40A

Crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
MKTQITTRDLVLEFIHALNTENFPAAKKRLNENFTFNGPMGHREGSERYMNDMEKMKFKYVVHKMFEEGNDVCLIYDINMNGKTIAASGLYHLEKGEITSLHVYFDPRPLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized NTF2-like protein
publication title Crystal structure of NTF2-like protein of unknown function (YP_677363.1) from CYTOPHAGA HUTCHINSONII ATCC 33406 at 1.27 A resolution
rcsb
source organism Cytophaga hutchinsonii atcc 33406
total genus 28
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f40A00
2B1XB 3B4PA 1JKGA 1JB5A 4XB5A 1ISKA 2GBWB 3FKAA 3S5CA 4HJLB 2RCDA 4LGQA 1STDA 4WWUC 3DUKA 4L8PA 3SOYA 3SOAA 5AIHA 1UUVB 3OV4A 3I0YA 1E97A 4XDWA 4OVMA 2BMQB 2Z76A 2BMRB 1ULJB 3GRDA 4HM6B 3E99A 3CU3A 3ROBA 1GY5A 3F7XA 3GZBA 2BNGA 1O7WB 2CHCA 2HMKB 3EQQB 2GEXA 5AIIA 2W2CA 2GEYA 5IG5A 2XR8B 2YFJB 3FF2A 4FCMA 3EX9A 2QGUA 5JPUA 4STDA 3M8CA 5IG4A 3MKIA 3DMCA 1DMMA 3B4OA 3EF8A 1Q42A 1O7GB 3JUQA 3G16A 4PEJA 1JKGB 2HMJB 3FSDA 4R9KA 1W6YA 3F9SA 1Z1SA 3LYGA 1OF5A 4X2HA 2F86B 1GYBA 4HM4B 2BMOB 3OXAA 4RZMA 3FZWA 3UJMA 3FF0A 5AEUB 2XSHB 3SEDA 3GZYB 3DZLA 1BUQA 7STDA 1NDOB 3GZXB 1O7NB 2GXFA 4U13A 3EBYA 2F98A 1OHSA 3NBRA 1IDPA 3HZPA 1E3RA 4HM1B 3H3HA 1E3VA 3T8UA 5IF6A 4K1UA 5FW5A 5AI1A 1A2KA 1GY7A 5AEWB 3BB9A 4MJDA 5IENA 5DRVA 1QMAA 1OHOA 2B24B 3NHXA 3ER7A 4L7KA 2Z7AA 5AIFA 2INXA 3HK4A 1DMQA 3IPTA 1NU3A 1HKXA 3OWUA 3D9RA 5KP3A 2I9WA 1SJWA 1O7HB 5CF1A 3F8XA 4XM4A 2RGQA 4HM3B 2HMLB 3KSPA 5STDA 1QJGA 5KP4A 2CKFB 3BLZA 3KZTA 4CDLA 3GZRA 3WMDA 1OF5B 2YFIB 1VZZA 1TP6A 2GBXB 5CLKA 1OH0A 4GB5A 3B7CA 4ORLA 3OWSA 4K1VA 3RGAA 4XBTA 3MSOA 3VSYA 3B8LA 1OGZA 3KKGA 3UNLA 4IIAA 2HMNB 1O7MB 3EN8A 3MG2A 4HM0B 4XBXA 3T8NA 3G0KA 3JUOA 3NM2A 3NV0A 1GY6A 3F14A 5G2GA 4WYKA 1W00A 3KE7A 3NUVA 3JUNA 3FH1A 1DMNA 2QIYA 1K41A 2HMOB 1ZX2A 1ZO2A 1JB2A 8CHOA 3CNMA 2R4IA 5IERA 1C7HA 3A76A 1UUWB 3ECFA 1GS3A 5KP1A 1S5AA 1EG9B 4L8OA 5CXOA 4HKVB 4X2OA 4J9AA 5D81A 5BVBA 1JN5A 2JQ5A 4I4KA 3JUMA 1OUNA 1Q40A 3LZAA 3Q90A 3MG1A 4R9LA 5TGNA 1EA2A 4LMIA 3H51A 4HM8B 5D83A 3CNXA 3G8ZA 3VGNA 5JPPA 1ULIB 3F7SA 3EHCA 4KVHA 5D82A 2OWPA 3EN1B 4HM2B 5DREA 2PZVA 1JB4A 1OPYA 3EC9A 4H3UA 1CQSA 4N3VA 3F40A 4HM7B 3NXJA 5AIGA 5EVHA 3DXOA 4XBYA 3NV0B 1WQLB 3EBTA 3CPOA 3JUPA 4WYKB 3OX9A 4HM5B 3MG3A 1TUHA 2Z77A 5IG0A 5IEOA 3K0ZA 5HGRA 3OWYA 2RFRA 1OGXA 2XRXB 5IEPA 3RGRA 3MYTA 1JN5B 4HZ9B 4OUQA 3F8HA 3K7CA 4R1KA 4Q53A 1Q40B 1O7PB 4XDVA 2UX0A 4HVNA 3DM8A 3EJVA 3GWRA 5BXQA 1ASKA 4WP5A 1W02A 4HZBB 5CF2A 3FLJA 3STDA 2IMJA 3HX8A 6STDA 2HMMB 2A15A 5CK6A 1OHPA 2F99A 1U5OA 2K54A 5IG3A 2XSOB 4J8TA 1AR0A 1OCVA 2YFLB 2STDA 1W01A 3FGYA 4FCJA 1NWWA 3MHEA 4LEHA
chains in the Genus database with same CATH superfamily
4K90B 1ZS7A 3QK9A 1BGSA 2CG1A 1B21A 2B1XB 3B4PA 1JKGA 1X1WA 4BL3A 3X3XA 1JB5A 4XB5A 1T5YA 1BNIA 2ML5A 4O2HA 4FMAA 1ISKA 2GBWB 1N8QA 3D4AA 3NBJA 3Q2PA 1RHLA 4DKIA 1VQP3 1RMSA 3FKAA 3S5CA 1DETA 2H0HA 1VQ83 4HJLB 2D1WA 2RCDA 4LGQA 1BRNL 1RRLA 1STDA 4WWUC 5BIRA 3DUKA 1LNHA 4L8PA 3SOYA 3SOAA 2P0MA 1RGGA 3NM7A 1KWIA 1YI23 1X1XA 5AIHA 1YJW3 4NHFA 1UUVB 1R4CA 1TTOA 3KN4A 3OV4A 3I0YA 3LMLA 1D6ZA 1TRPA 2C4BA 1Q7HA 1PYLA 1E97A 3DGMA 3URPA 1WMPA 4XDWA 1CYVA 1D6YA 3PZWA 2CW9A 2IYJA 4OVMA 2BMQB 1ROVA 2Z76A 1FGQA 1VQQA 2BMRB 1SQWA 4TX4A 1ULJB 2HOHA 3GRDA 1VQ53 1YVSA 3L0RA 4HM6B 1FGMA 2KF4A 3E99A 3CU3A 1LVNA 1RN4A 2C10A 3ROBA 4BIRA 2QA43 3D79A 4MMZB 1TU5A 1GY5A 3F7XA 1J2BA 3CCR3 3GZBA 2WO0A 1TFOA 2BNGA 1O7WB 4KT3B 5AYSC 2CFKA 1UCIA 2CHCA 2XFSA 4RNTA 2HMKB 2WOHA 3EQQB 1RGFA 1W4NA 2GEXA 1QAFA 3S27A 3NQZA 5AIIA 4GHOA 2W2CA 3AGNA 3DGYA 2GEYA 2OCTA 3HOHA 5IG5A 2XR8B 4N6LA 3K9MC 1JZDA 2YFJB 2WGQA 1TIJA 3FF2A 4FCMA 4EC6A 3CCU3 1IVVA 1X1YA 3EX9A 1I0VA 1FGTA 5ELJA 4R4KA 2QGUA 1YJN3 3V98A 1GMQA 5JPUA 2F5WA 4STDA 3M8CA 2XGLA 2OTL3 5IG4A 1BNRA 1V58A 3MKIA 3DMCA 1BSBA 1DMMA 1JZOA 1UI8A 3B4OA 2BO9B 2XFTA 1UI7A 2Q07A 1W2ZA 3HIGA 2W6JH 3LTCA 1GOYA 3EF8A 1RGEA 1Q42A 2XF3A 3D5GA 1IV9A 1O7GB 1Y4KA 3DH2A 2XH9A 3JUQA 4BTYA 3ZG5A 2CFDA 1RCKA 1LOVA 3G16A 4PEJA 5EQLA 1JKGB 3G4S3 2HMJB 4LZIA 2W0QA 1MWRA 2ZL8A 1I2FA 3EE1A 2CC3A 3FSDA 3LTAA 4RNZA 1M1K4 1KC84 3S28A 1MOLA 3KCHA 4R9KA 4BTWA 2MC8A 1W6YA 5EEOA 2KAAA 3F9SA 2Y73A 1UUGB 1Z1SA 2CWVA 2LQVA 3LYGA 2L1SA 1F8NA 1OF5A 4X2HA 2F86B 1GYBA 3ZFZA 4HM4B 3G713 1QAKA 