3G6E3

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3g6e300
1VQN3 3CPW2 3CCM3 1YIJ3 1KC84 3CCJ3 3CXC2 3CD63 1K9M4 1VQ53 1VQ83 3CCS3 1KQS2 3CC23 1Q824 1K734 1KD14 1YJ93 1VQL3 1K8A4 1S723 1VQ93 3CMA3 3CC73 3I553 1M904 1QVF2 1NJI4 3CC43 1QVG2 1YIT3 2QEX3 3CCU3 3CCV3 2QA43 1VQ73 1VQP3 2OTJ3 3G713 1YJN3 1YJW3 3I563 3CCE3 1VQK3 1YI23 1N8R4 1W2B2 1Q814 1JJ22 1VQ43 2OTL3 1Q7Y4 3CCL3 1Q864 3G6E3 3CME3 1VQM3 1YHQ3 3OW22 3G4S3 1M1K4 1VQO3 1VQ63 3CCR3 3CCQ3
chains in the Genus database with same CATH superfamily
1I3IA 3B4OA 1FYSA 4MMZB 3F14A 3F8XA 4IT7A 3LT8A 4O8SA 3ZG0A 1SJWA 4R4KA 5G1LA 5BU4A 1O7PB 3UL6A 2BMQB 3BIRA 1K734 1OGXA 1RHLA 5G2GA 1QMAA 1EQKA 3N9HA 1KWIA 1RN7A 2IYJA 3PGBA 3N54B 4JF8A 5RNTA 1DE3A 3JUQA 1BIRA 4HKVB 4CPKA 4HYZA 2KCDA 3D9RA 3NV0B 2WOFA 4J8TA 1NB5I 1SQWA 2CWVA 4EC6A 1GOVA 4J9AA 4N6V0 4HM1B 1JB4A 1RCLA 2HMJB 3WOEB 3BNBA 5BIRA 2HMLB 5DRVA 2L4VA 1C54A 3EC9A 3BLZA 4HBRA 2CG1A 1E97A 2GBXB 5BXQA 1I2FA 1F8NA 3CCQ3 3D5IA 3MKIA 6STDA 3WA2X 2GBWB 3CPW2 1GMRA 1N5PA 1UUVB 1SARA 1B21A 3S28A 1BSDA 2ZL8A 2XSOB 3T0UA 2QGUA 1FGRA 1I2EA 3FG1A 8RNTA 3H3HA 2KF5A 1Q42A 3G16A 3LTAA 3X3ZA 1LNIA 2Z77A 1BRGA 1OCVA 3STDA 1JB2A 1ZO2A 4FR9A 1ASKA 3SOYA 1UCIA 3ZG5A 2QA43 2B1XB 3EF8A 4ORLA 5D83A 1VQK3 2P38A 1RGAA 1Q814 3F7XA 2H0IA 1OUNA 1L5GB 3QK9A 1JN5A 3EQQB 4EV5A 1SIIA 3GSPA 4FMDA 2GEXA 3MWZA 2E2TA 4OK0A 1WNHA 2XF3A 3NX0A 4I5QA 3Q3FA 1BUJA 2RBIA 2SARA 1TJDA 1LOVA 1RSNA 3ER7A 3LTCA 3E99A 3HIIA 2QIYA 2K3DA 3KN4A 1TFOA 3FG4A 2LYXA 2WGOA 1GYBA 1RJOA 1W00A 5KP3A 1ZX2A 3CCS3 4AEQA 1W5ZA 1FZUA 2OOVC 4NHFA 1Q40B 1X1WA 3GZRA 3X41A 3ECFA 2I9WA 3D3LA 4R9LA 3X3XA 2AAEA 2XFTA 1GSPA 3FSDA 4EV2A 2E2UA 4K1VA 2Z6BA 3CCE3 2F98A 2JQ5A 1WMPA 1MGRA 1UDII 3RDEA 5IG4A 1OH0A 1W2B2 2C11A 3O8YA 1FUWA 1Q864 3NUVA 1IVXA 3TDGA 1LVNA 1PYLA 3NQYA 1PY3A 1B2MA 1BNRA 1VQN3 5AYRB 3Q2PA 3LXUX 2BNGA 3LT9A 3IPTA 4HM8B 1UW1A 1QALA 3SLUA 2MF7A 4GSPA 1W01A 1W6CA 2YFIB 3IJEB 1D6ZA 5IERA 2W04A 2YFLB 1YVSA 3UNLA 4HM6B 1VQL3 1BRKA 2CFWA 3NBRA 3PZWA 1ROAA 3SX1A 1YGEA 5IF6A 1NJI4 2MC8A 1QVF2 1B2ZA 7RNTA 1AR0A 3CCU3 1JZOA 1B20A 4N6UA 2JDIH 5EQLA 1DVCA 1JB5A 2BO9B 2UGIA 4FMAA 4NPBA 2CK3H 5D81A 3U1WA 4LGQA 1RRLA 3VSYA 2CC3A 3N8BA 1RCKA 2KXGA 3KSED 2R41A 1FGMA 1DETA 4FCMA 1NB3I 1FGOA 1SIHA 3OXAA 1LOWA 1UUWB 1FGTA 2Z76A 2W56A 3AMOA 4RNYA 4X2HA 5TGNA 2W6JH 6GSPA 3Q90A 4XM4A 5D82A 2IY2A 1STFI 5AEWB 3B8LA 1WMNA 3PYJA 1D6YA 1YJ93 1HZ1A 1TP6A 4LMIA 8CHOA 1R4YA 3OWSA 3MG3A 3CPOA 1LOYA 4KT3B 3SXXA 3UL5A 4STDA 1WQLB 3D5GA 1O7HB 1UCJA 2XRXB 4AKZA 1JRQA 1R4CA 3KIIA 3FLJA 4PEJA 2IA7A 3S5CA 2IUJA 3S67A 3I563 1RLSA 3JUPA 3MPHA 1EEJA 4WFOA 3B4PA 1OGZA 5AIIA 1HKXA 2KRTA 1VQM3 1UGHI 1N9JA 2SBLA 3AHSA 3GRDA 4LSOA 4TX4A 1RGEA 1MWRA 7GSPA 1U8CB 5ELJA 2L1SA 1ULIB 1VZZA 1KC84 4K90B 2CFKA 2W03A 3A5EA 4N6NB 1GY6A 1GY7A 2CHCA 3KKGA 3RGAA 4KFFA 2F5WA 3AGOA 1RN1A 4HZ9B 4NREA 2WOHA 3UB1A 4ILFA 1QVG2 2CWTA 2KF4A 5FGOA 2O9UX 1YIT3 4N6LA 1BSBA 3F40A 1SPUA 4HJLB 5STDA 1ISKA 3FH1A 2A15A 2CH9A 3AHWA 3KZTA 4I4KA 3FZWA 3X3YA 5M19A 1Q7Y4 4FCJA 1RMSA 4IIAA 1ULJB 1W2ZA 4L8OA 4LYLB 1X1XA 4BTYA 5IEPA 1M9GA 3EBYA 1NNVA 4O3VA 3U97A 1CYUA 1LXEA 2HMOB 1IQ8A 2PZVA 5M18A 3G0KA 1GOUA 3CD63 2XFSA 1PFPA 3EB8A 2CFDA 2BU4A 4KVHA 5M1AA 2YFJB 1VQ93 2WGQA 1I2GA 3LOYA 2GSPA 1JBRA 1CH0A 2BIRA 2Y73A 3PS8A 5JBSA 5BVBA 3KSPA 4LZIA 3GZXB 2QEX3 1B27A 1VQP3 1A90A 1FUSA 2K54A 1NO3A 1IQXA 1MGWA 5LC7A 1Q7HA 1N8R4 4HM5B 4XDWA 1WMOA 1O7GB 4L8PA 3F8HA 4MJDA 3GAXA 5IEOA 2K0MA 2GU1A 3MSOA 3DGOA 2RCDA 3T8UA 1VQ63 4HVNA 2CX1A 3CCR3 3F7SA 1B2SA 1GMQA 3AGNA 2C10A 2P09A 2XEPA 2XH9A 5CXOA 6RNTA 3CCM3 1CEWI 4CJNA 3NM7A 4K61A 3SVAA 1Y4KA 2R4IA 3FF2A 1NDOB 3DGLA 1IV9A 3HZPA 1Z1SA 2FNQA 1K8A4 