1V58A

Crystal structure of the reduced protein disulfide bond isomerase dsbg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v58A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v58A02
3L9UA 1JFUA 5G30A 1GL8A 2PBJA 2ON7A 1VF1A 2FHEA 2FD3A 2B1KA 1QK8A 4H86A 1Z3EA 1GNEA 2HZEA 1Y6EA 3LSZA 2WFCA 4OD7A 2L4QA 3HJMA 5LD0A 2Z9SA 5CRHA 3DRNA 1F3AA 3RHCA 2H1DA 1F9MA 4WR4A 1X9WB 1TRUA 5DDLA 2E7PA 3KTBA 3TJFA 4KW6A 3UVTA 1N2AA 3GA4A 5INYA 3DYRA 2FWHA 4TN8A 2N5AA 3FRCA 1NSWA 3U6VA 2GVPA 3WD6A 1FHEA 4DVCA 2YV7A 1J0FA 2H75A 3QMXA 1KTEA 4I2UA 3HVSA 1M2DA 4EDZA 3ED3A 1T00A 1G7OA 1PL1A 3TRQA 2BTOT 4WETA 2H66A 1ML6A 1N8JA 1SD9A 1BG5A 3CYNA 3UBKA 3DEXA 2FLSA 3IA1A 2L59A 2CT6A 1EOHA 3BCIA 3VK9A 3FYGA 3I6AA 4FYCA 1WOUA 4MDCA 4MMMA 4CHSA 2LNSA 1PA3A 1B4PA 1F6MC 3ERFA 1O85A 4GWRA 3MNGA 1HNBA 4MPFA 1BEDA 3GX0A 4I5QA 1ZMAA 4NHWA 3TCOA 2I81A 2F3MA 4XS4B 1IYHA 4Q5QA 3PGTA 4AJ7A 3M1GA 4KSMA 4J56E 1U3AA 2B1LA 4KCAA 2B7JA 3DVXA 4HJ2A 2VM2A 3FEUA 3HJPA 1BYEA 2MBTA 3P2AA 4ZBBA 2MBSA 2PGTA 1V57A 1Z6MA 4LMWA 2XPEA 4PNGA 3FHKA 4KB3A 4GCIA 2CVBA 5A4VA 2N5BA 3KM6A 4HZ4A 2MMNA 4ML1A 5ECRB 4WF5A 2GT6A 5KN0A 4MH3A 4PXOA 4Q5NA 3HKRA 2C80A 2RUEA 3C73A 3F8UA 1R7HA 4ZBAA 1A2MA 2V6KA 1M9AA 4XS6A 1XOBA 1XVWA 2HT9A 3QFBC 5JCGA 2P31A 3EU3A 4WR5A 1WPIA 4FYBA 2VL2A 4MJEA 4XIHA 5CRDA 3VWUA 2CQ9A 5ELAA 1NM3A 2H73A 3WYWA 1F3BA 5ECSA 2FA4A 4G19A 1FW1A 2XPDA 1AUCA 3DWVA 4F0CA 5DALA 4PUAA 2OACA 3UOMA 3IE3A 4XS4A 2F9SA 5ECPB 2R4VA 1XWAA 4POMA 1A8LA 4MZBA 4TRXA 5GAPD 1TU7A 2OBKA 1KEBA 2WRTA 5EVOA 1XIYA 4L5LA 4GSTA 2IY2A 2PWJA 3TKSC 2AB6A 1BX9A 4AF2A 2H19A 2HLSA 2NBSA 4HEA2 2DSAA 1TRWA 3LXTA 2XBQA 3GTUB 4D73B 3D5JA 3GKXA 4RUVA 4TR3A 4YH2A 4F9ZA 2JU5A 3G7IA 5DVBA 2LQQA 3TGZA 3GN3A 4LL4B 2O87A 3P7XA 3FKFA 3CRUA 3IR4A 3A2VA 2AAWA 2YNXA 3HZ8A 1IYIA 3SBCA 5KEJA 4MZCA 2KLXA 2PPTA 4OCEA 4IHUA 2WGRA 2A2SA 2AYTA 1VRSD 2V41A 2D2ZA 2B3SA 2X8GA 4KA0A 3D4MA 2LRNA 3L9VA 5H5SA 2M46A 2L57A 1XW6A 3LQ7A 1MDKA 4JU5A 1EGRA 5ECHB 4G10A 4E8EA 1SU9A 2VD0A 2VAFA 2DJ2A 1EGOA 1VF4A 2WB9A 5F06A 4GRFA 3IXRA 1V98A 2GGTA 2FWFA 1DSBA 1Z7RA 2B6MA 2YCDA 1AAZA 4JBBA 2P5RA 2N5FA 2IMDA 3M8NA 3H8QA 4HOJA 1K0OA 3TOTA 9GSSA 1HNAA 4EF0A 2IMFA 2NPBA 4TR0A 2JZTA 2X99A 3GTUA 5HFGA 1GTUA 2IFQB 2QKEA 4AJ8A 5DJLA 5DCGA 5JWQB 2GZYA 2IMKA 2HNLA 1J9BA 2ZUPA 3APSA 3VPQA 2YP6A 2HI7A 4PNFA 1MEKA 2OADA 2C0GA 3HY2A 2EIOA 1HNCA 4OFMA 4KNDA 4N10A 1H75A 3VPTA 4POLA 3VWXA 3FZ5A 4FH8A 3FW2A 3QD9A 4FYUA 2WJUA 14GSA 4ZIJA 2GS3A 3PR8A 1A23A 4NV2A 2B5EA 3FR3A 1F2EA 2VCQA 4MA9A 3FK8A 2VO4A 1F37A 2IWTA 2REMA 2VLTA 3IHQA 2AUVA 3RDWA 3QAVA 1K0BA 1WE0A 1G0TA 1GSFA 1QGVA 1DE2A 1QFNA 3GSSA 3L4NA 3HVXA 1TJDA 3QDNA 1EP8A 4L0UA 5B6MA 3IC4A 2HZEB 5J9CA 1I9DA 2WULA 3VURA 2ALBA 1B9YC 3EMXA 3DGQA 4ILFA 2R3XA 3H79A 5HFIA 4ZB9A 1SJIA 3QPMA 3EINA 5JCUA 1XCCA 4KDXA 2AV4A 1FOVA 3VFIA 2IMIA 19GSA 4IN0A 2LEGA 4RQXA 3VWVA 1ZZYA 2E2GA 2NTOA 2VIMA 5EPFA 1X5EA 3F4TA 4HQZA 5IMAA 6GSXA 4QL9A 2XC2A 1HYUA 2DMLA 4WXTA 3DVWA 3NOFA 2J9HA 3J7Yb 1U6TA 1EEJA 3C7MA 2HSYA 3D22A 4Q5RA 3HYPA 4PUFC 4NPBA 2YJHA 2BMXA 2GZZA 4ACSA 2C3NA 1XBSA 5L71A 1SYRA 4MP4A 2QSIA 1ILOA 3IK9A 3L78A 2L4CA 4ML6A 5ECKB 5DQSA 4QQ7A 1PKWA 2H0IA 4OFNA 1U3IA 1RW1A 3C71A 2L5LA 2IL3A 2DJ1A 3ZLPA 5D9TA 2R5GA 5AIVA 4TW5A 1WWJA 2I3YA 5ECMB 1GUKA 4MZWA 1YF0A 3UIWA 4MABA 1DUGA 1ON4A 4JRRA 5G31A 4XTSA 3F9UA 4J2FA 3F4RA 4TR4A 3GRXA 3LORA 2GTUA 1K0AA 2KHPA 2XHFA 4ZL7A 2TIRA 4TXOB 3EURA 3ZMLA 2LQOA 2E2MA 4K7NA 3CBUA 1OAZA 2WZ9A 4HS1A 2IPAA 3EC3A 5G2ZA 5HR3A 4Z7XA 5IO0A 4F0BA 1GTAA 3EYTA 3CTFA 2I1UA 3RBTA 3QOUA 1TP9A 1SL1B 2IMEA 4JE1A 4K9ZA 3S9FA 4K6XA 2FCHA 2O7KA 4N30A 3TUEA 3IPZA 2MZCA 1FVKA 1OC3A 3QAGA 3LEFA 1TK8B 3KTLA 1GWCA 