3SXXA 5FGOA 2BMOB 1BSAA 1UCKA 1W5ZA 3BU4A 2P38A 3DGNA 3FZWA 3OXAA 4RZMA 2OQEA 3UJMA 1W6GA 1RJOA 2J8XB 3FF0A 5AEUB 2XSHB 3O8YA 3IMAB 4NPBA 1Q864 3SEDA 3GZYB 3DZLA 1BUQA 7STDA 1NDOB 3RNTA 1MGWA 2F56A 1VQ93 3GZXB 5LC6A 1CYUA 1O7NB 2GXFA 1HZ1A 4U13A 1IQ8A 3EBYA 4H61A 2F98A 2YX9A 1OHSA 1VQN3 4BTXA 1RN7A 3NBRA 1BVIA 1IDPA 4LSOA 1N5HA 3HZPA 1NNVA 1T2HA 1W2B2 1E3RA 4HM1B 3H3HA 1E3VA 3T8UA 5IF6A 4K1UA 2W9QA 1RGLA 5FW5A 3DY5A 5AI1A 5G1KA 4MEIA 1VQ63 1A2KA 1DE3A 1GY7A 1KSIA 5AYRB 4NREA 1RGHA 4EBGA 3OW22 5AEWB 3X3ZA 2E2UA 4N6V0 5IW9A 1JJ22 4FR9A 4WFOA 1BUJA 2K3DA 1IVUA 2BIRA 3BB9A 5JBSA 4HAAA 4MJDA 1UDII 4K61A 4EV5A 5IENA 1QVG2 4IT7A 5DRVA 3UB1A 1QMAA 1OHOA 1LQGC 2B24B 4FMCA 3NHXA 1AY7A 3CCV3 3N8BA 3AGOA 4EYCA 1M904 4FCZA 3ER7A 4L7KA 3FG3A 3CPW2 4N6OB 3FG4A 1SIIA 1IYYA 1A2VA 2BHMA 2Z7AA 5AIFA 2INXA 3N9HA 3HK4A 5M19A 1LOWA 1YGWA 1G02A 1A90A 3ZG0A 1DMQA 3IPTA 1BANA 1NU3A 1T3BA 2SBLA 1HKXA 1MWSA 3D9RA 3OWUA 5KP3A 1K28A 3I563 1FA3A 1FZUA 1K8A4 2UUGC 2WGOA 1RDSA 1RKYA 2I9WA 1GSPA 1SJWA 1O7HB 5CF1A 3F8XA 3HIIA 1FUSA 4XM4A 3G6E3 4HYZA 1M9GA 2RGQA 1YIT3 4HM3B 1GD3A 2D42A 1B2ZA 1VQ43 1S723 2HMLB 2CFLA 1BRKA 3KSPA 5STDA 1N8R4 1DVCA 1QJGA 5KP4A 4IPBA 3CC73 2ZA4A 2CKFB 2O3OA 3BLZA 3KZTA 1I3FA 2IA7A 3KFQC 1FUTA 4CDLA 3GZRA 3CCS3 3WMDA 1OF5B 4HBRA 1RNBA 3BNEA 3PS8A 3PYJA 2FGTA 1B2UA 1TP6A 1G96A 1VZZA 2YFIB 2GBXB 5CLKA 1OH0A 1BNEA 1RLSA 5M18A 2XGNA 1YNVX 3CD63 1GMRA 1I2GA 4GB5A 2ZHXB 1VQO3 2RSXA 5LC7A 1RGCA 4EV2A 3B7CA 3RDEA 8RNTA 4ORLA 4J5GA 1X1UA 1IK3A 1MWUA 3OWSA 4K1VA 2XEPA 1IQYA 4RNYA 1IU7A 3LTDA 2E2TA 2F5MA 2OQEC 2W56A 4KFEA 3RGAA 2W03A 3CCJ3 3QRDA 3PXMA 1BRGA 3K63A 4XBTA 3MSOA 3VSYA 3BIRA 2GU1A 5G1LA 6GSPA 4WHAA 1YIJ3 2ZDJA 4QWTA 1V57A 3AHWA 3B8LA 4BL2A 1K734 1UCLA 2CIUA 1OGZA 4EXRA 3T0UA 2GU3A 3KKGA 4IIAA 3UNLA 1CH0A 3LOYA 1W6CA 1EQKA 2GSPA 1I2EA 2HMNB 1O7MB 4GSPA 1JBSA 3V99A 4KFDA 2AAEA 3EN8A 3MG2A 4HM0B 4AKZA 4CCVA 3U97A 4EW5A 1FYSA 2OTJ3 5I97A 3CME3 1YGEA 4N6NB 1LNIA 2CWTA 3TDGA 4XBXA 3CCQ3 1LRAA 1PY3A 3A5EA 3G0KA 3JUOA 3NM2A 3NQYA 3T8NA 3AMOA 1BOXA 3NV0A 1OACA 1UCJA 3WHOA 1LOYA 1GY6A 3F14A 4BU4A 1C54A 2RBIA 5G2GA 1M1XB 2FXTA 3X41A 1RCLA 2WOFA 3LTBA 2MF7A 4WYKA 2KRTA 1W00A 3KE7A 3KIIA 1B3SA 3NUVA 1L5GB 3JUNA 3I553 3FH1A 1DMNA 2QIYA 1K41A 2HMOB 2UGIA 1AQZA 1ZX2A 1ZO2A 1JB2A 8CHOA 3CNMA 1PU4A 2R4IA 4KZ1A 3EB8A 2OOVA 5IERA 2V1LA 5A0OB 1C7HA 2RNTA 1W7CA 1BAOA 1US1A 3A76A 1UUWB 1VQL3 1VQ73 1JNQA 3ECFA 1GS3A 3CXC2 5KP1A 3Q3FA 1BIRA 3U1WA 1S5AA 1WMOA 2C11A 5GSPA 1GOVA 1EG9B 3SX1A 1GMPA 2AADA 4L8OA 5CXOA 3X42A 9RNTA 1B2MA 3D5IA 2CH9A 4HKVB 1JBTA 4X2OA 4J9AA 3JVCA 4O02B 1NB5I 5D81A 5BVBA 1JN5A 1IT7A 1WMNA 3NX0A 2JQ5A 3MPHA 2F4YA 1FGRA 1YVBI 1ZGXA 4LYLB 4I4KA 1DVDA 1GD4A 7GSPA 3SYUA 3JUMA 1OUNA 1Q40A 1DYUA 1K9M4 1BSEA 3LZAA 3Q90A 3PCSA 5ELUA 3MG1A 3CCM3 1N9JA 4JF8A 1BSCA 2L4VA 1BRIA 4R9LA 1SARA 5TGNA 5RNTA 2JDIH 3GAXA 3LXUX 4FMBA 1NJI4 1B27A 1EA2A 4LMIA 4AKYA 1JBRA 1BSDA 2LYXA 3H51A 4HM8B 3AHSA 5D83A 1IVXA 3CNXA 3G8ZA 3WA3A 1VQM3 2CK3H 4N6MA 3VGNA 5JPPA 1TFKA 4MMXB 1EKMA 1BRSA 1ULIB 2W56B 3F7SA 3CCE3 3EHCA 3SLUA 2KF5A 1FUWA 4G1MB 1IQXA 4KVHA 1AVKA 2ML6A 1RN1A 1MWTA 3MWZA 5D82A 3X40A 1N5PA 2OWPA 4KFFA 1N9EA 3EN1B 2Z6BA 2CG0A 4HM2B 5DREA 1V74A 4MMYB 2PZVA 3KSED 1MNLA 1JB4A 1RRHA 1OPYA 3GSPA 3N54B 2Y74A 3EC9A 3S29A 2P05A 3VF1A 1I8VA 2CFGA 4ZM8A 4H3UA 1SIHA 2BT3A 1STFI 3Q1CA 1CQSA 1SPUA 4N3VA 3F40A 3K5TA 1RNTA 4HM7B 3NXJA 5AIGA 2E2VA 5EVHA 2H0GA 4CJNA 1LXEA 3DXOA 4XBYA 1G0TA 3AMOB 3NV0B 1RGKA 1WQLB 3EBTA 1BNSA 1KQS2 1RSNA 3DGOA 3CPOA 3X3YA 4FMDA 4N6UA 3JUPA 1NO3A 1IVWA 3NBBA 1CEWI 4WYKB 3HI7A 4OK0A 1QVF2 3OX9A 3S67A 1BNFA 4HM5B 3MG3A 1TJDA 1TUHA 2Z77A 2IY2A 5M1AA 3FG1A 3LT9A 1AV4A 1I70A 5IG0A 5IEOA 2QEX3 3PCRA 3LT8A 1EEJA 2PNCA 1UGIA 3K0ZA 4HOHA 1A2PA 1BNJA 4O8SA 1A67A 2KXGA 2P0XA 2R41A 5HGRA 3OWYA 4O3VA 2RFRA 2P09A 4N6TA 1OGXA 1IV7A 2M7OA 2IUJA 2XRXB 1EUIC 5IEPA 2H0IA 2KF6A 2OOVC 3RGRA 3MYTA 1JN5B 4HZ9B 4OUQA 3WR2A 3J7Yd 1B2SA 4ILFA 3F8HA 3K7CA 4R1KA 2W9PA 7RNTA 1BNGA 4Q53A 4CPKA 3PGBA 1IT8A 1Q40B 2W04A 1O7PB 2CFWA 1BRJA 1B2XA 4I5QA 1QALA 4XDVA 1Q7Y4 1HU9A 3IJEB 2UX0A 4HVNA 3DM8A 1Q814 1GOUA 3CMA3 3DGLA 3EJVA 3GWRA 3SVAA 1WNHA 5BXQA 5HOHA 1ASKA 3FCSB 4RBNA 1ROAA 1R4YA 4WP5A 4AEQA 1BU4A 1W02A 3UL5A 1D6UA 1RTUA 4HZBB 5CF2A 3FLJA 1I0XA 1LOXA 3ALAA 3STDA 1U8CB 1NB3I 3BNCA 1T2IA 1PFPA 1I3IA 1HYFA 2IMJA 1MGRA 3HX8A 1UW1A 3WOFB 1TRQA 4R80A 6STDA 1Q824 1B20A 2HMMB 2A15A 5CK6A 1OHPA 1FGOA 2KCDA 2KF3A 4GL6A 3WOEB 4J5KA 2SARA 2F99A 1U5OA 2K54A 5IG3A 3CCL3 1FW7A 2O9UX 2CWUA 6RNTA 1KD14 2CX0A 2FNQA 1JV2B 2BU4A 2XSOB 3BNBA 4J8TA 1JRQA 3D3LA 1UGHI 1Q9EA 1YJ93 1WTHA 2CX1A 2K0MA 3CC23 1AR0A 1OCVA 1RGAA 2STDA 2YFLB 3LH4A 1W01A 3FGYA 5BU4A 1BRHA 4FCJA 3WDGB 1NWWA 3MHEA 4JRFA 1VQK3 2IUKA 1AVLA 3BNDA 3WA2X 1LQMB 1YHQ3 3CC43 4LEHA 3WODG 3UL6A 3V92A
