1BNIA

Barnase wildtype structure at ph 6.0
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Microbial ribonuclease
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 29
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bniA00
1RGEA 1BNIA 4RNTA 8RNTA 2F5MA 1BUJA 4HAAA 1I70A 1AQZA 1BVIA 1BSCA 1B2ZA 1I3FA 2GSPA 2RNTA 7GSPA 1HYFA 1BRKA 2F4YA 3RNTA 1RN4A 3SYUA 1LNIA 1FUTA 1RNBA 1LOYA 3HOHA 3D5IA 6GSPA 1YNVX 1X1UA 2BU4A 3BU4A 1RN1A 1I2FA 1DE3A 1B20A 1B2SA 1UCLA 1BU4A 2HOHA 1RCLA 1BSBA 1LOWA 1TRPA 1RNTA 3AGOA 1TTOA 2SARA 3DH2A 1BNEA 1FUSA 1HZ1A 3A5EA 1PYLA 1B2MA 3AGNA 1C54A 2KF6A 1SARA 1BRJA 1BRIA 1BOXA 1RGAA 3KCHA 1BNRA 1UCJA 1IYYA 1RSNA 2KAAA 9RNTA 1ZGXA 2F5WA 2KF5A 1I2GA 2KF3A 1A2PA 1B2XA 1I0XA 1LOVA 5BU4A 6RNTA 1R4YA 1B2UA 2C4BA 1BRSA 1RGFA 1RGHA 5HOHA 1RDSA 1BRNL 1DETA 5RNTA 1BRHA 3D5GA 1I2EA 1B27A 2ZA4A 1RGLA 1RGCA 1BAOA 1GOVA 3BIRA 2AAEA 1GMQA 1X1XA 1FW7A 1BSDA 1UCIA 3WR2A 1BNFA 1BSEA 3URPA 1YVSA 1GSPA 1BNJA 7RNTA 1FYSA 1I8VA 1X1YA 1RMSA 2RBIA 1LRAA 1T2IA 1RHLA 1GMRA 2F56A 4GHOA 1JBTA 1B21A 1RLSA 3Q3FA 3DGYA 1BGSA 3AHWA 1BSAA 2KF4A 1RGKA 2AADA 1AY7A 1BNGA 1CH0A 1I0VA 1BNSA 1JBRA 5GSPA 1BANA 1JBSA 1G02A 1UCKA 1RGGA 1FZUA 1BRGA 2BIRA 4J5GA 1RCKA 1T2HA 4GSPA 1PY3A 1X1WA 3D4AA 1BIRA 1RTUA 1TRQA 1Q9EA 3GSPA 1GMPA 3AHSA 1MGWA 1GOUA 4BU4A 1B3SA 1GOYA 1I3IA 3WHOA 1YGWA 5BIRA 1MGRA 4HOHA 4J5KA 4BIRA
chains in the Genus database with same CATH superfamily
2GU1A 2W2CA 3K0ZA 2IUJA 3NHXA 3X3XA 1YJN3 1S5AA 1I70A 3B4OA 2W9QA 1NU3A 1HYFA 1W2ZA 2WO0A 5AI1A 1EG9B 4GL6A 3S27A 1UI7A 4HM6B 1FUTA 2H0IA 2HMKB 1KQS2 2RFRA 1EEJA 4R9KA 1STDA 2W9PA 3CXC2 3NM2A 2MF7A 1BU4A 4EXRA 3B4PA 3UL5A 2XSHB 1LOWA 3AGOA 3CCU3 1YVBI 2ML6A 1GD3A 4K90B 5CK6A 1CQSA 1IQXA 2LQVA 1NNVA 1NO3A 3FSDA 3KE7A 2CK3H 1VZZA 4DKIA 3STDA 4AKZA 3ECFA 3WODG 1BRJA 2CIUA 1J2BA 5LC7A 3KCHA 5KP3A 1RSNA 1LNHA 2KAAA 3PZWA 5IG0A 1IVWA 1I2GA 1Q7Y4 1GYBA 1Q7HA 4HBRA 4KFDA 1HU9A 1MWSA 1WMPA 1B2XA 3BB9A 5STDA 3JUQA 1MWRA 3GZRA 5KP1A 3CCS3 2Z77A 3NV0A 3Q2PA 3CCR3 3BNEA 4L7KA 1NB3I 3BNDA 3SLUA 1RGHA 5HOHA 1UGIA 1CYUA 2FGTA 1DETA 3O8YA 3ZG5A 1BRHA 4PEJA 1RGLA 4FMDA 3NV0B 1VQN3 1RGCA 2STDA 2KCDA 1STFI 2LYXA 2Z6BA 3BIRA 4N6MA 2OOVA 1BUQA 1OHPA 4MMZB 1GMQA 2R4IA 2UUGC 1FW7A 1TFOA 3KIIA 3WR2A 3SVAA 1BSEA 3HIGA 1YVSA 1W4NA 1FGQA 3BNCA 2XFTA 1GSPA 1KD14 3DUKA 3JUPA 4MMXB 1ULIB 3FCSB 5BVBA 1GY7A 3OW22 1FGRA 3B7CA 4X2HA 4OUQA 1V74A 1JKGA 4MEIA 3RDEA 3QK9A 4GHOA 1VQM3 2CX0A 1JBTA 1B21A 3N9HA 3DM8A 5FGOA 2RGQA 3JUMA 4JF8A 2WGOA 2GXFA 2INXA 3DGYA 5IEPA 5JBSA 1NJI4 3AHWA 4FCMA 4U13A 1KWIA 2AADA 3NX0A 3NM7A 1I0VA 1CH0A 1JBRA 1YJW3 2E2UA 3FKAA 3SX1A 5AEUB 5JPPA 5I97A 1K9M4 1JBSA 1G02A 2W6JH 1U8CB 1RGGA 2W03A 3U97A 1VQ73 1IV7A 4FCJA 4J5GA 1T2HA 4I4KA 1PY3A 3LXUX 4BTWA 3CPOA 