1BNIA

Barnase wildtype structure at ph 6.0
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Crystal structural analysis of mutations in the hydrophobic cores of barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Microbial ribonuclease
total genus 29
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bniA00
1JBSA 4GHOA 1B21A 1BRIA 1MGWA 3RNTA 3WHOA 3DH2A 1BRKA 1I3IA 1BU4A 2GSPA 3AGOA 3BU4A 1RNBA 1LOYA 2C4BA 2F5WA 1GOYA 3URPA 1RSNA 4HOHA 1RGKA 1G02A 1RLSA 4J5KA 3SYUA 3Q3FA 1FZUA 1JBTA 2SARA 1BRGA 6RNTA 2KF3A 1BRHA 6GSPA 3A5EA 1RCKA 1TTOA 1IYYA 1RDSA 1BAOA 1Q9EA 1RNTA 1B2ZA 4RNTA 1B3SA 1UCLA 1GMRA 1BSDA 1BOXA 1LRAA 1SARA 4BIRA 5HOHA 1RCLA 1DETA 3KCHA 9RNTA 1DE3A 1BIRA 1BNJA 1RGGA 2BU4A 5BU4A 1UCJA 7RNTA 1BNSA 3WR2A 1R4YA 1BSAA 2RNTA 1LNIA 1I2EA 1T2HA 1BRSA 1AQZA 1BVIA 1LOWA 1BNFA 2KF6A 2KF4A 1AY7A 1BSBA 1B2SA 2KAAA 1BNRA 2AAEA 1GSPA 1I2FA 8RNTA 3D4AA 1I8VA 1RTUA 4BU4A 1RGAA 3AGNA 1X1XA 1B2UA 3DGYA 1FUSA 4J5GA 1RHLA 1BSEA 1C54A 1RMSA 7GSPA 1I0VA 1YNVX 1BANA 3D5GA 1GOVA 1PYLA 1TRQA 1FW7A 1RGEA 1RGLA 4GSPA 1BNGA 1HYFA 2AADA 1GMQA 1X1UA 1B2MA 1LOVA 1JBRA 2F5MA 1RGHA 1B20A 2ZA4A 1YVSA 3GSPA 1BGSA 3AHSA 1RGFA 2KF5A 1I0XA 1BNEA 1PY3A 1YGWA 1FUTA 1RN4A 1I2GA 2RBIA 1X1YA 2HOHA 1UCKA 3HOHA 1RGCA 1TRPA 5GSPA 1BUJA 1BRNL 2F4YA 5BIRA 1MGRA 1A2PA 1B2XA 3BIRA 1FYSA 1B27A 1I70A 1X1WA 1BRJA 1BSCA 1ZGXA 1UCIA 3AHWA 2F56A 1T2IA 3D5IA 1HZ1A 1RN1A 5RNTA 1GMPA 2BIRA 4HAAA 1BNIA 1CH0A 1GOUA 1I3FA
chains in the Genus database with same CATH superfamily
1TJDA 3NBJA 5DREA 2CWTA 2YX9A 4GHOA 4HM2B 3B8LA 2WOFA 4LYLB 3RNTA 1OH0A 3DH2A 3LZAA 1AVLA 3BLZA 3LXUX 3KSED 1VZZA 1NDOB 1IVUA 8CHOA 1GOYA 4FCZA 1GYBA 3PGBA 3PYJA 1PU4A 4HOHA 2O3OA 2INXA 1OUNA 1S5AA 3CXC2 1BRGA 6RNTA 4ORLA 1DVCA 3A5EA 3MYTA 4BL2A 1SPUA 1ULIB 3U1WA 1RJOA 3UNLA 1KD14 1RNTA 1B2ZA 3NHXA 5CLKA 3JUOA 4GB5A 1BOXA 1UW1A 4XBXA 1STFI 2UX0A 3UJMA 1SJWA 1DETA 2E2TA 3BNDA 3KCHA 3OWYA 1BNJA 4KVHA 1FGOA 1RGGA 2BU4A 4PEJA 9RNTA 2Y73A 3M8CA 3WR2A 1TU5A 3K9MC 2RNTA 4L7KA 4O2HA 3GZYB 1GD4A 3SXXA 3V99A 4AKYA 1N9EA 2RCDA 1AQZA 5G1LA 2QIYA 3HIGA 2XSOB 1TUHA 3SOYA 1OGZA 4WP5A 3TDGA 3K0ZA 2Y74A 1IT8A 3T8NA 1B2SA 2KAAA 1D6ZA 1I2FA 4LZIA 3CD63 8RNTA 3WA3A 1VQO3 1UGHI 2YFLB 4R80A 3ALAA 2KXGA 1IV7A 3KN4A 1SIIA 1E97A 3JUMA 3AGNA 4G1MB 2WGQA 3S29A 3DGYA 3KIIA 4HZBB 5AYRB 5LC7A 5BVBA 2CWVA 4H3UA 1JB5A 2CKFB 5I97A 1F8NA 1RMSA 1J2BA 5IEOA 7GSPA 1W6YA 2BMQB 2HMNB 2OOVC 1WMPA 2BMRB 1K28A 3DUKA 1PYLA 2CFKA 3EBYA 4HM7B 1TRQA 3MPHA 3CCJ3 3ZG5A 5AEWB 1DVDA 2H0GA 1YI23 3MHEA 1ZX2A 2J8XB 3LYGA 4N6TA 1GMQA 1GY7A 4FCJA 3G0KA 4XDWA 1WTHA 3VGNA 3VSYA 5A0OB 1DMMA 3BNCA 3EQQB 1Y4KA 4X2HA 4K1VA 1UI7A 4NPBA 3CPOA 1JB4A 1RGFA 3BNBA 4HM3B 1ISKA 2JQ5A 4EV5A 1FUTA 2XF3A 3LTDA 4RNZA 1MOLA 1QJGA 1FGQA 3LT9A 3LH4A 