3G6E3

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3g6e300
3CCE3 3CCV3 1YJN3 1YHQ3 1KC84 1VQ93 3OW22 3CC73 1QVF2 1YIT3 1VQL3 2QEX3 3CCQ3 3CCS3 1Q864 1VQM3 1KQS2 1Q824 2OTJ3 1VQP3 3CCJ3 1NJI4 1KD14 1YIJ3 1N8R4 1K8A4 3I553 3CC23 3G6E3 1S723 1JJ22 1VQ43 3CMA3 1YJW3 1M1K4 3CCU3 3G713 1VQ53 1K9M4 3CCR3 3I563 3CCM3 1W2B2 3CXC2 1K734 3CC43 1VQ63 1YJ93 1VQN3 1YI23 1Q814 2OTL3 1VQ73 3CCL3 1VQK3 3CD63 3G4S3 1QVG2 1Q7Y4 1VQ83 3CME3 1VQO3 3CPW2 1M904 2QA43
chains in the Genus database with same CATH superfamily
4NHFA 3K63A 1IV7A 2W56A 1UGHI 3PXMA 3EQQB 1V58A 4R9KA 1N9JA 1QJGA 4IIAA 1HU9A 1IK3A 4EV5A 1M1XB 1LRAA 1B2UA 2SARA 3B4OA 2O3OA 5AYSC 1ISKA 2BMOB 3A5EA 3U1WA 4GHOA 3FZWA 3CC23 3DZLA 3U97A 4O2HA 4GB5A 4DKIA 1S723 2RSXA 1VQ43 2XSHB 3BNCA 3I563 1W2B2 2BMQB 2KF4A 1W6YA 3AGNA 3RGRA 1RCLA 1BNGA 4XM4A 2MF7A 3CD63 2SBLA 3IMAB 3NM7A 2OQEC 3T0UA 1I0XA 2FNQA 1US1A 4HM8B 3TDGA 4CJNA 1O7NB 4ZM8A 1BANA 3JUQA 2E2VA 4EV2A 5IERA 3CU3A 3FSDA 5M18A 4L7KA 4R80A 1CH0A 5GSPA 1QVF2 1E3RA 1NB3I 1BGSA 3AMOA 1O7WB 3S67A 2ZA4A 2BU4A 1BSDA 3X40A 4EC6A 1BOXA 1JN5A 1YGWA 3F7XA 1FGMA 1RSNA 4LGQA 3Q2PA 1STDA 6RNTA 1W7CA 1B2SA 4CDLA 3CCU3 3G713 3H3HA 3ALAA 5AYRB 3SVAA 1Q40B 1RDSA 1GY6A 2D1WA 1AVKA 3JVCA 3B7CA 4J5GA 1OUNA 1GSPA 2JDIH 3DY5A 3K0ZA 1MOLA 1IT8A 4HZBB 1MWTA 4XBTA 2Y73A 5CXOA 1RGLA 3VF1A 1RGGA 5IW9A 1HKXA 1TP6A 1UUWB 1V74A 3KSPA 1SJWA 3HIGA 1X1XA 1WMOA 1OCVA 2HMNB 1B27A 1IT7A 1DVCA 1JKGA 1L5GB 3MG3A 2BO9B 3MG1A 1YIJ3 3F9SA 3LH4A 3NUVA 4FCZA 1EA2A 1PU4A 1WNHA 3UL6A 3DGNA 3AMOB 3LTDA 1A2PA 1VQ63 3URPA 1GOVA 1GD4A 2WGQA 3DH2A 3GAXA 3CNMA 1JN5B 2L4VA 4OVMA 1LQGC 3X3XA 2F5MA 3ZG5A 1OHPA 3KSED 1M904 1O7PB 1JB5A 3EX9A 2ML5A 1ULJB 3X41A 2CK3H 3UNLA 3FG4A 1EEJA 2CFWA 1SIHA 1FW7A 1DMQA 1BSBA 1UDII 1YVBI 1W6CA 2C4BA 2CX0A 4FMBA 1BNFA 4N6UA 4N6OB 1CEWI 3G6E3 3EN1B 1YJW3 3LOYA 4LMIA 1PYLA 4RBNA 5CF2A 5FGOA 4BIRA 1TFKA 5IEPA 3GSPA 3J7Yd 1F8NA 1FGQA 3LZAA 1E3VA 1M9GA 1UW1A 2B1XB 2CWTA 3OWYA 1C54A 1SPUA 3ROBA 2XFSA 5BIRA 1YNVX 3V92A 4X2OA 3DXOA 3VSYA 1QVG2 1N5HA 2Y74A 3OXAA 3SOAA 5ELJA 4WFOA 3WA3A 1QALA 4L8PA 1TU5A 1OF5B 1RGKA 1NDOB 1NU3A 1MNLA 3B8LA 3D4AA 3DGMA 3D9RA 5JPUA 3MG2A 3DGOA 1WMNA 4LSOA 3LMLA 4MMYB 4NREA 3X3ZA 6GSPA 3UJMA 3K5TA 1C7HA 1BNEA 3V98A 1KQS2 2GU1A 3MWZA 3CCJ3 1NJI4 1FUSA 1BRKA 1JNQA 1N5PA 2A15A 3FG1A 3OV4A 4QWTA 4CPKA 3FLJA 1UI7A 4NPBA 1VQ53 2RNTA 5IG5A 4KFFA 1QAKA 1EQKA 2CWVA 4HBRA 3OWUA 3CXC2 2M7OA 4TX4A 4OUQA 3HZPA 1WQLB 1RGCA 3F14A 1UCLA 2WO0A 1SARA 4RNYA 5AI1A 4BTWA 1U5OA 3PCRA 1RJOA 1WMPA 4N6NB 3BNEA 2OCTA 3DM8A 5IG0A 4K1UA 2R41A 4IPBA 1KC84 3NX0A 2HOHA 1Q7HA 2IY2A 1Q40A 2L1SA 3CCQ3 2F86B 1Q864 1VQM3 2OTJ3 5IENA 2F99A 1K41A 4HOHA 1IQXA 4L8OA 2W0QA 3A76A 3EN8A 1LVNA 1BRHA 3CNXA 1D6YA 4I5QA 8CHOA 3KE7A 1ASKA 1ZO2A 1K734 2OOVA 1FGOA 2RBIA 4LEHA 2XF3A 3N54B 4KVHA 2P09A 3G4S3 2CFLA 1KSIA 3DUKA 3WOFB 3X3YA 1RGEA 2HMLB 2XR8B 2H0HA 3ECFA 1IYYA 2QA43 3K9MC 3MYTA 2R4IA 1BNRA 1UCJA 3H51A 1BSEA 1WTHA 3EHCA 4LZIA 1UI8A 5G1LA 3ZG0A 2K3DA 2UUGC 1ZX2A 1T5YA 1Y4KA 2BT3A 1BAOA 1X1WA 3OX9A 5I97A 1R4CA 5ELUA 3LT9A 1YGEA 3OWSA 2QIYA 3HX8A 3VGNA 3MHEA 1I0VA 1LOVA 2K54A 3MSOA 4HM0B 7RNTA 2WGOA 6STDA 2CX1A 3UB1A 4RZMA 4N6V0 4K90B 2KF5A 4MJDA 5M1AA 1SIIA 4FCJA 1VQ73 2I9WA 1NNVA 3JUMA 1D6ZA 1Q7Y4 3QK9A 1MGRA 3AHSA 1BU4A 3HIIA 1RRHA 5AIGA 3N8BA 5BU4A 4FCMA 4EW5A 2HMOB 4ILFA 3EBTA 1O7GB 3NHXA 5STDA 4HM3B 1UCKA 4O3VA 1GMPA 5FW5A 1R4YA 4HM7B 4IT7A 2Z77A 2C10A 2IUJA 9RNTA 2CW9A 3NQYA 3BIRA 5IG3A 1D6UA 3M8CA 1EG9B 1QAFA 1O7HB 5EQLA 3T8NA 2KF6A 3S27A 5KP3A 3F8XA 3X42A 5CLKA 3GWRA 4J8TA 1OACA 1RHLA 1FGRA 3KZTA 1B2ZA 4GSPA 3GZBA 2CH9A 1OF5A 2J8XB 4R4KA 1RGHA 5IF6A 1O7MB 1G02A 2GBXB 1JB2A 3KIIA 3NV0A 