3SOAA 1JN5B 1RKYA 1IQYA 1LRAA 3K5TA 3BB9A 1CQSA 1A67A 3DGMA 1M1XB 1IT8A 1OHPA 3A76A 3CCV3 2OTJ3 1DMQA 3PCSA 4MMXB 2Y74A 3DM8A 1G02A 3BNEA 1TUHA 2YX9A 1DYUA 2OTL3 4KFEA 5AIFA 1OF5A 5CF1A 2AADA 1IVWA 4BIRA 1T5YA 2IUKA 4HOHA 1NWWA 3I0YA 1LQMB 2V1LA 2INXA 1K9M4 1FGQA 3FG3A 3K0ZA 3X40A 3PCRA 5IG0A 1Q824 1UI8A 3CMA3 3DUKA 1OF5B 4BTWA 3HIGA 1JZDA 3ALAA 2ML6A 1BNEA 2PNCA 2HMNB 2STDA 3EX9A 4WYKA 1I3FA 1GD3A 1IK3A 3LZAA 5IG3A 2CIUA 3G713 1BSCA 1JBSA 1BAOA 3D79A 3ROBA 3K9MC 4BL2A 3WMDA 1BRHA 1MWSA 2F56A 4RZMA 2GU3A 5FW5A 3WDGB 3G4S3 3OW22 1ZS7A 1N5HA 2W2CA 1KSIA 1RGKA 4WYKB 3JUNA 5G1KA 1QAKA 1BU4A 1BGSA 4HM7B 2OQEA 5LC6A 1EKMA 1Q9EA 1X1YA 3KFQC 1TU5A 2F5MA 4FCZA 4N6MA 1MWTA 1RGHA 2HOHA 1O7WB 1IT7A 2RGQA 1IV7A 2KF6A 1O7NB 3HI7A 4RNZA 4XBYA 1OACA 3MHEA 1BOXA 1VQ73 1IVUA 3AMOB 2W56B 2FGTA 4HM3B 1STDA 1J2BA 1B2UA 1A2KA 2F4YA 3MG2A 1IVVA 1BNJA 2RNTA 2KAAA 3OWYA 3SEDA 3V92A 1QJGA 4G1MB 3DY5A 1AY7A 1RRHA 1BNIA 4J5KA 7STDA 1YVBI 1GS3A 1RDSA 1VQ53 3X42A 1JV2B 3L0RA 3J7Yd 4HAAA 5IW9A 2F99A 1MNLA 2LQVA 3I553 1IU7A 2UUGC 3FGYA 4FMBA 3GZYB 3EBTA 3EE1A 4KFDA 3F9SA 1OHOA 1VQQA 1LNHA 1FUTA 1RTUA 1UCKA 2D1WA 3NBBA 4OVMA 1GD4A 5KP1A 1YJW3 5AEUB 1RGLA 2OCTA 5DREA 3DXOA 1HU9A 2IMJA 3H51A 2WO0A 1BRJA 3CNMA 4JRFA 3NXJA 5GSPA 1N9EA 3HOHA 2OWPA 1YGWA 2RSXA 3UJMA 4EXRA 2HMMB 3BNDA 4O02B 3DMCA 4U13A 4MEIA 3BU4A 2Z7AA 3K63A 4R1KA 1IYYA 4WWUC 1NU3A 2ZA4A 1GMPA 4LEHA 1LQGC 3K7CA 4FMCA 3MYTA 4N6TA 1AVLA 2Q07A 3GZBA 1RNBA 5AIHA 3CC43 4BU4A 1D6UA 1AVKA 2H0GA 2F86B 3EHCA 4R80A 3ZFZA 1VQ43 1OHSA 2CWUA 1BRIA 3T8NA 1RGGA 2W0QA 9RNTA 4GB5A 1BRNL 3CME3 1O7MB 4H3UA 2XR8B 3V99A 1YHQ3 2XGNA 1GY5A 1K28A 4BTXA 3WHOA 5AYSC 1UUGB 3WODG 2GXFA 2CFGA 1AQZA 4MMYB 3M8CA 4BL3A 4EBGA 1WTHA 1YIJ3 2OQEC 4HM0B 2ZHXB 2O3OA 3B7CA 3FF0A 1VQ83 3HX8A 1ROVA 2W9PA 2E2VA 2H0HA 3GWRA 3KCHA 4K1UA 1T2HA 3WA3A 3JUMA 1I70A 3D4AA 3OX9A 4O2HA 2ML5A 4GL6A 3CC73 1BUQA 1GOYA 2CKFB 3JVCA 3CU3A 1I0VA 1RGFA 5A0OB 1S5AA 1YJN3 3G8ZA 4HZBB 1Q40A 1E3VA 4KZ1A 4XBXA 5ELUA 1V57A 2FXTA 1TTOA 1T2IA 2GEYA 1E3RA 5JPUA 1YNVX 1ZGXA 2CFLA 1BSAA 1FW7A 4HM4B 3OV4A 4HM2B 3RGRA 3V98A 3FKAA 1W7CA 5CK6A 1B2XA 4N3VA 3CXC2 1V74A 4EYCA 1FA3A 4OUQA 1KQS2 3BNCA 4DKIA 1S723 4CDLA 1JBTA 4GHOA 4H61A 5HOHA 2KF3A 1X1UA 3DZLA 5AIGA 1UCLA 3EN1B 3DGYA 1W6GA 1BRSA 4RBNA 1JJ22 1U5OA 5JPPA 2BT3A 4XBTA 5EVHA 2P0MA 3VF1A 1HYFA 2D42A 1M1K4 1DVDA 4ZM8A 1VQO3 2M7OA 1I0XA 4J5GA 4R9KA 2B24B 3NHXA 4EW5A 1RGCA 3QRDA 1K41A 2P0XA 3WOFB 5IENA 1EUIC 3WR2A 3NQZA 4QWTA 3NBJA 3JUOA 4RNTA 3CNXA 1BNGA 3DGNA 1JNQA 3DH2A 3LTBA 1BVIA 4WHAA 3CC23 1AV4A 1TRPA 1T3BA 1I8VA 1W4NA 1M904 1IDPA 1BSEA 3HK4A 5KP4A 2XSHB 1W02A 2BMOB 4X2OA 3FCSB 4N6OB 2RFRA 1TRQA 1BNFA 3LYGA 1YI23 1OPYA 3URPA 1MOLA 1US1A 3S27A 2CW9A 5AI1A 5IG5A 1DMMA 2C4BA 2CG0A 3OWUA 1W6YA 3SYUA 3RNTA 3IMAB 1BNSA 1RN4A 4Q53A 2W9QA 4AKYA 1UI7A 4CCVA 3VGNA 1PU4A 5I97A 2UX0A 2XGLA 4WP5A 1A2PA 2CX0A 1TFKA 2P05A 1CYVA 3CCJ3 1V58A 3NM2A 4XB5A 3S29A 1JKGA 1B3SA 1EG9B 3LTDA 1EA2A 5CLKA 5EEOA 3LMLA 1KD14 2J8XB 2ZDJA 2HMKB 1BANA 1QAFA 1G0TA 1UGIA 2BMRB 1MWUA 3EN8A 2BHMA 4L7KA 2OOVA 3KE7A 4IPBA 1RNTA 3MG1A 4XDVA 1G96A 3CCL3 1JKGB 1TIJA 3PXMA 1A2VA 5CF2A 3G6E3 1DMNA 5HGRA 1C7HA 1LOXA 3Q1CA 1N8QA 3EJVA 3NV0A 3LH4A
chains in the Genus database with same CATH topology