chains in the Genus database with same CATH topology
4K90B 3QK9A 2CG1A 2B1XB 3B4PA 1JKGA 3X3XA 1JB5A 4XB5A 1T5YA 2ML5A 4O2HA 4FMAA 1ISKA 2GBWB 1N8QA 3NBJA 3Q2PA 1VQP3 3FKAA 3S5CA 1VQ83 4HJLB 2D1WA 2RCDA 4LGQA 1RRLA 1STDA 4WWUC 3DUKA 1LNHA 4L8PA 3SOYA 3SOAA 2P0MA 3NM7A 1KWIA 1YI23 5AIHA 1YJW3 4NHFA 1UUVB 1R4CA 3OV4A 3KN4A 3I0YA 3LMLA 1D6ZA 1E97A 3DGMA 1WMPA 4XDWA 1CYVA 1D6YA 3PZWA 2CW9A 4OVMA 2BMQB 1ROVA 2Z76A 1FGQA 2BMRB 1SQWA 4TX4A 1ULJB 3GRDA 1VQ53 4HM6B 3L0RA 1FGMA 3E99A 3CU3A 1LVNA 3ROBA 2C10A 2QA43 4MMZB 1TU5A 1GY5A 3F7XA 1J2BA 3CCR3 3GZBA 2WO0A 1TFOA 2BNGA 1O7WB 5AYSC 2CFKA 2CHCA 2XFSA 2HMKB 2WOHA 3EQQB 2GEXA 1W4NA 1QAFA 3S27A 3NQZA 5AIIA 2W2CA 2GEYA 2OCTA 5IG5A 2XR8B 4N6LA 3K9MC 2YFJB 3CCU3 2WGQA 1TIJA 3FF2A 4FCMA 4EC6A 1IVVA 3EX9A 1FGTA 5ELJA 4R4KA 2QGUA 1YJN3 3V98A 5JPUA 4STDA 3M8CA 2XGLA 2OTL3 5IG4A 3MKIA 3DMCA 1DMMA 1UI8A 3B4OA 2BO9B 2XFTA 1UI7A 2Q07A 1W2ZA 3HIGA 2W6JH 3LTCA 3EF8A 1Q42A 2XF3A 1IV9A 1O7GB 1Y4KA 2XH9A 3JUQA 4BTYA 2CFDA 3G16A 4PEJA 5EQLA 1JKGB 3G4S3 2HMJB 4LZIA 2W0QA 2ZL8A 3EE1A 2CC3A 3FSDA 3LTAA 4RNZA 1M1K4 1KC84 3S28A 1MOLA 4R9KA 4BTWA 2MC8A 1W6YA 5EEOA 3F9SA 2Y73A 1Z1SA 2CWVA 2LQVA 3LYGA 1F8NA 1OF5A 4X2HA 2F86B 1GYBA 4HM4B 3G713 1QAKA 3SXXA 5FGOA 2BMOB 3OXAA 1W5ZA 3FZWA 2P38A 3DGNA 4RZMA 2OQEA 3UJMA 1W6GA 1RJOA 3FF0A 5AEUB 2XSHB 3O8YA 3IMAB 1Q864 3SEDA 3GZYB 3DZLA 1BUQA 7STDA 1NDOB 1VQ93 1CYUA 3GZXB 5LC6A 1O7NB 2GXFA 4U13A 1IQ8A 3EBYA 4H61A 2F98A 2YX9A 1OHSA 1VQN3 4BTXA 1RN7A 3NBRA 1IDPA 4LSOA 1N5HA 3HZPA 1W2B2 1E3RA 4HM1B 3H3HA 1E3VA 3T8UA 5IF6A 4K1UA 2W9QA 5FW5A 3DY5A 5AI1A 4MEIA 1VQ63 1A2KA 1GY7A 1KSIA 5AYRB 4NREA 4EBGA 3OW22 5AEWB 3X3ZA 2E2UA 4N6V0 5IW9A 1JJ22 4FR9A 4WFOA 1IVUA 3BB9A 5JBSA 4MJDA 4K61A 4EV5A 5IENA 1QVG2 4IT7A 5DRVA 3UB1A 1QMAA 1OHOA 2B24B 4FMCA 3NHXA 3CCV3 3N8BA 4EYCA 1M904 4FCZA 3ER7A 4L7KA 3FG3A 3CPW2 4N6OB 3FG4A 1SIIA 1A2VA 2BHMA 2Z7AA 5AIFA 2INXA 3N9HA 3HK4A 1A90A 1DMQA 3IPTA 1NU3A 3I563 2SBLA 1HKXA 3OWUA 3D9RA 5KP3A 1FA3A 1K28A 1K8A4 2WGOA 1RKYA 2I9WA 1SJWA 1O7HB 5CF1A 3F8XA 3HIIA 4XM4A 3G6E3 4HYZA 1M9GA 2RGQA 1YIT3 4HM3B 1GD3A 2D42A 1VQ43 1S723 2HMLB 2CFLA 3KSPA 5STDA 1N8R4 1DVCA 1QJGA 5KP4A 4IPBA 3CC73 2CKFB 2O3OA 3BLZA 3KZTA 2IA7A 3KFQC 4CDLA 3GZRA 3CCS3 3WMDA 1OF5B 4HBRA 3BNEA 3PS8A 3PYJA 2YFIB 1VZZA 1TP6A 1G96A 2FGTA 2GBXB 5CLKA 1OH0A 2XGNA 3CD63 4GB5A 1VQO3 2RSXA 5LC7A 4EV2A 3B7CA 3RDEA 4ORLA 1IK3A 3OWSA 4K1VA 2XEPA 1IQYA 4RNYA 1IU7A 3LTDA 2E2TA 2OQEC 2W56A 4KFEA 3RGAA 2W03A 3CCJ3 3QRDA 3PXMA 3K63A 4XBTA 3MSOA 3VSYA 2GU1A 4WHAA 1YIJ3 2ZDJA 4QWTA 3B8LA 1K734 2CIUA 1OGZA 4EXRA 3T0UA 2GU3A 3KKGA 4IIAA 3UNLA 3LOYA 1W6CA 1EQKA 2HMNB 1O7MB 3V99A 4KFDA 3EN8A 3MG2A 4CCVA 4HM0B 4AKZA 3U97A 2OTJ3 5I97A 3CME3 1YGEA 4N6NB 2CWTA 3TDGA 4XBXA 3CCQ3 3T8NA 3G0KA 3JUOA 3NM2A 3NQYA 3AMOA 3NV0A 1OACA 1GY6A 3F14A 5G2GA 1M1XB 2FXTA 3X41A 2WOFA 3LTBA 4WYKA 2MF7A 2KRTA 1W00A 3KE7A 3KIIA 3NUVA 1L5GB 3JUNA 3I553 3FH1A 1DMNA 2QIYA 1K41A 2HMOB 1ZX2A 1ZO2A 1JB2A 8CHOA 3CNMA 1PU4A 2R4IA 4KZ1A 3EB8A 2OOVA 5IERA 2V1LA 5A0OB 1C7HA 1W7CA 1US1A 3A76A 1UUWB 1VQL3 1VQ73 1JNQA 3ECFA 1GS3A 3CXC2 5KP1A 3U1WA 1S5AA 1WMOA 2C11A 1EG9B 3SX1A 4L8OA 3X42A 5CXOA 2CH9A 4HKVB 4X2OA 4J9AA 3JVCA 4O02B 1NB5I 5D81A 5BVBA 1JN5A 1IT7A 1WMNA 3NX0A 2JQ5A 3MPHA 1FGRA 1YVBI 4I4KA 1DVDA 1GD4A 3JUMA 1OUNA 1Q40A 1DYUA 1K9M4 3LZAA 3Q90A 3PCSA 5ELUA 3MG1A 3CCM3 1N9JA 4JF8A 2L4VA 4R9LA 5TGNA 2JDIH 3GAXA 3LXUX 4FMBA 1NJI4 1EA2A 4LMIA 4AKYA 2LYXA 3H51A 4HM8B 5D83A 1IVXA 3CNXA 3G8ZA 3WA3A 1VQM3 2CK3H 4N6MA 3VGNA 5JPPA 1TFKA 4MMXB 1EKMA 1ULIB 2W56B 3F7SA 3CCE3 3EHCA 3SLUA 1FUWA 4G1MB 1IQXA 4KVHA 1AVKA 2ML6A 5D82A 3MWZA 3X40A 1N5PA 2OWPA 4KFFA 1N9EA 3EN1B 2Z6BA 2CG0A 4HM2B 5DREA 1V74A 4MMYB 2PZVA 3KSED 1JB4A 1MNLA 1RRHA 1OPYA 3N54B 