5D82A 3D4AA 1RTUA 3SOAA 1K734 1Q9EA 3GSPA 4TX4A 1W6YA 3KSPA 3NBBA 1TJDA 5BIRA 1NWWA 2V1LA 4J5KA 1W01A 2CH9A 4BIRA 2YFJB 4HM4B 1LXEA 8RNTA 4H61A 2F5MA 1QAKA 4N6V0 3H51A 2I9WA 1BVIA 2XRXB 1SQWA 2RNTA 3FG1A 3PS8A 5M18A 3F40A 1BRKA 3K9MC 1RN4A 1LNIA 1VQK3 3TDGA 4BTYA 1IK3A 3OWSA 2KXGA 3I563 6GSPA 1YNVX 1GY5A 3BU4A 1DE3A 1RN1A 1I2FA 3NBJA 3OWUA 1O7HB 1O7PB 2HOHA 3JUOA 3PCSA 3MHEA 3S67A 1BSBA 4FMAA 5ELJA 1RNTA 1TTOA 4KVHA 3J7Yd 1VQP3 3LTAA 4LZIA 3ROBA 2CW9A 3OXAA 4QWTA 2H0GA 3DH2A 1BNEA 4HM8B 4K61A 4LEHA 1OACA 3A5EA 1IT8A 1OUNA 2FXTA 4HM5B 4WYKB 3SEDA 1UUGB 1D6ZA 4Q53A 4N6OB 1G96A 5IF6A 1EKMA 1JV2B 1C54A 3GWRA 2KF6A 1EQKA 4WP5A 3LZAA 3UNLA 1BRIA 4NHFA 1BOXA 4BTXA 4OK0A 3G713 3EX9A 4MJDA 3X41A 3G6E3 3CCJ3 1QVG2 2HMLB 1W00A 3MG2A 5HGRA 4HM0B 1A2PA 1I0XA 3PGBA 3EE1A 4KFFA 2PNCA 4HM7B 3CD63 1R4YA 3LT9A 2XR8B 3X42A 1ROAA 1BRSA 3CMA3 2C10A 3IJEB 4FCZA 4RNYA 1VQ43 3EC9A 2XFSA 3HX8A 3LYGA 5RNTA 3FH1A 1E3RA 5LC6A 1N5HA 3LT8A 1JB5A 4HM1B 2SBLA 3OX9A 2JDIH 1W6GA 3NBRA 1ZO2A 3SOYA 2P38A 3I553 2CG1A 1LQGC 5AYRB 2BT3A 4I5QA 2OTL3 1UCIA 5IENA 4XBYA 3EHCA 3CCE3 2CC3A 4ORLA 4XB5A 1K8A4 5M1AA 1CEWI 5IG4A 1QMAA 3EN1B 3DGOA 5M19A 3K5TA 1Q824 1JZDA 1SIHA 1AVLA 2P0XA 1X1YA 4RBNA 1IVUA 1IDPA 2MC8A 1RMSA 2BHMA 5AIGA 2F99A 1LRAA 2CX1A 3CC73 3EBTA 2F56A 5EEOA 1RLSA 2IY2A 2CFWA 2ML5A 4HVNA 1M1XB 2BMRB 1BGSA 1YIJ3 3N54B 1BSAA 2H0HA 3F8XA 1RGKA 4MMYB 1AY7A 1BNGA 4WWUC 1BANA 3D9RA 3VSYA 1UCKA 1IU7A 5IEOA 1BRGA 1JN5A 1QJGA 1DMNA 2PZVA 4WFOA 1W2B2 1X1WA 3FF2A 4LMIA 2WOFA 3FF0A 2ZL8A 4STDA 1GMPA 4HKVB 5G1LA 1JN5B 1TP6A 5D81A 1YJ93 1ISKA 1B3SA 1I3IA 3CCV3 1FGMA 1GY6A 4RNZA 1RGEA 1N9JA 1BNIA 4RNTA 3UB1A 2CG0A 1A67A 3G16A 1TIJA 4HAAA 3WOFB 2D42A 4FR9A 1ZS7A 2GSPA 2GEYA 2O3OA 3M8CA 1Q42A 3K7CA 3SYUA 4LGQA 4XDVA 4HM2B 1RNBA 1LOYA 1AR0A 3JUNA 3D5IA 2YX9A 1DVCA 1SJWA 3EN8A 5ELUA 1AV4A 1ZX2A 1X1UA 2BU4A 4AEQA 1E3VA 4RZMA 1B2SA 1L5GB 3G4S3 1RCLA 1UUWB 3MG3A 4IIAA 1TRPA 1RKYA 3KN4A 4HYZA 3CNMA 1QALA 1Y4KA 3V92A 1FA3A 5CF2A 2R41A 1W02A 1W5ZA 3ZG0A 3IPTA 5A0OB 1OHSA 1PYLA 3MYTA 2OWPA 2W56B 3WDGB 1B2MA 3CC43 3LTDA 1A2VA 3F9SA 3NQYA 3OWYA 1UGHI 1GS3A 3JVCA 4K1VA 1N8R4 1NB5I 4KZ1A 2K0MA 2OCTA 1OGZA 2CFKA 1IYYA 9RNTA 1ZGXA 2F5WA 2E2TA 2HMNB 2KF5A 2B1XB 3X3ZA 2K54A 6STDA 1GD4A 2A15A 4EV5A 4WYKA 2BO9B 3UL6A 4EBGA 1Q40A 1M904 3T8NA 1O7GB 2BMQB 1YI23 5EQLA 5AYSC 3HIIA 1VQ63 3LMLA 1RDSA 1ULJB 3MWZA 1RJOA 1SIIA 4JRFA 2XF3A 1B27A 1I2EA 3HZPA 2HMMB 4H3UA 3GZXB 3F14A 1V58A 1Z1SA 1Q40B 3CME3 3H3HA 1BAOA 1IT7A 1IQ8A 1M9GA 3A76A 2RCDA 3IMAB 1D6YA 1GOVA 2WOHA 4N3VA 3B8LA 3DMCA 4R80A 4FMCA 1T5YA 5EVHA 1TU5A 2W0QA 1IQYA 1X1XA 4HJLB 3V98A 3WA2X 4J9AA 4AKYA 3URPA 3S28A 3ZFZA 1UI8A 2QA43 1Q864 1IV9A 4HZBB 3BLZA 1DMQA 5G1KA 1UDII 3CNXA 3FG4A 3VGNA 1BNJA 2CWVA 2GBXB 3E99A 7STDA 