3B4OA 4MMZB 3F14A 3F8XA 4IT7A 3LT8A 4O8SA 1SJWA 4R4KA 1O7PB 3UL6A 2BMQB 1K734 1OGXA 5G2GA 1QMAA 1EQKA 3N9HA 1KWIA 1RN7A 3PGBA 4JF8A 3N54B 3JUQA 4HKVB 4HYZA 2KCDA 3D9RA 3NV0B 2WOFA 4J8TA 1NB5I 1SQWA 2CWVA 4EC6A 4J9AA 4N6V0 4HM1B 1JB4A 2HMJB 3WOEB 3BNBA 2HMLB 5DRVA 2L4VA 3EC9A 3BLZA 4HBRA 2CG1A 1E97A 2GBXB 5BXQA 1F8NA 3CCQ3 3MKIA 6STDA 3WA2X 2GBWB 3CPW2 1N5PA 1UUVB 3S28A 2ZL8A 2XSOB 3T0UA 2QGUA 1FGRA 3FG1A 3H3HA 3G16A 1Q42A 3LTAA 3X3ZA 2Z77A 1OCVA 3STDA 1JB2A 1ZO2A 4FR9A 1ASKA 3SOYA 2QA43 2B1XB 3EF8A 4ORLA 5D83A 1VQK3 2P38A 1Q814 3F7XA 1OUNA 1L5GB 3QK9A 1JN5A 3EQQB 4EV5A 1SIIA 4FMDA 2GEXA 3MWZA 2E2TA 4OK0A 1WNHA 2XF3A 3NX0A 3ER7A 3LTCA 3E99A 3HIIA 2QIYA 3KN4A 1TFOA 3FG4A 2LYXA 2WGOA 1GYBA 1RJOA 1W00A 5KP3A 1ZX2A 3CCS3 4AEQA 1W5ZA 2OOVC 4NHFA 1Q40B 3GZRA 3X41A 3ECFA 2I9WA 3D3LA 4R9LA 3X3XA 2XFTA 3FSDA 4EV2A 2E2UA 4K1VA 2Z6BA 3CCE3 2F98A 2JQ5A 1WMPA 3RDEA 1W2B2 5IG4A 1OH0A 2C11A 3O8YA 1FUWA 1Q864 3NUVA 1IVXA 3TDGA 1LVNA 3NQYA 1VQN3 5AYRB 3Q2PA 3LXUX 2BNGA 3LT9A 3IPTA 4HM8B 1UW1A 1QALA 3SLUA 2MF7A 1W01A 1W6CA 2YFIB 3IJEB 1D6ZA 5IERA 2W04A 2YFLB 3UNLA 4HM6B 1VQL3 2CFWA 3NBRA 3PZWA 1ROAA 3SX1A 1YGEA 5IF6A 1NJI4 2MC8A 1QVF2 1AR0A 3CCU3 4N6UA 2JDIH 5EQLA 1DVCA 1JB5A 2BO9B 4FMAA 2CK3H 5D81A 3U1WA 4LGQA 1RRLA 3VSYA 2CC3A 3N8BA 2KXGA 3KSED 1FGMA 4FCMA 1NB3I 1FGOA 1SIHA 3OXAA 4X2HA 1UUWB 1FGTA 2Z76A 2W56A 3AMOA 4RNYA 5TGNA 2W6JH 3Q90A 4XM4A 5D82A 1STFI 5AEWB 3B8LA 1WMNA 3PYJA 1D6YA 1YJ93 1TP6A 4LMIA 8CHOA 3OWSA 3MG3A 3CPOA 3UL5A 3SXXA 4STDA 1WQLB 1O7HB 2XRXB 4AKZA 1JRQA 1R4CA 3KIIA 3FLJA 4PEJA 2IA7A 3S5CA 2IUJA 3S67A 3I563 3JUPA 3MPHA 4WFOA 3B4PA 1OGZA 5AIIA 1HKXA 2KRTA 1VQM3 1N9JA 2SBLA 3GRDA 4LSOA 4TX4A 1U8CB 5ELJA 1ULIB 1VZZA 1KC84 4K90B 2CFKA 2W03A 4N6NB 1GY6A 1GY7A 2CHCA 3KKGA 3RGAA 4KFFA 4HZ9B 4NREA 2WOHA 3UB1A 1QVG2 2CWTA 5FGOA 1YIT3 2O9UX 4N6LA 3F40A 1SPUA 4HJLB 5STDA 1ISKA 3FH1A 2A15A 2CH9A 3KZTA 4I4KA 3FZWA 3X3YA 1Q7Y4 4FCJA 4IIAA 1ULJB 1W2ZA 4L8OA 4BTYA 5IEPA 1M9GA 3EBYA 3U97A 4O3VA 1CYUA 1LXEA 2HMOB 1IQ8A 2PZVA 3G0KA 3CD63 2XFSA 1PFPA 3EB8A 2CFDA 4KVHA 2YFJB 1VQ93 2WGQA 3LOYA 2Y73A 3PS8A 5JBSA 5BVBA 3KSPA 4LZIA 3GZXB 2QEX3 1VQP3 1A90A 2K54A 1NO3A 1IQXA 5LC7A 1N8R4 4HM5B 4XDWA 1WMOA 1O7GB 4L8PA 3F8HA 4MJDA 3GAXA 5IEOA 2K0MA 2GU1A 3MSOA 3DGOA 2RCDA 3T8UA 1VQ63 4HVNA 3CCR3 3F7SA 2C10A 2P09A 2XEPA 2XH9A 5CXOA 3CCM3 1CEWI 3NM7A 4K61A 3SVAA 1Y4KA 2R4IA 3FF2A 1NDOB 3DGLA 1IV9A 3HZPA 1Z1SA 2FNQA 1K8A4 3SOAA 1JN5B 1RKYA 1IQYA 3K5TA 3BB9A 1CQSA 1A67A 3DGMA 1M1XB 1IT8A 1OHPA 3A76A 3CCV3 2OTJ3 1DMQA 3PCSA 4MMXB 2Y74A 3DM8A 3BNEA 1TUHA 2YX9A 1DYUA 2OTL3 4KFEA 5AIFA 1OF5A 5CF1A 1IVWA 1T5YA 2IUKA 1NWWA 3I0YA 2V1LA 2INXA 1K9M4 1FGQA 3FG3A 3K0ZA 3X40A 3PCRA 5IG0A 1Q824 1UI8A 3CMA3 3DUKA 1OF5B 4BTWA 3HIGA 3ALAA 2ML6A 2PNCA 2HMNB 2STDA 3EX9A 4WYKA 1GD3A 1IK3A 3LZAA 5IG3A 2CIUA 3G713 3ROBA 3K9MC 3WMDA 3OW22 4RZMA 5FW5A 2GU3A 3WDGB 3G4S3 1N5HA 2W2CA 1KSIA 4WYKB 3JUNA 1QAKA 4HM7B 2OQEA 5LC6A 1EKMA 1TU5A 3KFQC 4FCZA 4N6MA 1O7WB 1IT7A 2RGQA 1IV7A 3HI7A 1O7NB 4RNZA 4XBYA 1OACA 3MHEA 1VQ73 1IVUA 3AMOB 2W56B 2FGTA 4HM3B 1STDA 1J2BA 1A2KA 3MG2A 1IVVA 3OWYA 3SEDA 3V92A 1QJGA 4G1MB 3DY5A 1RRHA 7STDA 1YVBI 1GS3A 1VQ53 3X42A 1JV2B 3L0RA 3J7Yd 5IW9A 2F99A 1MNLA 2LQVA 3I553 1IU7A 3FGYA 4FMBA 3GZYB 3EBTA 3EE1A 4KFDA 3F9SA 1OHOA 1LNHA 5KP1A 2D1WA 3NBBA 4OVMA 1GD4A 1YJW3 5AEUB 2OCTA 5DREA 3DXOA 1HU9A 2IMJA 3H51A 2WO0A 4JRFA 3CNMA 3NXJA 1N9EA 2OWPA 2RSXA 3UJMA 4EXRA 2HMMB 3BNDA 4O02B 3DMCA 4U13A 4MEIA 3K63A 2Z7AA 4R1KA 4WWUC 1NU3A 4LEHA 4FMCA 3K7CA 4N6TA 3MYTA 1AVLA 2Q07A 3GZBA 5AIHA 3CC43 1D6UA 1AVKA 2F86B 3EHCA 4R80A 1VQ43 1OHSA 2CWUA 3T8NA 2W0QA 4GB5A 3CME3 1O7MB 4H3UA 2XR8B 3V99A 1YHQ3 2XGNA 1GY5A 1K28A 4BTXA 5AYSC 3WODG 2GXFA 2CFGA 4MMYB 3M8CA 4EBGA 1WTHA 1YIJ3 2OQEC 4HM0B 2O3OA 3B7CA 3FF0A 1VQ83 3HX8A 1ROVA 2W9PA 2E2VA 3GWRA 4K1UA 3WA3A 3JUMA 3CC73 3OX9A 4O2HA 2ML5A 4GL6A 1BUQA 2CKFB 3JVCA 3CU3A 5A0OB 1S5AA 1YJN3 3G8ZA 4HZBB 1Q40A 1E3VA 4KZ1A 4XBXA 5ELUA 2FXTA 2GEYA 1E3RA 5JPUA 2CFLA 4HM4B 3OV4A 4HM2B 3RGRA 3V98A 3FKAA 1W7CA 5CK6A 4N3VA 3CXC2 1V74A 4EYCA 1FA3A 4OUQA 1KQS2 3BNCA 1S723 