2Y74A 3EC9A 3S29A 2P05A 3VF1A 4ZM8A 2CFGA 4H3UA 1SIHA 2BT3A 1STFI 3Q1CA 1CQSA 1SPUA 4N3VA 3F40A 3K5TA 4HM7B 3NXJA 5AIGA 2E2VA 5EVHA 1LXEA 3DXOA 4XBYA 3AMOB 3NV0B 1WQLB 3EBTA 1KQS2 3DGOA 3CPOA 3X3YA 4FMDA 4N6UA 3JUPA 1NO3A 1IVWA 3NBBA 1CEWI 4WYKB 3HI7A 4OK0A 1QVF2 3OX9A 3S67A 4HM5B 3MG3A 1TUHA 2Z77A 3FG1A 3LT9A 1AV4A 5IG0A 5IEOA 2QEX3 3PCRA 3LT8A 2PNCA 3K0ZA 4O8SA 1A67A 2KXGA 2P0XA 5HGRA 3OWYA 4O3VA 2RFRA 2P09A 4N6TA 1OGXA 1IV7A 2M7OA 2IUJA 2XRXB 5IEPA 2OOVC 3RGRA 3MYTA 1JN5B 4HZ9B 4OUQA 3J7Yd 3F8HA 3K7CA 4R1KA 2W9PA 4Q53A 3PGBA 1IT8A 1Q40B 2W04A 1O7PB 2CFWA 4XDVA 1Q7Y4 1QALA 3CMA3 1HU9A 3IJEB 2UX0A 4HVNA 3DM8A 1Q814 3DGLA 3EJVA 3GWRA 3SVAA 1WNHA 5BXQA 1ASKA 3FCSB 4RBNA 1ROAA 4WP5A 4AEQA 1W02A 3UL5A 1D6UA 4HZBB 5CF2A 3FLJA 1LOXA 3ALAA 3STDA 1U8CB 1NB3I 3BNCA 1PFPA 2IMJA 3HX8A 1UW1A 3WOFB 4R80A 6STDA 1Q824 2HMMB 2A15A 5CK6A 1OHPA 1FGOA 2KCDA 4GL6A 3WOEB 2F99A 1U5OA 2K54A 5IG3A 3CCL3 2O9UX 2CWUA 1KD14 2FNQA 1JV2B 2XSOB 3BNBA 4J8TA 1JRQA 3D3LA 1YJ93 1WTHA 2K0MA 3CC23 1AR0A 2YFLB 1OCVA 2STDA 3LH4A 1W01A 3FGYA 4FCJA 3WDGB 1NWWA 3MHEA 4JRFA 1VQK3 2IUKA 1AVLA 3BNDA 3WA2X 1YHQ3 3CC43 4LEHA 3WODG 3UL6A 3V92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1X B;  3B4P A;  1JKG A;  1JB5 A;  4XB5 A;  1ISK A;  2GBW B;  3FKA A;  3S5C A;  4HJL B;  2RCD A;  4LGQ A;  1STD A;  4WWU C;  3DUK A;  4L8P A;  3SOY A;  3SOA A;  5AIH A;  1UUV B;  3OV4 A;  3I0Y A;  1E97 A;  4XDW A;  4OVM A;  2BMQ B;  2Z76 A;  2BMR B;  1ULJ B;  3GRD A;  4HM6 B;  3E99 A;  3CU3 A;  3ROB A;  1GY5 A;  3F7X A;  3GZB A;  2BNG A;  1O7W B;  2CHC A;  2HMK B;  3EQQ B;  2GEX A;  5AII A;  2W2C A;  2GEY A;  5IG5 A;  2XR8 B;  2YFJ B;  3FF2 A;  4FCM A;  3EX9 A;  2QGU A;  5JPU A;  4STD A;  3M8C A;  5IG4 A;  3MKI A;  3DMC A;  1DMM A;  3B4O A;  3EF8 A;  1Q42 A;  1O7G B;  3JUQ A;  3G16 A;  4PEJ A;  1JKG B;  2HMJ B;  3FSD A;  4R9K A;  1W6Y A;  3F9S A;  1Z1S A;  3LYG A;  1OF5 A;  4X2H A;  2F86 B;  1GYB A;  4HM4 B;  2BMO B;  3OXA A;  4RZM A;  3FZW A;  3UJM A;  3FF0 A;  5AEU B;  2XSH B;  3SED A;  3GZY B;  3DZL A;  1BUQ A;  7STD A;  1NDO B;  3GZX B;  1O7N B;  2GXF A;  4U13 A;  3EBY A;  2F98 A;  1OHS A;  3NBR A;  1IDP A;  3HZP A;  1E3R A;  4HM1 B;  3H3H A;  1E3V A;  3T8U A;  5IF6 A;  4K1U A;  5FW5 A;  5AI1 A;  1A2K A;  1GY7 A;  5AEW B;  3BB9 A;  4MJD A;  5IEN A;  5DRV A;  1QMA A;  1OHO A;  2B24 B;  3NHX A;  3ER7 A;  4L7K A;  2Z7A A;  5AIF A;  2INX A;  3HK4 A;  1DMQ A;  3IPT A;  1NU3 A;  1HKX A;  3OWU A;  3D9R A;  5KP3 A;  2I9W A;  1SJW A;  1O7H B;  5CF1 A;  3F8X A;  4XM4 A;  2RGQ A;  4HM3 B;  2HML B;  3KSP A;  5STD A;  1QJG A;  5KP4 A;  2CKF B;  3BLZ A;  3KZT A;  4CDL A;  3GZR A;  3WMD A;  1OF5 B;  2YFI B;  1VZZ A;  1TP6 A;  2GBX B;  5CLK A;  1OH0 A;  4GB5 A;  3B7C A;  4ORL A;  3OWS A;  4K1V A;  3RGA A;  4XBT A;  3MSO A;  3VSY A;  3B8L A;  1OGZ A;  3KKG A;  3UNL A;  4IIA A;  2HMN B;  1O7M B;  3EN8 A;  3MG2 A;  4HM0 B;  4XBX A;  3T8N A;  3G0K A;  3JUO A;  3NM2 A;  3NV0 A;  1GY6 A;  3F14 A;  5G2G A;  4WYK A;  1W00 A;  3KE7 A;  3NUV A;  3JUN A;  3FH1 A;  1DMN A;  2QIY A;  1K41 A;  2HMO B;  1ZX2 A;  1ZO2 A;  1JB2 A;  8CHO A;  3CNM A;  2R4I A;  5IER A;  1C7H A;  3A76 A;  1UUW B;  3ECF A;  1GS3 A;  5KP1 A;  1S5A A;  1EG9 B;  4L8O A;  5CXO A;  4HKV B;  4X2O A;  4J9A A;  5D81 A;  5BVB A;  1JN5 A;  2JQ5 A;  4I4K A;  3JUM A;  1OUN A;  1Q40 A;  3LZA A;  3Q90 A;  3MG1 A;  4R9L A;  5TGN A;  1EA2 A;  4LMI A;  3H51 A;  4HM8 B;  5D83 A;  3CNX A;  3G8Z A;  3VGN A;  5JPP A;  1ULI B;  3F7S A;  3EHC A;  4KVH A;  5D82 A;  2OWP A;  3EN1 B;  4HM2 B;  5DRE A;  2PZV A;  1JB4 A;  1OPY A;  3EC9 A;  4H3U A;  1CQS A;  4N3V A;  3F40 A;  4HM7 B;  3NXJ A;  5AIG A;  5EVH A;  3DXO A;  4XBY A;  3NV0 B;  1WQL B;  3EBT A;  3CPO A;  3JUP A;  4WYK B;  3OX9 A;  4HM5 B;  3MG3 A;  1TUH A;  2Z77 A;  5IG0 A;  5IEO A;  3K0Z A;  5HGR A;  3OWY A;  2RFR A;  1OGX A;  2XRX B;  5IEP A;  3RGR A;  3MYT A;  1JN5 B;  4HZ9 B;  4OUQ A;  3F8H A;  3K7C A;  4R1K A;  4Q53 A;  1Q40 B;  1O7P B;  4XDV A;  2UX0 A;  4HVN A;  3DM8 A;  3EJV A;  3GWR A;  5BXQ A;  1ASK A;  4WP5 A;  1W02 A;  4HZB B;  5CF2 A;  3FLJ A;  3STD A;  2IMJ A;  3HX8 A;  6STD A;  2HMM B;  2A15 A;  5CK6 A;  1OHP A;  2F99 A;  1U5O A;  2K54 A;  5IG3 A;  2XSO B;  4J8T A;  1AR0 A;  1OCV A;  2YFL B;  2STD A;  1W01 A;  3FGY A;  4FCJ A;  1NWW A;  3MHE A;  4LEH A; 