1N5HA 3KFQC 1TIJA 1Q40B 2GU1A 1QVG2 2FGTA 2ML6A 1TRPA 4JF8A 3X3ZA 1FUWA 2HMMB 1MGRA 3L0RA 3NV0B 3I553 5CF1A 4RNYA 3BIRA 1FYSA 1IVXA 1PFPA 3T0UA 2HMKB 5AYSC 2CG1A 1UCIA 4K1UA 2FNQA 3X41A 4K90B 2QGUA 3D5IA 3WOEB 2ML5A 5RNTA 1GMPA 3WODG 1BNIA 4ILFA 1Q814 2A15A 1I3FA 4J5KA 1IQXA 3FZWA 3DGLA 4HBRA 1MGWA 2C11A 1Z1SA 2FXTA 4ZM8A 3FG1A 1BRKA 2BO9B 2CH9A 2ZDJA 2GSPA 4RBNA 1T5YA 2C10A 1DMNA 2WO0A 1AR0A 4BTWA 2KRTA 4AKZA 1RSNA 5IERA 6STDA 3EJVA 1JBTA 1NB3I 2M7OA 2SARA 3WDGB 1VQN3 3EF8A 1RCKA 2GBXB 1VQ93 2Z76A 3OX9A 3WMDA 1BAOA 3LTBA 1E3RA 2B1XB 1B3SA 4RNTA 1YVBI 4EV2A 3U97A 2L4VA 4BIRA 5HOHA 2K3DA 3NXJA 1FGTA 3S5CA 1BIRA 3S67A 1UCJA 3MG1A 4OK0A 3A76A 3EB8A 1R4CA 1AVKA 2RFRA 4XB5A 1LNIA 4JRFA 3CNMA 3OV4A 1YIT3 1I2EA 3PCRA 4CCVA 1Q40A 1W4NA 3B4OA 1UUWB 1BVIA 1W02A 3I0YA 1M904 3V98A 3NV0A 5EVHA 1MNLA 1AY7A 1U5OA 2W2CA 1NNVA 2XRXB 3SVAA 2CX1A 4U13A 1T3BA 1L5GB 4MMYB 1M9GA 1US1A 3F8XA 4RZMA 5D82A 2LQVA 1HKXA 2PZVA 2STDA 3JUPA 1RRHA 3O8YA 1LOXA 4O02B 5AIFA 3FG3A 4BU4A 1KSIA 4EXRA 5FW5A 2UGIA 1IU7A 3G8ZA 4HVNA 4J5GA 5M18A 4I4KA 1WMNA 1C54A 1ZS7A 2GU3A 2W9QA 2RGQA 1I0VA 4BTYA 1OF5A 1BANA 2JDIH 3D5GA 2XGNA 3G713 3SEDA 3B7CA 1N9JA 1RGLA 2IA7A 3V92A 1ROVA 1BNGA 1HYFA 3FLJA 3EC9A 2F99A 1YJN3 2CIUA 2D42A 2P05A 4EW5A 1B2MA 1SIHA 1IV9A 1GD3A 1RGHA 2F5MA 2L1SA 1W5ZA 3CCQ3 3QRDA 2ZA4A 1YVSA 4HM8B 1BGSA 1UI8A 3AHSA 2BHMA 2GXFA 1N5PA 2OWPA 3ECFA 1IVWA 1PY3A 1TFKA 1RRLA 4STDA 1IQYA 1RN4A 1X1YA 2SBLA 2E2UA 2LYXA 3FH1A 3ZFZA 3LOYA 5JBSA 2H0IA 3HOHA 4I5QA 1RGCA 3OWSA 5GSPA 3K7CA 3I563 4N6UA 1MWRA 1VQ83 7STDA 2CFLA 2V1LA 2F86B 2UUGC 3D3LA 3EN8A 1X1WA 1N8QA 3FG4A 3HZPA 1BSCA 2XEPA 1LNHA 3CNXA 3RDEA 2OTJ3 1BUQA 3UL6A 3MG3A 4HM5B 1K9M4 1T2IA 1GY6A 3GRDA 4R1KA 3CCM3 1HZ1A 3CCS3 1WNHA 3E99A 1K734 1CQSA 3LMLA 5EEOA 4N6V0 1IK3A 2CFGA 4WFOA 5M1AA 1JBRA 2CW9A 4WYKA 5IG5A 3CCU3 1B21A 5EQLA 1O7GB 2HMOB 3WOFB 5JPUA 4KFFA 5IEPA 1I3IA 1BU4A 2F98A 3N8BA 2GEYA 3AGOA 3NQYA 5CXOA 1QAFA 1DMQA 1TP6A 3IMAB 4MMXB 2O9UX 3CCE3 2MC8A 1RNBA 1LOYA 3ROBA 5FGOA 2P09A 2F5WA 1EA2A 3URPA 4EYCA 3OWUA 3CPW2 5ELJA 1RGKA 1JB2A 1NO3A 1RLSA 1RN7A 1IDPA 3KZTA 3Q3FA 1QVF2 3EX9A 1JKGB 1FZUA 1BRHA 4HM4B 3B4PA 3MSOA 1MWTA 2QEX3 1MWUA 3DM8A 1NJI4 3H3HA 1TTOA 5HGRA 1ASKA 2OOVA 1RDSA 4HZ9B 4FR9A 3SOAA 1VQ43 1Q42A 2RSXA 4LGQA 3LT8A 2OCTA 2W56B 4MJDA 5KP4A 1Q824 1VQL3 1LRAA 1DYUA 1NU3A 1W2B2 1OF5B 2GBWB 3S28A 3ER7A 4N6OB 1W7CA 3VF1A 4Q53A 4HM6B 1DE3A 4FMCA 1VQQA 5M19A 3GZBA 1R4YA 1BSAA 3IJEB 3LTCA 1O7HB 1EUIC 5IG4A 3EN1B 1T2HA 4OUQA 1W00A 2CWUA 2CHCA 1BNFA 2KF4A 3G6E3 1CYVA 2CC3A 1QAKA 3GAXA 1BSBA 4N6NB 3CC43 2IYJA 2MF7A 2W9PA 2AAEA 4XM4A 1GSPA 1JZDA 5IENA 1BNRA 1EG9B 3FKAA 3KSPA 3WA2X 2P0XA 1RTUA 5ELUA 1U8CB 4HM0B 4N3VA 1EKMA 1OHOA 1X1XA 3N54B 1B2UA 3S27A 1WQLB 3IPTA 1M1XB 1LVNA 1FUSA 2XFTA 