4CDLA 4H61A 3DZLA 5AIGA 3EN1B 1W6GA 4RBNA 1JJ22 1U5OA 5JPPA 2BT3A 4XBTA 5EVHA 2P0MA 3VF1A 2D42A 1M1K4 1DVDA 4ZM8A 1VQO3 2M7OA 4R9KA 2B24B 3NHXA 3QRDA 1K41A 2P0XA 3WOFB 5IENA 3NQZA 4QWTA 3NBJA 3JUOA 3CNXA 3DGNA 1JNQA 3LTBA 3CC23 4WHAA 1AV4A 1W4NA 1M904 1IDPA 3HK4A 5KP4A 2XSHB 1W02A 2BMOB 4X2OA 3FCSB 4N6OB 2RFRA 3LYGA 1YI23 1OPYA 1MOLA 1US1A 3S27A 2CW9A 5AI1A 5IG5A 1DMMA 2CG0A 3OWUA 1W6YA 3IMAB 4AKYA 4Q53A 2W9QA 4CCVA 1UI7A 1PU4A 3VGNA 5I97A 2UX0A 2XGLA 4WP5A 2P05A 1TFKA 1CYVA 3CCJ3 3NM2A 4XB5A 3S29A 1JKGA 1EG9B 3LTDA 1EA2A 5CLKA 5EEOA 3LMLA 1KD14 2ZDJA 2HMKB 1QAFA 2BMRB 4L7KA 3EN8A 2BHMA 2OOVA 3KE7A 4IPBA 3MG1A 4XDVA 1G96A 3CCL3 1JKGB 1TIJA 3PXMA 1A2VA 5CF2A 3G6E3 1DMNA 5HGRA 1C7HA 1LOXA 3Q1CA 1N8QA 3EJVA 3NV0A 3LH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN 3;  3CPW 2;  3CCM 3;  1YIJ 3;  1KC8 4;  3CCJ 3;  3CXC 2;  3CD6 3;  1K9M 4;  1VQ5 3;  1VQ8 3;  3CCS 3;  1KQS 2;  3CC2 3;  1Q82 4;  1K73 4;  1KD1 4;  1YJ9 3;  1VQL 3;  1K8A 4;  1S72 3;  1VQ9 3;  3CMA 3;  3CC7 3;  3I55 3;  1M90 4;  1QVF 2;  1NJI 4;  3CC4 3;  1QVG 2;  1YIT 3;  2QEX 3;  3CCU 3;  3CCV 3;  2QA4 3;  1VQ7 3;  1VQP 3;  2OTJ 3;  3G71 3;  1YJN 3;  1YJW 3;  3I56 3;  3CCE 3;  1VQK 3;  1YI2 3;  1N8R 4;  1W2B 2;  1Q81 4;  1JJ2 2;  1VQ4 3;  2OTL 3;  1Q7Y 4;  3CCL 3;  1Q86 4;  3G6E 3;  3CME 3;  1VQM 3;  1YHQ 3;  3OW2 2;  3G4S 3;  1M1K 4;  1VQO 3;  1VQ6 3;  3CCR 3;  3CCQ 3; 
#chains in the Genus database with same CATH topology
 1I3I A;  3B4O A;  1FYS A;  4MMZ B;  3F14 A;  3F8X A;  4IT7 A;  3LT8 A;  4O8S A;  3ZG0 A;  1SJW A;  4R4K A;  5G1L A;  5BU4 A;  1O7P B;  3UL6 A;  2BMQ B;  3BIR A;  1K73 4;  1OGX A;  1RHL A;  5G2G A;  1QMA A;  1EQK A;  3N9H A;  1KWI A;  1RN7 A;  2IYJ A;  3PGB A;  3N54 B;  4JF8 A;  5RNT A;  1DE3 A;  3JUQ A;  1BIR A;  4HKV B;  4CPK A;  4HYZ A;  2KCD A;  3D9R A;  3NV0 B;  2WOF A;  4J8T A;  1NB5 I;  1SQW A;  2CWV A;  4EC6 A;  1GOV A;  4J9A A;  4N6V 0;  4HM1 B;  1JB4 A;  1RCL A;  2HMJ B;  3WOE B;  3BNB A;  5BIR A;  2HML B;  5DRV A;  2L4V A;  1C54 A;  3EC9 A;  3BLZ A;  4HBR A;  2CG1 A;  1E97 A;  2GBX B;  5BXQ A;  1I2F A;  1F8N A;  3CCQ 3;  3D5I A;  3MKI A;  6STD A;  3WA2 X;  2GBW B;  3CPW 2;  1GMR A;  1N5P A;  1UUV B;  1SAR A;  1B21 A;  3S28 A;  1BSD A;  2ZL8 A;  2XSO B;  3T0U A;  2QGU A;  1FGR A;  1I2E A;  3FG1 A;  8RNT A;  3H3H A;  2KF5 A;  1Q42 A;  3G16 A;  3LTA A;  3X3Z A;  1LNI A;  2Z77 A;  1BRG A;  1OCV A;  3STD A;  1JB2 A;  1ZO2 A;  4FR9 A;  1ASK A;  3SOY A;  1UCI A;  3ZG5 A;  2QA4 3;  2B1X B;  3EF8 A;  4ORL A;  5D83 A;  1VQK 3;  2P38 A;  1RGA A;  1Q81 4;  3F7X A;  2H0I A;  1OUN A;  1L5G B;  3QK9 A;  1JN5 A;  3EQQ B;  4EV5 A;  1SII A;  3GSP A;  4FMD A;  2GEX A;  3MWZ A;  2E2T A;  4OK0 A;  1WNH A;  2XF3 A;  3NX0 A;  4I5Q A;  3Q3F A;  1BUJ A;  2RBI A;  2SAR A;  1TJD A;  1LOV A;  1RSN A;  3ER7 A;  3LTC A;  3E99 A;  3HII A;  2QIY A;  2K3D A;  3KN4 A;  1TFO A;  3FG4 A;  2LYX A;  2WGO A;  1GYB A;  1RJO A;  1W00 A;  5KP3 A;  1ZX2 A;  3CCS 3;  4AEQ A;  1W5Z A;  1FZU A;  2OOV C;  4NHF A;  1Q40 B;  1X1W A;  3GZR A;  3X41 A;  3ECF A;  2I9W A;  3D3L A;  4R9L A;  3X3X A;  2AAE A;  2XFT A;  1GSP A;  3FSD A;  4EV2 A;  2E2U A;  4K1V A;  2Z6B A;  3CCE 3;  2F98 A;  2JQ5 A;  1WMP A;  1MGR A;  1UDI I;  3RDE A;  5IG4 A;  1OH0 A;  1W2B 2;  2C11 A;  3O8Y A;  1FUW A;  1Q86 4;  3NUV A;  1IVX A;  3TDG A;  1LVN A;  1PYL A;  3NQY A;  1PY3 A;  1B2M A;  1BNR A;  1VQN 3;  5AYR B;  3Q2P A;  3LXU X;  2BNG A;  3LT9 A;  3IPT A;  4HM8 B;  1UW1 A;  1QAL A;  3SLU A;  2MF7 A;  4GSP A;  1W01 A;  1W6C A;  2YFI B;  3IJE B;  1D6Z A;  5IER A;  2W04 A;  2YFL B;  1YVS A;  3UNL A;  4HM6 B;  1VQL 3;  1BRK A;  2CFW A;  