#chains in the Genus database with same CATH topology
 4K90 B;  1ZS7 A;  3QK9 A;  1BGS A;  2CG1 A;  1B21 A;  2B1X B;  3B4P A;  1JKG A;  1X1W A;  4BL3 A;  3X3X A;  1JB5 A;  4XB5 A;  1T5Y A;  1BNI A;  2ML5 A;  4O2H A;  4FMA A;  1ISK A;  2GBW B;  1N8Q A;  3D4A A;  3NBJ A;  3Q2P A;  1RHL A;  4DKI A;  1VQP 3;  1RMS A;  3FKA A;  3S5C A;  1DET A;  2H0H A;  1VQ8 3;  4HJL B;  2D1W A;  2RCD A;  4LGQ A;  1BRN L;  1RRL A;  1STD A;  4WWU C;  5BIR A;  3DUK A;  1LNH A;  4L8P A;  3SOY A;  3SOA A;  2P0M A;  1RGG A;  3NM7 A;  1KWI A;  1YI2 3;  1X1X A;  5AIH A;  1YJW 3;  4NHF A;  1UUV B;  1R4C A;  1TTO A;  3KN4 A;  3OV4 A;  3I0Y A;  3LML A;  1D6Z A;  1TRP A;  2C4B A;  1Q7H A;  1PYL A;  1E97 A;  3DGM A;  3URP A;  1WMP A;  4XDW A;  1CYV A;  1D6Y A;  3PZW A;  2CW9 A;  2IYJ A;  4OVM A;  2BMQ B;  1ROV A;  2Z76 A;  1FGQ A;  1VQQ A;  2BMR B;  1SQW A;  4TX4 A;  1ULJ B;  2HOH A;  3GRD A;  1VQ5 3;  1YVS A;  3L0R A;  4HM6 B;  1FGM A;  2KF4 A;  3E99 A;  3CU3 A;  1LVN A;  1RN4 A;  2C10 A;  3ROB A;  4BIR A;  2QA4 3;  3D79 A;  4MMZ B;  1TU5 A;  1GY5 A;  3F7X A;  1J2B A;  3CCR 3;  3GZB A;  2WO0 A;  1TFO A;  2BNG A;  1O7W B;  4KT3 B;  5AYS C;  2CFK A;  1UCI A;  2CHC A;  2XFS A;  4RNT A;  2HMK B;  2WOH A;  3EQQ B;  1RGF A;  1W4N A;  2GEX A;  1QAF A;  3S27 A;  3NQZ A;  5AII A;  4GHO A;  2W2C A;  3AGN A;  3DGY A;  2GEY A;  2OCT A;  3HOH A;  5IG5 A;  2XR8 B;  4N6L A;  3K9M C;  1JZD A;  2YFJ B;  2WGQ A;  1TIJ A;  3FF2 A;  4FCM A;  4EC6 A;  3CCU 3;  1IVV A;  1X1Y A;  3EX9 A;  1I0V A;  1FGT A;  5ELJ A;  4R4K A;  2QGU A;  1YJN 3;  3V98 A;  1GMQ A;  5JPU A;  2F5W A;  4STD A;  3M8C A;  2XGL A;  2OTL 3;  5IG4 A;  1BNR A;  1V58 A;  3MKI A;  3DMC A;  1BSB A;  1DMM A;  1JZO A;  1UI8 A;  3B4O A;  2BO9 B;  2XFT A;  1UI7 A;  2Q07 A;  1W2Z A;  3HIG A;  2W6J H;  3LTC A;  1GOY A;  3EF8 A;  1RGE A;  1Q42 A;  2XF3 A;  3D5G A;  1IV9 A;  1O7G B;  1Y4K A;  3DH2 A;  2XH9 A;  3JUQ A;  4BTY A;  3ZG5 A;  2CFD A;  1RCK A;  1LOV A;  3G16 A;  4PEJ A;  5EQL A;  1JKG B;  3G4S 3;  2HMJ B;  4LZI A;  2W0Q A;  1MWR A;  2ZL8 A;  1I2F A;  3EE1 A;  2CC3 A;  3FSD A;  3LTA A;  4RNZ A;  1M1K 4;  1KC8 4;  3S28 A;  1MOL A;  3KCH A;  4R9K A;  4BTW A;  2MC8 A;  1W6Y A;  5EEO A;  2KAA A;  3F9S A;  2Y73 A;  1UUG B;  1Z1S A;  2CWV A;  2LQV A;  3LYG A;  2L1S A;  1F8N A;  1OF5 A;  4X2H A;  2F86 B;  1GYB A;  3ZFZ A;  4HM4 B;  3G71 3;  1QAK A;  3SXX A;  5FGO A;  2BMO B;  1BSA A;  1UCK A;  1W5Z A;  3BU4 A;  2P38 A;  3DGN A;  3FZW A;  3OXA A;  4RZM A;  2OQE A;  3UJM A;  1W6G A;  1RJO A;  2J8X B;  3FF0 A;  5AEU B;  2XSH B;  3O8Y A;  3IMA B;  4NPB A;  1Q86 4;  3SED A;  3GZY B;  3DZL A;  1BUQ A;  7STD A;  1NDO B;  3RNT A;  1MGW A;  2F56 A;  1VQ9 3;  3GZX B;  5LC6 A;  1CYU A;  1O7N B;  2GXF A;  1HZ1 A;  4U13 A;  1IQ8 A;  3EBY A;  4H61 A;  2F98 A;  2YX9 A;  1OHS A;  1VQN 3;  4BTX A;  1RN7 A;  3NBR A;  1BVI A;  1IDP A;  4LSO A;  1N5H A;  3HZP A;  1NNV A;  1T2H A;  1W2B 2;  1E3R A;  4HM1 B;  3H3H A;  1E3V A;  3T8U A;  5IF6 A;  4K1U A;  2W9Q A;  1RGL A;  5FW5 A;  3DY5 A;  5AI1 A;  5G1K A;  4MEI A;  1VQ6 3;  1A2K A;  1DE3 A;  1GY7 A;  1KSI A;  5AYR B;  4NRE A;  1RGH A;  4EBG A;  3OW2 2;  5AEW B;  3X3Z A;  2E2U A;  4N6V 0;  5IW9 A;  1JJ2 2;  4FR9 A;  4WFO A;  1BUJ A;  2K3D A;  1IVU A;  2BIR A;  3BB9 A;  5JBS A;  4HAA A;  4MJD A;  1UDI I;  4K61 A;  4EV5 A;  5IEN A;  1QVG 2;  4IT7 A;  5DRV A;  3UB1 A;  1QMA A;  1OHO A;  1LQG C;  2B24 B;  4FMC A;  3NHX A;  1AY7 A;  3CCV 3;  3N8B A;  3AGO A;  4EYC A;  1M90 4;  4FCZ A;  3ER7 A;  4L7K A;  3FG3 A;  3CPW 2;  4N6O B;  3FG4 A;  1SII A;  1IYY A;  1A2V A;  2BHM A;  2Z7A A;  5AIF A;  2INX A;  3N9H A;  3HK4 A;  5M19 A;  1LOW A;  1YGW A;  1G02 A;  1A90 A;  3ZG0 A;  1DMQ A;  3IPT A;  1BAN A;  1NU3 A;  1T3B A;  2SBL A;  1HKX A;  1MWS A;  3D9R A;  3OWU A;  5KP3 A;  1K28 A;  3I56 3;  1FA3 A;  1FZU A;  1K8A 4;  2UUG C;  2WGO A;  1RDS A;  1RKY A;  2I9W A;  1GSP A;  1SJW A;  1O7H B;  5CF1 A;  3F8X A;  3HII A;  1FUS A;  4XM4 A;  3G6E 3;  4HYZ A;  1M9G A;  2RGQ A;  1YIT 3;  4HM3 B;  1GD3 A;  2D42 A;  1B2Z A;  1VQ4 3;  1S72 3;  2HML B;  2CFL A;  1BRK A;  3KSP A;  5STD A;  1N8R 4;  1DVC A;  1QJG A;  