2VD1A 1YF1A 4TXVA 5CO3A 3FR9A 3FY7A 4GQCA 2EC4A 5ABRA 3RPPA 1M7TA 1UC7A 2HXKA 4L5OA 5ECLB 1H4OA 4EE0A 2V1MA 5EL8A 3UMAA 4CDOA 1LU4A 3TJBA 5D9VA 1X9SB 2IIYA 2O8VB 1KBNA 3QAWA 3O76A 2LNTA 4K7OA 4LL1B 2VL9A 4JR4A 2VUPA 3KEBA 2YN1A 1YEXA 2A2RA 1NHOA 4KDUA 3APQA 3VLNA 3F3RA 3L9SA 3ZL5A 1S3DA 1W89A 1CQGA 1TRVA 2GQKA 2L6CA 1HD2A 4ID0A 4XS1A 4TXOA 3IAM2 2ZCTA 4MF6A 4IJ3A 4ECCA 1MTCA 3GKMA 3A2XA 1JZOA 3ZVJD 4I2TA 3GURA 3C1SA 2CA8A 3CXGA 3LFLA 1VGLA 5C04A 4L0WA 4RI6A 7GSSA 2H0GA 4HUAA 3CMIA 1XW5A 3F6DA 1GSYA 2RUFA 5E59A 1TTZA 5IIZA 1Y25A 1TOFA 4TR1B 3UL3A 5CRGA 2K8SA 1AIUA 3GFKA 3M9JA 1A0RP 1AQWA 1O73A 1ZYEA 2AHEA 1RQMA 1FB0A 3E0UA 3ZIVA 3KMNA 3IDVA 4IW9A 4ZL9A 3IK7A 1JZRA 5A4UA 5G5FA 3F3QA 4ECJA 3A3TA 3BOAA 3F4SA 3G9BA 1GTBA 4WBJA 1NHYA 3D6IA 4EDYA 1WIKA 1X0RA 2P0GA 1O8XA 12GSA 1GH2A 3US3A 1RK4A 2LSTA 4EXJA 1WRYA 5CP1A 4NMUA 3DXBA 5CAXA 1AQVA 4OWYA 2HRFA 3HD5A 4GXZA 5KN3A 4AGSA 1M2AA 5C00A 3GUSA 2L6DA 1B48A 3KXOA 2YWOA 2KP1A 1Q4JA 1R5PA 3CSJA 4O92A 3I69A 1TI3A 2DJJA 2K18A 1SD8A 2GSQA 4JEDA 1PL2A 5G5EA 4ZILA 2RM5A 4J57E 3TRPA 1XXUA 1E2YA 2O89A 3J7Yk 3Q19A 1E6BA 4TVEA 2OA7A 1AC1A 4MF7A 4BVYA 1PSQA 5JCWA 4WBRD 4V1Ag 1QMVA 2FNOA 1Z7PA 3VI5A 2LJRA 1WJKA 4NXIA 1TK5B 1GLQA 1O81A 5A4WA 3QR6A 2EIRA 1K3YA 3PH9A 1XWCA 2FUG2 1XWBA 6GSTA 3ZTLA 1Z6NA 4FIWA 3I9V2 6GSUA 1XZOA 2DJKA 1PX6A 2FWEA 4PQ1A 1GSDA 3P8WA 1PGTA 2B5YA 1AW9A 4WKWA 5D93A 2F8FA 1BAYA 4E8HA 5H5QA 2VL2C 3WT2A 3GL3A 1EV4A 3O6TA 1TI1A 5HR0A 4F82A 2K9FA 3MDKA 2VOCA 3DD3A 2H76A 3M3MA 4IVFA 3U5RE 5IMVA 1QUWA 4K0NA 2GQMA 1SJ6A 2FWGA 1X9MB 3E3EA 1ZYQB 4YAVA 1WP0A 2WDUA 4XCSA 2VL3A 1FB6A 5J3RA 4WF4A 4LMVA 1XFLA 3GYKA 3TDGA 5DQYA 5EY6A 1U87A 2H01A 3GSTA 3JCML 4BA7A 1FO5A 1A8YA 4PQIA 2VCWA 3WGDA 4ZXGA 2X8CA 4HJMA 3HJOA 4F2IA 3E9JB 4YAPA 2EIQA 1YDKA 1GNWA 2YWNA 4X1UA 1QQ2A 2I4AA 2H30A 3UBLA 2LUSA 3H4KA 1X5CA 2WS2A 2TRXA 2VCZA 2CX3A 1PRXA 2I9HA 4K1FA 3LYKA 4HU9A 5G1LA 4KSOA 3M9KA 1PMTA 1ST9A 2LKUA 5LNKe 1M9BA 3LG6A 5FWGA 2CVKA 4BPYA 2G2QA 1LJRA 2JACA 1R4WA 1B4QA 4OMVA 1ACVA 4XHMA 2B7KA 4V2NA 5IMZA 3C1RA 1TW9A 2OE3A 2DMMA 2PVOC 3Q6OA 3APOA 2YV9A 1NW2A 3VI7A 4X0XA 1YZXA 4O7HA 3UARA 3O3TA 1T4YA 2H1BA 3GMFA 22GSA 1PX7A 1MDJA 1GSSA 3UAPA 3FZ4A 1LBKA 3M0FA 4KUNA 1GUHA 2LS5A 1JZWA 3GX8A 3CSIA 5J4UA 4JZQA 3WGXA 1A24A 3LGCA 2VLVA 3NIVA 4EUYA 1GTIA 2K6VA 4MLYA 1YKAA 2JADA 3TJJA 5JWOB 3H1NA 1K0NA 1GLPA 2CZ3A 5AGYA 2KUCA 1FG4A 1R26A 2G0FA 1GUMA 1USBA 5F0GA 3KD0A 5J5NA 4MPGA 5AIXA 2TRCP 2YZHA 3CSHA 1PD21 3Q74A 1XWGA 3EMPA 2PN8A 2JL4A 3TOUA 3N9JA 2H70A 3KJYA 1GSQA 3EU4A 1K3OA 1TRSA 1ABAA 2H74A 2VLUA 4EL1A 1JHBA 4ECIA 1MDIA 3OR5A 2PU9C 1G6YA 1A2LA 1UN2A 1QXHA 3F0IA 3R2QA 3ZFLA 3DKSA 3LJRA 3MSZA 4PQHA 2LV3A 1PN9A 2GDRA 4RQRA 1SJZA 2H6ZA 5IOWA 4GSSA 1BJXA 2NDOA 4V2LA 5D9XA 3GHAA 2M80A 4IS0A 3K8NA 1T4ZA 2CAQA 4GF0A 5IOXA 4GQFA 2HYXA 13GSA 4GSNA 3F63A 1GSUA 5GAND 3HZ4A 2XBIA 4HQSA 4KCEA 4HI7A 1M2BA 1EV9A 3KMOA 4NAXA 4TR1A 2E0QA 5HR1A 2MMOA 3HVVA 3GL5A 1O7UA 3DMLA 3IRAA 2JZRA 3BCKA 4LA1A 1YEPA 2DJ0A 4DSSA 3SWLA 1V2AA 2OE0A 2BJXA 4EVMA 2CVDA 4KDYA 3D0ZA 2FY6A 2X64A 4IP6A 2IJYA 1G7EA 4IQAA 2R37A 4TOPA 1TDIA 1S3AA 1TXXA 3UVHA 1OKDA 3ZFBA 5GSTA 2VCXA 2H72A 2ZNMA 5DAKA 2LRCA 5CRWA 3AY8A 5ECOB 1CQHA 5B6NA 4RI7A 3RHBA 10GSA 2JZSA 4XRDA 4I8BA 5ID2B 2QC7A 4KAEA 1DBYA 2LTKA 4Q5FA 1T8EB 3GH6A 3TKQA 3D21A 6GSSA 4KE3A 4GTUA 3KP8A 4K8MA 2P5QA 1K3LA 1EEMA 1YQ1A 1FAAA 1DE1A 5A5KA 5AN1A 3GIXA 1T3BA 3HHVA 3I43A 2IN3A 5D73A 3GKKA 5J9BA 2KP2A 3KH7A 3G7YA 4POBA 1OC9A 4PURA 3EE2A 5IMFA 2PERA 2GLRA 3LWAA 4EKZA 1V40A 2KOKA 3ERGA 4X43A 1SK2A 3IOSA 2ES7A 1SL2B 1ERVA 4DSSB 8GSSA 1B8XA 1T1VA 6GSYA 1GRXA 4IKHA 3ME7A 3TRXA 1SYXA 2LJAA 3FZAA 4HZ2A 4N0VA 1G6WA 