1I2GA 2XGNA 3SEDA 1UUGB 3WODG 2CFDA 3O8YA 2STDA 1BSAA 1BRIA 2O9UX 1RNTA 4WHAA 1B2MA 1RNBA 3OW22 1OH0A 4R9LA 2FXTA 4LYLB 3LTCA 1G96A 2HMJB 4X2HA 3CCS3 1TFOA 1RRLA 2CWUA 1LNHA 3CPOA 1FUWA 3LYGA 1NO3A 3Q1CA 4ORLA 1A2KA 1GMQA 1B2XA 1IVWA 1I70A 2BHMA 2LYXA 3RNTA 2ML6A 2P05A 1IDPA 1FGTA 1W00A 1AQZA 1CYUA 1RGAA 2INXA 4XDVA 5BVBA 2F98A 2IA7A 3NBRA 1VQ83 4FR9A 3DGYA 4G1MB 4XDWA 1I2FA 4BU4A 1FYSA 3CCE3 1JBTA 1RN1A 1YJN3 1BRJA 1T3BA 1JBRA 3BNBA 4K1VA 4BTYA 2B24B 2XGLA 1IVUA 4EXRA 1YIT3 4GL6A 1A67A 2XSOB 2PZVA 3RDEA 2GU3A 3NV0B 4N6TA 5IG4A 1JRQA 2K0MA 4H3UA 2XRXB 1RGFA 3JUNA 3NXJA 3NBBA 4HAAA 1DETA 2IYJA 1OHOA 1TRPA 1M1K4 1RCKA 1Z1SA 1IU7A 5LC7A 2P38A 1LQMB 2BNGA 3GZXB 3IJEB 4BL2A 1YI23 2CG1A 1YJ93 1IVVA 1GMRA 2KXGA 2CG0A 2OTL3 3QRDA 1W2ZA 1NB5I 1I2EA 1OPYA 3KCHA 4HJLB 3PCSA 3KKGA 1VQO3 3CPW2 1BRGA 2KCDA 3D5IA 3UL5A 1B21A 2KRTA 2WOFA 4KFEA 5LC6A 1JBSA 3FCSB 3HOHA 3BB9A 3JUPA 4HM5B 1JV2B 1VQ93 3NQZA 4RNTA 1VQL3 2QEX3 3WHOA 2Z76A 4I4KA 4J5KA 5DREA 2PNCA 1GY5A 1PFPA 4CCVA 2F5WA 3I553 2OOVC 2UX0A 1JJ22 2W9PA 2E2UA 1J2BA 2GEXA 8RNTA 3CC43 4JF8A 1DE3A 2IUKA 3IPTA 2AAEA 1LXEA 1V57A 3JUOA 3KFQC 4FMCA 3WMDA 4MMZB 2F4YA 3I0YA 1BUQA 1DVDA 2CC3A 3MKIA 5DRVA 1ZS7A 3NBJA 1NWWA 1U8CB 4EBGA 4H61A 2WOHA 1TJDA 2XEPA 3EJVA 7STDA 5IEOA 5HGRA 3ZFZA 5AEWB 1ZGXA 3L0RA 1VQQA 4WYKA 1KWIA 4HM4B 4HZ9B 1S5AA 3PZWA 4HKVB 1B3SA 1EUIC 2GXFA 3EBYA 3FKAA 4MEIA 2CKFB 2KAAA 2BMRB 1UGIA 3S5CA 1KD14 4AEQA 1TIJA 1X1YA 2GSPA 3BNDA 4HYZA 3CMA3 3KN4A 2HMMB 4Q53A 2YFLB 3G0KA 3LT8A 1Q9EA 2RFRA 5BXQA 1YVSA 1GS3A 1TTOA 3WR2A 1VQN3 2RGQA 2W6JH 1BNSA 3FF0A 3RGAA 1X1UA 3FH1A 1VQK3 3Q90A 3N9HA 2W03A 1LOXA 3NM2A 4XBYA 3WOEB 1LOYA 1LOWA 2OQEA 4KFDA 1TUHA 3SOYA 1YHQ3 5G2GA 4OK0A 4KZ1A 1JZOA 3S28A 3B4PA 5D82A 5D81A 2UGIA 3LXUX 5AIHA 1AY7A 2CFKA 1AR0A 2XFTA 2GBWB 3GRDA 3PYJA 1MWRA 1STFI 1IVXA 2W56B 2ZL8A 4AKYA 1N9EA 2XH9A 7GSPA 2Q07A 3CCM3 4WYKB 1G0TA 2CHCA 5AIFA 3AHWA 3S29A 1JB4A 3HI7A 3PS8A 5G1KA 2LQVA 2ZDJA 3GZRA 2GEYA 2RCDA 1BNJA 3F8HA 4WWUC 1AVLA 1W6GA 3FGYA 3MPHA 1ROAA 4STDA 1Q42A 3G16A 1K28A 5AEUB 4BL3A 2YFIB 1AV4A 1A2VA 1I8VA 1Q824 1SQWA 1VQP3 1B20A 5KP1A 2W9QA 1K8A4 4XB5A 4HM2B 2V1LA 2CFGA 1UCIA 1I3IA 1OGXA 3CCR3 1BVIA 1GYBA 1FZUA 1T2IA 2P0MA 4HVNA 4J9AA 3WDGB 5HOHA 3FG3A 4JRFA 1BIRA 1EKMA 1GOUA 1OGZA 2H0GA 2JQ5A 2P0XA 1GOYA 1T2HA 2CIUA 5RNTA 4HM1B 4O02B 1RN4A 2AADA 3E99A 1BUJA 1MGWA 2FGTA 1JZDA 2H0IA 1W02A 2MC8A 3BLZA 3V99A 3GZYB 2BIRA 2Z6BA 3D5GA 2YFJB 1MWSA 3CCV3 2HMKB 3SYUA 4MMXB 4AKZA 1VZZA 1FUTA 3EE1A 3DMCA 4FMDA 4N3VA 5A0OB 5AIIA 2W04A 3ER7A 2YX9A 2W2CA 4WP5A 1FA3A 3LTBA 1IQ8A 1UUVB 4N6LA 1CQSA 2KF3A 3FF2A 3EB8A 1JKGB 5JPPA 5M19A 1E97A 1QMAA 4PEJA 1BRSA 3K7CA 1ROVA 1PY3A 5CK6A 2Z7AA 3SX1A 1RMSA 1DYUA 3F7SA 4FMAA 3T8UA 4O8SA 2C11A 3G8ZA 1RN7A 2OWPA 3LTAA 3D3LA 2QGUA 5D83A 3SLUA 5KP4A 3F40A 4U13A 1LNIA 2F56A 3SXXA 1GY7A 1W5ZA 2D42A 1ULIB 1DMMA 1I3FA 1IQYA 1DMNA 1RLSA 3CC73 3BU4A 1IV9A 1A90A 1OHSA 2IMJA 1HYFA 1N8R4 3EC9A 3Q3FA 4KT3B 4BTXA 1BSCA 1MWUA 1BNIA 1N8QA 1K9M4 1RTUA 4N6MA 4K61A 5EVHA 3PGBA 1W01A 3EF8A 1CYVA 1GD3A 1TRQA 5JBSA 1Q814 5EEOA 3WA2X 2E2TA 4HM6B 3CCL3 1W4NA 3AGOA 4EYCA 2ZHXB 5CF1A 1RKYA 1BRNL 4RNZA 3CME3 3DGLA 3D79A 3STDA 4XBXA 5TGNA 3HK4A 1HZ1A 4R1KA
chains in the Genus database with same CATH topology