5KP4 A;  4IPB A;  3CC7 3;  2ZA4 A;  2CKF B;  2O3O A;  3BLZ A;  3KZT A;  1I3F A;  2IA7 A;  3KFQ C;  1FUT A;  4CDL A;  3GZR A;  3CCS 3;  3WMD A;  1OF5 B;  4HBR A;  1RNB A;  3BNE A;  3PS8 A;  3PYJ A;  2FGT A;  1B2U A;  1TP6 A;  1G96 A;  1VZZ A;  2YFI B;  2GBX B;  5CLK A;  1OH0 A;  1BNE A;  1RLS A;  5M18 A;  2XGN A;  1YNV X;  3CD6 3;  1GMR A;  1I2G A;  4GB5 A;  2ZHX B;  1VQO 3;  2RSX A;  5LC7 A;  1RGC A;  4EV2 A;  3B7C A;  3RDE A;  8RNT A;  4ORL A;  4J5G A;  1X1U A;  1IK3 A;  1MWU A;  3OWS A;  4K1V A;  2XEP A;  1IQY A;  4RNY A;  1IU7 A;  3LTD A;  2E2T A;  2F5M A;  2OQE C;  2W56 A;  4KFE A;  3RGA A;  2W03 A;  3CCJ 3;  3QRD A;  3PXM A;  1BRG A;  3K63 A;  4XBT A;  3MSO A;  3VSY A;  3BIR A;  2GU1 A;  5G1L A;  6GSP A;  4WHA A;  1YIJ 3;  2ZDJ A;  4QWT A;  1V57 A;  3AHW A;  3B8L A;  4BL2 A;  1K73 4;  1UCL A;  2CIU A;  1OGZ A;  4EXR A;  3T0U A;  2GU3 A;  3KKG A;  4IIA A;  3UNL A;  1CH0 A;  3LOY A;  1W6C A;  1EQK A;  2GSP A;  1I2E A;  2HMN B;  1O7M B;  4GSP A;  1JBS A;  3V99 A;  4KFD A;  2AAE A;  3EN8 A;  3MG2 A;  4HM0 B;  4AKZ A;  4CCV A;  3U97 A;  4EW5 A;  1FYS A;  2OTJ 3;  5I97 A;  3CME 3;  1YGE A;  4N6N B;  1LNI A;  2CWT A;  3TDG A;  4XBX A;  3CCQ 3;  1LRA A;  1PY3 A;  3A5E A;  3G0K A;  3JUO A;  3NM2 A;  3NQY A;  3T8N A;  3AMO A;  1BOX A;  3NV0 A;  1OAC A;  1UCJ A;  3WHO A;  1LOY A;  1GY6 A;  3F14 A;  4BU4 A;  1C54 A;  2RBI A;  5G2G A;  1M1X B;  2FXT A;  3X41 A;  1RCL A;  2WOF A;  3LTB A;  2MF7 A;  4WYK A;  2KRT A;  1W00 A;  3KE7 A;  3KII A;  1B3S A;  3NUV A;  1L5G B;  3JUN A;  3I55 3;  3FH1 A;  1DMN A;  2QIY A;  1K41 A;  2HMO B;  2UGI A;  1AQZ A;  1ZX2 A;  1ZO2 A;  1JB2 A;  8CHO A;  3CNM A;  1PU4 A;  2R4I A;  4KZ1 A;  3EB8 A;  2OOV A;  5IER A;  2V1L A;  5A0O B;  1C7H A;  2RNT A;  1W7C A;  1BAO A;  1US1 A;  3A76 A;  1UUW B;  1VQL 3;  1VQ7 3;  1JNQ A;  3ECF A;  1GS3 A;  3CXC 2;  5KP1 A;  3Q3F A;  1BIR A;  3U1W A;  1S5A A;  1WMO A;  2C11 A;  5GSP A;  1GOV A;  1EG9 B;  3SX1 A;  1GMP A;  2AAD A;  4L8O A;  5CXO A;  3X42 A;  9RNT A;  1B2M A;  3D5I A;  2CH9 A;  4HKV B;  1JBT A;  4X2O A;  4J9A A;  3JVC A;  4O02 B;  1NB5 I;  5D81 A;  5BVB A;  1JN5 A;  1IT7 A;  1WMN A;  3NX0 A;  2JQ5 A;  3MPH A;  2F4Y A;  1FGR A;  1YVB I;  1ZGX A;  4LYL B;  4I4K A;  1DVD A;  1GD4 A;  7GSP A;  3SYU A;  3JUM A;  1OUN A;  1Q40 A;  1DYU A;  1K9M 4;  1BSE A;  3LZA A;  3Q90 A;  3PCS A;  5ELU A;  3MG1 A;  3CCM 3;  1N9J A;  4JF8 A;  1BSC A;  2L4V A;  1BRI A;  4R9L A;  1SAR A;  5TGN A;  5RNT A;  2JDI H;  3GAX A;  3LXU X;  4FMB A;  1NJI 4;  1B27 A;  1EA2 A;  4LMI A;  4AKY A;  1JBR A;  1BSD A;  2LYX A;  3H51 A;  4HM8 B;  3AHS A;  5D83 A;  1IVX A;  3CNX A;  3G8Z A;  3WA3 A;  1VQM 3;  2CK3 H;  4N6M A;  3VGN A;  5JPP A;  1TFK A;  4MMX B;  1EKM A;  1BRS A;  1ULI B;  2W56 B;  3F7S A;  3CCE 3;  3EHC A;  3SLU A;  2KF5 A;  1FUW A;  4G1M B;  1IQX A;  4KVH A;  1AVK A;  2ML6 A;  1RN1 A;  1MWT A;  3MWZ A;  5D82 A;  3X40 A;  1N5P A;  2OWP A;  4KFF A;  1N9E A;  3EN1 B;  2Z6B A;  2CG0 A;  4HM2 B;  5DRE A;  1V74 A;  4MMY B;  2PZV A;  3KSE D;  1MNL A;  1JB4 A;  1RRH A;  1OPY A;  3GSP A;  3N54 B;  2Y74 A;  3EC9 A;  3S29 A;  2P05 A;  3VF1 A;  1I8V A;  2CFG A;  4ZM8 A;  4H3U A;  1SIH A;  2BT3 A;  1STF I;  3Q1C A;  1CQS A;  1SPU A;  4N3V A;  3F40 A;  3K5T A;  1RNT A;  4HM7 B;  3NXJ A;  5AIG A;  2E2V A;  5EVH A;  2H0G A;  4CJN A;  1LXE A;  3DXO A;  4XBY A;  1G0T A;  3AMO B;  3NV0 B;  1RGK A;  1WQL B;  3EBT A;  1BNS A;  1KQS 2;  1RSN A;  3DGO A;  3CPO A;  3X3Y A;  4FMD A;  4N6U A;  3JUP A;  1NO3 A;  1IVW A;  3NBB A;  1CEW I;  4WYK B;  3HI7 A;  4OK0 A;  1QVF 2;  3OX9 A;  3S67 A;  1BNF A;  4HM5 B;  3MG3 A;  1TJD A;  1TUH A;  2Z77 A;  2IY2 A;  5M1A A;  3FG1 A;  3LT9 A;  1AV4 A;  1I70 A;  5IG0 A;  5IEO A;  2QEX 3;  3PCR A;  3LT8 A;  1EEJ A;  2PNC A;  1UGI A;  3K0Z A;  4HOH A;  1A2P A;  1BNJ A;  4O8S A;  1A67 A;  2KXG A;  2P0X A;  2R41 A;  5HGR A;  3OWY A;  4O3V A;  2RFR A;  2P09 A;  4N6T A;  1OGX A;  1IV7 A;  2M7O A;  2IUJ A;  2XRX B;  1EUI C;  5IEP A;  2H0I A;  2KF6 A;  2OOV C;  3RGR A;  3MYT A;  1JN5 B;  4HZ9 B;  4OUQ A;  3WR2 A;  3J7Y d;  1B2S A;  4ILF A;  3F8H A;  3K7C A;  4R1K A;  2W9P A;  7RNT A;  1BNG A;  4Q53 A;  4CPK A;  3PGB A;  1IT8 A;  1Q40 B;  2W04 A;  1O7P B;  2CFW A;  