3NBR A;  3PZW A;  1ROA A;  3SX1 A;  1YGE A;  5IF6 A;  1NJI 4;  2MC8 A;  1QVF 2;  1B2Z A;  7RNT A;  1AR0 A;  3CCU 3;  1JZO A;  1B20 A;  4N6U A;  2JDI H;  5EQL A;  1DVC A;  1JB5 A;  2BO9 B;  2UGI A;  4FMA A;  4NPB A;  2CK3 H;  5D81 A;  3U1W A;  4LGQ A;  1RRL A;  3VSY A;  2CC3 A;  3N8B A;  1RCK A;  2KXG A;  3KSE D;  2R41 A;  1FGM A;  1DET A;  4FCM A;  1NB3 I;  1FGO A;  1SIH A;  3OXA A;  1LOW A;  1UUW B;  1FGT A;  2Z76 A;  2W56 A;  3AMO A;  4RNY A;  4X2H A;  5TGN A;  2W6J H;  6GSP A;  3Q90 A;  4XM4 A;  5D82 A;  2IY2 A;  1STF I;  5AEW B;  3B8L A;  1WMN A;  3PYJ A;  1D6Y A;  1YJ9 3;  1HZ1 A;  1TP6 A;  4LMI A;  8CHO A;  1R4Y A;  3OWS A;  3MG3 A;  3CPO A;  1LOY A;  4KT3 B;  3SXX A;  3UL5 A;  4STD A;  1WQL B;  3D5G A;  1O7H B;  1UCJ A;  2XRX B;  4AKZ A;  1JRQ A;  1R4C A;  3KII A;  3FLJ A;  4PEJ A;  2IA7 A;  3S5C A;  2IUJ A;  3S67 A;  3I56 3;  1RLS A;  3JUP A;  3MPH A;  1EEJ A;  4WFO A;  3B4P A;  1OGZ A;  5AII A;  1HKX A;  2KRT A;  1VQM 3;  1UGH I;  1N9J A;  2SBL A;  3AHS A;  3GRD A;  4LSO A;  4TX4 A;  1RGE A;  1MWR A;  7GSP A;  1U8C B;  5ELJ A;  2L1S A;  1ULI B;  1VZZ A;  1KC8 4;  4K90 B;  2CFK A;  2W03 A;  3A5E A;  4N6N B;  1GY6 A;  1GY7 A;  2CHC A;  3KKG A;  3RGA A;  4KFF A;  2F5W A;  3AGO A;  1RN1 A;  4HZ9 B;  4NRE A;  2WOH A;  3UB1 A;  4ILF A;  1QVG 2;  2CWT A;  2KF4 A;  5FGO A;  2O9U X;  1YIT 3;  4N6L A;  1BSB A;  3F40 A;  1SPU A;  4HJL B;  5STD A;  1ISK A;  3FH1 A;  2A15 A;  2CH9 A;  3AHW A;  3KZT A;  4I4K A;  3FZW A;  3X3Y A;  5M19 A;  1Q7Y 4;  4FCJ A;  1RMS A;  4IIA A;  1ULJ B;  1W2Z A;  4L8O A;  4LYL B;  1X1X A;  4BTY A;  5IEP A;  1M9G A;  3EBY A;  1NNV A;  4O3V A;  3U97 A;  1CYU A;  1LXE A;  2HMO B;  1IQ8 A;  2PZV A;  5M18 A;  3G0K A;  1GOU A;  3CD6 3;  2XFS A;  1PFP A;  3EB8 A;  2CFD A;  2BU4 A;  4KVH A;  5M1A A;  2YFJ B;  1VQ9 3;  2WGQ A;  1I2G A;  3LOY A;  2GSP A;  1JBR A;  1CH0 A;  2BIR A;  2Y73 A;  3PS8 A;  5JBS A;  5BVB A;  3KSP A;  4LZI A;  3GZX B;  2QEX 3;  1B27 A;  1VQP 3;  1A90 A;  1FUS A;  2K54 A;  1NO3 A;  1IQX A;  1MGW A;  5LC7 A;  1Q7H A;  1N8R 4;  4HM5 B;  4XDW A;  1WMO A;  1O7G B;  4L8P A;  3F8H A;  4MJD A;  3GAX A;  5IEO A;  2K0M A;  2GU1 A;  3MSO A;  3DGO A;  2RCD A;  3T8U A;  1VQ6 3;  4HVN A;  2CX1 A;  3CCR 3;  3F7S A;  1B2S A;  1GMQ A;  3AGN A;  2C10 A;  2P09 A;  2XEP A;  2XH9 A;  5CXO A;  6RNT A;  3CCM 3;  1CEW I;  4CJN A;  3NM7 A;  4K61 A;  3SVA A;  1Y4K A;  2R4I A;  3FF2 A;  1NDO B;  3DGL A;  1IV9 A;  3HZP A;  1Z1S A;  2FNQ A;  1K8A 4;  3SOA A;  1JN5 B;  1RKY A;  1IQY A;  1LRA A;  3K5T A;  3BB9 A;  1CQS A;  1A67 A;  3DGM A;  1M1X B;  1IT8 A;  1OHP A;  3A76 A;  3CCV 3;  2OTJ 3;  1DMQ A;  3PCS A;  4MMX B;  2Y74 A;  3DM8 A;  1G02 A;  3BNE A;  1TUH A;  2YX9 A;  1DYU A;  2OTL 3;  4KFE A;  5AIF A;  1OF5 A;  5CF1 A;  2AAD A;  1IVW A;  4BIR A;  1T5Y A;  2IUK A;  4HOH A;  1NWW A;  3I0Y A;  1LQM B;  2V1L A;  2INX A;  1K9M 4;  1FGQ A;  3FG3 A;  3K0Z A;  3X40 A;  3PCR A;  5IG0 A;  1Q82 4;  1UI8 A;  3CMA 3;  3DUK A;  1OF5 B;  4BTW A;  3HIG A;  1JZD A;  3ALA A;  2ML6 A;  1BNE A;  2PNC A;  2HMN B;  2STD A;  3EX9 A;  4WYK A;  1I3F A;  1GD3 A;  1IK3 A;  3LZA A;  5IG3 A;  2CIU A;  3G71 3;  1BSC A;  1JBS A;  1BAO A;  3D79 A;  3ROB A;  3K9M C;  4BL2 A;  3WMD A;  1BRH A;  1MWS A;  2F56 A;  4RZM A;  2GU3 A;  5FW5 A;  3WDG B;  3G4S 3;  3OW2 2;  1ZS7 A;  1N5H A;  2W2C A;  1KSI A;  1RGK A;  4WYK B;  3JUN A;  5G1K A;  1QAK A;  1BU4 A;  1BGS A;  4HM7 B;  2OQE A;  5LC6 A;  1EKM A;  1Q9E A;  1X1Y A;  3KFQ C;  1TU5 A;  2F5M A;  4FCZ A;  4N6M A;  1MWT A;  1RGH A;  2HOH A;  1O7W B;  1IT7 A;  2RGQ A;  1IV7 A;  2KF6 A;  1O7N B;  3HI7 A;  4RNZ A;  4XBY A;  1OAC A;  3MHE