4NHFA 3K63A 1IV7A 2W56A 3PXMA 3EQQB 4R9KA 1N9JA 1QJGA 4IIAA 1HU9A 1IK3A 4EV5A 1M1XB 3B4OA 2O3OA 5AYSC 1ISKA 2BMOB 3U1WA 3FZWA 3CC23 3DZLA 3U97A 4O2HA 4GB5A 1S723 1VQ43 2RSXA 2XSHB 3BNCA 3I563 1W2B2 2BMQB 1W6YA 3RGRA 4XM4A 2MF7A 3CD63 2SBLA 3IMAB 3NM7A 2OQEC 3T0UA 2FNQA 1US1A 4HM8B 3TDGA 1O7NB 4ZM8A 3JUQA 2E2VA 4EV2A 5IERA 3CU3A 3FSDA 4L7KA 4R80A 1QVF2 1E3RA 1NB3I 3AMOA 1O7WB 3S67A 3X40A 4EC6A 1JN5A 3F7XA 1FGMA 4LGQA 3Q2PA 1STDA 1W7CA 4CDLA 3CCU3 3G713 3H3HA 3ALAA 5AYRB 3SVAA 1Q40B 1GY6A 2D1WA 1AVKA 3JVCA 3B7CA 1OUNA 2JDIH 3DY5A 3K0ZA 1MOLA 1IT8A 4HZBB 4XBTA 5CXOA 2Y73A 3VF1A 5IW9A 1HKXA 1TP6A 1UUWB 1V74A 3KSPA 1SJWA 3HIGA 1WMOA 1OCVA 2HMNB 1IT7A 1DVCA 1JKGA 1L5GB 3MG3A 2BO9B 3MG1A 1YIJ3 3F9SA 3LH4A 3NUVA 4FCZA 1EA2A 1PU4A 1WNHA 3UL6A 3DGNA 3AMOB 3LTDA 1VQ63 1GD4A 2WGQA 3GAXA 3CNMA 1JN5B 2L4VA 4OVMA 3X3XA 1OHPA 3KSED 1M904 1O7PB 1JB5A 3EX9A 2ML5A 1ULJB 3X41A 2CK3H 3UNLA 3FG4A 2CFWA 1SIHA 1DMQA 1YVBI 1W6CA 4FMBA 4N6UA 4N6OB 1CEWI 3G6E3 3EN1B 1YJW3 3LOYA 4LMIA 4RBNA 5CF2A 5FGOA 1TFKA 5IEPA 3J7Yd 1F8NA 1FGQA 3LZAA 1E3VA 1M9GA 1UW1A 2B1XB 2CWTA 3OWYA 1SPUA 3ROBA 2XFSA 3V92A 4X2OA 3DXOA 3VSYA 1QVG2 1N5HA 2Y74A 3OXAA 3SOAA 5ELJA 4WFOA 3WA3A 1QALA 4L8PA 1TU5A 1OF5B 1NDOB 1NU3A 3DGMA 1MNLA 3B8LA 3D9RA 5JPUA 3MG2A 3DGOA 1WMNA 4LSOA 3LMLA 4MMYB 4NREA 3X3ZA 3UJMA 3K5TA 1C7HA 3V98A 1KQS2 2GU1A 3MWZA 3CCJ3 1NJI4 1N5PA 2A15A 1JNQA 3FG1A 3OV4A 4QWTA 3FLJA 1UI7A 1VQ53 5IG5A 4KFFA 1QAKA 1EQKA 2CWVA 4HBRA 3OWUA 3CXC2 2M7OA 4TX4A 4OUQA 3HZPA 1WQLB 3F14A 2WO0A 4RNYA 5AI1A 4BTWA 1U5OA 3PCRA 1RJOA 1WMPA 4N6NB 3BNEA 2OCTA 3DM8A 5IG0A 4K1UA 4IPBA 1KC84 3NX0A 1Q40A 3CCQ3 2F86B 1Q864 1VQM3 2OTJ3 5IENA 2F99A 1K41A 4L8OA 1IQXA 2W0QA 3A76A 3EN8A 1LVNA 3CNXA 1D6YA 8CHOA 3KE7A 1ASKA 1ZO2A 1K734 2OOVA 1FGOA 4LEHA 2XF3A 3N54B 4KVHA 2P09A 3G4S3 2CFLA 1KSIA 3DUKA 3WOFB 3X3YA 2XR8B 2HMLB 3ECFA 2QA43 3K9MC 3MYTA 2R4IA 3H51A 1WTHA 3EHCA 4LZIA 1UI8A 1ZX2A 1T5YA 1Y4KA 2BT3A 3OX9A 5I97A 1R4CA 5ELUA 3LT9A 1YGEA 3OWSA 2QIYA 3HX8A 3VGNA 3MHEA 2K54A 3MSOA 4HM0B 2WGOA 6STDA 3UB1A 4RZMA 4N6V0 4K90B 4MJDA 1SIIA 4FCJA 1VQ73 2I9WA 3JUMA 1D6ZA 1Q7Y4 3QK9A 3HIIA 1RRHA 5AIGA 3N8BA 4FCMA 2HMOB 3EBTA 1O7GB 3NHXA 5STDA 4HM3B 4O3VA 5FW5A 4HM7B 4IT7A 2Z77A 2C10A 2IUJA 2CW9A 3NQYA 5IG3A 1D6UA 3M8CA 1EG9B 1QAFA 1O7HB 5EQLA 3T8NA 3S27A 5KP3A 3F8XA 3X42A 5CLKA 3GWRA 4J8TA 1OACA 1FGRA 3KZTA 3GZBA 2CH9A 1OF5A 4R4KA 5IF6A 1O7MB 2GBXB 1JB2A 3KIIA 3NV0A 2XGNA 3SEDA 3WODG 2CFDA 3O8YA 2STDA 2O9UX 4WHAA 3OW22 1OH0A 4R9LA 2FXTA 3LTCA 1G96A 2HMJB 4X2HA 3CCS3 1TFOA 1RRLA 2CWUA 1LNHA 3CPOA 1FUWA 3LYGA 1NO3A 3Q1CA 4ORLA 1A2KA 1IVWA 2BHMA 2LYXA 2ML6A 2P05A 1IDPA 1FGTA 1W00A 1CYUA 2INXA 4XDVA 5BVBA 2F98A 2IA7A 3NBRA 1VQ83 4FR9A 4G1MB 4XDWA 3CCE3 1YJN3 3BNBA 4K1VA 4BTYA 2B24B 2XGLA 1IVUA 4EXRA 1YIT3 4GL6A 1A67A 2XSOB 2PZVA 3RDEA 2GU3A 3NV0B 4N6TA 5IG4A 1JRQA 2K0MA 4H3UA 2XRXB 3JUNA 3NXJA 3NBBA 1OHOA 1M1K4 1Z1SA 1IU7A 5LC7A 2P38A 2BNGA 3IJEB 3GZXB 1YI23 1YJ93 2OTL3 2CG1A 1IVVA 2KXGA 2CG0A 3QRDA 1W2ZA 1NB5I 1OPYA 4HJLB 3PCSA 3KKGA 1VQO3 3CPW2 2KCDA 3UL5A 2KRTA 2WOFA 4KFEA 5LC6A 3FCSB 3BB9A 3JUPA 4HM5B 1JV2B 1VQ93 3NQZA 1VQL3 2QEX3 2Z76A 4I4KA 5DREA 2PNCA 1GY5A 1PFPA 4CCVA 3I553 2OOVC 2UX0A 1JJ22 2W9PA 2E2UA 1J2BA 2GEXA 3CC43 4JF8A 2IUKA 3IPTA 3JUOA 1LXEA 3KFQC 4FMCA 3WMDA 4MMZB 3I0YA 1BUQA 1DVDA 2CC3A 3MKIA 5DRVA 3NBJA 1NWWA 1U8CB 4EBGA 4H61A 2WOHA 2XEPA 3EJVA 7STDA 5IEOA 5HGRA 5AEWB 3L0RA 4WYKA 1KWIA 4HM4B 4HZ9B 1S5AA 3PZWA 4HKVB 2GXFA 3FKAA 3V99A 3EBYA 1KD14 4MEIA 2CKFB 2BMRB 3S5CA 4AEQA 1TIJA 3BNDA 3CMA3 4HYZA 3KN4A 2HMMB 4Q53A 2YFLB 3G0KA 3LT8A 2RFRA 5BXQA 1VQN3 1GS3A 2RGQA 2W6JH 3FF0A 3RGAA 1VQK3 3FH1A 3Q90A 3N9HA 2W03A 1LOXA 3NM2A 4XBYA 3WOEB 2OQEA 4KFDA 1TUHA 3SOYA 1YHQ3 5G2GA 4OK0A 4KZ1A 3S28A 3B4PA 5D82A 5D81A 3LXUX 5AIHA 2CFKA 1AR0A 2XFTA 2GBWB 3GRDA 3PYJA 4AKYA 1STFI 1IVXA 2W56B 2ZL8A 1N9EA 2XH9A 2Q07A 3CCM3 4WYKB 2CHCA 5AIFA 3S29A 1JB4A 3HI7A 3PS8A 2LQVA 2ZDJA 3GZRA 2GEYA 2RCDA 3F8HA 4WWUC 1AVLA 1W6GA 3FGYA 3MPHA 1ROAA 4STDA 1Q42A 3G16A 1K28A 5AEUB 2YFIB 1AV4A 1A2VA 1Q824 1SQWA 1VQP3 5KP1A 2W9QA 1K8A4 4XB5A 4HM2B 2V1LA 