1W7CA 1OCVA 2QGUA 3GZBA 1I8VA 3CPW2 4N6NB 4NREA 1K28A 1WNHA 2W04A 1N8QA 1LQMB 1OGXA 2RBIA 1JB4A 3L0RA 5AIFA 1T2IA 1W6CA 3EQQB 1IVVA 1MOLA 1GMRA 1MNLA 1RHLA 2GEXA 2Z76A 1OF5A 3G0KA 3NXJA 2IYJA 1C7HA 3F7SA 2YFLB 1F8NA 1EA2A 3D3LA 5AIHA 3GAXA 4KFEA 4BL3A 3GRDA 2UGIA 2XEPA 3DGNA 3G8ZA 3LH4A 1MWUA 3FG3A 1OF5B 3RGAA 1RRHA 3NQZA 3X3YA 1YGEA 1FZUA 3F8HA 1A90A 1WQLB 2RSXA 3CCQ3 3D79A 2F98A 1AVKA 1O7WB 2BMOB 2CWTA 5TGNA 4EYCA 1LVNA 1WTHA 1TRQA 1A2KA 1VQQA 3MG1A 4G1MB 1MGWA 3DZLA 1GOUA 4BU4A 5CF1A 1N9EA 1GOYA 3UJMA 5KP4A 1YGWA 1FGOA 2F86B 1MGRA 3PYJA 4HOHA 3WMDA 5JPUA 1VQ93 3I0YA 2KRTA 3KFQC 2Y74A 1PU4A 1BUJA 1AQZA 1I3FA 1BSCA 1B2ZA 1IVXA 1V57A 2CFGA 1RN7A 2F4YA 2FNQA 2P0MA 3RNTA 7GSPA 1VQ83 1DYUA 4CCVA 3EJVA 1VQ53 1DVDA 1K41A 4O8SA 4KT3B 3HOHA 1M1K4 2CWUA 1KSIA 4CDLA 3ER7A 2CFLA 2K3DA 4ILFA 3CCL3 3MSOA 1B20A 3VF1A 2P05A 2QIYA 4EC6A 2CHCA 1UCLA 1D6UA 4R4KA 4O3VA 3K63A 1NDOB 3GZYB 4LYLB 2XGLA 2SARA 4O02B 4HZ9B 2XH9A 3SXXA 1UUVB 3MPHA 1FUSA 1HZ1A 1O7NB 1JJ22 2Z7AA 3N8BA 2B24B 2OQEC 3LOYA 3AGNA 2UX0A 2L4VA 3DXOA 3DY5A 2IA7A 3HK4A 4R9LA 5AEWB 3EB8A 3LTCA 1SARA 1JB2A 4XDWA 1RGAA 2O9UX 1BNRA 3F7XA 1UCJA 1FGTA 3DGMA 4BL2A 1OHOA 3PXMA 1YIT3 1T3BA 5BXQA 2QEX3 4N6LA 2CFDA 1JNQA 2KF3A 3FZWA 4ZM8A 1LOVA 2J8XB 4XBTA 5BU4A 2Q07A 1N5PA 6RNTA 1B2UA 1OH0A 1SPUA 2C4BA 2W56A 3LTBA 3U1WA 2IUKA 4IPBA 5CLKA 1RGFA 3Q90A 1BRNL 2HMOB 1RRLA 1E97A 1WMNA 3FLJA 3D5GA 3OV4A 4O2HA 5CXOA 2ZA4A 4K1UA 3BNBA 3S5CA 3V99A 4EW5A 4EV2A 2C11A 3ALAA 1KC84 1JRQA 1JKGB 2AAEA 5AIIA 3S29A 1VQO3 3FGYA 5IG3A 1QAFA 1MWTA 4XM4A 1BSDA 2YFIB 3T8UA 2XSOB 1BNFA 2GBWB 1LOXA 2ZHXB 3EF8A 4L8OA 2P09A 1QVF2 3AMOA 3MKIA 4GB5A 1WMOA 5DREA 1O7MB 2BNGA 4N6UA 2WGQA 2CKFB 3EBYA 4L8PA 4LSOA 2L1SA 7RNTA 1FYSA 4IT7A 2E2VA 5IW9A 3DGLA 4J8TA 4WHAA 1VQL3 4R1KA 5G2GA 3WA3A 3KKGA 1YHQ3 1Q814 5D83A 2HMJB 1OPYA 2D1WA 3AMOB 4N6TA 1PFPA 3CU3A 1R4CA 1U5OA 4HM3B 3Q3FA 2JQ5A 3HI7A 1FUWA 1G0TA 1ROVA 2ZDJA 4OVMA 2KF4A 4FMBA 1EUIC 1S723 8CHOA 1BNSA 1HKXA 2M7OA 5GSPA 1JZOA 1TUHA 2GU3A 5IG5A 3QRDA 2IMJA 3Q1CA 3RGRA 4X2OA 2BIRA 2XGNA 3KSED 3KZTA 1RCKA 1DMMA 2Y73A 3PCRA 4GSPA 2OQEA 4CJNA 3CCM3 1TFKA 1UW1A 3NUVA 4XBXA 1BIRA 4NPBA 3T0UA 5IERA 3CC23 2OOVC 3AHSA 1CYVA 1US1A 4CPKA 2OTJ3 3WOEB 5DRVA 3WHOA 5FW5A 3X40A 1ASKA
chains in the Genus database with same CATH topology
1RGEA 1BNIA 4RNTA 8RNTA 2F5MA 1BUJA 4HAAA 1I70A 1AQZA 1BVIA 1BSCA 1B2ZA 1I3FA 2GSPA 2RNTA 7GSPA 1HYFA 1BRKA 2F4YA 3RNTA 1RN4A 3SYUA 1LNIA 1FUTA 1RNBA 1LOYA 3HOHA 3D5IA 6GSPA 1YNVX 1X1UA 2BU4A 3BU4A 1RN1A 1I2FA 1DE3A 1B20A 1B2SA 1UCLA 1BU4A 2HOHA 1RCLA 1BSBA 1LOWA 1TRPA 1RNTA 3AGOA 1TTOA 2SARA 3DH2A 1BNEA 1FUSA 1HZ1A 3A5EA 1PYLA 1B2MA 3AGNA 1C54A 2KF6A 1SARA 1BRJA 1BRIA 1BOXA 1RGAA 3KCHA 1BNRA 1UCJA 1IYYA 1RSNA 2KAAA 9RNTA 1ZGXA 