1JLWA 2C4JA 4WEYA 4K0GA 5DAKB 2M72A 5FHIA 4IELA 3ZREA 2R2JA 5D9WA 5B8AA 2VCVA 2CAIA 2F8AA 1TKDB 4DSQA 4MF5A 2HFDA 2H8LA 1M0UA 4V2MA 2YPMA 1OE7A 5ECNB 1ERUA 1ZL9A 2C3QA 3A2WA 4HU7A 2YWIA 5DJMA 1URMA 3MWHA 2YOIA 1MD4A 4L8EA 3WGEA 2HSHA 3ZVJA 3TKRA 3VWWA 2GSTA 4O5RA 3TJGA 1OC9B 1O8WA 2C0EA 1V58A 2LRTA 2OJLA 1TU8A 2HZFA 2IYJA 2ON5A 2CV4A 4V1Ap 2DC5A 3KH9A 5B8BA 3LXZA 4LLRA 5JWRB 5AISA 5KN1A 3A5WA 2VCTA 1EWXA 3IV4A 4YQUA 5E4WA 4HDEA 2RLIA 4MH2A 2C3TA 4BL7A 1OE8A 2DLXA 4KGIA 1A2JA 4OO5A 5ECIB 2FGXA 2A4VA 3RPNA 4N0ZA 1AXDA 3BJ5A 3F6FA 1Q98A 5FT3A 2R6KA 3P90A 2DIZA 6GSVA 6GSWA 1C72A 1OC8A 3IAS2 3ZITA 3TJKA 1S3CA 2JSZA 1XW9A 4I6XA 4F03A 1UA5A 1VF2A 3HDCA 3HA9A 2PUKC 4OO4A 2H1AA 3QFAC 5D96A 5IQYA 4OCFA 1K0CA 1O6JA 5HFKA 1XPVA 5IPHA 2OBIA 4BWSA 1ZOFA 1UVZA 5CREA 2FA8A 2QGVA 2YANA 3GH9A 1ERWA 4IP1A 3RAZA 1TK0B 3ZRDA 4QL7A 4EO3A 3IBHA 20GSA 3GKNA 4FO5A 5COHA 2MMAA 1EZKA 2C0FA 3HCZA 2RIIA 2GT5A 2GZPA 4ISDA 1JZDA 3BD2A 4G9HA 4YQVA 1XOAA 3WT1A 1HQOA 2B5XA 4OFTA 1XVQA 5CNWA 2RM6A 1I5GA 1GP1A 16GSA 3MAKA 4N11A 4G2EA 2MMZA 3KGKA 1YKCA 3KP9A 4POKA 3BBYA 3FZ9A 5IO2A 1J08A 2AJQB 2DJ3A 1U88A 4MCUA 3G7JA 4IQ1A 1ZCPA 3ME8A 4GLTA 4PGTA 5DALB 1JLVA 2WCIA 4EC0A 2YWMA 4K2DA 2LJKA 5IM9A 1B9XC 2GSRA 1SK1A 2V32A 4PX1A 1SL0B 2CX4A 4ECBA 1GULA 2K8VA 3LYPA 2DIYA 1ERTA 4KX4A 5B7CA 5ELGA 4NHZA 5F05A 4ZBDA 5G1KA 4K7IA 4D73A 2DBCA 4O32A 1SK0A 2HE3A 4ULXA 3W6GA 3ZMKA 4ZB8A 1OVNA 2H1GA 3UEMA 1GSEA 4ZB6A 1YY7A 3FR6A 3TB2A 5IPGA 1SENA 4CW9A 2X8HA 1THOA 1VF3A 2HRNA 2F51A 4KH7A 5D8IA 3PINA 4MK3A 4YQMA 3W8JA 5DCHA 5F07A 1XWKA 2H71A 2YJ7A 1AQXA 4BWQA 3CTGA 1W4VA 4ZL8A 4DEJA 2L5OA 1OYJA 4JR6A 3W8SA 4NV5A 1K0DA 5HQPA 1SKSB 3CRTA 5IMCA 3TKSE 3GV1A 1X5DA 3HXSA 2VM1A 3DIEA 4MJBA 2OE1A 3GNJA 2V6OA 1YJ6A 2OKAA 5ID2A 2JSYA 2H6YA 3C8EA 3H93A 3L0HA 3ZZXA 18GSA 2C8UA 3ZYWA 1OKTA 3N5OA 5KN2A 1WMJA 1A0FA 3QCPA 4AJ6A 2NVLA 1EP7A 4DSRA 3EWLA 3TKSA 4IJIA 1BQ7A 4P3YB 1T7PB 2C1YA 3ZIJA 4IBPA 5GZZB 1Z9HA 2PVQA 2PMTA 3NZNA 5ECQB 3KCMA 2IFQA 5GSSA 17GSA 5IMDA 3Q18A 3EVIA 1KNGA 2H0HA 5H5RA 3V1WA 1PQNA 2CZ2A 5J41A 2H6XA 2O85A 1V9WA 3ERWA 5DBQA 3KIJA 2MYGA 1THXA 2YZUA 5LCZA 1PKZA 3UJ1A 1MD3A 1EOGA 4MJCA 3ISOA 4XRAA 1ZGNA 4IGJA 3TKPA 4I97A 1R5AA 3D4TA 5ENUA 5HR2A 1M99A 2GQLA 11GSA 1SKWB 2GSSA 1SKRB 5F8BA 2C0DA 1K0MA 5CYYA 3KZQA 4TKYA 1Z5YE 2V2GA 2J23A 1FVJA 4MJAA 4BVXA 4NWYA
chains in the Genus database with same CATH superfamily
3L9UA 1JFUA 5G30A 2KF6A 9RNTA 1GL8A 2PBJA 3PYJA 2ON7A 1UUGB 1VF1A 2FHEA 1B2UA 2FD3A 3Q90A 2B1KA 1QK8A 4H86A 1Z3EA 1GNEA 2HZEA 3CCM3 1RKYA 1Y6EA 3LSZA 1UI7A 4N3VA 1TFOA 2WFCA 3KN4A 1SQWA 2QEX3 4OD7A 2L4QA 1NB5I 3HJMA 2E2TA 5LD0A 4BTWA 2Z9SA 5KP1A 5CRHA 3DRNA 1F3AA 1STDA 3I0YA 3RHCA 2H1DA 2CFKA 2F86B 1BUJA 1F9MA 4BIRA 4WR4A 1X9WB 1TRUA 5DDLA 2E7PA 3KTBA 5BMUA 3TJFA 1T5YA 5IG3A 1BANA 3LYGA 4KW6A 3UVTA 3O8YA 3JUMA 1N2AA 3GA4A 5INYA 1RN1A 3DYRA 2FWHA 4TN8A 2WOHA 2N5AA 1JRQA 1UGHI 3FRCA 1NSWA 3U6VA 2GVPA 3WD6A 1FHEA 2QA1A 4DVCA 1FGQA 2YV7A 1J0FA 4EW5A 2H75A 3QMXA 5CK6A 1KTEA 4G0KA 4I2UA 1JKGB 5A0OB 1GOVA 3HVSA 1M2DA 3NUVA 4EDZA 3ED3A 1T00A 1W00A 2XF3A 1G7OA 1PL1A 3TRQA 5JPUA 2BTOT 4WETA 2H66A 1ML6A 3FH1A 1N8JA 1BVIA 1SD9A 1I3FA 4O3VA 1BG5A 3PGBA 3CYNA 3UBKA 3DEXA 2FLSA 3IA1A 2L59A 2CT6A 2MC8A 1EOHA 3BCIA 3VK9A 1K9M4 3FYGA 1S723 4J5GA 3I6AA 4FYCA 1WOUA 3H51A 4MDCA 4MMMA 3HOHA 2FXTA 4CHSA 2LNSA 5CXOA 1PA3A 3SOAA 1B4PA 1F6MC 3ERFA 3DGNA 2GU1A 1UUWB 1O85A 2Z76A 4WYKA 4GWRA 1R4CA 3MNGA 1HNBA 4MPFA 4PEJA 1RGHA 1BEDA 3GX0A 4I5QA 1JJ22 1ZMAA 4NHWA 3TCOA 2I81A 2CKFB 2F3MA 4XS4B 3X3ZA 1IYHA 4Q5QA 3DZLA 3PGTA 3MIXA 4AJ7A 1U5OA 3M1GA 4KSMA 4J56E 1U3AA 2B1LA 4KCAA 2B7JA 1OHPA 3DVXA 4HJ2A 2VM2A 2V1LA 3FEUA 