A;  1BOX A;  1VQ7 3;  1IVU A;  3AMO B;  2W56 B;  2FGT A;  4HM3 B;  1STD A;  1J2B A;  1B2U A;  1A2K A;  2F4Y A;  3MG2 A;  1IVV A;  1BNJ A;  2RNT A;  2KAA A;  3OWY A;  3SED A;  3V92 A;  1QJG A;  4G1M B;  3DY5 A;  1AY7 A;  1RRH A;  1BNI A;  4J5K A;  7STD A;  1YVB I;  1GS3 A;  1RDS A;  1VQ5 3;  3X42 A;  1JV2 B;  3L0R A;  3J7Y d;  4HAA A;  5IW9 A;  2F99 A;  1MNL A;  2LQV A;  3I55 3;  1IU7 A;  2UUG C;  3FGY A;  4FMB A;  3GZY B;  3EBT A;  3EE1 A;  4KFD A;  3F9S A;  1OHO A;  1VQQ A;  1LNH A;  1FUT A;  1RTU A;  1UCK A;  2D1W A;  3NBB A;  4OVM A;  1GD4 A;  5KP1 A;  1YJW 3;  5AEU B;  1RGL A;  2OCT A;  5DRE A;  3DXO A;  1HU9 A;  2IMJ A;  3H51 A;  2WO0 A;  1BRJ A;  3CNM A;  4JRF A;  3NXJ A;  5GSP A;  1N9E A;  3HOH A;  2OWP A;  1YGW A;  2RSX A;  3UJM A;  4EXR A;  2HMM B;  3BND A;  4O02 B;  3DMC A;  4U13 A;  4MEI A;  3BU4 A;  2Z7A A;  3K63 A;  4R1K A;  1IYY A;  4WWU C;  1NU3 A;  2ZA4 A;  1GMP A;  4LEH A;  1LQG C;  3K7C A;  4FMC A;  3MYT A;  4N6T A;  1AVL A;  2Q07 A;  3GZB A;  1RNB A;  5AIH A;  3CC4 3;  4BU4 A;  1D6U A;  1AVK A;  2H0G A;  2F86 B;  3EHC A;  4R80 A;  3ZFZ A;  1VQ4 3;  1OHS A;  2CWU A;  1BRI A;  3T8N A;  1RGG A;  2W0Q A;  9RNT A;  4GB5 A;  1BRN L;  3CME 3;  1O7M B;  4H3U A;  2XR8 B;  3V99 A;  1YHQ 3;  2XGN A;  1GY5 A;  1K28 A;  4BTX A;  3WHO A;  5AYS C;  1UUG B;  3WOD G;  2GXF A;  2CFG A;  1AQZ A;  4MMY B;  3M8C A;  4BL3 A;  4EBG A;  1WTH A;  1YIJ 3;  2OQE C;  4HM0 B;  2ZHX B;  2O3O A;  3B7C A;  3FF0 A;  1VQ8 3;  3HX8 A;  1ROV A;  2W9P A;  2E2V A;  2H0H A;  3GWR A;  3KCH A;  4K1U A;  1T2H A;  3WA3 A;  3JUM A;  1I70 A;  3D4A A;  3OX9 A;  4O2H A;  2ML5 A;  4GL6 A;  3CC7 3;  1BUQ A;  1GOY A;  2CKF B;  3JVC A;  3CU3 A;  1I0V A;  1RGF A;  5A0O B;  1S5A A;  1YJN 3;  3G8Z A;  4HZB B;  1Q40 A;  1E3V A;  4KZ1 A;  4XBX A;  5ELU A;  1V57 A;  2FXT A;  1TTO A;  1T2I A;  2GEY A;  1E3R A;  5JPU A;  1YNV X;  1ZGX A;  2CFL A;  1BSA A;  1FW7 A;  4HM4 B;  3OV4 A;  4HM2 B;  3RGR A;  3V98 A;  3FKA A;  1W7C A;  5CK6 A;  1B2X A;  4N3V A;  3CXC 2;  1V74 A;  4EYC A;  1FA3 A;  4OUQ A;  1KQS 2;  3BNC A;  4DKI A;  1S72 3;  4CDL A;  1JBT A;  4GHO A;  4H61 A;  5HOH A;  2KF3 A;  1X1U A;  3DZL A;  5AIG A;  1UCL A;  3EN1 B;  3DGY A;  1W6G A;  1BRS A;  4RBN A;  1JJ2 2;  1U5O A;  5JPP A;  2BT3 A;  4XBT A;  5EVH A;  2P0M A;  3VF1 A;  1HYF A;  2D42 A;  1M1K 4;  1DVD A;  4ZM8 A;  1VQO 3;  2M7O A;  1I0X A;  4J5G A;  4R9K A;  2B24 B;  3NHX A;  4EW5 A;  1RGC A;  3QRD A;  1K41 A;  2P0X A;  3WOF B;  5IEN A;  1EUI C;  3WR2 A;  3NQZ A;  4QWT A;  3NBJ A;  3JUO A;  4RNT A;  3CNX A;  1BNG A;  3DGN A;  1JNQ A;  3DH2 A;  3LTB A;  1BVI A;  4WHA A;  3CC2 3;  1AV4 A;  1TRP A;  1T3B A;  1I8V A;  1W4N A;  1M90 4;  1IDP A;  1BSE A;  3HK4 A;  5KP4 A;  2XSH B;  1W02 A;  2BMO B;  4X2O A;  3FCS B;  4N6O B;  2RFR A;  1TRQ A;  1BNF A;  3LYG A;  1YI2 3;  1OPY A;  3URP A;  1MOL A;  1US1 A;  3S27 A;  2CW9 A;  5AI1 A;  5IG5 A;  1DMM A;  2C4B A;  2CG0 A;  3OWU A;  1W6Y A;  3SYU A;  3RNT A;  3IMA B;  1BNS A;  1RN4 A;  4Q53 A;  2W9Q A;  4AKY A;  1UI7 A;  4CCV A;  3VGN A;  1PU4 A;  5I97 A;  2UX0 A;  2XGL A;  4WP5 A;  1A2P A;  2CX0 A;  1TFK A;  2P05 A;  1CYV A;  3CCJ 3;  1V58 A;  3NM2 A;  4XB5 A;  3S29 A;  1JKG A;  1B3S A;  1EG9 B;  3LTD A;  1EA2 A;  5CLK A;  5EEO A;  3LML A;  1KD1 4;  2J8X B;  2ZDJ A;  2HMK B;  1BAN A;  1QAF A;  1G0T A;  1UGI A;  2BMR B;  1MWU A;  3EN8 A;  2BHM A;  4L7K A;  2OOV A;  3KE7 A;  4IPB A;  1RNT A;  3MG1 A;  4XDV A;  1G96 A;  3CCL 3;  1JKG B;  1TIJ A;  3PXM A;  1A2V A;  5CF2 A;  3G6E 3;  1DMN A;  5HGR A;  1C7H A;  1LOX A;  3Q1C A;  1N8Q A;  3EJV A;  3NV0 A;  3LH4 A; 
#chains in the Genus database with same CATH homology