5AIIA 5LC6A 5KP1A 1BSEA 4KZ1A 2CG0A 2I9WA 1FGMA 1V58A 5CK6A 3F14A 1JNQA 1FA3A 1GOVA 2Q07A 2WGOA 3BB9A 3RGAA 1RGEA 1EQKA 2AADA 4FMBA 1UGIA 2B24B 4N6MA 1V57A 3HI7A 1X1UA 2ZL8A 1LOVA 3PXMA 3F7SA 4J9AA 5D83A 1KC84 2IUKA 3JUNA 3EE1A 3GSPA 3EBTA 3HIIA 3HX8A 2PNCA 4WYKB 1JKGA 1BNEA 3FCSB 1ULJB 1YGWA 3DGNA 1I2GA 2RBIA 5IG0A 3G16A 1NWWA 4KFEA 1O7MB 2W03A 1YJ93 1W01A 2W56A 1KWIA 3X40A 1Q7HA 1MWSA 4WHAA 1BRNL 2F4YA 1LXEA 3AMOB 3KE7A 5STDA 1A2PA 3SX1A 1SQWA 3HK4A 5AIHA 3X3YA 4MMZB 3UL5A 1VQK3 5KP3A 1B27A 3Q2PA 1I70A 3ZG0A 2K54A 4CPKA 2Z7AA 1M1K4 1IQ8A 2Z77A 1VQM3 1BRJA 1ZGXA 1YGEA 3MKIA 4FCMA 4KFDA 1EEJA 4CDLA 2F56A 1CEWI 1W2ZA 3F40A 1Q7Y4 2BT3A 3J7Yd 3NBRA 1RKYA 1VQ53 3LTAA 4FMDA 4HYZA 1VQ73 3D79A 5AIGA 2ZHXB 3JUQA 2BIRA 4HAAA 1Q864 1CH0A 2XR8B 3FF2A 1GOUA 2OTL3 4AEQA 1JBSA 5IG3A 1BRIA 1W6GA 2W04A 5IF6A 3WHOA 4O8SA 4R9KA 3X3XA 5G1KA 3BU4A 4HJLB 4NHFA 1S723 3GZXB 1QMAA 2C4BA 3QK9A 1YJW3 1OPYA 3GZRA 2YFJB 1A2KA 3H51A 3FSDA 1G02A 3SYUA 1VQ63 3MWZA 3PZWA 4K61A 2GEXA 1W6CA 2KF3A 1N8R4 1O7WB 6GSPA 1OHSA 1OGXA 3Q1CA 1JRQA 2Z6BA 1JJ22 2R4IA 3DY5A 1IYYA 1JN5B 1Q9EA 3OW22 4DKIA 1GS3A 1UCLA 1GMRA 1BSDA 1SARA 3CC73 1YHQ3 2HMLB 2OQEC 3CC23 3F7XA 1RCLA 5JPPA 5BU4A 4NREA 1ROAA 7RNTA 1BNSA 3CCV3 1A2VA 1QALA 2BMOB 3F9SA 4TX4A 1BRSA 2HMJB 1NB5I 4EBGA 1C7HA 1UUVB 1LOWA 4FMAA 3AMOA 2KF6A 3DXOA 4IPBA 2P0MA 3NM7A 1O7PB 1STDA 4KT3B 2IY2A 3CCL3 5DRVA 4R4KA 1KQS2 3CCR3 3NX0A 2P38A 1IVVA 1I8VA 3D4AA 4HM1B 4L8PA 4X2OA 3T8UA 5CF2A 1RGAA 2E2VA 1FGRA 4GL6A 4QWTA 1HU9A 2XH9A 3DMCA 3X42A 1CYUA 2KCDA 3FF0A 4LMIA 4IIAA 1D6UA 1RHLA 1ZO2A 2XGLA 2XFSA 3NBBA 4CJNA 1JZOA 1O7NB 2CK3H 1YNVX 4WWUC 3CME3 4MEIA 4O3VA 4R9LA 1A90A 3RGRA 2CFWA 1YIJ3 4LEHA 4H61A 1FW7A 2IMJA 4XDVA 2K0MA 2W0QA 4GSPA 1E3VA 5G2GA 3FGYA 2QA43 1D6YA 1UUGB 1OHPA 3SLUA 5IW9A 1JV2B 3NUVA 2OQEA 1TFOA 4HKVB 3F8HA 2R41A 3NQZA 4IT7A 1B20A 3PCSA 3DGMA 3DGOA 5AI1A 4EC6A 3EHCA 3G4S3 3STDA 5D81A 4XBTA 2KF5A 4BTXA 1I0XA 2BNGA 3CU3A 1G0TA 4XBYA 1AV4A 2XSHB 3N9HA 3MG2A 1LQMB 2HOHA 2W6JH 1UCKA 3D9RA 1LQGC 1IT7A 1JN5A 4LSOA 4OVMA 4J8TA 4BL3A 3JVCA 2D1WA 4L8OA 3CMA3 2H0HA 1WMOA 1V74A 1BUJA 3PS8A 1OCVA 1UDII 5BIRA 3K63A 1B2XA 3NM2A 5BXQA 1GY5A 3Q90A 3DZLA 3BNEA 1K41A 5TGNA 2WOHA 3K5TA 1G96A 2YFIB 3AHWA 5AEUB 3GWRA 3OXAA 3UB1A 1A67A 2IUJA 2CX0A 1VQP3 1RN1A 1OACA 2CFDA 1K8A4 4N6LA 3KKGA
chains in the Genus database with same CATH topology