1A90A 3JVCA 5BVBA 6GSPA 5IG5A 1BYEA 2MBTA 3HJPA 1BRKA 3P2AA 4ZBBA 2Q07A 2MBSA 1MNLA 2PGTA 1VQQA 1V57A 3CCQ3 1Z6MA 4LMWA 2XPEA 4PNGA 4FR9A 1FGRA 3FHKA 4KB3A 7GSPA 4GCIA 2CVBA 4MEIA 5A4VA 2N5BA 3KM6A 2C4BA 4HZ4A 2MMNA 4ML1A 5ECRB 4WF5A 3DMCA 3GRDA 1NJI4 2GT6A 5KN0A 2BHMA 4MH3A 4CDLA 4PXOA 4Q5NA 3HKRA 2C80A 2RUEA 1DETA 2IUJA 3C73A 3F8UA 1ZYPA 1R7HA 2A15A 4ZBAA 1MOLA 1A2MA 2V6KA 1M9AA 4XS6A 1XOBA 1XVWA 2HT9A 1FGMA 3QFBC 1NB3I 5JCGA 2P31A 3EU3A 4WR5A 1WPIA 4FYBA 4WP5A 2VL2A 4MJEA 4XIHA 5CRDA 3VWUA 2CQ9A 5ELAA 1KD14 4RNTA 3CCU3 1NM3A 2H73A 3WYWA 2ZA4A 2FNQA 1F3BA 5ECSA 1WMNA 3K63A 2FA4A 4G19A 2OTJ3 1VQ63 1FW1A 2XPDA 4X4JA 2QGUA 1AUCA 3SXXA 2E2UA 1VQN3 3DWVA 4F0CA 5DALA 4PUAA 3GWRA 2OACA 3UOMA 3IE3A 4XS4A 2F9SA 3X41A 4TX4A 4XBYA 2CX1A 5ECPB 2R4VA 1XWAA 4POMA 2WGOA 1A8LA 5I97A 4MZBA 1IDPA 1W4NA 4TRXA 5GAPD 1NO3A 1TU7A 1L5GB 2OBKA 1KEBA 3NX0A 2WRTA 4FCMA 5EVOA 1XIYA 4L8PA 4L5LA 4GSTA 2IY2A 3K9MC 2PWJA 3TKSC 2AB6A 1BX9A 4AF2A 1CEWI 2H19A 2HLSA 1RN7A 2NBSA 4HEA2 2DSAA 1QVF2 1TRWA 3LXTA 1IV9A 2Z77A 4AKZA 2XBQA 3GTUB 2QIYA 1EG9B 1VQK3 4D73B 1O7PB 3D5JA 3GKXA 4RUVA 1G02A 4TR3A 4YH2A 3PCRA 4F9ZA 2JU5A 3G7IA 5DVBA 2LQQA 4LL4B 3GN3A 1GD4A 3TGZA 2O87A 3P7XA 3AGNA 3FKFA 3CRUA 3IR4A 3DY5A 3A2VA 3N54B 5D81A 2AAWA 2YNXA 3HZ8A 1IYIA 4HM4B 3LXUX 3SBCA 5KEJA 4MZCA 1Q42A 2KLXA 2PPTA 1O7WB 1D6UA 4R4KA 3PZWA 4OCEA 4IHUA 2CW9A 1W2ZA 2ML5A 2WGRA 3SOYA 4HAAA 2A2SA 4KFDA 5LC6A 4HSCX 2AYTA 1RLSA 1VRSD 3NV0B 2V41A 2D2ZA 2B3SA 2X8GA 1GMQA 3D4MA 5EVHA 2LRNA 1BOXA 2F5MA 4KA0A 3L9VA 2L1SA 1W6GA 5H5SA 1J2BA 2YX9A 1NWWA 2M46A 1UDII 2HMOB 1I8VA 1X1XA 3EB8A 2L57A 1XW6A 3LQ7A 1MDKA 4JU5A 1EGRA 5ECHB 3HIIA 4G10A 2W56B 4E8EA 1SU9A 3AHWA 1FGTA 2VD0A 2VAFA 4N6TA 2DJ2A 1EGOA 1VF4A 2WB9A 3S27A 4FQUA 5CF1A 5F06A 4KFEA 4GRFA 3IXRA 1V98A 2GGTA 5EEOA 1DSBA 2FWFA 1Z7RA 2B6MA 4YKFA 2YCDA 3WMDA 1NDOB 1AAZA 4JBBA 2P5RA 1RDSA 1Y4KA 2N5FA 2IMDA 1LRAA 3M8NA 1ZO2A 3H8QA 1YHQ3 4HOJA 1K0OA 1RGLA 3TOTA 9GSSA 1HNAA 4EF0A 2IMFA 2NPBA 3RGRA 2JZTA 2A2PA 4TR0A 2X99A 3GTUA 4LZIA 4OK0A 5HFGA 1DVCA 1U8CB 1GTUA 2IFQB 2F4YA 2QKEA 4AJ8A 5DJLA 5DCGA 3WA2X 1BRGA 1PYLA 1ULIB 5JWQB 2W2CA 3NHXA 2GZYA 2IMKA 1JNQA 3U97A 2HNLA 4XDVA 1J9BA 2ZUPA 3APSA 3CCS3 3VPQA 2CHCA 2YP6A 2HI7A 3WR2A 4PNFA 1MEKA 3Q2PA 2OADA 2C0GA 1X1UA 3HY2A 3IJEB 2EIOA 1HNCA 4OFMA 2XEPA 4KFFA 4KNDA 4N10A 1H75A 1B3SA 1LNIA 3VPTA 4POLA 1RCLA 3VWXA 3A5EA 3A5IA 4N6OB 3FZ5A 4FH8A 3FW2A 3V98A 3QD9A 4FYUA 2WJUA 14GSA 4ZIJA 1JBSA 1E97A 2GS3A 3PR8A 3MG2A 1A23A 4NV2A 2B5EA 3X40A 4CY8A 3FR3A 1F2EA 4KVHA 2W6JH 2CG1A 2VCQA 4MA9A 2CK3H 2INXA 3FK8A 2VO4A 1F37A 2IWTA 2REMA 2VLTA 3IHQA 4BVXB 1QAFA 2AUVA 3RDWA 3QAVA 3J7Yd 4CY6A 1K0BA 2P09A 1WE0A 1G0TA 1PFOA 1GSFA 1QGVA 1DE2A 1VQL3 1QFNA 3EF8A 3GSSA 5RNTA 3L4NA 3HVXA 1TJDA 2QA43 3QDNA 1EP8A 1I3IA 4LGQA 3KZTA 4L0UA 5B6MA 3IC4A 4Z2TA 2HZEB 1Q9EA 3V92A 5J9CA 1I9DA 1CYVA 2WULA 4KT3B 3VURA 1UI8A 2KRTA 2ALBA 1B9YC 3EMXA 3NBRA 5TGNA 4MMYB 3DGQA 4ILFA 2R3XA 3H79A 4Q53A 5HFIA 2Y73A 4ZB9A 1FOHA 1SJIA 3QPMA 3EINA 5JCUA 1XCCA 3WOFB 4KDXA 4EIPA 2AV4A 1FOVA 3VFIA 3FZWA 2IMIA 19GSA 5STDA 3CCJ3 4IN0A 1BSEA 2LEGA 4RQXA 3VWVA 4O02B 1ZZYA 2E2GA 2NTOA 5KOXA 2VIMA 5EPFA 1X5EA 3F4TA 1VQ43 3WHOA 4HQZA 5IMAA 4LMIA 3EN1B 6GSXA 4QL9A 2XC2A 1HYUA 3FKAA 2DMLA 4WXTA 1UCJA 4GSPA 3DVWA 3G8ZA 3GZBA 1QALA 3NOFA 2J9HA 3J7Yb 1U6TA 1EEJA 2X4AA 3C7MA 2HSYA 2CWTA 3D22A 1AQZA 4Q5RA 3D3LA 1VQO3 3HYPA 2XFTA 4NPBA 4PUFC 2YJHA 2BMXA 2LYXA 2Z7AA 2GZZA 4ACSA 2C3NA 2K0MA 1BRSA 1XBSA 5L71A 1SYRA 3JUOA 4MP4A 2QSIA 4K5RA 1RCKA 1ILOA 3IK9A 3L78A 2L4CA 4WYKB 4ML6A 1IU7A 5ECKB 2AADA 5DQSA 4QQ7A 3GZRA 1PKWA 3LZAA 1JB4A 2KAAA 5AIGA 2HSMA 2H0IA 1B20A 4OFNA 1U3IA 4HM8B 1SIHA 