2F5WA 2KF5A 1I2GA 2KF3A 1A2PA 1B2XA 1I0XA 1LOVA 5BU4A 6RNTA 1R4YA 1B2UA 2C4BA 1BRSA 1RGFA 1RGHA 5HOHA 1RDSA 1BRNL 1DETA 5RNTA 1BRHA 3D5GA 1I2EA 1B27A 2ZA4A 1RGLA 1RGCA 1BAOA 1GOVA 3BIRA 2AAEA 1GMQA 1X1XA 1FW7A 1BSDA 1UCIA 3WR2A 1BNFA 1BSEA 3URPA 1YVSA 1GSPA 1BNJA 7RNTA 1FYSA 1I8VA 1X1YA 1RMSA 2RBIA 1LRAA 1T2IA 1RHLA 1GMRA 2F56A 4GHOA 1JBTA 1B21A 1RLSA 3Q3FA 3DGYA 1BGSA 3AHWA 1BSAA 2KF4A 1RGKA 2AADA 1AY7A 1BNGA 1CH0A 1I0VA 1BNSA 1JBRA 5GSPA 1BANA 1JBSA 1G02A 1UCKA 1RGGA 1FZUA 1BRGA 2BIRA 4J5GA 1RCKA 1T2HA 4GSPA 1PY3A 1X1WA 3D4AA 1BIRA 1RTUA 1TRQA 1Q9EA 3GSPA 1GMPA 3AHSA 1MGWA 1GOUA 4BU4A 1B3SA 1GOYA 1I3IA 3WHOA 1YGWA 5BIRA 1MGRA 4HOHA 4J5KA 4BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGE A;  1BNI A;  4RNT A;  8RNT A;  2F5M A;  1BUJ A;  4HAA A;  1I70 A;  1AQZ A;  1BVI A;  1BSC A;  1B2Z A;  1I3F A;  2GSP A;  2RNT A;  7GSP A;  1HYF A;  1BRK A;  2F4Y A;  3RNT A;  1RN4 A;  3SYU A;  1LNI A;  1FUT A;  1RNB A;  1LOY A;  3HOH A;  3D5I A;  6GSP A;  1YNV X;  1X1U A;  2BU4 A;  3BU4 A;  1RN1 A;  1I2F A;  1DE3 A;  1B20 A;  1B2S A;  1UCL A;  1BU4 A;  2HOH A;  1RCL A;  1BSB A;  1LOW A;  1TRP A;  1RNT A;  3AGO A;  1TTO A;  2SAR A;  3DH2 A;  1BNE A;  1FUS A;  1HZ1 A;  3A5E A;  1PYL A;  1B2M A;  3AGN A;  1C54 A;  2KF6 A;  1SAR A;  1BRJ A;  1BRI A;  1BOX A;  1RGA A;  3KCH A;  1BNR A;  1UCJ A;  1IYY A;  1RSN A;  2KAA A;  9RNT A;  1ZGX A;  2F5W A;  2KF5 A;  1I2G A;  2KF3 A;  1A2P A;  1B2X A;  1I0X A;  1LOV A;  5BU4 A;  6RNT A;  1R4Y A;  1B2U A;  2C4B A;  1BRS A;  1RGF A;  1RGH A;  5HOH A;  1RDS A;  1BRN L;  1DET A;  5RNT A;  1BRH A;  3D5G A;  1I2E A;  1B27 A;  2ZA4 A;  1RGL A;  1RGC A;  1BAO A;  1GOV A;  3BIR A;  2AAE A;  1GMQ A;  1X1X A;  1FW7 A;  1BSD A;  1UCI A;  3WR2 A;  1BNF A;  1BSE A;  3URP A;  1YVS A;  1GSP A;  1BNJ A;  7RNT A;  1FYS A;  1I8V A;  1X1Y A;  1RMS A;  2RBI A;  1LRA A;  1T2I A;  1RHL A;  1GMR A;  2F56 A;  4GHO A;  1JBT A;  1B21 A;  1RLS A;  3Q3F A;  3DGY A;  1BGS A;  3AHW A;  1BSA A;  2KF4 A;  1RGK A;  2AAD A;  1AY7 A;  1BNG A;  1CH0 A;  1I0V A;  1BNS A;  1JBR A;  5GSP A;  1BAN A;  1JBS A;  1G02 A;  1UCK A;  1RGG A;  1FZU A;  1BRG A;  2BIR A;  4J5G A;  1RCK A;  1T2H A;  4GSP A;  1PY3 A;  1X1W A;  3D4A A;  1BIR A;  1RTU A;  1TRQ A;  1Q9E A;  3GSP A;  1GMP A;  3AHS A;  1MGW A;  1GOU A;  4BU4 A;  1B3S A;  1GOY A;  1I3I A;  3WHO A;  1YGW A;  5BIR A;  1MGR A;  4HOH A;  4J5K A;  4BIR A; 
#chains in the Genus database with same CATH topology