 3B4O A;  4MMZ B;  3F14 A;  3F8X A;  4IT7 A;  3LT8 A;  4O8S A;  1SJW A;  4R4K A;  1O7P B;  3UL6 A;  2BMQ B;  1K73 4;  1OGX A;  5G2G A;  1QMA A;  1EQK A;  3N9H A;  1KWI A;  1RN7 A;  3PGB A;  4JF8 A;  3N54 B;  3JUQ A;  4HKV B;  4HYZ A;  2KCD A;  3D9R A;  3NV0 B;  2WOF A;  4J8T A;  1NB5 I;  1SQW A;  2CWV A;  4EC6 A;  4J9A A;  4N6V 0;  4HM1 B;  1JB4 A;  2HMJ B;  3WOE B;  3BNB A;  2HML B;  5DRV A;  2L4V A;  3EC9 A;  3BLZ A;  4HBR A;  2CG1 A;  1E97 A;  2GBX B;  5BXQ A;  1F8N A;  3CCQ 3;  3MKI A;  6STD A;  3WA2 X;  2GBW B;  3CPW 2;  1N5P A;  1UUV B;  3S28 A;  2ZL8 A;  2XSO B;  3T0U A;  2QGU A;  1FGR A;  3FG1 A;  3H3H A;  3G16 A;  1Q42 A;  3LTA A;  3X3Z A;  2Z77 A;  1OCV A;  3STD A;  1JB2 A;  1ZO2 A;  4FR9 A;  1ASK A;  3SOY A;  2QA4 3;  2B1X B;  3EF8 A;  4ORL A;  5D83 A;  1VQK 3;  2P38 A;  1Q81 4;  3F7X A;  1OUN A;  1L5G B;  3QK9 A;  1JN5 A;  3EQQ B;  4EV5 A;  1SII A;  4FMD A;  2GEX A;  3MWZ A;  2E2T A;  4OK0 A;  1WNH A;  2XF3 A;  3NX0 A;  3ER7 A;  3LTC A;  3E99 A;  3HII A;  2QIY A;  3KN4 A;  1TFO A;  3FG4 A;  2LYX A;  2WGO A;  1GYB A;  1RJO A;  1W00 A;  5KP3 A;  1ZX2 A;  3CCS 3;  4AEQ A;  1W5Z A;  2OOV C;  4NHF A;  1Q40 B;  3GZR A;  3X41 A;  3ECF A;  2I9W A;  3D3L A;  4R9L A;  3X3X A;  2XFT A;  3FSD A;  4EV2 A;  2E2U A;  4K1V A;  2Z6B A;  3CCE 3;  2F98 A;  2JQ5 A;  1WMP A;  3RDE A;  1W2B 2;  5IG4 A;  1OH0 A;  2C11 A;  3O8Y A;  1FUW A;  1Q86 4;  3NUV A;  1IVX A;  3TDG A;  1LVN A;  3NQY A;  1VQN 3;  5AYR B;  3Q2P A;  3LXU X;  2BNG A;  3LT9 A;  3IPT A;  4HM8 B;  1UW1 A;  1QAL A;  3SLU A;  2MF7 A;  1W01 A;  1W6C A;  2YFI B;  3IJE B;  1D6Z A;  5IER A;  2W04 A;  2YFL B;  3UNL A;  4HM6 B;  1VQL 3;  2CFW A;  3NBR A;  3PZW A;  1ROA A;  3SX1 A;  1YGE A;  5IF6 A;  1NJI 4;  2MC8 A;  1QVF 2;  1AR0 A;  3CCU 3;  4N6U A;  2JDI H;  5EQL A;  1DVC A;  1JB5 A;  2BO9 B;  4FMA A;  2CK3 H;  5D81 A;  3U1W A;  4LGQ A;  1RRL A;  3VSY A;  2CC3 A;  3N8B A;  2KXG A;  3KSE D;  1FGM A;  4FCM A;  1NB3 I;  1FGO A;  1SIH A;  3OXA A;  4X2H A;  1UUW B;  1FGT A;  2Z76 A;  2W56 A;  3AMO A;  4RNY A;  5TGN A;  2W6J H;  3Q90 A;  4XM4 A;  5D82 A;  1STF I;  5AEW B;  3B8L A;  1WMN A;  3PYJ A;  1D6Y A;  1YJ9 3;  1TP6 A;  4LMI A;  8CHO A;  3OWS A;  3MG3 A;  3CPO A;  3UL5 A;  3SXX A;  4STD A;  1WQL B;  1O7H B;  2XRX B;  4AKZ A;  1JRQ A;  1R4C A;  3KII A;  3FLJ A;  4PEJ A;  2IA7 A;  3S5C A;  2IUJ A;  3S67 A;  3I56 3;  3JUP A;  3MPH A;  4WFO A;  3B4P A;  1OGZ A;  5AII A;  1HKX A;  2KRT A;  1VQM 3;  1N9J A;  2SBL A;  3GRD A;  4LSO A;  4TX4 A;  1U8C B;  5ELJ A;  1ULI B;  1VZZ A;  1KC8 4;  4K90 B;  2CFK A;  2W03 A;  4N6N B;  1GY6 A;  1GY7 A;  2CHC A;  3KKG A;  3RGA A;  4KFF A;  4HZ9 B;  4NRE A;  2WOH A;  3UB1 A;  1QVG 2;  2CWT A;  5FGO A;  1YIT 3;  2O9U X;  4N6L A;  3F40 A;  1SPU A;  4HJL B;  5STD A;  1ISK A;  3FH1 A;  2A15 A;  2CH9 A;  3KZT A;  4I4K A;  3FZW A;  3X3Y A;  1Q7Y 4;  4FCJ A;  4IIA A;  1ULJ B;  1W2Z A;  4L8O A;  4BTY A;  5IEP A;  1M9G A;  3EBY A;  3U97 A;  4O3V A;  1CYU A;  1LXE A;  2HMO B;  1IQ8 A;  2PZV A;  3G0K A;  3CD6 3;  2XFS A;  1PFP A;  3EB8 A;  2CFD A;  4KVH A;  2YFJ B;  1VQ9 3;  2WGQ A;  3LOY A;  2Y73 A;  3PS8 A;  5JBS A;  5BVB A;  3KSP A;  4LZI A;  3GZX B;  2QEX 3;  1VQP 3;  1A90 A;  2K54 A;  1NO3 A;  1IQX A;  5LC7 A;  1N8R 4;  4HM5 B;  4XDW A;  1WMO A;  1O7G B;  4L8P A;  3F8H A;  4MJD A;  3GAX A;  5IEO A;  2K0M A;  2GU1 A;  3MSO A;  3DGO A;  2RCD A;  3T8U A;  1VQ6 3;  4HVN A;  3CCR 3;  3F7S A;  2C10 A;  2P09 A;  2XEP A;  2XH9 A;  5CXO A;  3CCM 3;  1CEW I;  3NM7 A;  4K61 A;  3SVA A;  1Y4K A;  2R4I A;  3FF2 A;  1NDO B;  3DGL A;  1IV9 A;  3HZP A;  1Z1S A;  2FNQ A;  1K8A 4;  