2CFGA 1OGXA 3CCR3 1GYBA 4HVNA 2P0MA 3WDGB 4J9AA 3FG3A 4JRFA 1EKMA 1OGZA 2JQ5A 2P0XA 2CIUA 4HM1B 4O02B 3E99A 2FGTA 1W02A 2MC8A 3BLZA 3GZYB 2Z6BA 2YFJB 3CCV3 2HMKB 4MMXB 4AKZA 1VZZA 3EE1A 4FMDA 3DMCA 4N3VA 5A0OB 5AIIA 2W04A 3ER7A 2YX9A 2W2CA 4WP5A 1FA3A 3LTBA 1IQ8A 1UUVB 4N6LA 1CQSA 3FF2A 3EB8A 1JKGB 5JPPA 1E97A 1QMAA 4PEJA 3K7CA 1ROVA 5CK6A 2Z7AA 3SX1A 1DYUA 3F7SA 4FMAA 3T8UA 4O8SA 2C11A 3G8ZA 1RN7A 2OWPA 3LTAA 3D3LA 2QGUA 5D83A 3SLUA 5KP4A 3F40A 4U13A 3SXXA 1GY7A 1W5ZA 2D42A 1ULIB 1DMMA 3CC73 1IQYA 1DMNA 1A90A 1IV9A 1OHSA 2IMJA 1N8R4 3EC9A 4BTXA 1N8QA 1K9M4 4N6MA 4K61A 5EVHA 3PGBA 1W01A 3EF8A 1CYVA 1GD3A 5JBSA 1Q814 5EEOA 3WA2X 2E2TA 4HM6B 3CCL3 1W4NA 1RKYA 4EYCA 5CF1A 4RNZA 3CME3 3DGLA 3STDA 4XBXA 5TGNA 3HK4A 4R1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE 3;  3CCV 3;  1YJN 3;  1YHQ 3;  1KC8 4;  1VQ9 3;  3OW2 2;  3CC7 3;  1QVF 2;  1YIT 3;  1VQL 3;  2QEX 3;  3CCQ 3;  3CCS 3;  1Q86 4;  1VQM 3;  1KQS 2;  1Q82 4;  2OTJ 3;  1VQP 3;  3CCJ 3;  1NJI 4;  1KD1 4;  1YIJ 3;  1N8R 4;  1K8A 4;  3I55 3;  3CC2 3;  3G6E 3;  1S72 3;  1JJ2 2;  1VQ4 3;  3CMA 3;  1YJW 3;  1M1K 4;  3CCU 3;  3G71 3;  1VQ5 3;  1K9M 4;  3CCR 3;  3I56 3;  3CCM 3;  1W2B 2;  3CXC 2;  1K73 4;  3CC4 3;  1VQ6 3;  1YJ9 3;  1VQN 3;  1YI2 3;  1Q81 4;  2OTL 3;  1VQ7 3;  3CCL 3;  1VQK 3;  3CD6 3;  3G4S 3;  1QVG 2;  1Q7Y 4;  1VQ8 3;  3CME 3;  1VQO 3;  3CPW 2;  1M90 4;  2QA4 3; 
#chains in the Genus database with same CATH topology
 4NHF A;  3K63 A;  1IV7 A;  2W56 A;  1UGH I;  3PXM A;  3EQQ B;  1V58 A;  4R9K A;  1N9J A;  1QJG A;  4IIA A;  1HU9 A;  1IK3 A;  4EV5 A;  1M1X B;  1LRA A;  1B2U A;  2SAR A;  3B4O A;  2O3O A;  5AYS C;  1ISK A;  2BMO B;  3A5E A;  3U1W A;  4GHO A;  3FZW A;  3CC2 3;  3DZL A;  3U97 A;  4O2H A;  4GB5 A;  4DKI A;  1S72 3;  2RSX A;  1VQ4 3;  2XSH B;  3BNC A;  3I56 3;  1W2B 2;  2BMQ B;  2KF4 A;  1W6Y A;  3AGN A;  3RGR A;  1RCL A;  1BNG A;  4XM4 A;  2MF7 A;  3CD6 3;  2SBL A;  3IMA B;  3NM7 A;  2OQE C;  3T0U A;  1I0X A;  2FNQ A;  1US1 A;  4HM8 B;  3TDG A;  4CJN A;  1O7N B;  4ZM8 A;  1BAN A;  3JUQ A;  2E2V A;  4EV2 A;  5IER A;  3CU3 A;  3FSD A;  5M18 A;  4L7K A;  4R80 A;  1CH0 A;  5GSP A;  1QVF 2;  1E3R A;  1NB3 I;  1BGS A;  3AMO A;  1O7W B;  3S67 A;  2ZA4 A;  2BU4 A;  1BSD A;  3X40 A;  4EC6 A;  1BOX A;  1JN5 A;  1YGW A;  3F7X A;  1FGM A;  1RSN A;  4LGQ A;  3Q2P A;  1STD A;  6RNT A;  1W7C A;  1B2S A;  4CDL A;  3CCU 3;  3G71 3;  3H3H A;  3ALA A;  5AYR B;  3SVA A;  1Q40 B;  1RDS A;  1GY6 A;  2D1W A;  1AVK A;  3JVC A;  3B7C A;  4J5G A;  1OUN A;  1GSP A;  2JDI H;  3DY5 A;  3K0Z A;  1MOL A;  1IT8 A;  4HZB B;  1MWT A;  4XBT A;  2Y73 A;  5CXO A;  1RGL A;  3VF1 A;  1RGG A;  5IW9 A;  1HKX A;  1TP6 A;  1UUW B;  1V74 A;  3KSP A;  1SJW A;  3HIG A;  1X1X A;  1WMO A;  1OCV A;  2HMN B;  1B27 A;  1IT7 A;  1DVC A;  1JKG A;  1L5G B;  3MG3 A;  2BO9 B;  3MG1 A;  1YIJ 3;  3F9S A;  3LH4 A;  3NUV A;  4FCZ A;  1EA2 A;  1PU4 A;  1WNH A;  3UL6 A;  3DGN A;  3AMO B;  3LTD A;  1A2P A;  1VQ6 3;  3URP A;  1GOV A;  1GD4 A;  2WGQ A;  3DH2 A;  3GAX A;  3CNM A;  1JN5 B;  2L4V A;  4OVM A;  1LQG C;  3X3X A;  2F5M A;  3ZG5 A;  1OHP A;  3KSE D;  1M90 4;  1O7P B;  1JB5 A;  3EX9 A;  2ML5 A;  1ULJ B;  3X41 A;  2CK3 H;  3UNL A;  3FG4 A;  1EEJ A;  2CFW A;  1SIH A;  1FW7 A;  1DMQ A;  1BSB A;  1UDI I;  1YVB I;  1W6C A;  2C4B A;  2CX0 A;  4FMB A;  1BNF A;  4N6U A;  4N6O B;  1CEW I;  3G6E 3;  3EN1 B;  1YJW 3;  3LOY A;  4LMI A;  1PYL A;  4RBN A;  5CF2 A;  5FGO A;  4BIR A;  1TFK A;  5IEP A;  3GSP A;  3J7Y d;  1F8N A;  1FGQ A;  3LZA A;  1E3V A;  1M9G A;  1UW1 A;  2B1X B;  2CWT A;  3OWY A;  1C54 A;  1SPU A;  3ROB A;  2XFS A;  5BIR A;  