1BRJ A;  1B2X A;  4I5Q A;  1QAL A;  4XDV A;  1Q7Y 4;  1HU9 A;  3IJE B;  2UX0 A;  4HVN A;  3DM8 A;  1Q81 4;  1GOU A;  3CMA 3;  3DGL A;  3EJV A;  3GWR A;  3SVA A;  1WNH A;  5BXQ A;  5HOH A;  1ASK A;  3FCS B;  4RBN A;  1ROA A;  1R4Y A;  4WP5 A;  4AEQ A;  1BU4 A;  1W02 A;  3UL5 A;  1D6U A;  1RTU A;  4HZB B;  5CF2 A;  3FLJ A;  1I0X A;  1LOX A;  3ALA A;  3STD A;  1U8C B;  1NB3 I;  3BNC A;  1T2I A;  1PFP A;  1I3I A;  1HYF A;  2IMJ A;  1MGR A;  3HX8 A;  1UW1 A;  3WOF B;  1TRQ A;  4R80 A;  6STD A;  1Q82 4;  1B20 A;  2HMM B;  2A15 A;  5CK6 A;  1OHP A;  1FGO A;  2KCD A;  2KF3 A;  4GL6 A;  3WOE B;  4J5K A;  2SAR A;  2F99 A;  1U5O A;  2K54 A;  5IG3 A;  3CCL 3;  1FW7 A;  2O9U X;  2CWU A;  6RNT A;  1KD1 4;  2CX0 A;  2FNQ A;  1JV2 B;  2BU4 A;  2XSO B;  3BNB A;  4J8T A;  1JRQ A;  3D3L A;  1UGH I;  1Q9E A;  1YJ9 3;  1WTH A;  2CX1 A;  2K0M A;  3CC2 3;  1AR0 A;  1OCV A;  1RGA A;  2STD A;  2YFL B;  3LH4 A;  1W01 A;  3FGY A;  5BU4 A;  1BRH A;  4FCJ A;  3WDG B;  1NWW A;  3MHE A;  4JRF A;  1VQK 3;  2IUK A;  1AVL A;  3BND A;  3WA2 X;  1LQM B;  1YHQ 3;  3CC4 3;  4LEH A;  3WOD G;  3UL6 A;  3V92 A; 
#chains in the Genus database with same CATH homology
 4K90 B;  3QK9 A;  2CG1 A;  2B1X B;  3B4P A;  1JKG A;  3X3X A;  1JB5 A;  4XB5 A;  1T5Y A;  2ML5 A;  4O2H A;  4FMA A;  1ISK A;  2GBW B;  1N8Q A;  3NBJ A;  3Q2P A;  1VQP 3;  3FKA A;  3S5C A;  1VQ8 3;  4HJL B;  2D1W A;  2RCD A;  4LGQ A;  1RRL A;  1STD A;  4WWU C;  3DUK A;  1LNH A;  4L8P A;  3SOY A;  3SOA A;  2P0M A;  3NM7 A;  1KWI A;  1YI2 3;  5AIH A;  1YJW 3;  4NHF A;  1UUV B;  1R4C A;  3OV4 A;  3KN4 A;  3I0Y A;  3LML A;  1D6Z A;  1E97 A;  3DGM A;  1WMP A;  4XDW A;  1CYV A;  1D6Y A;  3PZW A;  2CW9 A;  4OVM A;  2BMQ B;  1ROV A;  2Z76 A;  1FGQ A;  2BMR B;  1SQW A;  4TX4 A;  1ULJ B;  3GRD A;  1VQ5 3;  4HM6 B;  3L0R A;  1FGM A;  3E99 A;  3CU3 A;  1LVN A;  3ROB A;  2C10 A;  2QA4 3;  4MMZ B;  1TU5 A;  1GY5 A;  3F7X A;  1J2B A;  3CCR 3;  3GZB A;  2WO0 A;  1TFO A;  2BNG A;  1O7W B;  5AYS C;  2CFK A;  2CHC A;  2XFS A;  2HMK B;  2WOH A;  3EQQ B;  2GEX A;  1W4N A;  1QAF A;  3S27 A;  3NQZ A;  5AII A;  2W2C A;  2GEY A;  2OCT A;  5IG5 A;  2XR8 B;  4N6L A;  3K9M C;  2YFJ B;  3CCU 3;  2WGQ A;  1TIJ A;  3FF2 A;  4FCM A;  4EC6 A;  1IVV A;  3EX9 A;  1FGT A;  5ELJ A;  4R4K A;  2QGU A;  1YJN 3;  3V98 A;  5JPU A;  4STD A;  3M8C A;  2XGL A;  2OTL 3;  5IG4 A;  3MKI A;  3DMC A;  1DMM A;  1UI8 A;  3B4O A;  2BO9 B;  2XFT A;  1UI7 A;  2Q07 A;  1W2Z A;  3HIG A;  2W6J H;  3LTC A;  3EF8 A;  1Q42 A;  2XF3 A;  1IV9 A;  1O7G B;  1Y4K A;  2XH9 A;  3JUQ A;  4BTY A;  2CFD A;  3G16 A;  4PEJ A;  5EQL A;  1JKG B;  3G4S 3;  2HMJ B;  4LZI A;  2W0Q A;  2ZL8 A;  3EE1 A;  2CC3 A;  3FSD A;  3LTA A;  4RNZ A;  1M1K 4;  1KC8 4;  3S28 A;  1MOL A;  4R9K A;  4BTW A;  2MC8 A;  1W6Y A;  5EEO A;  3F9S A;  2Y73 A;  1Z1S A;  2CWV A;  2LQV A;  3LYG A;  1F8N A;  1OF5 A;  4X2H A;  2F86 B;  1GYB A;  4HM4 B;  3G71 3;  1QAK A;  3SXX A;  5FGO A;  2BMO B;  3OXA A;  1W5Z A;  3FZW A;  2P38 A;  3DGN A;  4RZM A;  2OQE A;  3UJM A;  1W6G A;  1RJO A;  3FF0 A;  5AEU B;  2XSH B;  3O8Y A;  3IMA B;  1Q86 4;  3SED A;  3GZY B;  3DZL A;  1BUQ A;  7STD A;  1NDO B;  1VQ9 3;  1CYU A;  3GZX B;  5LC6 A;  1O7N B;  2GXF A;  4U13 A;  1IQ8 A;  3EBY A;  4H61 A;  2F98 A;  2YX9 A;  1OHS A;  1VQN 3;  4BTX A;  1RN7 A;  3NBR A;  1IDP A;  4LSO A;  1N5H A;  3HZP A;  1W2B 2;  1E3R A;  4HM1 B;  3H3H A;  1E3V A;  3T8U A;  5IF6 A;  4K1U A;  2W9Q A;  5FW5 A;  3DY5 A;  5AI1 A;  4MEI A;  1VQ6 3;  1A2K A;  1GY7 A;  1KSI A;  5AYR B;  4NRE A;  4EBG A;  3OW2 2;  5AEW B;  3X3Z A;  2E2U A;  4N6V 0;  5IW9 A;  1JJ2 2;  4FR9 A;  4WFO A;  1IVU A;  3BB9 A;  5JBS A;  4MJD A;  4K61 A;  4EV5 A;  5IEN A;  1QVG 2;  4IT7 A;  5DRV A;  3UB1 A;  1QMA A;  1OHO A;  2B24 B;  4FMC A;  3NHX A;  3CCV 3;  3N8B A;  4EYC A;  1M90 4;  4FCZ A;  3ER7 A;  4L7K A;  3FG3 A;  3CPW 2;  4N6O B;  3FG4 A;  1SII A;  1A2V A;  2BHM A;  2Z7A A;  5AIF A;  2INX A;  3N9H A;  3HK4 A;  1A90 A;  1DMQ A;  3IPT A;  1NU3 A;  3I56 3;  2SBL A;  1HKX A;  3OWU A;  3D9R A;  5KP3 A;  1FA3 A;  1K28 A;  1K8A 4;  2WGO A;  1RKY A;  2I9W A;  1SJW A;  1O7H B;  5CF1 A;  3F8X A;  3HII A;  4XM4 A;  3G6E 3;  4HYZ A;  1M9G A;  2RGQ A;  1YIT 3;  4HM3 B;  1GD3 A;  