 2GU1 A;  2W2C A;  3K0Z A;  2IUJ A;  3NHX A;  3X3X A;  1YJN 3;  1S5A A;  1I70 A;  3B4O A;  2W9Q A;  1NU3 A;  1HYF A;  1W2Z A;  2WO0 A;  5AI1 A;  1EG9 B;  4GL6 A;  3S27 A;  1UI7 A;  4HM6 B;  1FUT A;  2H0I A;  2HMK B;  1KQS 2;  2RFR A;  1EEJ A;  4R9K A;  1STD A;  2W9P A;  3CXC 2;  3NM2 A;  2MF7 A;  1BU4 A;  4EXR A;  3B4P A;  3UL5 A;  2XSH B;  1LOW A;  3AGO A;  3CCU 3;  1YVB I;  2ML6 A;  1GD3 A;  4K90 B;  5CK6 A;  1CQS A;  1IQX A;  2LQV A;  1NNV A;  1NO3 A;  3FSD A;  3KE7 A;  2CK3 H;  1VZZ A;  4DKI A;  3STD A;  4AKZ A;  3ECF A;  3WOD G;  1BRJ A;  2CIU A;  1J2B A;  5LC7 A;  3KCH A;  5KP3 A;  1RSN A;  1LNH A;  2KAA A;  3PZW A;  5IG0 A;  1IVW A;  1I2G A;  1Q7Y 4;  1GYB A;  1Q7H A;  4HBR A;  4KFD A;  1HU9 A;  1MWS A;  1WMP A;  1B2X A;  3BB9 A;  5STD A;  3JUQ A;  1MWR A;  3GZR A;  5KP1 A;  3CCS 3;  2Z77 A;  3NV0 A;  3Q2P A;  3CCR 3;  3BNE A;  4L7K A;  1NB3 I;  3BND A;  3SLU A;  1RGH A;  5HOH A;  1UGI A;  1CYU A;  2FGT A;  1DET A;  3O8Y A;  3ZG5 A;  1BRH A;  4PEJ A;  1RGL A;  4FMD A;  3NV0 B;  1VQN 3;  1RGC A;  2STD A;  2KCD A;  1STF I;  2LYX A;  2Z6B A;  3BIR A;  4N6M A;  2OOV A;  1BUQ A;  1OHP A;  4MMZ B;  1GMQ A;  2R4I A;  2UUG C;  1FW7 A;  1TFO A;  3KII A;  3WR2 A;  3SVA A;  1BSE A;  3HIG A;  1YVS A;  1W4N A;  1FGQ A;  3BNC A;  2XFT A;  1GSP A;  1KD1 4;  3DUK A;  3JUP A;  4MMX B;  1ULI B;  3FCS B;  5BVB A;  1GY7 A;  3OW2 2;  1FGR A;  3B7C A;  4X2H A;  4OUQ A;  1V74 A;  1JKG A;  4MEI A;  3RDE A;  3QK9 A;  4GHO A;  1VQM 3;  2CX0 A;  1JBT A;  1B21 A;  3N9H A;  3DM8 A;  5FGO A;  2RGQ A;  3JUM A;  4JF8 A;  2WGO A;  2GXF A;  2INX A;  3DGY A;  5IEP A;  5JBS A;  1NJI 4;  3AHW A;  4FCM A;  4U13 A;  1KWI A;  2AAD A;  3NX0 A;  3NM7 A;  1I0V A;  1CH0 A;  1JBR A;  1YJW 3;  2E2U A;  3FKA A;  3SX1 A;  5AEU B;  5JPP A;  5I97 A;  1K9M 4;  1JBS A;  1G02 A;  2W6J H;  1U8C B;  1RGG A;  2W03 A;  3U97 A;  1VQ7 3;  1IV7 A;  4FCJ A;  4J5G A;  1T2H A;  4I4K A;  1PY3 A;  3LXU X;  4BTW A;  3CPO A;  5D82 A;  3D4A A;  1RTU A;  3SOA A;  1K73 4;  1Q9E A;  3GSP A;  4TX4 A;  1W6Y A;  3KSP A;  3NBB A;  1TJD A;  5BIR A;  1NWW A;  2V1L A;  4J5K A;  1W01 A;  2CH9 A;  4BIR A;  2YFJ B;  4HM4 B;  1LXE A;  8RNT A;  4H61 A;  2F5M A;  1QAK A;  4N6V 0;  3H51 A;  2I9W A;  1BVI A;  2XRX B;  1SQW A;  2RNT A;  3FG1 A;  3PS8 A;  5M18 A;  3F40 A;  1BRK A;  3K9M C;  1RN4 A;  1LNI A;  1VQK 3;  3TDG A;  4BTY A;  1IK3 A;  3OWS A;  2KXG A;  3I56 3;  6GSP A;  1YNV X;  1GY5 A;  3BU4 A;  1DE3 A;  1RN1 A;  1I2F A;  3NBJ A;  3OWU A;  1O7H B;  1O7P B;  2HOH A;  3JUO A;  3PCS A;  3MHE A;  3S67 A;  1BSB A;  4FMA A;  5ELJ A;  1RNT A;  1TTO A;  4KVH A;  3J7Y d;  1VQP 3;  3LTA A;  4LZI A;  3ROB A;  2CW9 A;  3OXA A;  4QWT A;  2H0G A;  3DH2 A;  1BNE A;  4HM8 B;  4K61 A;  4LEH A;  1OAC A;  3A5E A;  1IT8 A;  1OUN A;  2FXT A;  4HM5 B;  4WYK B;  3SED A;  1UUG B;  1D6Z A;  4Q53 A;  4N6O B;  1G96 A;  5IF6 A;  1EKM A;  1JV2 B;  1C54 A;  3GWR A;  2KF6 A;  1EQK A;  4WP5 A;  3LZA A;  3UNL A;  1BRI A;  4NHF A;  1BOX A;  4BTX A;  4OK0 A;  