1JBSA 4GHOA 1B21A 1BRIA 1MGWA 3RNTA 3WHOA 3DH2A 1BRKA 1I3IA 1BU4A 2GSPA 3AGOA 3BU4A 1RNBA 1LOYA 2C4BA 2F5WA 1GOYA 3URPA 1RSNA 4HOHA 1RGKA 1G02A 1RLSA 4J5KA 3SYUA 3Q3FA 1FZUA 1JBTA 2SARA 1BRGA 6RNTA 2KF3A 1BRHA 6GSPA 3A5EA 1RCKA 1TTOA 1IYYA 1RDSA 1BAOA 1Q9EA 1RNTA 1B2ZA 4RNTA 1B3SA 1UCLA 1GMRA 1BSDA 1BOXA 1LRAA 1SARA 4BIRA 5HOHA 1RCLA 1DETA 3KCHA 9RNTA 1DE3A 1BIRA 1BNJA 1RGGA 2BU4A 5BU4A 1UCJA 7RNTA 1BNSA 3WR2A 1R4YA 1BSAA 2RNTA 1LNIA 1I2EA 1T2HA 1BRSA 1AQZA 1BVIA 1LOWA 1BNFA 2KF6A 2KF4A 1AY7A 1BSBA 1B2SA 2KAAA 1BNRA 2AAEA 1GSPA 1I2FA 8RNTA 3D4AA 1I8VA 1RTUA 4BU4A 1RGAA 3AGNA 1X1XA 1B2UA 3DGYA 1FUSA 4J5GA 1RHLA 1BSEA 1C54A 1RMSA 7GSPA 1I0VA 1YNVX 1BANA 3D5GA 1GOVA 1PYLA 1TRQA 1FW7A 1RGEA 1RGLA 4GSPA 1BNGA 1HYFA 2AADA 1GMQA 1X1UA 1B2MA 1LOVA 1JBRA 2F5MA 1RGHA 1B20A 2ZA4A 1YVSA 3GSPA 1BGSA 3AHSA 1RGFA 2KF5A 1I0XA 1BNEA 1PY3A 1YGWA 1FUTA 1RN4A 1I2GA 2RBIA 1X1YA 2HOHA 1UCKA 3HOHA 1RGCA 1TRPA 5GSPA 1BUJA 1BRNL 2F4YA 5BIRA 1MGRA 1A2PA 1B2XA 3BIRA 1FYSA 1B27A 1I70A 1X1WA 1BRJA 1BSCA 1ZGXA 1UCIA 3AHWA 2F56A 1T2IA 3D5IA 1HZ1A 1RN1A 5RNTA 1GMPA 2BIRA 4HAAA 1BNIA 1CH0A 1GOUA 1I3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBS A;  4GHO A;  1B21 A;  1BRI A;  1MGW A;  3RNT A;  3WHO A;  3DH2 A;  1BRK A;  1I3I A;  1BU4 A;  2GSP A;  3AGO A;  3BU4 A;  1RNB A;  1LOY A;  2C4B A;  2F5W A;  1GOY A;  3URP A;  1RSN A;  4HOH A;  1RGK A;  1G02 A;  1RLS A;  4J5K A;  3SYU A;  3Q3F A;  1FZU A;  1JBT A;  2SAR A;  1BRG A;  6RNT A;  2KF3 A;  1BRH A;  6GSP A;  3A5E A;  1RCK A;  1TTO A;  1IYY A;  1RDS A;  1BAO A;  1Q9E A;  1RNT A;  1B2Z A;  4RNT A;  1B3S A;  1UCL A;  1GMR A;  1BSD A;  1BOX A;  1LRA A;  1SAR A;  4BIR A;  5HOH A;  1RCL A;  1DET A;  3KCH A;  9RNT A;  1DE3 A;  1BIR A;  1BNJ A;  1RGG A;  2BU4 A;  5BU4 A;  1UCJ A;  7RNT A;  1BNS A;  3WR2 A;  1R4Y A;  1BSA A;  2RNT A;  1LNI A;  1I2E A;  1T2H A;  1BRS A;  1AQZ A;  1BVI A;  1LOW A;  1BNF A;  2KF6 A;  2KF4 A;  1AY7 A;  1BSB A;  1B2S A;  2KAA A;  1BNR A;  2AAE A;  1GSP A;  1I2F A;  8RNT A;  3D4A A;  1I8V A;  1RTU A;  4BU4 A;  1RGA A;  3AGN A;  1X1X A;  1B2U A;  3DGY A;  1FUS A;  4J5G A;  1RHL A;  1BSE A;  1C54 A;  1RMS A;  7GSP A;  1I0V A;  1YNV X;  1BAN A;  3D5G A;  1GOV A;  1PYL A;  1TRQ A;  1FW7 A;  1RGE A;  1RGL A;  4GSP A;  1BNG A;  1HYF A;  2AAD A;  1GMQ A;  1X1U A;  1B2M A;  1LOV A;  1JBR A;  2F5M A;  1RGH A;  1B20 A;  2ZA4 A;  1YVS A;  3GSP A;  1BGS A;  3AHS A;  1RGF A;  2KF5 A;  1I0X A;  1BNE A;  1PY3 A;  1YGW A;  1FUT A;  1RN4 A;  1I2G A;  2RBI A;  1X1Y A;  2HOH A;  1UCK A;  3HOH A;  1RGC A;  1TRP A;  5GSP A;  1BUJ A;  1BRN L;  2F4Y A;  5BIR A;  1MGR A;  1A2P A;  1B2X A;  3BIR A;  1FYS A;  1B27 A;  1I70 A;  1X1W A;  1BRJ A;  1BSC A;  1ZGX A;  1UCI A;  3AHW A;  2F56 A;  1T2I A;  3D5I A;  1HZ1 A;  1RN1 A;  5RNT A;  1GMP A;  2BIR A;  4HAA A;  1BNI A;  1CH0 A;  1GOU A;  1I3F A; 
#chains in the Genus database with same CATH topology