2D42 A;  1VQ4 3;  1S72 3;  2HML B;  2CFL A;  3KSP A;  5STD A;  1N8R 4;  1DVC A;  1QJG A;  5KP4 A;  4IPB A;  3CC7 3;  2CKF B;  2O3O A;  3BLZ A;  3KZT A;  2IA7 A;  3KFQ C;  4CDL A;  3GZR A;  3CCS 3;  3WMD A;  1OF5 B;  4HBR A;  3BNE A;  3PS8 A;  3PYJ A;  2YFI B;  1VZZ A;  1TP6 A;  1G96 A;  2FGT A;  2GBX B;  5CLK A;  1OH0 A;  2XGN A;  3CD6 3;  4GB5 A;  1VQO 3;  2RSX A;  5LC7 A;  4EV2 A;  3B7C A;  3RDE A;  4ORL A;  1IK3 A;  3OWS A;  4K1V A;  2XEP A;  1IQY A;  4RNY A;  1IU7 A;  3LTD A;  2E2T A;  2OQE C;  2W56 A;  4KFE A;  3RGA A;  2W03 A;  3CCJ 3;  3QRD A;  3PXM A;  3K63 A;  4XBT A;  3MSO A;  3VSY A;  2GU1 A;  4WHA A;  1YIJ 3;  2ZDJ A;  4QWT A;  3B8L A;  1K73 4;  2CIU A;  1OGZ A;  4EXR A;  3T0U A;  2GU3 A;  3KKG A;  4IIA A;  3UNL A;  3LOY A;  1W6C A;  1EQK A;  2HMN B;  1O7M B;  3V99 A;  4KFD A;  3EN8 A;  3MG2 A;  4CCV A;  4HM0 B;  4AKZ A;  3U97 A;  2OTJ 3;  5I97 A;  3CME 3;  1YGE A;  4N6N B;  2CWT A;  3TDG A;  4XBX A;  3CCQ 3;  3T8N A;  3G0K A;  3JUO A;  3NM2 A;  3NQY A;  3AMO A;  3NV0 A;  1OAC A;  1GY6 A;  3F14 A;  5G2G A;  1M1X B;  2FXT A;  3X41 A;  2WOF A;  3LTB A;  4WYK A;  2MF7 A;  2KRT A;  1W00 A;  3KE7 A;  3KII A;  3NUV A;  1L5G B;  3JUN A;  3I55 3;  3FH1 A;  1DMN A;  2QIY A;  1K41 A;  2HMO B;  1ZX2 A;  1ZO2 A;  1JB2 A;  8CHO A;  3CNM A;  1PU4 A;  2R4I A;  4KZ1 A;  3EB8 A;  2OOV A;  5IER A;  2V1L A;  5A0O B;  1C7H A;  1W7C A;  1US1 A;  3A76 A;  1UUW B;  1VQL 3;  1VQ7 3;  1JNQ A;  3ECF A;  1GS3 A;  3CXC 2;  5KP1 A;  3U1W A;  1S5A A;  1WMO A;  2C11 A;  1EG9 B;  3SX1 A;  4L8O A;  3X42 A;  5CXO A;  2CH9 A;  4HKV B;  4X2O A;  4J9A A;  3JVC A;  4O02 B;  1NB5 I;  5D81 A;  5BVB A;  1JN5 A;  1IT7 A;  1WMN A;  3NX0 A;  2JQ5 A;  3MPH A;  1FGR A;  1YVB I;  4I4K A;  1DVD A;  1GD4 A;  3JUM A;  1OUN A;  1Q40 A;  1DYU A;  1K9M 4;  3LZA A;  3Q90 A;  3PCS A;  5ELU A;  3MG1 A;  3CCM 3;  1N9J A;  4JF8 A;  2L4V A;  4R9L A;  5TGN A;  2JDI H;  3GAX A;  3LXU X;  4FMB A;  1NJI 4;  1EA2 A;  4LMI A;  4AKY A;  2LYX A;  3H51 A;  4HM8 B;  5D83 A;  1IVX A;  3CNX A;  3G8Z A;  3WA3 A;  1VQM 3;  2CK3 H;  4N6M A;  3VGN A;  5JPP A;  1TFK A;  4MMX B;  1EKM A;  1ULI B;  2W56 B;  3F7S A;  3CCE 3;  3EHC A;  3SLU A;  1FUW A;  4G1M B;  1IQX A;  4KVH A;  1AVK A;  2ML6 A;  5D82 A;  3MWZ A;  3X40 A;  1N5P A;  2OWP A;  4KFF A;  1N9E A;  3EN1 B;  2Z6B A;  2CG0 A;  4HM2 B;  5DRE A;  1V74 A;  4MMY B;  2PZV A;  3KSE D;  1JB4 A;  1MNL A;  1RRH A;  1OPY A;  3N54 B;  2Y74 A;  3EC9 A;  3S29 A;  2P05 A;  3VF1 A;  4ZM8 A;  2CFG A;  4H3U A;  1SIH A;  2BT3 A;  1STF I;  3Q1C A;  1CQS A;  1SPU A;  4N3V A;  3F40 A;  3K5T A;  4HM7 B;  3NXJ A;  5AIG A;  2E2V A;  5EVH A;  1LXE A;  3DXO A;  4XBY A;  3AMO B;  3NV0 B;  1WQL B;  3EBT A;  1KQS 2;  3DGO A;  3CPO A;  3X3Y A;  4FMD A;  4N6U A;  3JUP A;  1NO3 A;  1IVW A;  3NBB A;  1CEW I;  4WYK B;  3HI7 A;  4OK0 A;  1QVF 2;  3OX9 A;  3S67 A;  4HM5 B;  3MG3 A;  1TUH A;  2Z77 A;  3FG1 A;  3LT9 A;  1AV4 A;  5IG0 A;  5IEO A;  2QEX 3;  3PCR A;  3LT8 A;  2PNC A;  3K0Z A;  4O8S A;  1A67 A;  2KXG A;  2P0X A;  5HGR A;  3OWY A;  4O3V A;  2RFR A;  2P09 A;  4N6T A;  1OGX A;  1IV7 A;  2M7O A;  2IUJ A;  2XRX B;  5IEP A;  2OOV C;  3RGR A;  3MYT A;  1JN5 B;  4HZ9 B;  4OUQ A;  3J7Y d;  3F8H A;  3K7C A;  4R1K A;  2W9P A;  4Q53 A;  3PGB A;  1IT8 A;  1Q40 B;  2W04 A;  1O7P B;  2CFW A;  4XDV A;  1Q7Y 4;  1QAL A;  3CMA 3;  1HU9 A;  3IJE B;  2UX0 A;  4HVN A;  3DM8 A;  1Q81 4;  3DGL A;  3EJV A;  3GWR A;  3SVA A;  1WNH A;  5BXQ A;  1ASK A;  3FCS B;  4RBN A;  1ROA A;  4WP5 A;  4AEQ A;  1W02 A;  3UL5 A;  1D6U A;  4HZB B;  5CF2 A;  3FLJ A;  1LOX A;  3ALA A;  3STD A;  1U8C B;  1NB3 I;  3BNC A;  1PFP A;  2IMJ A;  3HX8 A;  1UW1 A;  3WOF B;  4R80 A;  6STD A;  1Q82 4;  2HMM B;  2A15 A;  5CK6 A;  1OHP A;  1FGO A;  2KCD A;  4GL6 A;  3WOE B;  2F99 A;  1U5O A;  2K54 A;  5IG3 A;  3CCL 3;  2O9U X;  2CWU A;  1KD1 4;  2FNQ A;  1JV2 B;  2XSO B;  3BNB A;  4J8T A;  1JRQ A;  3D3L A;  1YJ9 3;  1WTH A;  2K0M A;  3CC2 3;  1AR0 A;  2YFL B;  1OCV A;  2STD A;  3LH4 A;  1W01 A;  3FGY A;  4FCJ A;  3WDG B;  1NWW A;  3MHE A;  4JRF A;  1VQK 3;  2IUK A;  1AVL A;  3BND A;  3WA2 X;  1YHQ 3;  3CC4 3;  4LEH A;  3WOD G;  3UL6 A;  3V92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...