1YNV X;  3V92 A;  4X2O A;  3DXO A;  3VSY A;  1QVG 2;  1N5H A;  2Y74 A;  3OXA A;  3SOA A;  5ELJ A;  4WFO A;  3WA3 A;  1QAL A;  4L8P A;  1TU5 A;  1OF5 B;  1RGK A;  1NDO B;  1NU3 A;  1MNL A;  3B8L A;  3D4A A;  3DGM A;  3D9R A;  5JPU A;  3MG2 A;  3DGO A;  1WMN A;  4LSO A;  3LML A;  4MMY B;  4NRE A;  3X3Z A;  6GSP A;  3UJM A;  3K5T A;  1C7H A;  1BNE A;  3V98 A;  1KQS 2;  2GU1 A;  3MWZ A;  3CCJ 3;  1NJI 4;  1FUS A;  1BRK A;  1JNQ A;  1N5P A;  2A15 A;  3FG1 A;  3OV4 A;  4QWT A;  4CPK A;  3FLJ A;  1UI7 A;  4NPB A;  1VQ5 3;  2RNT A;  5IG5 A;  4KFF A;  1QAK A;  1EQK A;  2CWV A;  4HBR A;  3OWU A;  3CXC 2;  2M7O A;  4TX4 A;  4OUQ A;  3HZP A;  1WQL B;  1RGC A;  3F14 A;  1UCL A;  2WO0 A;  1SAR A;  4RNY A;  5AI1 A;  4BTW A;  1U5O A;  3PCR A;  1RJO A;  1WMP A;  4N6N B;  3BNE A;  2OCT A;  3DM8 A;  5IG0 A;  4K1U A;  2R41 A;  4IPB A;  1KC8 4;  3NX0 A;  2HOH A;  1Q7H A;  2IY2 A;  1Q40 A;  2L1S A;  3CCQ 3;  2F86 B;  1Q86 4;  1VQM 3;  2OTJ 3;  5IEN A;  2F99 A;  1K41 A;  4HOH A;  1IQX A;  4L8O A;  2W0Q A;  3A76 A;  3EN8 A;  1LVN A;  1BRH A;  3CNX A;  1D6Y A;  4I5Q A;  8CHO A;  3KE7 A;  1ASK A;  1ZO2 A;  1K73 4;  2OOV A;  1FGO A;  2RBI A;  4LEH A;  2XF3 A;  3N54 B;  4KVH A;  2P09 A;  3G4S 3;  2CFL A;  1KSI A;  3DUK A;  3WOF B;  3X3Y A;  1RGE A;  2HML B;  2XR8 B;  2H0H A;  3ECF A;  1IYY A;  2QA4 3;  3K9M C;  3MYT A;  2R4I A;  1BNR A;  1UCJ A;  3H51 A;  1BSE A;  1WTH A;  3EHC A;  4LZI A;  1UI8 A;  5G1L A;  3ZG0 A;  2K3D A;  2UUG C;  1ZX2 A;  1T5Y A;  1Y4K A;  2BT3 A;  1BAO A;  1X1W A;  3OX9 A;  5I97 A;  1R4C A;  5ELU A;  3LT9 A;  1YGE A;  3OWS A;  2QIY A;  3HX8 A;  3VGN A;  3MHE A;  1I0V A;  1LOV A;  2K54 A;  3MSO A;  4HM0 B;  7RNT A;  2WGO A;  6STD A;  2CX1 A;  3UB1 A;  4RZM A;  4N6V 0;  4K90 B;  2KF5 A;  4MJD A;  5M1A A;  1SII A;  4FCJ A;  1VQ7 3;  2I9W A;  1NNV A;  3JUM A;  1D6Z A;  1Q7Y 4;  3QK9 A;  1MGR A;  3AHS A;  1BU4 A;  3HII A;  1RRH A;  5AIG A;  3N8B A;  5BU4 A;  4FCM A;  4EW5 A;  2HMO B;  4ILF A;  3EBT A;  1O7G B;  3NHX A;  5STD A;  4HM3 B;  1UCK A;  4O3V A;  1GMP A;  5FW5 A;  1R4Y A;  4HM7 B;  4IT7 A;  2Z77 A;  2C10 A;  2IUJ A;  9RNT A;  2CW9 A;  3NQY A;  3BIR A;  5IG3 A;  1D6U A;  3M8C A;  1EG9 B;  1QAF A;  1O7H B;  5EQL A;  3T8N A;  2KF6 A;  3S27 A;  5KP3 A;  3F8X A;  3X42 A;  5CLK A;  3GWR A;  4J8T A;  1OAC A;  1RHL A;  1FGR A;  3KZT A;  1B2Z A;  4GSP A;  3GZB A;  2CH9 A;  1OF5 A;  2J8X B;  4R4K A;  1RGH A;  5IF6 A;  1O7M B;  1G02 A;  2GBX B;  1JB2 A;  3KII A;  3NV0 A;  1I2G A;  2XGN A;  3SED A;  1UUG B;  3WOD G;  2CFD A;  3O8Y A;  2STD A;  1BSA A;  1BRI A;  2O9U X;  1RNT A;  4WHA A;  1B2M A;  1RNB A;  3OW2 2;  1OH0 A;  4R9L A;  2FXT A;  4LYL B;  3LTC A;  1G96 A;  2HMJ B;  4X2H A;  3CCS 3;  1TFO A;  1RRL A;  2CWU A;  1LNH A;  3CPO A;  1FUW A;  3LYG A;  1NO3 A;  3Q1C A;  4ORL A;  1A2K A;  1GMQ A;  1B2X A;  1IVW A;  1I70 A;  2BHM A;  2LYX A;  3RNT A;  2ML6 A;  2P05 A;  1IDP A;  1FGT A;  1W00 A;  1AQZ A;  1CYU A;  1RGA A;  2INX A;  4XDV A;  5BVB A;  2F98 A;  2IA7 A;  3NBR A;  1VQ8 3;  4FR9 A;  3DGY A;  4G1M B;  4XDW A;  1I2F A;  4BU4 A;  1FYS A;  3CCE 3;  1JBT A;  1RN1 A;  1YJN 3;  1BRJ A;  1T3B A;  1JBR A;  3BNB A;  4K1V A;  4BTY A;  2B24 B;  2XGL A;  1IVU A;  4EXR A;  1YIT 3;  4GL6 A;  1A67 A;  2XSO B;  2PZV A;  3RDE A;  2GU3 A;  3NV0 B;  4N6T A;  5IG4 A;  1JRQ A;  2K0M A;  4H3U A;  2XRX B;  1RGF A;  3JUN A;  3NXJ A;  3NBB A;  4HAA A;  1DET A;  2IYJ A;  1OHO A;  1TRP A;  1M1K 4;  1RCK A;  1Z1S A;  1IU7 A;  5LC7 A;  2P38 A;  1LQM B;  2BNG A;  3GZX B;  3IJE B;  4BL2 A;  1YI2 3;  2CG1 A;  1YJ9 3;  1IVV A;  1GMR A;  2KXG A;  2CG0 A;  2OTL 3;  3QRD A;  1W2Z A;  1NB5 I;  1I2E