1NU3A 1RW1A 3C71A 1DMMA 2L5LA 2IL3A 2DJ1A 1GOYA 3ZLPA 1OPYA 5D9TA 2R5GA 5AIVA 4TW5A 1WWJA 2I3YA 5ECMB 1GUKA 4MZWA 1T2HA 1YF0A 3UIWA 4MABA 1DUGA 1ON4A 4JRRA 1MWTA 1LVNA 4BTXA 3FMWA 5G31A 4XTSA 4R9LA 3F9UA 4J2FA 3F4RA 4TR4A 3OX9A 3GRXA 4R1KA 3LORA 4R9KA 2GTUA 1K0AA 2KHPA 2XHFA 3MYTA 4ZL7A 2TIRA 4TXOB 3EURA 3HK4A 3ZMLA 2LQOA 3OWYA 2E2MA 4K7NA 3CBUA 4ZM8A 1BU4A 1OAZA 1TRPA 2UGIA 1W2B2 2WZ9A 4I4KA 1MGWA 1W5ZA 3KSPA 4HS1A 2IPAA 2FGTA 1QJGA 3EC3A 5G2ZA 5HR3A 4U13A 4Z7XA 5IO0A 5AIHA 4F0BA 1GTAA 3EYTA 1A2VA 3CTFA 5HGRA 2I1UA 4XBTA 3RBTA 3QOUA 1TP9A 1SL1B 4STDA 4IIAA 2IMEA 4JE1A 4K9ZA 3S9FA 2HMNB 4K6XA 3HIGA 2FCHA 1HKXA 1AY7A 2O7KA 3KKGA 4N30A 3TUEA 3IPZA 2SARA 1QAKA 2MZCA 1FVKA 1OC3A 1K28A 3DM8A 3QAGA 3LEFA 1A2KA 1TK8B 3KTLA 1GWCA 2VD1A 1YF1A 2XR8B 3D4AA 4TXVA 5CO3A 2OOVA 3FR9A 3FY7A 4GQCA 4O5UA 2EC4A 1IQXA 5ABRA 3RPPA 1M7TA 1UC7A 2HXKA 4L5OA 5ECLB 5IEPA 1H4OA 1VQ73 4EE0A 1IK3A 2V1MA 3SVAA 5EL8A 4RZMA 3UMAA 4CDOA 4LYLB 1LU4A 3TJBA 2BMOB 5D9VA 3LTDA 2BO9B 1X9SB 1SIIA 2IIYA 2O8VB 1KBNA 1K41A 3CPW2 3QAWA 3O76A 3KCHA 1SJWA 2LNTA 4K7OA 4LL1B 2VL9A 4JR4A 2VUPA 4BTYA 3KEBA 6RNTA 1YEXA 2A2RA 2YN1A 1KC84 1YJW3 1NHOA 4KDUA 3APQA 3VLNA 3IPTA 3F3RA 2OCTA 3EBYA 3L9SA 1OCVA 3G0KA 3ZL5A 3N9HA 3CCR3 1S3DA 1W89A 5CF2A 1CQGA 3DGOA 1TRVA 4MMZB 2GQKA 2L6CA 3Q3FA 1HD2A 4ID0A 4XS1A 4TXOA 1I2GA 3DH2A 1W6YA 3IAM2 1GYBA 3MHEA 2ZCTA 4MF6A 3RDEA 4IJ3A 4ECCA 1MTCA 3GKMA 3A2XA 1I70A 1JZOA 3ZVJD 4I2TA 3GURA 3C1SA 1B2XA 2CA8A 2MF7A 3CXGA 1N5PA 3FG3A 1OH0A 1VGLA 3LFLA 5C04A 4L0WA 4RI6A 7GSSA 2H0GA 4HUAA 3CMIA 3X3XA 1XW5A 2GBWB 3F6DA 1ZGXA 5AEWB 3EQQB 1GSYA 2RUFA 5E59A 1TTZA 3NV0A 5IIZA 1Y25A 1TOFA 2C10A 4TR1B 3UL3A 2BT3A 5CRGA 2K8SA 1AIUA 3GFKA 4FMDA 1MGRA 3A76A 1BNIA 2CX0A 2RNTA 2RSXA 2YFJB 1A0RP 1AQWA 1WMOA 1O73A 3M9JA 3R3EA 1ZYEA 2W56A 2AHEA 1RQMA 1WQLB 3S29A 3K5TA 1FB0A 4RNZA 3EX9A 3E0UA 3ZIVA 2KF5A 3KMNA 1VQM3 3IDVA 4IW9A 4ZL9A 3IK7A 3PXMA 1JZRA 3WA3A 5A4UA 5G5FA 1FGOA 3F3QA 4ECJA 3A3TA 3BOAA 3F4SA 3G9BA 1GTBA 4WBJA 1NHYA 3T8NA 2P05A 3D6IA 3VGNA 4EDYA 1WIKA 4EIQA 1X0RA 2P0GA 1O8XA 12GSA 1GH2A 3US3A 1RK4A 2LSTA 1RGFA 4EXJA 1WRYA 5CP1A 3L0RA 3DXBA 4NMUA 5CAXA 1AQVA 1BRIA 4OWYA 2HRFA 3HD5A 4GXZA 4WHAA 5KN3A 4AGSA 3VF1A 3SLUA 1M2AA 4L7KA 5C00A 3G16A 3GUSA 2L6DA 1IV7A 1B48A 2CWUA 3KXOA 2L4VA 2YWOA 2KP1A 1Q4JA 1R5PA 3CSJA 5M19A 3I69A 1TI3A 4O92A 2DJJA 2K18A 1SD8A 2GSQA 4JEDA 1PL2A 1AR0A 3ROBA 5G5EA 4ZILA 2RM5A 4J57E 5IERA 4RBNA 3TRPA 1BNEA 3KFQC 1XXUA 1FA3A 1E2YA 2O89A 3BU4A 3Q19A 1E6BA 1Q7HA 4TVEA 1W01A 3J7Yk 3OV4A 4X2OA 2OA7A 1AC1A 3FF0A 4O2HA 4MF7A 4BVYA 1PSQA 5JCWA 5IF6A 4WBRD 4V1Ag 4ICYA 1QMVA 2FNOA 1Z7PA 3EHCA 3VI5A 4HM0B 2LJRA 1WJKA 2X49A 4QWTA 4NXIA 1TK5B 1GLQA 1O81A 5A4WA 1RNTA 3QR6A 1FUWA 3MG3A 2E2VA 2A4HA 1O7MB 2EIRA 2ZHXB 1K3YA 3PH9A 1XWCA 4DKIA 3JUPA 4HZ9B 2FUG2 1XWBA 6GSTA 3ZTLA 2F5WA 3F7SA 1Z6NA 1GSPA 4FIWA 3I9V2 3FG4A 3CC73 6GSUA 1LOVA 1SPUA 1XZOA 2DJKA 3ALAA 3EBTA 2R41A 1PX6A 2FWEA 4PQ1A 1GSDA 4EYCA 3P8WA 3BLZA 1PGTA 2B5YA 2Y74A 1AW9A 2F8FA 1MWSA 4WKWA 5D93A 1BAYA 4Z2RA 4E8HA 1HYFA 5H5QA 3AMOA 2XH9A 3F14A 3MWZA 4MNNA 2VL2C 3WT2A 3GL3A 1OUNA 1EV4A 3O6TA 2CG0A 3IMAB 2UUGC 8CHOA 1BRNL 5HOHA 1TI1A 5HR0A 3G6E3 4F82A 2K9FA 3MDKA 2VOCA 3DD3A 2F98A 3AGOA 2P38A 2H76A 1W02A 2BMRB 1RMSA 4G1MB 3M3MA 4IVFA 3U5RE 1IVVA 5IMVA 1QUWA 3CU3A 2GQMA 1YJ93 4K0NA 1SJ6A 2FWGA 1AV4A 1MWUA 1X9MB 2CFWA 3E3EA 5FGOA 1Z1SA 1ZYQB 4O5QA 4YAVA 1E3RA 1WP0A 2WDUA 4XCSA 2YFIB 1PY3A 2VL3A 1GY6A 1FB6A 3FCSB 1CQSA 4FMAA 2M7OA 5J3RA 1IVXA 4WF4A 4XBXA 2JQ5A 2LQVA 4LMVA 1XFLA 3EC9A 3TDGA 3GYKA 5DQYA 5EY6A 1U87A 2H01A 3GSTA 1GMRA 2BNGA 4BVYB 3JCML 5ELJA 4BA7A 1FO5A 1A8YA 4MJDA 4PQIA 2VCWA 4OVMA 1JBTA 4NREA 