 1TJD A;  3NBJ A;  5DRE A;  2CWT A;  2YX9 A;  4GHO A;  4HM2 B;  3B8L A;  2WOF A;  4LYL B;  3RNT A;  1OH0 A;  3DH2 A;  3LZA A;  1AVL A;  3BLZ A;  3LXU X;  3KSE D;  1VZZ A;  1NDO B;  1IVU A;  8CHO A;  1GOY A;  4FCZ A;  1GYB A;  3PGB A;  3PYJ A;  1PU4 A;  4HOH A;  2O3O A;  2INX A;  1OUN A;  1S5A A;  3CXC 2;  1BRG A;  6RNT A;  4ORL A;  1DVC A;  3A5E A;  3MYT A;  4BL2 A;  1SPU A;  1ULI B;  3U1W A;  1RJO A;  3UNL A;  1KD1 4;  1RNT A;  1B2Z A;  3NHX A;  5CLK A;  3JUO A;  4GB5 A;  1BOX A;  1UW1 A;  4XBX A;  1STF I;  2UX0 A;  3UJM A;  1SJW A;  1DET A;  2E2T A;  3BND A;  3KCH A;  3OWY A;  1BNJ A;  4KVH A;  1FGO A;  1RGG A;  2BU4 A;  4PEJ A;  9RNT A;  2Y73 A;  3M8C A;  3WR2 A;  1TU5 A;  3K9M C;  2RNT A;  4L7K A;  4O2H A;  3GZY B;  1GD4 A;  3SXX A;  3V99 A;  4AKY A;  1N9E A;  2RCD A;  1AQZ A;  5G1L A;  2QIY A;  3HIG A;  2XSO B;  1TUH A;  3SOY A;  1OGZ A;  4WP5 A;  3TDG A;  3K0Z A;  2Y74 A;  1IT8 A;  3T8N A;  1B2S A;  2KAA A;  1D6Z A;  1I2F A;  4LZI A;  3CD6 3;  8RNT A;  3WA3 A;  1VQO 3;  1UGH I;  2YFL B;  4R80 A;  3ALA A;  2KXG A;  1IV7 A;  3KN4 A;  1SII A;  1E97 A;  3JUM A;  3AGN A;  4G1M B;  2WGQ A;  3S29 A;  3DGY A;  3KII A;  4HZB B;  5AYR B;  5LC7 A;  5BVB A;  2CWV A;  4H3U A;  1JB5 A;  2CKF B;  5I97 A;  1F8N A;  1RMS A;  1J2B A;  5IEO A;  7GSP A;  1W6Y A;  2BMQ B;  2HMN B;  2OOV C;  1WMP A;  2BMR B;  1K28 A;  3DUK A;  1PYL A;  2CFK A;  3EBY A;  4HM7 B;  1TRQ A;  3MPH A;  3CCJ 3;  3ZG5 A;  5AEW B;  1DVD A;  2H0G A;  1YI2 3;  3MHE A;  1ZX2 A;  2J8X B;  3LYG A;  4N6T A;  1GMQ A;  1GY7 A;  4FCJ A;  3G0K A;  4XDW A;  1WTH A;  3VGN A;  3VSY A;  5A0O B;  1DMM A;  3BNC A;  3EQQ B;  1Y4K A;  4X2H A;  4K1V A;  1UI7 A;  4NPB A;  3CPO A;  1JB4 A;  1RGF A;  3BNB A;  4HM3 B;  1ISK A;  2JQ5 A;  4EV5 A;  1FUT A;  2XF3 A;  3LTD A;  4RNZ A;  1MOL A;  1QJG A;  1FGQ A;  3LT9 A;  3LH4 A;  1N5H A;  3KFQ C;  1TIJ A;  1Q40 B;  2GU1 A;  1QVG 2;  2FGT A;  2ML6 A;  1TRP A;  4JF8 A;  3X3Z A;  1FUW A;  2HMM B;  1MGR A;  3L0R A;  3NV0 B;  3I55 3;  5CF1 A;  4RNY A;  3BIR A;  1FYS A;  1IVX A;  1PFP A;  3T0U A;  2HMK B;  5AYS C;  2CG1 A;  1UCI A;  4K1U A;  2FNQ A;  3X41 A;  4K90 B;  2QGU A;  3D5I A;  3WOE B;  2ML5 A;  5RNT A;  1GMP A;  3WOD G;  1BNI A;  4ILF A;  1Q81 4;  2A15 A;  1I3F A;  4J5K A;  1IQX A;  3FZW A;  3DGL A;  4HBR A;  1MGW A;  2C11 A;  1Z1S A;  2FXT A;  4ZM8 A;  3FG1 A;  1BRK A;  2BO9 B;  2CH9 A;  2ZDJ A;  2GSP A;  4RBN A;  1T5Y A;  2C10 A;  1DMN A;  2WO0 A;  1AR0 A;  4BTW A;  2KRT A;  4AKZ A;  1RSN A;  5IER A;  6STD A;  3EJV A;  1JBT A;  1NB3 I;  2M7O A;  2SAR A;  3WDG B;  1VQN 3;  3EF8 A;  1RCK A;  2GBX B;  1VQ9 3;  2Z76 A;  3OX9 A;  3WMD A;  1BAO A;  3LTB A;  1E3R A;  2B1X B;  1B3S A;  4RNT A;  1YVB I;  4EV2 A;  3U97 A;  2L4V A;  4BIR A;  5HOH A;  2K3D A;  3NXJ A;  1FGT A;  3S5C A;  1BIR A;  3S67 A;  1UCJ A;  3MG1 A;  4OK0 A;  3A76 A;  3EB8 A;  1R4C A;  1AVK A;  2RFR A;  4XB5 A;  1LNI A;  4JRF A;  3CNM A;  3OV4 A;  1YIT 3;  1I2E A;  3PCR A;  4CCV