A;  1OPY A;  3KCH A;  4HJL B;  3PCS A;  3KKG A;  1VQO 3;  3CPW 2;  1BRG A;  2KCD A;  3D5I A;  3UL5 A;  1B21 A;  2KRT A;  2WOF A;  4KFE A;  5LC6 A;  1JBS A;  3FCS B;  3HOH A;  3BB9 A;  3JUP A;  4HM5 B;  1JV2 B;  1VQ9 3;  3NQZ A;  4RNT A;  1VQL 3;  2QEX 3;  3WHO A;  2Z76 A;  4I4K A;  4J5K A;  5DRE A;  2PNC A;  1GY5 A;  1PFP A;  4CCV A;  2F5W A;  3I55 3;  2OOV C;  2UX0 A;  1JJ2 2;  2W9P A;  2E2U A;  1J2B A;  2GEX A;  8RNT A;  3CC4 3;  4JF8 A;  1DE3 A;  2IUK A;  3IPT A;  2AAE A;  1LXE A;  1V57 A;  3JUO A;  3KFQ C;  4FMC A;  3WMD A;  4MMZ B;  2F4Y A;  3I0Y A;  1BUQ A;  1DVD A;  2CC3 A;  3MKI A;  5DRV A;  1ZS7 A;  3NBJ A;  1NWW A;  1U8C B;  4EBG A;  4H61 A;  2WOH A;  1TJD A;  2XEP A;  3EJV A;  7STD A;  5IEO A;  5HGR A;  3ZFZ A;  5AEW B;  1ZGX A;  3L0R A;  1VQQ A;  4WYK A;  1KWI A;  4HM4 B;  4HZ9 B;  1S5A A;  3PZW A;  4HKV B;  1B3S A;  1EUI C;  2GXF A;  3EBY A;  3FKA A;  4MEI A;  2CKF B;  2KAA A;  2BMR B;  1UGI A;  3S5C A;  1KD1 4;  4AEQ A;  1TIJ A;  1X1Y A;  2GSP A;  3BND A;  4HYZ A;  3CMA 3;  3KN4 A;  2HMM B;  4Q53 A;  2YFL B;  3G0K A;  3LT8 A;  1Q9E A;  2RFR A;  5BXQ A;  1YVS A;  1GS3 A;  1TTO A;  3WR2 A;  1VQN 3;  2RGQ A;  2W6J H;  1BNS A;  3FF0 A;  3RGA A;  1X1U A;  3FH1 A;  1VQK 3;  3Q90 A;  3N9H A;  2W03 A;  1LOX A;  3NM2 A;  4XBY A;  3WOE B;  1LOY A;  1LOW A;  2OQE A;  4KFD A;  1TUH A;  3SOY A;  1YHQ 3;  5G2G A;  4OK0 A;  4KZ1 A;  1JZO A;  3S28 A;  3B4P A;  5D82 A;  5D81 A;  2UGI A;  3LXU X;  5AIH A;  1AY7 A;  2CFK A;  1AR0 A;  2XFT A;  2GBW B;  3GRD A;  3PYJ A;  1MWR A;  1STF I;  1IVX A;  2W56 B;  2ZL8 A;  4AKY A;  1N9E A;  2XH9 A;  7GSP A;  2Q07 A;  3CCM 3;  4WYK B;  1G0T A;  2CHC A;  5AIF A;  3AHW A;  3S29 A;  1JB4 A;  3HI7 A;  3PS8 A;  5G1K A;  2LQV A;  2ZDJ A;  3GZR A;  2GEY A;  2RCD A;  1BNJ A;  3F8H A;  4WWU C;  1AVL A;  1W6G A;  3FGY A;  3MPH A;  1ROA A;  4STD A;  1Q42 A;  3G16 A;  1K28 A;  5AEU B;  4BL3 A;  2YFI B;  1AV4 A;  1A2V A;  1I8V A;  1Q82 4;  1SQW A;  1VQP 3;  1B20 A;  5KP1 A;  2W9Q A;  1K8A 4;  4XB5 A;  4HM2 B;  2V1L A;  2CFG A;  1UCI A;  1I3I A;  1OGX A;  3CCR 3;  1BVI A;  1GYB A;  1FZU A;  1T2I A;  2P0M A;  4HVN A;  4J9A A;  3WDG B;  5HOH A;  3FG3 A;  4JRF A;  1BIR A;  1EKM A;  1GOU A;  1OGZ A;  2H0G A;  2JQ5 A;  2P0X A;  1GOY A;  1T2H A;  2CIU A;  5RNT A;  4HM1 B;  4O02 B;  1RN4 A;  2AAD A;  3E99 A;  1BUJ A;  1MGW A;  2FGT A;  1JZD A;  2H0I A;  1W02 A;  2MC8 A;  3BLZ A;  3V99 A;  3GZY B;  2BIR A;  2Z6B A;  3D5G A;  2YFJ B;  1MWS A;  3CCV 3;  2HMK B;  3SYU A;  4MMX B;  4AKZ A;  1VZZ A;  1FUT A;  3EE1 A;  3DMC A;  4FMD A;  4N3V A;  5A0O B;  5AII A;  2W04 A;  3ER7 A;  2YX9 A;  2W2C A;  4WP5 A;  1FA3 A;  3LTB A;  1IQ8 A;  1UUV B;  4N6L A;  1CQS A;  2KF3 A;  3FF2 A;  3EB8 A;  1JKG B;  5JPP A;  5M19 A;  1E97 A;  1QMA A;  4PEJ A;  1BRS A;  3K7C A;  1ROV A;  1PY3 A;  5CK6 A;  2Z7A A;  3SX1 A;  1RMS A;  1DYU A;  3F7S A;  4FMA A;  3T8U A;  4O8S A;  2C11 A;  3G8Z A;  1RN7 A;  2OWP A;  3LTA A;  3D3L A;  2QGU A;  5D83 A;  3SLU A;  5KP4 A;  3F40 A;  4U13 A;  1LNI A;  2F56 A;  3SXX A;  1GY7 A;  1W5Z A;  2D42 A;  1ULI B;  1DMM A;  1I3F A;  1IQY A;  1DMN A;  1RLS A;  3CC7 3;  3BU4 A;  1IV9 A;  1A90 A;  1OHS A;  2IMJ A;  1HYF A;  1N8R 4;  3EC9 A;  3Q3F A;  4KT3 B;  4BTX A;  1BSC A;  1MWU A;  1BNI A;  1N8Q A;  1K9M 4;  1RTU A;  4N6M A;  4K61 A;  5EVH A;  3PGB A;  1W01 A;  3EF8 A;  1CYV A;  1GD3 A;  1TRQ A;  5JBS A;  1Q81 4;  5EEO A;  3WA2 X;  2E2T A;  4HM6 B;  3CCL 3;  1W4N A;  3AGO A;  4EYC A;  2ZHX B;  5CF1 A;  1RKY A;  1BRN L;  4RNZ A;  3CME 3;  3DGL A;  3D79 A;  3STD A;  4XBX A;  5TGN A;  3HK4 A;  1HZ1 A;  4R1K A; 
#chains in the Genus database with same CATH homology