3SOA A;  1JN5 B;  1RKY A;  1IQY A;  3K5T A;  3BB9 A;  1CQS A;  1A67 A;  3DGM A;  1M1X B;  1IT8 A;  1OHP A;  3A76 A;  3CCV 3;  2OTJ 3;  1DMQ A;  3PCS A;  4MMX B;  2Y74 A;  3DM8 A;  3BNE A;  1TUH A;  2YX9 A;  1DYU A;  2OTL 3;  4KFE A;  5AIF A;  1OF5 A;  5CF1 A;  1IVW A;  1T5Y A;  2IUK A;  1NWW A;  3I0Y A;  2V1L A;  2INX A;  1K9M 4;  1FGQ A;  3FG3 A;  3K0Z A;  3X40 A;  3PCR A;  5IG0 A;  1Q82 4;  1UI8 A;  3CMA 3;  3DUK A;  1OF5 B;  4BTW A;  3HIG A;  3ALA A;  2ML6 A;  2PNC A;  2HMN B;  2STD A;  3EX9 A;  4WYK A;  1GD3 A;  1IK3 A;  3LZA A;  5IG3 A;  2CIU A;  3G71 3;  3ROB A;  3K9M C;  3WMD A;  3OW2 2;  4RZM A;  5FW5 A;  2GU3 A;  3WDG B;  3G4S 3;  1N5H A;  2W2C A;  1KSI A;  4WYK B;  3JUN A;  1QAK A;  4HM7 B;  2OQE A;  5LC6 A;  1EKM A;  1TU5 A;  3KFQ C;  4FCZ A;  4N6M A;  1O7W B;  1IT7 A;  2RGQ A;  1IV7 A;  3HI7 A;  1O7N B;  4RNZ A;  4XBY A;  1OAC A;  3MHE A;  1VQ7 3;  1IVU A;  3AMO B;  2W56 B;  2FGT A;  4HM3 B;  1STD A;  1J2B A;  1A2K A;  3MG2 A;  1IVV A;  3OWY A;  3SED A;  3V92 A;  1QJG A;  4G1M B;  3DY5 A;  1RRH A;  7STD A;  1YVB I;  1GS3 A;  1VQ5 3;  3X42 A;  1JV2 B;  3L0R A;  3J7Y d;  5IW9 A;  2F99 A;  1MNL A;  2LQV A;  3I55 3;  1IU7 A;  3FGY A;  4FMB A;  3GZY B;  3EBT A;  3EE1 A;  4KFD A;  3F9S A;  1OHO A;  1LNH A;  5KP1 A;  2D1W A;  3NBB A;  4OVM A;  1GD4 A;  1YJW 3;  5AEU B;  2OCT A;  5DRE A;  3DXO A;  1HU9 A;  2IMJ A;  3H51 A;  2WO0 A;  4JRF A;  3CNM A;  3NXJ A;  1N9E A;  2OWP A;  2RSX A;  3UJM A;  4EXR A;  2HMM B;  3BND A;  4O02 B;  3DMC A;  4U13 A;  4MEI A;  3K63 A;  2Z7A A;  4R1K A;  4WWU C;  1NU3 A;  4LEH A;  4FMC A;  3K7C A;  4N6T A;  3MYT A;  1AVL A;  2Q07 A;  3GZB A;  5AIH A;  3CC4 3;  1D6U A;  1AVK A;  2F86 B;  3EHC A;  4R80 A;  1VQ4 3;  1OHS A;  2CWU A;  3T8N A;  2W0Q A;  4GB5 A;  3CME 3;  1O7M B;  4H3U A;  2XR8 B;  3V99 A;  1YHQ 3;  2XGN A;  1GY5 A;  1K28 A;  4BTX A;  5AYS C;  3WOD G;  2GXF A;  2CFG A;  4MMY B;  3M8C A;  4EBG A;  1WTH A;  1YIJ 3;  2OQE C;  4HM0 B;  2O3O A;  3B7C A;  3FF0 A;  1VQ8 3;  3HX8 A;  1ROV A;  2W9P A;  2E2V A;  3GWR A;  4K1U A;  3WA3 A;  3JUM A;  3CC7 3;  3OX9 A;  4O2H A;  2ML5 A;  4GL6 A;  1BUQ A;  2CKF B;  3JVC A;  3CU3 A;  5A0O B;  1S5A A;  1YJN 3;  3G8Z A;  4HZB B;  1Q40 A;  1E3V A;  4KZ1 A;  4XBX A;  5ELU A;  2FXT A;  2GEY A;  1E3R A;  5JPU A;  2CFL A;  4HM4 B;  3OV4 A;  4HM2 B;  3RGR A;  3V98 A;  3FKA A;  1W7C A;  5CK6 A;  4N3V A;  3CXC 2;  1V74 A;  4EYC A;  1FA3 A;  4OUQ A;  1KQS 2;  3BNC A;  1S72 3;  4CDL A;  4H61 A;  3DZL A;  5AIG A;  3EN1 B;  1W6G A;  4RBN A;  1JJ2 2;  1U5O A;  5JPP A;  2BT3 A;  4XBT A;  5EVH A;  2P0M A;  3VF1 A;  2D42 A;  1M1K 4;  1DVD A;  4ZM8 A;  1VQO 3;  2M7O A;  4R9K A;  2B24 B;  3NHX A;  3QRD A;  1K41 A;  2P0X A;  3WOF B;  5IEN A;  3NQZ A;  4QWT A;  3NBJ A;  3JUO A;  3CNX A;  3DGN A;  1JNQ A;  3LTB A;  3CC2 3;  4WHA A;  1AV4 A;  1W4N A;  1M90 4;  1IDP A;  3HK4 A;  5KP4 A;  2XSH B;  1W02 A;  2BMO B;  4X2O A;  3FCS B;  4N6O B;  2RFR A;  3LYG A;  1YI2 3;  1OPY A;  1MOL A;  1US1 A;  3S27 A;  2CW9 A;  5AI1 A;  5IG5 A;  1DMM A;  2CG0 A;  3OWU A;  1W6Y A;  3IMA B;  4AKY A;  4Q53 A;  2W9Q A;  4CCV A;  1UI7 A;  1PU4 A;  3VGN A;  5I97 A;  2UX0 A;  2XGL A;  4WP5 A;  2P05 A;  1TFK A;  1CYV A;  3CCJ 3;  3NM2 A;  4XB5 A;  3S29 A;  1JKG A;  1EG9 B;  3LTD A;  1EA2 A;  5CLK A;  5EEO A;  3LML A;  1KD1 4;  2ZDJ A;  2HMK B;  1QAF A;  2BMR B;  4L7K A;  3EN8 A;  2BHM A;  2OOV A;  3KE7 A;  4IPB A;  3MG1 A;  4XDV A;  1G96 A;  3CCL 3;  1JKG B;  1TIJ A;  3PXM A;  1A2V A;  5CF2 A;  3G6E 3;  1DMN A;  5HGR A;  1C7H A;  1LOX A;  3Q1C A;  1N8Q A;  3EJV A;  3NV0 A;  3LH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...