3WGDA 4ZXGA 2X8CA 4HJMA 2DKIA 3HJOA 3SX1A 4F2IA 3E9JB 1O7NB 4YAPA 2EIQA 1ZX2A 3D5IA 1JN5A 2HMMB 1YDKA 2PNCA 5KOWA 1I2FA 1GNWA 2YWNA 4X1UA 1QQ2A 2I4AA 4LSOA 2H30A 3UBLA 3LTAA 2LUSA 4H61A 3H4KA 1X5CA 2WS2A 2TRXA 1A67A 2VCZA 3STDA 2CX3A 1PRXA 2I9HA 3B4PA 3FG1A 4K1FA 3LYKA 4HU9A 1CH0A 5G1LA 4KSOA 3M9KA 1PMTA 4BL7B 1ST9A 2R0PA 4OUQA 2LKUA 5LNKe 1M9BA 3LG6A 1D6YA 3AMOB 5FWGA 2CVKA 4BPYA 1RHLA 2G2QA 1YGEA 2GEYA 1LJRA 2JACA 2STDA 1X1YA 1R4WA 1B27A 4HM7B 3QK9A 1B4QA 4OMVA 1ACVA 4XHMA 2B7KA 4V2NA 5IMZA 4AEQA 5AI1A 3C1RA 1BRHA 1TW9A 4K1VA 3GAXA 2OE3A 1ZS7A 2DMMA 2PVOC 3Q6OA 2W0QA 3APOA 2YV9A 1NW2A 3VI7A 4X0XA 1YZXA 4O7HA 3NBBA 3O3TA 3UARA 1T4YA 3NM7A 2H1BA 3Q1CA 3GMFA 22GSA 1PX7A 5LC7A 1MDJA 1GSSA 3UAPA 3LH4A 3FZ4A 4KF9A 3JUQA 3F9SA 1LBKA 3M0FA 4KUNA 1GUHA 2CFDA 2LS5A 3DUKA 2HOHA 1JZWA 3GX8A 3CSIA 1N5HA 4HM5B 1K734 5J4UA 1M1K4 4JZQA 1BSAA 3WGXA 3KIIA 1Q40B 1DVDA 1A24A 3LGCA 2VLVA 3NIVA 3VSYA 1YJN3 2I9WA 4EUYA 1DMNA 3CPOA 3OW22 1YI23 1O7HB 1VZZA 1JN5B 1GTIA 1O7GB 2K6VA 3KE7A 4MLYA 1TIJA 3LOYA 3KSED 1YKAA 2IMJA 3HX8A 4BL3A 2CIUA 1B2ZA 2JADA 3TJJA 5JWOB 3G4S3 3H1NA 1K0NA 3GZXB 1GLPA 2CZ3A 1STFI 2XGNA 1ROVA 5AGYA 2KUCA 1FG4A 1R26A 2G0FA 5JPPA 2HMKB 1GUMA 1GMPA 1USBA 1EA2A 1IVUA 5F0GA 5KP4A 1ISKA 3ZFZA 3KD0A 3CC23 1RRHA 5J5NA 2B24B 1ULJB 4FCZA 1QVG2 1IQYA 1GY7A 4MPGA 5AIXA 3RGAA 2TRCP 2YZHA 1US1A 3WDGB 3CSHA 1PD21 3Q74A 1OF5A 3HI7A 2W9PA 1XWGA 1M904 3M8CA 3EMPA 2PN8A 4K2XA 2JL4A 1DYUA 3N9JA 3TOUA 4WWUC 2H70A 3KJYA 2YFLB 1GSQA 3EU4A 1K3OA 1TRSA 1OGXA 1ABAA 2H74A 2QA2A 2VLUA 2PZVA 4EL1A 1JHBA 4ECIA 1MDIA 3OR5A 3URPA 2PU9C 1G6YA 1E3VA 1A2LA 1UN2A 1QXHA 3F0IA 3EPTA 1FW7A 3R2QA 3ZFLA 1WTHA 1YIT3 3DKSA 3LJRA 3NXJA 2GXFA 3MSZA 4PQHA 3EN8A 3NBJA 2LV3A 2KCDA 1PN9A 2GDRA 2ML6A 4RQRA 2OTL3 1SJZA 5IG0A 2H6ZA 1VQ53 5IOWA 3OWUA 4IT7A 3HVNA 4GSSA 1BJXA 2NDOA 4V2LA 5D9XA 3GHAA 2M80A 3U1WA 4IS0A 1EQKA 3K8NA 1T4ZA 2CAQA 4GF0A 3HZPA 5IOXA 4GQFA 1I0XA 1Q40A 2HYXA 13GSA 4GSNA 3F63A 1TU5A 1MWRA 1GSUA 5GAND 1LQMB 3HZ4A 3DGMA 2XBIA 5BU4A 3WOEB 4HQSA 4HVNA 4KCEA 4HI7A 1BSDA 1M2BA 1EV9A 3IC8A 3KMOA 4NAXA 4TR1A 3K0ZA 2E0QA 5HR1A 3PPUA 2MMOA 3HVVA 1RGKA 3GL5A 2F99A 1O7UA 3LTBA 3DMLA 3IRAA 2JZRA 3BCKA 4LA1A 3CXC2 1YEPA 2DJ0A 4DSSA 4Z2UA 3SWLA 1V2AA 1M3JA 2OE0A 2BJXA 4EVMA 2CVDA 4HBRA 4KDYA 3D0ZA 5BRTA 1QMAA 2FY6A 2X64A 4IP6A 3MSOA 2RGQA 2IJYA 1G7EA 4IQAA 2R37A 4TOPA 1TDIA 1Q7Y4 1S3AA 1TXXA 3UVHA 1OKDA 5GSTA 3ZFBA 2VCXA 2H72A 2ZNMA 5DAKA 2LRCA 5CRWA 3AY8A 5ECOB 1CQHA 5B6NA 4RI7A 3RHBA 2OOVC 10GSA 1BNRA 1RTUA 3FF2A 3N8BA 2JZSA 4XRDA 4I8BA 5ID2B 4N6UA 1KWIA 1KSIA 1M1XB 2QC7A 4KAEA 1DBYA 2LTKA 2SBLA 1HU9A 4Q5FA 1T8EB 2D1WA 4HM3B 3CQFA 3GH6A 3TKQA 3D21A 1FUTA 1YVBI 6GSSA 4KE3A 2UX0A 4HM6B 4GTUA 3KP8A 1TP6A 1ROAA 4K8MA 3LTCA 2P5QA 1IQ8A 1AVLA 2HMJB 1K3LA 5FW5A 1EEMA 3LT8A 2UZ8A 1YQ1A 1FAAA 1B21A 3BB9A 1DE1A 1KQS2 5A5KA 1JV2B 6STDA 3GIXA 5AN1A 1G96A 1T3BA 3HHVA 3I43A 2GBXB 2IN3A 2R0CA 1RSNA 5D73A 3GKKA 3FLJA 5J9BA 1PFPA 3EE1A 5AEUB 4EBGA 4K1UA 2KP2A 3KH7A 3G7YA 4POBA 1OC9A 4PURA 3EE2A 1GS3A 5IMFA 4WFOA 2GLRA 2PERA 2ZDJA 3LWAA 2BU4A 4EKZA 3DGLA 1V40A 3S5CA 4FCJA 3BNDA 2DKHA 1F8NA 2KOKA 3ERGA 4X43A 1SK2A 3IOSA 2ES7A 1SL2B 1ERVA 4DSSB 8GSSA 1WMPA 1B8XA 1BUQA 1T1VA 3CCL3 6GSYA 1GRXA 4HZBB 1BRJA 2R4IA 4CCVA 4IKHA 3ME7A 3TRXA 3PCSA 1SYXA 3E99A 2LJAA 3FZAA 2K3DA 4HZ2A 3LMLA 1LOWA 4N0VA 3CNXA 1G6WA 4BIKA 2ZL8A 3DXOA 1JLWA 2C4JA 4WEYA 3F8XA 1I2EA 4K0GA 5DAKB 2M72A 1UW1A 4FMCA 2CFLA 3D9RA 5FHIA 2RBIA 4IELA 3ZREA 2KF3A 2R2JA 5D9WA 5B8AA 2VCVA 2CAIA 4MMXB 2F8AA 1JB5A 1TKDB 5JBSA 4DSQA 1GY5A 2GSPA 4MF5A 2HFDA 1EKMA 2H8LA 4LEHA 1M0UA 4V2MA 2YPMA 1UGIA 1OE7A 3S28A 3SEDA 1TTOA 4J5KA 5ECNB 4N6NB 1FYSA 3V99A 