 4NHF A;  3K63 A;  1IV7 A;  2W56 A;  3PXM A;  3EQQ B;  4R9K A;  1N9J A;  1QJG A;  4IIA A;  1HU9 A;  1IK3 A;  4EV5 A;  1M1X B;  3B4O A;  2O3O A;  5AYS C;  1ISK A;  2BMO B;  3U1W A;  3FZW A;  3CC2 3;  3DZL A;  3U97 A;  4O2H A;  4GB5 A;  1S72 3;  1VQ4 3;  2RSX A;  2XSH B;  3BNC A;  3I56 3;  1W2B 2;  2BMQ B;  1W6Y A;  3RGR A;  4XM4 A;  2MF7 A;  3CD6 3;  2SBL A;  3IMA B;  3NM7 A;  2OQE C;  3T0U A;  2FNQ A;  1US1 A;  4HM8 B;  3TDG A;  1O7N B;  4ZM8 A;  3JUQ A;  2E2V A;  4EV2 A;  5IER A;  3CU3 A;  3FSD A;  4L7K A;  4R80 A;  1QVF 2;  1E3R A;  1NB3 I;  3AMO A;  1O7W B;  3S67 A;  3X40 A;  4EC6 A;  1JN5 A;  3F7X A;  1FGM A;  4LGQ A;  3Q2P A;  1STD A;  1W7C A;  4CDL A;  3CCU 3;  3G71 3;  3H3H A;  3ALA A;  5AYR B;  3SVA A;  1Q40 B;  1GY6 A;  2D1W A;  1AVK A;  3JVC A;  3B7C A;  1OUN A;  2JDI H;  3DY5 A;  3K0Z A;  1MOL A;  1IT8 A;  4HZB B;  4XBT A;  5CXO A;  2Y73 A;  3VF1 A;  5IW9 A;  1HKX A;  1TP6 A;  1UUW B;  1V74 A;  3KSP A;  1SJW A;  3HIG A;  1WMO A;  1OCV A;  2HMN B;  1IT7 A;  1DVC A;  1JKG A;  1L5G B;  3MG3 A;  2BO9 B;  3MG1 A;  1YIJ 3;  3F9S A;  3LH4 A;  3NUV A;  4FCZ A;  1EA2 A;  1PU4 A;  1WNH A;  3UL6 A;  3DGN A;  3AMO B;  3LTD A;  1VQ6 3;  1GD4 A;  2WGQ A;  3GAX A;  3CNM A;  1JN5 B;  2L4V A;  4OVM A;  3X3X A;  1OHP A;  3KSE D;  1M90 4;  1O7P B;  1JB5 A;  3EX9 A;  2ML5 A;  1ULJ B;  3X41 A;  2CK3 H;  3UNL A;  3FG4 A;  2CFW A;  1SIH A;  1DMQ A;  1YVB I;  1W6C A;  4FMB A;  4N6U A;  4N6O B;  1CEW I;  3G6E 3;  3EN1 B;  1YJW 3;  3LOY A;  4LMI A;  4RBN A;  5CF2 A;  5FGO A;  1TFK A;  5IEP A;  3J7Y d;  1F8N A;  1FGQ A;  3LZA A;  1E3V A;  1M9G A;  1UW1 A;  2B1X B;  2CWT A;  3OWY A;  1SPU A;  3ROB A;  2XFS A;  3V92 A;  4X2O A;  3DXO A;  3VSY A;  1QVG 2;  1N5H A;  2Y74 A;  3OXA A;  3SOA A;  5ELJ A;  4WFO A;  3WA3 A;  1QAL A;  4L8P A;  1TU5 A;  1OF5 B;  1NDO B;  1NU3 A;  3DGM A;  1MNL A;  3B8L A;  3D9R A;  5JPU A;  3MG2 A;  3DGO A;  1WMN A;  4LSO A;  3LML A;  4MMY B;  4NRE A;  3X3Z A;  3UJM A;  3K5T A;  1C7H A;  3V98 A;  1KQS 2;  2GU1 A;  3MWZ A;  3CCJ 3;  1NJI 4;  1N5P A;  2A15 A;  1JNQ A;  3FG1 A;  3OV4 A;  4QWT A;  3FLJ A;  1UI7 A;  1VQ5 3;  5IG5 A;  4KFF A;  1QAK A;  1EQK A;  2CWV A;  4HBR A;  3OWU A;  3CXC 2;  2M7O A;  4TX4 A;  4OUQ A;  3HZP A;  1WQL B;  3F14 A;  2WO0 A;  4RNY A;  5AI1 A;  4BTW A;  1U5O A;  3PCR A;  1RJO A;  1WMP A;  4N6N B;  3BNE A;  2OCT A;  3DM8 A;  5IG0 A;  4K1U A;  4IPB A;  1KC8 4;  3NX0 A;  1Q40 A;  3CCQ 3;  2F86 B;  1Q86 4;  1VQM 3;  2OTJ 3;  5IEN A;  2F99 A;  1K41 A;  4L8O A;  1IQX A;  2W0Q A;  3A76 A;  3EN8 A;  1LVN A;  3CNX A;  1D6Y A;  8CHO A;  3KE7 A;  1ASK A;  1ZO2 A;  1K73 4;  2OOV A;  1FGO A;  4LEH A;  2XF3 A;  3N54 B;  4KVH A;  2P09 A;  3G4S 3;  2CFL A;  1KSI A;  3DUK A;  3WOF B;  3X3Y A;  2XR8 B;  2HML B;  3ECF A;  2QA4 3;  3K9M C;  3MYT A;  2R4I A;  3H51 A;  1WTH A;  3EHC A;  4LZI A;  1UI8 A;  1ZX2 A;  1T5Y A;  1Y4K A;  2BT3 A;  3OX9 A;  5I97 A;  1R4C A;  5ELU A;  3LT9 A;  1YGE A;  3OWS A;  2QIY A;  3HX8 A;  3VGN A;  3MHE A;  2K54 A;  3MSO A;  4HM0 B;  2WGO A;  6STD A;  3UB1 A;  4RZM A;  4N6V 0;  4K90 B;  4MJD A;  1SII A;  4FCJ A;  1VQ7 3;  2I9W A;  3JUM A;  1D6Z A;  1Q7Y 4;  3QK9 A;  3HII A;  1RRH A;  5AIG A;  3N8B A;  4FCM A;  2HMO B;  3EBT A;  1O7G B;  3NHX A;  5STD A;  4HM3 B;  4O3V A;  5FW5 A;  4HM7 B;  4IT7 A;  2Z77 A;  2C10 A;  2IUJ A;  2CW9 A;  3NQY A;  5IG3 A;  1D6U A;  3M8C A;  1EG9 B;  1QAF A;  1O7H B;  5EQL A;  3T8N A;  3S27 A;  5KP3 A;  3F8X A;  3X42 A;  5CLK A;  3GWR A;  4J8T A;  1OAC A;  1FGR A;  3KZT A;  3GZB A;  2CH9 A;  1OF5 A;  4R4K A;  5IF6 A;  1O7M B;  2GBX B;  1JB2 A;  3KII A;  3NV0 A;  2XGN A;  