3G71 3;  3EX9 A;  4MJD A;  3X41 A;  3G6E 3;  3CCJ 3;  1QVG 2;  2HML B;  1W00 A;  3MG2 A;  5HGR A;  4HM0 B;  1A2P A;  1I0X A;  3PGB A;  3EE1 A;  4KFF A;  2PNC A;  4HM7 B;  3CD6 3;  1R4Y A;  3LT9 A;  2XR8 B;  3X42 A;  1ROA A;  1BRS A;  3CMA 3;  2C10 A;  3IJE B;  4FCZ A;  4RNY A;  1VQ4 3;  3EC9 A;  2XFS A;  3HX8 A;  3LYG A;  5RNT A;  3FH1 A;  1E3R A;  5LC6 A;  1N5H A;  3LT8 A;  1JB5 A;  4HM1 B;  2SBL A;  3OX9 A;  2JDI H;  1W6G A;  3NBR A;  1ZO2 A;  3SOY A;  2P38 A;  3I55 3;  2CG1 A;  1LQG C;  5AYR B;  2BT3 A;  4I5Q A;  2OTL 3;  1UCI A;  5IEN A;  4XBY A;  3EHC A;  3CCE 3;  2CC3 A;  4ORL A;  4XB5 A;  1K8A 4;  5M1A A;  1CEW I;  5IG4 A;  1QMA A;  3EN1 B;  3DGO A;  5M19 A;  3K5T A;  1Q82 4;  1JZD A;  1SIH A;  1AVL A;  2P0X A;  1X1Y A;  4RBN A;  1IVU A;  1IDP A;  2MC8 A;  1RMS A;  2BHM A;  5AIG A;  2F99 A;  1LRA A;  2CX1 A;  3CC7 3;  3EBT A;  2F56 A;  5EEO A;  1RLS A;  2IY2 A;  2CFW A;  2ML5 A;  4HVN A;  1M1X B;  2BMR B;  1BGS A;  1YIJ 3;  3N54 B;  1BSA A;  2H0H A;  3F8X A;  1RGK A;  4MMY B;  1AY7 A;  1BNG A;  4WWU C;  1BAN A;  3D9R A;  3VSY A;  1UCK A;  1IU7 A;  5IEO A;  1BRG A;  1JN5 A;  1QJG A;  1DMN A;  2PZV A;  4WFO A;  1W2B 2;  1X1W A;  3FF2 A;  4LMI A;  2WOF A;  3FF0 A;  2ZL8 A;  4STD A;  1GMP A;  4HKV B;  5G1L A;  1JN5 B;  1TP6 A;  5D81 A;  1YJ9 3;  1ISK A;  1B3S A;  1I3I A;  3CCV 3;  1FGM A;  1GY6 A;  4RNZ A;  1RGE A;  1N9J A;  1BNI A;  4RNT A;  3UB1 A;  2CG0 A;  1A67 A;  3G16 A;  1TIJ A;  4HAA A;  3WOF B;  2D42 A;  4FR9 A;  1ZS7 A;  2GSP A;  2GEY A;  2O3O A;  3M8C A;  1Q42 A;  3K7C A;  3SYU A;  4LGQ A;  4XDV A;  4HM2 B;  1RNB A;  1LOY A;  1AR0 A;  3JUN A;  3D5I A;  2YX9 A;  1DVC A;  1SJW A;  3EN8 A;  5ELU A;  1AV4 A;  1ZX2 A;  1X1U A;  2BU4 A;  4AEQ A;  1E3V A;  4RZM A;  1B2S A;  1L5G B;  3G4S 3;  1RCL A;  1UUW B;  3MG3 A;  4IIA A;  1TRP A;  1RKY A;  3KN4 A;  4HYZ A;  3CNM A;  1QAL A;  1Y4K A;  3V92 A;  1FA3 A;  5CF2 A;  2R41 A;  1W02 A;  1W5Z A;  3ZG0 A;  3IPT A;  5A0O B;  1OHS A;  1PYL A;  3MYT A;  2OWP A;  2W56 B;  3WDG B;  1B2M A;  3CC4 3;  3LTD A;  1A2V A;  3F9S A;  3NQY A;  3OWY A;  1UGH I;  1GS3 A;  3JVC A;  4K1V A;  1N8R 4;  1NB5 I;  4KZ1 A;  2K0M A;  2OCT A;  1OGZ A;  2CFK A;  1IYY A;  9RNT A;  1ZGX A;  2F5W A;  2E2T A;  2HMN B;  2KF5 A;  2B1X B;  3X3Z A;  2K54 A;  6STD A;  1GD4 A;  2A15 A;  4EV5 A;  4WYK A;  2BO9 B;  3UL6 A;  4EBG A;  1Q40 A;  1M90 4;  3T8N A;  1O7G B;  2BMQ B;  1YI2 3;  5EQL A;  5AYS C;  3HII A;  1VQ6 3;  3LML A;  1RDS A;  1ULJ B;  3MWZ A;  1RJO A;  1SII A;  4JRF A;  2XF3 A;  1B27 A;  1I2E A;  3HZP A;  2HMM B;  4H3U A;  3GZX B;  3F14 A;  1V58 A;  1Z1S A;  1Q40 B;  3CME 3;  3H3H A;  1BAO A;  1IT7 A;  1IQ8 A;  1M9G A;  3A76 A;  2RCD A;  3IMA B;  1D6Y A;  1GOV A;  2WOH A;  4N3V