2W9QA 3LW9A 3DGYA 1ERUA 1ZL9A 3QRDA 3D79A 4GL6A 2C3QA 3A2WA 4HU7A 2YWIA 4HM1B 1XG8A 3S67A 5DJMA 1URMA 3MWHA 2XGLA 2YOIA 1RGEA 1MD4A 4L8EA 3WGEA 3UB1A 3CD63 2HSHA 1JBRA 1BSBA 3ZVJA 3TKRA 4N6MA 1YIJ3 1DMQA 3I563 2BMQB 3ZG0A 3VWWA 2B1XB 2GSTA 4O5RA 3TJGA 1OC9B 1O8WA 2C0EA 1V58A 4ORLA 2LRTA 2OJLA 1TU8A 2HZFA 2IYJA 3GSPA 2ON5A 2CV4A 4V1Ap 2RFRA 2DC5A 3KH9A 5B8BA 3LXZA 4LLRA 2D42A 5JWRB 1EUIC 1ZYNA 5AISA 3PS8A 5KN1A 1IT8A 3A5WA 2OQEC 4BL2A 2VCTA 4K90B 1EWXA 1S5AA 5GSPA 3IHGA 3IV4A 8RNTA 4YQUA 3JUNA 4EXRA 5E4WA 1N8QA 4HDEA 2RLIA 4MH2A 2C3TA 1JB2A 2XFSA 4BL7A 1OE8A 1PU4A 2DLXA 2CH9A 4NHFA 1Q814 2P0XA 1A2JA 4KGIA 4OO5A 5ECIB 1RJOA 3F8HA 4EV2A 2FGXA 4A5PA 1FUSA 1N9JA 1RGCA 2A4VA 1UUVB 3RPNA 3FSDA 4N0ZA 1AXDA 4J9AA 1CYUA 5CLKA 3BNEA 3BJ5A 3F6FA 1Q98A 5FT3A 2R6KA 1C54A 1W6CA 3P90A 3UJMA 2DIZA 6GSVA 3NQZA 6GSWA 1C72A 1NNVA 3OXAA 1OC8A 1M9GA 2R0GA 3IAS2 3ZITA 2HRKA 3TJKA 1SARA 1S3CA 1XW9A 2JSZA 4I6XA 1AVKA 1UA5A 4F03A 1VF2A 3UNLA 3HDCA 3HA9A 2PUKC 1Q824 4OO4A 1X1WA 2H1AA 3FGYA 3QFAC 3GZYB 4BU4A 4HJLB 5D96A 3ZG5A 4OCFA 5IQYA 1K0CA 1O6JA 1LOXA 5DRVA 5HFKA 1VQ83 1XPVA 5IPHA 1ASKA 2OBIA 4BWSA 1B2SA 1BNGA 1ZOFA 1A2PA 1UVZA 5CREA 3BNCA 2FA8A 2QGVA 2YANA 4HM2B 3GH9A 1ERWA 4IP1A 3RAZA 1TK0B 3ZRDA 4QL7A 4EO3A 1OHOA 3IBHA 1WNHA 20GSA 1BNFA 3GKNA 3X42A 1TFKA 2GEXA 4FO5A 5COHA 2MMAA 3BNBA 3B7CA 4RNYA 1EZKA 3B4OA 2C0FA 3HCZA 2RIIA 2GT5A 2GZPA 4ISDA 1JZDA 4AKYA 3CMA3 3RNTA 3BD2A 4G9HA 4PTSA 4YQVA 1XOAA 3AHSA 4USSA 3WT1A 1HQOA 1I0VA 3T8UA 4N6V0 2B5XA 1YNVX 4OFTA 2WGQA 2WO0A 1XVQA 5ELUA 1T2IA 5CNWA 2RM6A 1I5GA 3UL6A 2AAEA 1GP1A 1Q864 16GSA 3MAKA 4N11A 2F56A 4G2EA 2MMZA 1S3RA 3KGKA 3F40A 1YKCA 3KP9A 4JRFA 1DE3A 1OF5B 4POKA 3BBYA 3FZ9A 5IO2A 1J08A 2AJQB 2DJ3A 1U88A 5M1AA 1BIRA 4MCUA 3G7JA 4IQ1A 1ZCPA 1PN0A 1B2MA 3ME8A 4GLTA 4PGTA 4KZ1A 5DALB 1JLVA 2WCIA 4EC0A 2RCDA 5AIFA 4G0IA 2YWMA 5D83A 5BIRA 4K2DA 1FZUA 2LJKA 1RGAA 3F7XA 1IT7A 5IM9A 1B9XC 3CME3 4XB5A 1OGZA 2GSRA 1SK1A 2V32A 2J8XB 4PX1A 1SL0B 2CX4A 5EQLA 1D6ZA 4IPBA 4ECBA 1GULA 2K8VA 3LYPA 2DIYA 3CNMA 3ER7A 1ERTA 4KX4A 2CWVA 1IVWA 5B7CA 5ELGA 3ECFA 4NHZA 3MG1A 4EC6A 4X2HA 5F05A 2IA7A 4ZBDA 3B8LA 5G1KA 1BAOA 4XDWA 4K7IA 4D73A 2DBCA 3T0UA 4O32A 1SK0A 2HE3A 4ULXA 3W6GA 3ZMKA 5D82A 3LT9A 2HRAA 5IENA 4ZB8A 1BSCA 3I553 2O3OA 1OVNA 2H1GA 1M3IA 3UEMA 1GSEA 4ZB6A 2XSHB 1YY7A 2XSOB 3FR6A 3TB2A 1YVSA 5IPGA 1SENA 4CW9A 1BGSA 2X8HA 4HKVB 1THOA 1LNHA 1VF3A 2HRNA 2F51A 4KH7A 1UCKA 5D8IA 3PINA 4MK3A 3CC43 4YQMA 3W8JA 5DCHA 5F07A 1RRLA 1XWKA 2H71A 2YJ7A 4GHOA 1AQXA 4BWQA 2Z6BA 3CTGA 2IUKA 1W4VA 2O9UX 4ZL8A 1K8A4 4DEJA 2KF4A 4K5SA 2L5OA 1OYJA 5KP3A 2BIRA 2HMLB 4JR6A 3W8SA 4NV5A 1N9EA 1K0DA 3OWSA 5HQPA 3CCV3 1W7CA 4HYZA 1VQ93 1LQGC 4CJNA 3D5GA 3CRTA 1SKSB 5IMCA 3TKSE 3GV1A 1X5DA 3HXSA 1UCIA 2VM1A 3DIEA 3MYDA 4MJBA 4EV5A 1VQP3 2OE1A 3GNJA 2V6OA 1YJ6A 2OKAA 5ID2A 2JSYA 3X3YA 2H6YA 2W03A 1LOYA 3C8EA 4YKGA 3H93A 2WOFA 5IEOA 3L0HA 3ZZXA 18GSA 4H3UA 2C8UA 4N6LA 3ZYWA 2W04A 4CPKA 5AYRB 1OKTA 4J8TA 3N5OA 5KN2A 3H3HA 1WMJA 1A0FA 3QCPA 4AJ6A 2NVLA 1EP7A 4DSRA 1UCLA 3EWLA 3TKSA 3K7CA 4IJIA 1R4YA 4FMBA 4GB5A 1BQ7A 1YGWA 4P3YB 1T7PB 2C1YA 3ZIJA 4HOHA 4IBPA 2C11A 1IYYA 5GZZB 1OACA 1RNBA 1Z9HA 2PVQA 2PMTA 3NZNA 4K61A 1OHSA 3WODG 3NQYA 4L8OA 3KCMA 5ECQB 3SYUA 2IFQA 5M18A 2GU3A 1TUHA 3G713 1TRQA 5GSSA 1GOUA 17GSA 5IMDA 3Q18A 2OQEA 3EVIA 1KNGA 2CFGA 2H0HA 5H5RA 3V1WA 3MKIA 1PQNA 2CZ2A 5J41A 2H6XA 2O85A 1V9WA 3ERWA 1RGGA 5DBQA 1JKGA 3KIJA 2MYGA 1THXA 2XRXB 1N8R4 2YZUA 1C7HA 1PKZA 5LCZA 7STDA 3UJ1A 5IW9A 4R80A 1MD3A 1EOGA 2KXGA 4MJCA 3ISOA 1BNJA 4XRAA 1ZGNA 4IGJA 3TKPA 4I97A 2JDIH 1RN4A 1R5AA 2K54A 3D4TA 1GD3A 5ENUA 5HR2A 4G0LA 1M99A 1HZ1A 2GQLA 5BXQA 11GSA 3NM2A 1SKWB 2GSSA 1SKRB 3BIRA 5F8BA 2C0DA 2CC3A 5IG4A 1K0MA 5CYYA 3KZQA 2P0MA 4XM4A 5AIIA 1Z5YE 4TKYA 1LXEA 2V2GA 3UL5A 2J23A 4JF8A 4O8SA 5DREA 1FVJA 5AYSC 7RNTA 4MJAA 1BNSA 1V74A 3CCE3 4BVXA 4NWYA 3MPHA 5G2GA 3EJVA 2OWPA