3SED A;  3WOD G;  2CFD A;  3O8Y A;  2STD A;  2O9U X;  4WHA A;  3OW2 2;  1OH0 A;  4R9L A;  2FXT A;  3LTC A;  1G96 A;  2HMJ B;  4X2H A;  3CCS 3;  1TFO A;  1RRL A;  2CWU A;  1LNH A;  3CPO A;  1FUW A;  3LYG A;  1NO3 A;  3Q1C A;  4ORL A;  1A2K A;  1IVW A;  2BHM A;  2LYX A;  2ML6 A;  2P05 A;  1IDP A;  1FGT A;  1W00 A;  1CYU A;  2INX A;  4XDV A;  5BVB A;  2F98 A;  2IA7 A;  3NBR A;  1VQ8 3;  4FR9 A;  4G1M B;  4XDW A;  3CCE 3;  1YJN 3;  3BNB A;  4K1V A;  4BTY A;  2B24 B;  2XGL A;  1IVU A;  4EXR A;  1YIT 3;  4GL6 A;  1A67 A;  2XSO B;  2PZV A;  3RDE A;  2GU3 A;  3NV0 B;  4N6T A;  5IG4 A;  1JRQ A;  2K0M A;  4H3U A;  2XRX B;  3JUN A;  3NXJ A;  3NBB A;  1OHO A;  1M1K 4;  1Z1S A;  1IU7 A;  5LC7 A;  2P38 A;  2BNG A;  3IJE B;  3GZX B;  1YI2 3;  1YJ9 3;  2OTL 3;  2CG1 A;  1IVV A;  2KXG A;  2CG0 A;  3QRD A;  1W2Z A;  1NB5 I;  1OPY A;  4HJL B;  3PCS A;  3KKG A;  1VQO 3;  3CPW 2;  2KCD A;  3UL5 A;  2KRT A;  2WOF A;  4KFE A;  5LC6 A;  3FCS B;  3BB9 A;  3JUP A;  4HM5 B;  1JV2 B;  1VQ9 3;  3NQZ A;  1VQL 3;  2QEX 3;  2Z76 A;  4I4K A;  5DRE A;  2PNC A;  1GY5 A;  1PFP A;  4CCV A;  3I55 3;  2OOV C;  2UX0 A;  1JJ2 2;  2W9P A;  2E2U A;  1J2B A;  2GEX A;  3CC4 3;  4JF8 A;  2IUK A;  3IPT A;  3JUO A;  1LXE A;  3KFQ C;  4FMC A;  3WMD A;  4MMZ B;  3I0Y A;  1BUQ A;  1DVD A;  2CC3 A;  3MKI A;  5DRV A;  3NBJ A;  1NWW A;  1U8C B;  4EBG A;  4H61 A;  2WOH A;  2XEP A;  3EJV A;  7STD A;  5IEO A;  5HGR A;  5AEW B;  3L0R A;  4WYK A;  1KWI A;  4HM4 B;  4HZ9 B;  1S5A A;  3PZW A;  4HKV B;  2GXF A;  3FKA A;  3V99 A;  3EBY A;  1KD1 4;  4MEI A;  2CKF B;  2BMR B;  3S5C A;  4AEQ A;  1TIJ A;  3BND A;  3CMA 3;  4HYZ A;  3KN4 A;  2HMM B;  4Q53 A;  2YFL B;  3G0K A;  3LT8 A;  2RFR A;  5BXQ A;  1VQN 3;  1GS3 A;  2RGQ A;  2W6J H;  3FF0 A;  3RGA A;  1VQK 3;  3FH1 A;  3Q90 A;  3N9H A;  2W03 A;  1LOX A;  3NM2 A;  4XBY A;  3WOE B;  2OQE A;  4KFD A;  1TUH A;  3SOY A;  1YHQ 3;  5G2G A;  4OK0 A;  4KZ1 A;  3S28 A;  3B4P A;  5D82 A;  5D81 A;  3LXU X;  5AIH A;  2CFK A;  1AR0 A;  2XFT A;  2GBW B;  3GRD A;  3PYJ A;  4AKY A;  1STF I;  1IVX A;  2W56 B;  2ZL8 A;  1N9E A;  2XH9 A;  2Q07 A;  3CCM 3;  4WYK B;  2CHC A;  5AIF A;  3S29 A;  1JB4 A;  3HI7 A;  3PS8 A;  2LQV A;  2ZDJ A;  3GZR A;  2GEY A;  2RCD A;  3F8H A;  4WWU C;  1AVL A;  1W6G A;  3FGY A;  3MPH A;  1ROA A;  4STD A;  1Q42 A;  3G16 A;  1K28 A;  5AEU B;  2YFI B;  1AV4 A;  1A2V A;  1Q82 4;  1SQW A;  1VQP 3;  5KP1 A;  2W9Q A;  1K8A 4;  4XB5 A;  4HM2 B;  2V1L A;  2CFG A;  1OGX A;  3CCR 3;  1GYB A;  4HVN A;  2P0M A;  3WDG B;  4J9A A;  3FG3 A;  4JRF A;  1EKM A;  1OGZ A;  2JQ5 A;  2P0X A;  2CIU A;  4HM1 B;  4O02 B;  3E99 A;  2FGT A;  1W02 A;  2MC8 A;  3BLZ A;  3GZY B;  2Z6B A;  2YFJ B;  3CCV 3;  2HMK B;  4MMX B;  4AKZ A;  1VZZ A;  3EE1 A;  4FMD A;  3DMC A;  4N3V A;  5A0O B;  5AII A;  2W04 A;  3ER7 A;  2YX9 A;  2W2C A;  4WP5 A;  1FA3 A;  3LTB A;  1IQ8 A;  1UUV B;  4N6L A;  1CQS A;  3FF2 A;  3EB8 A;  1JKG B;  5JPP A;  1E97 A;  1QMA A;  4PEJ A;  3K7C A;  1ROV A;  5CK6 A;  2Z7A A;  3SX1 A;  1DYU A;  3F7S A;  4FMA A;  3T8U A;  4O8S A;  2C11 A;  3G8Z A;  1RN7 A;  2OWP A;  3LTA A;  3D3L A;  2QGU A;  5D83 A;  3SLU A;  5KP4 A;  3F40 A;  4U13 A;  3SXX A;  1GY7 A;  1W5Z A;  2D42 A;  1ULI B;  1DMM A;  3CC7 3;  1IQY A;  1DMN A;  1A90 A;  1IV9 A;  1OHS A;  2IMJ A;  1N8R 4;  3EC9 A;  4BTX A;  1N8Q A;  1K9M 4;  4N6M A;  4K61 A;  5EVH A;  3PGB A;  1W01 A;  3EF8 A;  1CYV A;  1GD3 A;  5JBS A;  1Q81 4;  5EEO A;  3WA2 X;  2E2T A;  4HM6 B;  3CCL 3;  1W4N A;  1RKY A;  4EYC A;  5CF1 A;  4RNZ A;  3CME 3;  3DGL A;  3STD A;  4XBX A;  5TGN A;  3HK4 A;  4R1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...