A;  3B8L A;  3DMC A;  4R80 A;  4FMC A;  1T5Y A;  5EVH A;  1TU5 A;  2W0Q A;  1IQY A;  1X1X A;  4HJL B;  3V98 A;  3WA2 X;  4J9A A;  4AKY A;  3URP A;  3S28 A;  3ZFZ A;  1UI8 A;  2QA4 3;  1Q86 4;  1IV9 A;  4HZB B;  3BLZ A;  1DMQ A;  5G1K A;  1UDI I;  3CNX A;  3FG4 A;  3VGN A;  1BNJ A;  2CWV A;  2GBX B;  3E99 A;  7STD A;  1W7C A;  1OCV A;  2QGU A;  3GZB A;  1I8V A;  3CPW 2;  4N6N B;  4NRE A;  1K28 A;  1WNH A;  2W04 A;  1N8Q A;  1LQM B;  1OGX A;  2RBI A;  1JB4 A;  3L0R A;  5AIF A;  1T2I A;  1W6C A;  3EQQ B;  1IVV A;  1MOL A;  1GMR A;  1MNL A;  1RHL A;  2GEX A;  2Z76 A;  1OF5 A;  3G0K A;  3NXJ A;  2IYJ A;  1C7H A;  3F7S A;  2YFL B;  1F8N A;  1EA2 A;  3D3L A;  5AIH A;  3GAX A;  4KFE A;  4BL3 A;  3GRD A;  2UGI A;  2XEP A;  3DGN A;  3G8Z A;  3LH4 A;  1MWU A;  3FG3 A;  1OF5 B;  3RGA A;  1RRH A;  3NQZ A;  3X3Y A;  1YGE A;  1FZU A;  3F8H A;  1A90 A;  1WQL B;  2RSX A;  3CCQ 3;  3D79 A;  2F98 A;  1AVK A;  1O7W B;  2BMO B;  2CWT A;  5TGN A;  4EYC A;  1LVN A;  1WTH A;  1TRQ A;  1A2K A;  1VQQ A;  3MG1 A;  4G1M B;  1MGW A;  3DZL A;  1GOU A;  4BU4 A;  5CF1 A;  1N9E A;  1GOY A;  3UJM A;  5KP4 A;  1YGW A;  1FGO A;  2F86 B;  1MGR A;  3PYJ A;  4HOH A;  3WMD A;  5JPU A;  1VQ9 3;  3I0Y A;  2KRT A;  3KFQ C;  2Y74 A;  1PU4 A;  1BUJ A;  1AQZ A;  1I3F A;  1BSC A;  1B2Z A;  1IVX A;  1V57 A;  2CFG A;  1RN7 A;  2F4Y A;  2FNQ A;  2P0M A;  3RNT A;  7GSP A;  1VQ8 3;  1DYU A;  4CCV A;  3EJV A;  1VQ5 3;  1DVD A;  1K41 A;  4O8S A;  4KT3 B;  3HOH A;  1M1K 4;  2CWU A;  1KSI A;  4CDL A;  3ER7 A;  2CFL A;  2K3D A;  4ILF A;  3CCL 3;  3MSO A;  1B20 A;  3VF1 A;  2P05 A;  2QIY A;  4EC6 A;  2CHC A;  1UCL A;  1D6U A;  4R4K A;  4O3V A;  3K63 A;  1NDO B;  3GZY B;  4LYL B;  2XGL A;  2SAR A;  4O02 B;  4HZ9 B;  2XH9 A;  3SXX A;  1UUV B;  3MPH A;  1FUS A;  1HZ1 A;  1O7N B;  1JJ2 2;  2Z7A A;  3N8B A;  2B24 B;  2OQE C;  3LOY A;  3AGN A;  2UX0 A;  2L4V A;  3DXO A;  3DY5 A;  2IA7 A;  3HK4 A;  4R9L A;  5AEW B;  3EB8 A;  3LTC A;  1SAR A;  1JB2 A;  4XDW A;  1RGA A;  2O9U X;  1BNR A;  3F7X A;  1UCJ A;  1FGT A;  3DGM A;  4BL2 A;  1OHO A;  3PXM A;  1YIT 3;  1T3B A;  5BXQ A;  2QEX 3;  4N6L A;  2CFD A;  1JNQ A;  2KF3 A;  3FZW A;  4ZM8 A;  1LOV A;  2J8X B;  4XBT A;  5BU4 A;  2Q07 A;  1N5P A;  6RNT A;  1B2U A;  1OH0 A;  1SPU A;  2C4B A;  2W56 A;  3LTB A;  3U1W A;  2IUK A;  4IPB A;  5CLK A;  1RGF A;  3Q90 A;  1BRN L;  2HMO B;  1RRL A;  1E97 A;  1WMN A;  3FLJ A;  3D5G A;  3OV4 A;  4O2H A;  5CXO A;  2ZA4 A;  4K1U A;  3BNB A;  3S5C A;  3V99 A;  4EW5 A;  4EV2 A;  2C11 A;  3ALA A;  1KC8 4;  1JRQ A;  1JKG B;  2AAE A;  5AII A;  3S29 A;  1VQO 3;  3FGY A;  5IG3 A;  1QAF A;  1MWT A;  4XM4 A;  1BSD A;  2YFI B;  3T8U A;  2XSO B;  1BNF A;  2GBW B;  1LOX A;  2ZHX B;  3EF8 A;  4L8O