A;  1Q40 A;  1W4N A;  3B4O A;  1UUW B;  1BVI A;  1W02 A;  3I0Y A;  1M90 4;  3V98 A;  3NV0 A;  5EVH A;  1MNL A;  1AY7 A;  1U5O A;  2W2C A;  1NNV A;  2XRX B;  3SVA A;  2CX1 A;  4U13 A;  1T3B A;  1L5G B;  4MMY B;  1M9G A;  1US1 A;  3F8X A;  4RZM A;  5D82 A;  2LQV A;  1HKX A;  2PZV A;  2STD A;  3JUP A;  1RRH A;  3O8Y A;  1LOX A;  4O02 B;  5AIF A;  3FG3 A;  4BU4 A;  1KSI A;  4EXR A;  5FW5 A;  2UGI A;  1IU7 A;  3G8Z A;  4HVN A;  4J5G A;  5M18 A;  4I4K A;  1WMN A;  1C54 A;  1ZS7 A;  2GU3 A;  2W9Q A;  2RGQ A;  1I0V A;  4BTY A;  1OF5 A;  1BAN A;  2JDI H;  3D5G A;  2XGN A;  3G71 3;  3SED A;  3B7C A;  1N9J A;  1RGL A;  2IA7 A;  3V92 A;  1ROV A;  1BNG A;  1HYF A;  3FLJ A;  3EC9 A;  2F99 A;  1YJN 3;  2CIU A;  2D42 A;  2P05 A;  4EW5 A;  1B2M A;  1SIH A;  1IV9 A;  1GD3 A;  1RGH A;  2F5M A;  2L1S A;  1W5Z A;  3CCQ 3;  3QRD A;  2ZA4 A;  1YVS A;  4HM8 B;  1BGS A;  1UI8 A;  3AHS A;  2BHM A;  2GXF A;  1N5P A;  2OWP A;  3ECF A;  1IVW A;  1PY3 A;  1TFK A;  1RRL A;  4STD A;  1IQY A;  1RN4 A;  1X1Y A;  2SBL A;  2E2U A;  2LYX A;  3FH1 A;  3ZFZ A;  3LOY A;  5JBS A;  2H0I A;  3HOH A;  4I5Q A;  1RGC A;  3OWS A;  5GSP A;  3K7C A;  3I56 3;  4N6U A;  1MWR A;  1VQ8 3;  7STD A;  2CFL A;  2V1L A;  2F86 B;  2UUG C;  3D3L A;  3EN8 A;  1X1W A;  1N8Q A;  3FG4 A;  3HZP A;  1BSC A;  2XEP A;  1LNH A;  3CNX A;  3RDE A;  2OTJ 3;  1BUQ A;  3UL6 A;  3MG3 A;  4HM5 B;  1K9M 4;  1T2I A;  1GY6 A;  3GRD A;  4R1K A;  3CCM 3;  1HZ1 A;  3CCS 3;  1WNH A;  3E99 A;  1K73 4;  1CQS A;  3LML A;  5EEO A;  4N6V 0;  1IK3 A;  2CFG A;  4WFO A;  5M1A A;  1JBR A;  2CW9 A;  4WYK A;  5IG5 A;  3CCU 3;  1B21 A;  5EQL A;  1O7G B;  2HMO B;  3WOF B;  5JPU A;  4KFF A;  5IEP A;  1I3I A;  1BU4 A;  2F98 A;  3N8B A;  2GEY A;  3AGO A;  3NQY A;  5CXO A;  1QAF A;  1DMQ A;  1TP6 A;  3IMA B;  4MMX B;  2O9U X;  3CCE 3;  2MC8 A;  1RNB A;  1LOY A;  3ROB A;  5FGO A;  2P09 A;  2F5W A;  1EA2 A;  3URP A;  4EYC A;  3OWU A;  3CPW 2;  5ELJ A;  1RGK A;  1JB2 A;  1NO3 A;  1RLS A;  1RN7 A;  1IDP A;  3KZT A;  3Q3F A;  1QVF 2;  3EX9 A;  1JKG B;  1FZU A;  1BRH A;  4HM4 B;  3B4P A;  3MSO A;  1MWT A;  2QEX 3;  1MWU A;  3DM8 A;  1NJI 4;  3H3H A;  1TTO A;  5HGR A;  1ASK A;  2OOV A;  1RDS A;  4HZ9 B;  4FR9 A;  3SOA A;  1VQ4 3;  1Q42 A;  2RSX A;  4LGQ A;  3LT8 A;  2OCT A;  2W56 B;  4MJD A;  5KP4 A;  1Q82 4;  1VQL 3;  1LRA A;  1DYU A;  1NU3 A;  1W2B 2;  1OF5 B;  2GBW B;  3S28 A;  3ER7 A;  4N6O B;  1W7C A;  3VF1 A;  4Q53 A;  4HM6 B;  1DE3 A;  4FMC A;  1VQQ A;  5M19 A;  3GZB A;  1R4Y A;  1BSA A;  3IJE B;  3LTC A;  1O7H B;  1EUI C;  5IG4 A;  3EN1 B;  1T2H A;  4OUQ A;  1W00 A;  2CWU A;  2CHC A;  1BNF A;  2KF4 A;  3G6E 3;  1CYV A;  2CC3 A;  1QAK A;  3GAX A;  1BSB A;  4N6N B;  3CC4 3;  2IYJ A;  2MF7 A;  2W9P A;  2AAE A;  