A;  2P09 A;  1QVF 2;  3AMO A;  3MKI A;  4GB5 A;  1WMO A;  5DRE A;  1O7M B;  2BNG A;  4N6U A;  2WGQ A;  2CKF B;  3EBY A;  4L8P A;  4LSO A;  2L1S A;  7RNT A;  1FYS A;  4IT7 A;  2E2V A;  5IW9 A;  3DGL A;  4J8T A;  4WHA A;  1VQL 3;  4R1K A;  5G2G A;  3WA3 A;  3KKG A;  1YHQ 3;  1Q81 4;  5D83 A;  2HMJ B;  1OPY A;  2D1W A;  3AMO B;  4N6T A;  1PFP A;  3CU3 A;  1R4C A;  1U5O A;  4HM3 B;  3Q3F A;  2JQ5 A;  3HI7 A;  1FUW A;  1G0T A;  1ROV A;  2ZDJ A;  4OVM A;  2KF4 A;  4FMB A;  1EUI C;  1S72 3;  8CHO A;  1BNS A;  1HKX A;  2M7O A;  5GSP A;  1JZO A;  1TUH A;  2GU3 A;  5IG5 A;  3QRD A;  2IMJ A;  3Q1C A;  3RGR A;  4X2O A;  2BIR A;  2XGN A;  3KSE D;  3KZT A;  1RCK A;  1DMM A;  2Y73 A;  3PCR A;  4GSP A;  2OQE A;  4CJN A;  3CCM 3;  1TFK A;  1UW1 A;  3NUV A;  4XBX A;  1BIR A;  4NPB A;  3T0U A;  5IER A;  3CC2 3;  2OOV C;  3AHS A;  1CYV A;  1US1 A;  4CPK A;  2OTJ 3;  3WOE B;  5DRV A;  3WHO A;  5FW5 A;  3X40 A;  1ASK A; 
#chains in the Genus database with same CATH homology
 1RGE A;  1BNI A;  4RNT A;  8RNT A;  2F5M A;  1BUJ A;  4HAA A;  1I70 A;  1AQZ A;  1BVI A;  1BSC A;  1B2Z A;  1I3F A;  2GSP A;  2RNT A;  7GSP A;  1HYF A;  1BRK A;  2F4Y A;  3RNT A;  1RN4 A;  3SYU A;  1LNI A;  1FUT A;  1RNB A;  1LOY A;  3HOH A;  3D5I A;  6GSP A;  1YNV X;  1X1U A;  2BU4 A;  3BU4 A;  1RN1 A;  1I2F A;  1DE3 A;  1B20 A;  1B2S A;  1UCL A;  1BU4 A;  2HOH A;  1RCL A;  1BSB A;  1LOW A;  1TRP A;  1RNT A;  3AGO A;  1TTO A;  2SAR A;  3DH2 A;  1BNE A;  1FUS A;  1HZ1 A;  3A5E A;  1PYL A;  1B2M A;  3AGN A;  1C54 A;  2KF6 A;  1SAR A;  1BRJ A;  1BRI A;  1BOX A;  1RGA A;  3KCH A;  1BNR A;  1UCJ A;  1IYY A;  1RSN A;  2KAA A;  9RNT A;  1ZGX A;  2F5W A;  2KF5 A;  1I2G A;  2KF3 A;  1A2P A;  1B2X A;  1I0X A;  1LOV A;  5BU4 A;  6RNT A;  1R4Y A;  1B2U A;  2C4B A;  1BRS A;  1RGF A;  1RGH A;  5HOH A;  1RDS A;  1BRN L;  1DET A;  5RNT A;  1BRH A;  3D5G A;  1I2E A;  1B27 A;  2ZA4 A;  1RGL A;  1RGC A;  1BAO A;  1GOV A;  3BIR A;  2AAE A;  1GMQ A;  1X1X A;  1FW7 A;  1BSD A;  1UCI A;  3WR2 A;  1BNF A;  1BSE A;  3URP A;  1YVS A;  1GSP A;  1BNJ A;  7RNT A;  1FYS A;  1I8V A;  1X1Y A;  1RMS A;  2RBI A;  1LRA A;  1T2I A;  1RHL A;  1GMR A;  2F56 A;  4GHO A;  1JBT A;  1B21 A;  1RLS A;  3Q3F A;  3DGY A;  1BGS A;  3AHW A;  1BSA A;  2KF4 A;  1RGK A;  2AAD A;  1AY7 A;  1BNG A;  1CH0 A;  1I0V A;  1BNS A;  1JBR A;  5GSP A;  1BAN A;  1JBS A;  1G02 A;  1UCK A;  1RGG A;  1FZU A;  1BRG A;  2BIR A;  4J5G A;  1RCK A;  1T2H A;  4GSP A;  1PY3 A;  1X1W A;  3D4A A;  1BIR A;  1RTU A;  1TRQ A;  1Q9E A;  3GSP A;  1GMP A;  3AHS A;  1MGW A;  1GOU A;  4BU4 A;  1B3S A;  1GOY A;  1I3I A;  3WHO A;  1YGW A;  5BIR A;  1MGR A;  4HOH A;  4J5K A;  4BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...