4XM4 A;  1GSP A;  1JZD A;  5IEN A;  1BNR A;  1EG9 B;  3FKA A;  3KSP A;  3WA2 X;  2P0X A;  1RTU A;  5ELU A;  1U8C B;  4HM0 B;  4N3V A;  1EKM A;  1OHO A;  1X1X A;  3N54 B;  1B2U A;  3S27 A;  1WQL B;  3IPT A;  1M1X B;  1LVN A;  1FUS A;  2XFT A;  5AII A;  5LC6 A;  5KP1 A;  1BSE A;  4KZ1 A;  2CG0 A;  2I9W A;  1FGM A;  1V58 A;  5CK6 A;  3F14 A;  1JNQ A;  1FA3 A;  1GOV A;  2Q07 A;  2WGO A;  3BB9 A;  3RGA A;  1RGE A;  1EQK A;  2AAD A;  4FMB A;  1UGI A;  2B24 B;  4N6M A;  1V57 A;  3HI7 A;  1X1U A;  2ZL8 A;  1LOV A;  3PXM A;  3F7S A;  4J9A A;  5D83 A;  1KC8 4;  2IUK A;  3JUN A;  3EE1 A;  3GSP A;  3EBT A;  3HII A;  3HX8 A;  2PNC A;  4WYK B;  1JKG A;  1BNE A;  3FCS B;  1ULJ B;  1YGW A;  3DGN A;  1I2G A;  2RBI A;  5IG0 A;  3G16 A;  1NWW A;  4KFE A;  1O7M B;  2W03 A;  1YJ9 3;  1W01 A;  2W56 A;  1KWI A;  3X40 A;  1Q7H A;  1MWS A;  4WHA A;  1BRN L;  2F4Y A;  1LXE A;  3AMO B;  3KE7 A;  5STD A;  1A2P A;  3SX1 A;  1SQW A;  3HK4 A;  5AIH A;  3X3Y A;  4MMZ B;  3UL5 A;  1VQK 3;  5KP3 A;  1B27 A;  3Q2P A;  1I70 A;  3ZG0 A;  2K54 A;  4CPK A;  2Z7A A;  1M1K 4;  1IQ8 A;  2Z77 A;  1VQM 3;  1BRJ A;  1ZGX A;  1YGE A;  3MKI A;  4FCM A;  4KFD A;  1EEJ A;  4CDL A;  2F56 A;  1CEW I;  1W2Z A;  3F40 A;  1Q7Y 4;  2BT3 A;  3J7Y d;  3NBR A;  1RKY A;  1VQ5 3;  3LTA A;  4FMD A;  4HYZ A;  1VQ7 3;  3D79 A;  5AIG A;  2ZHX B;  3JUQ A;  2BIR A;  4HAA A;  1Q86 4;  1CH0 A;  2XR8 B;  3FF2 A;  1GOU A;  2OTL 3;  4AEQ A;  1JBS A;  5IG3 A;  1BRI A;  1W6G A;  2W04 A;  5IF6 A;  3WHO A;  4O8S A;  4R9K A;  3X3X A;  5G1K A;  3BU4 A;  4HJL B;  4NHF A;  1S72 3;  3GZX B;  1QMA A;  2C4B A;  3QK9 A;  1YJW 3;  1OPY A;  3GZR A;  2YFJ B;  1A2K A;  3H51 A;  3FSD A;  1G02 A;  3SYU A;  1VQ6 3;  3MWZ A;  3PZW A;  4K61 A;  2GEX A;  1W6C A;  2KF3 A;  1N8R 4;  1O7W B;  6GSP A;  1OHS A;  1OGX A;  3Q1C A;  1JRQ A;  2Z6B A;  1JJ2 2;  2R4I A;  3DY5 A;  1IYY A;  1JN5 B;  1Q9E A;  3OW2 2;  4DKI A;  1GS3 A;  1UCL A;  1GMR A;  1BSD A;  1SAR A;  3CC7 3;  1YHQ 3;  2HML B;  2OQE C;  3CC2 3;  3F7X A;  1RCL A;  5JPP A;  5BU4 A;  4NRE A;  1ROA A;  7RNT A;  1BNS A;  3CCV 3;  1A2V A;  1QAL A;  2BMO B;  3F9S A;  4TX4 A;  1BRS A;  2HMJ B;  1NB5 I;  4EBG A;  1C7H A;  1UUV B;  1LOW A;  4FMA A;  3AMO A;  2KF6 A;  3DXO A;  4IPB A;  2P0M A;  3NM7 A;  1O7P B;  1STD A;  4KT3 B;  2IY2 A;  3CCL 3;  5DRV A;  4R4K A;  1KQS 2;  3CCR 3;  3NX0 A;  2P38 A;  1IVV A;  1I8V A;  3D4A A;  4HM1 B;  4L8P A;  4X2O A;  3T8U A;  5CF2 A;  1RGA A;  2E2V A;  1FGR A;  4GL6 A;  4QWT A;  1HU9 A;  2XH9 A;  3DMC A;  3X42 A;  1CYU A;  2KCD A;  3FF0 A;  4LMI A;  4IIA A;  1D6U A;  1RHL A;  1ZO2 A;  2XGL A;  2XFS A;  3NBB A;  4CJN A;  1JZO A;  1O7N B;  2CK3 H;  1YNV X;  4WWU C;  3CME 3;  4MEI A;  4O3V A;  4R9L A;  1A90 A;  3RGR A;  2CFW A;  1YIJ 3;  4LEH A;  4H61 A;  1FW7 A;  2IMJ A;  4XDV A;  2K0M A;  2W0Q A;  4GSP A;  1E3V A;  5G2G A;  3FGY A;  2QA4 3;  1D6Y A;  1UUG B;  1OHP A;  3SLU A;  5IW9 A;  1JV2 B;  3NUV A;  2OQE A;  1TFO A;  4HKV B;  3F8H A;  2R41 A;  3NQZ A;  4IT7 A;  1B20 A;  3PCS A;  3DGM A;  3DGO A;  5AI1 A;  4EC6 A;  3EHC A;  3G4S 3;  3STD A;  5D81 A;  4XBT A;  2KF5 A;  4BTX A;  1I0X A;  2BNG A;  3CU3 A;  1G0T A;  4XBY A;  1AV4 A;  2XSH B;  3N9H A;  3MG2 A;  1LQM B;  2HOH A;  2W6J H;  1UCK A;  3D9R A;  1LQG C;  1IT7 A;  1JN5 A;  4LSO A;  4OVM A;  4J8T A;  4BL3 A;  3JVC A;  2D1W A;  4L8O A;  3CMA 3;  2H0H A;  1WMO A;  1V74 A;  1BUJ A;  3PS8 A;  1OCV A;  1UDI I;  5BIR A;  3K63 A;  1B2X A;  3NM2 A;  5BXQ A;  1GY5 A;  3Q90 A;  3DZL A;  3BNE A;  1K41 A;  5TGN A;  2WOH A;  3K5T A;  1G96 A;  2YFI B;  3AHW A;  5AEU B;  3GWR A;  3OXA A;  3UB1 A;  1A67 A;  2IUJ A;  2CX0 A;  1VQP 3;  1RN1 A;  1OAC A;  2CFD A;  1K8A 4;  4N6L A;  3KKG A; 
#chains in the Genus database with same CATH homology
 1JBS A;  4GHO A;  1B21 A;  1BRI A;  1MGW A;  3RNT A;  3WHO A;  3DH2 A;  1BRK A;  1I3I A;  1BU4 A;  2GSP A;  3AGO A;  3BU4 A;  1RNB A;  1LOY A;  2C4B A;  2F5W A;  1GOY A;  3URP A;  1RSN A;  4HOH A;  1RGK A;  1G02 A;  1RLS A;  4J5K A;  3SYU A;  3Q3F A;  1FZU A;  1JBT A;  2SAR A;  1BRG A;  6RNT A;  2KF3 A;  1BRH A;  6GSP A;  3A5E A;  1RCK A;  1TTO A;  1IYY A;  1RDS A;  1BAO A;  1Q9E A;  1RNT A;  1B2Z A;  4RNT A;  1B3S A;  1UCL A;  1GMR A;  1BSD A;  1BOX A;  1LRA A;  1SAR A;  4BIR A;  5HOH A;  1RCL A;  1DET A;  3KCH A;  9RNT A;  1DE3 A;  1BIR A;  1BNJ A;  1RGG A;  2BU4 A;  5BU4 A;  1UCJ A;  7RNT A;  1BNS A;  3WR2 A;  1R4Y A;  1BSA A;  2RNT A;  1LNI A;  1I2E A;  1T2H A;  1BRS A;  1AQZ A;  1BVI A;  1LOW A;  1BNF A;  2KF6 A;  2KF4 A;  1AY7 A;  1BSB A;  1B2S A;  2KAA A;  1BNR A;  2AAE A;  1GSP A;  1I2F A;  8RNT A;  3D4A A;  1I8V A;  1RTU A;  4BU4 A;  1RGA A;  3AGN A;  1X1X A;  1B2U A;  3DGY A;  1FUS A;  4J5G A;  1RHL A;  1BSE A;  1C54 A;  1RMS A;  7GSP A;  1I0V A;  1YNV X;  1BAN A;  3D5G A;  1GOV A;  1PYL A;  1TRQ A;  1FW7 A;  1RGE A;  1RGL A;  4GSP A;  1BNG A;  1HYF A;  2AAD A;  1GMQ A;  1X1U A;  1B2M A;  1LOV A;  1JBR A;  2F5M A;  1RGH A;  1B20 A;  2ZA4 A;  1YVS A;  3GSP A;  1BGS A;  3AHS A;  1RGF A;  2KF5 A;  1I0X A;  1BNE A;  1PY3 A;  1YGW A;  1FUT A;  1RN4 A;  1I2G A;  2RBI A;  1X1Y A;  2HOH A;  1UCK A;  3HOH A;  1RGC A;  1TRP A;  5GSP A;  1BUJ A;  1BRN L;  2F4Y A;  5BIR A;  1MGR A;  1A2P A;  1B2X A;  3BIR A;  1FYS A;  1B27 A;  1I70 A;  1X1W A;  1BRJ A;  1BSC A;  1ZGX A;  1UCI A;  3AHW A;  2F56 A;  1T2I A;  3D5I A;  1HZ1 A;  1RN1 A;  5RNT A;  1GMP A;  2BIR A;  4HAA A;  1BNI A;  1CH0 A;  1GOU A;  1I3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...