chains in the Genus database with same CATH topology
3L9UA 1JFUA 5G30A 1GL8A 2PBJA 2ON7A 1VF1A 2FHEA 2FD3A 2B1KA 1QK8A 4H86A 1Z3EA 1GNEA 2HZEA 1Y6EA 3LSZA 2WFCA 4OD7A 2L4QA 3HJMA 5LD0A 2Z9SA 5CRHA 3DRNA 1F3AA 3RHCA 2H1DA 1F9MA 4WR4A 1X9WB 1TRUA 5DDLA 2E7PA 3KTBA 5BMUA 3TJFA 4KW6A 3UVTA 1N2AA 3GA4A 5INYA 3DYRA 2FWHA 4TN8A 2N5AA 3FRCA 1NSWA 3U6VA 2GVPA 3WD6A 1FHEA 2QA1A 4DVCA 2YV7A 1J0FA 2H75A 3QMXA 1KTEA 4G0KA 4I2UA 3HVSA 1M2DA 4EDZA 3ED3A 1T00A 1G7OA 1PL1A 3TRQA 2BTOT 4WETA 2H66A 1ML6A 1N8JA 1SD9A 1BG5A 3CYNA 3UBKA 3DEXA 2FLSA 3IA1A 2L59A 2CT6A 1EOHA 3BCIA 3VK9A 3FYGA 3I6AA 4FYCA 1WOUA 4MDCA 4MMMA 4CHSA 2LNSA 1PA3A 1B4PA 1F6MC 3ERFA 1O85A 4GWRA 3MNGA 1HNBA 4MPFA 1BEDA 3GX0A 4I5QA 1ZMAA 4NHWA 3TCOA 2I81A 2F3MA 4XS4B 1IYHA 4Q5QA 3PGTA 3MIXA 4AJ7A 3M1GA 4KSMA 4J56E 1U3AA 2B1LA 4KCAA 2B7JA 3DVXA 4HJ2A 2VM2A 3FEUA 3HJPA 1BYEA 2MBTA 3P2AA 4ZBBA 2MBSA 2PGTA 1V57A 1Z6MA 4LMWA 2XPEA 4PNGA 3FHKA 4KB3A 4GCIA 2CVBA 5A4VA 2N5BA 3KM6A 4HZ4A 2MMNA 4ML1A 5ECRB 4WF5A 2GT6A 5KN0A 4MH3A 4PXOA 4Q5NA 3HKRA 2C80A 2RUEA 3C73A 3F8UA 1ZYPA 1R7HA 4ZBAA 1A2MA 2V6KA 1M9AA 4XS6A 1XOBA 1XVWA 2HT9A 3QFBC 5JCGA 2P31A 3EU3A 4WR5A 1WPIA 4FYBA 2VL2A 4MJEA 4XIHA 5CRDA 3VWUA 2CQ9A 5ELAA 1NM3A 2H73A 3WYWA 1F3BA 5ECSA 2FA4A 4G19A 1FW1A 2XPDA 4X4JA 1AUCA 3DWVA 4F0CA 5DALA 4PUAA 2OACA 3UOMA 3IE3A 4XS4A 2F9SA 5ECPB 2R4VA 1XWAA 4POMA 1A8LA 4MZBA 4TRXA 5GAPD 1TU7A 2OBKA 1KEBA 2WRTA 5EVOA 1XIYA 4L5LA 4GSTA 2IY2A 2PWJA 3TKSC 2AB6A 1BX9A 4AF2A 2H19A 2HLSA 2NBSA 4HEA2 2DSAA 1TRWA 3LXTA 2XBQA 3GTUB 4D73B 3D5JA 3GKXA 4RUVA 4TR3A 4YH2A 4F9ZA 2JU5A 3G7IA 5DVBA 4LL4B 3TGZA 2LQQA 3GN3A 2O87A 3P7XA 3FKFA 3CRUA 3IR4A 3A2VA 2AAWA 2YNXA 3HZ8A 1IYIA 3SBCA 5KEJA 4MZCA 2KLXA 2PPTA 4OCEA 4IHUA 2WGRA 2A2SA 2AYTA 1VRSD 2V41A 2D2ZA 2B3SA 2X8GA 4KA0A 3D4MA 2LRNA 3L9VA 5H5SA 2M46A 2L57A 1XW6A 3LQ7A 1MDKA 4JU5A 1EGRA 5ECHB 4G10A 4E8EA 1SU9A 2VD0A 2VAFA 2DJ2A 1EGOA 1VF4A 2WB9A 4FQUA 5F06A 4GRFA 3IXRA 1V98A 2GGTA 2FWFA 1DSBA 1Z7RA 2B6MA 4YKFA 2YCDA 1AAZA 4JBBA 2P5RA 2N5FA 2IMDA 3M8NA 3H8QA 4HOJA 1K0OA 3TOTA 9GSSA 1HNAA 4EF0A 2IMFA 2NPBA 4TR0A 2JZTA 2A2PA 2X99A 3GTUA 5HFGA 1GTUA 2IFQB 2QKEA 4AJ8A 5DJLA 5DCGA 5JWQB 2GZYA 2IMKA 2HNLA 1J9BA 2ZUPA 3APSA 3VPQA 2YP6A 2HI7A 4PNFA 1MEKA 2OADA 2C0GA 3HY2A 2EIOA 1HNCA 4OFMA 4KNDA 4N10A 1H75A 3VPTA 4POLA 3VWXA 3A5IA 3FZ5A 4FH8A 3FW2A 3QD9A 4FYUA 2WJUA 14GSA 4ZIJA 2GS3A 3PR8A 1A23A 4NV2A 2B5EA 4CY8A 3FR3A 1F2EA 2VCQA 4MA9A 3FK8A 2VO4A 1F37A 2IWTA 2REMA 2VLTA 3IHQA 4BVXB 2AUVA 3RDWA 3QAVA 4CY6A 1K0BA 1WE0A 1G0TA 1GSFA 1QGVA 1DE2A 1QFNA 3GSSA 3L4NA 3HVXA 1TJDA 3QDNA 1EP8A 4L0UA 5B6MA 3IC4A 4Z2TA 2HZEB 5J9CA 1I9DA 2WULA 3VURA 2ALBA 1B9YC 3EMXA 3DGQA 4ILFA 2R3XA 3H79A 5HFIA 4ZB9A 1FOHA 1SJIA 3QPMA 3EINA 5JCUA 1XCCA 4KDXA 4EIPA 2AV4A 1FOVA 3VFIA 2IMIA 19GSA 4IN0A 2LEGA 4RQXA 3VWVA 1ZZYA 2E2GA 2NTOA 5KOXA 2VIMA 5EPFA 1X5EA 3F4TA 4HQZA 5IMAA 6GSXA 4QL9A 2XC2A 1HYUA 2DMLA 4WXTA 3DVWA 3NOFA 2J9HA 3J7Yb 1U6TA 1EEJA 2X4AA 3C7MA 2HSYA 3D22A 4Q5RA 3HYPA 4PUFC 4NPBA 2YJHA 2BMXA 2GZZA 4ACSA 2C3NA 1XBSA 5L71A 1SYRA 4MP4A 2QSIA 4K5RA 1ILOA 3IK9A 3L78A 2L4CA 4ML6A 5ECKB 5DQSA 4QQ7A 1PKWA 2HSMA 2H0IA 4OFNA 1U3IA 1RW1A 3C71A 2L5LA 2IL3A 2DJ1A 3ZLPA 5D9TA 2R5GA 5AIVA 4TW5A 1WWJA 2I3YA 5ECMB 1GUKA 4MZWA 1YF0A 3UIWA 4MABA 1DUGA 1ON4A 4JRRA 3FMWA 5G31A 4XTSA 3F9UA 4J2FA 3F4RA 4TR4A 3GRXA 3LORA 2GTUA 1K0AA 2KHPA 2XHFA 4ZL7A 2TIRA 4TXOB 3EURA 3ZMLA 2LQOA 2E2MA 4K7NA 3CBUA 1OAZA 2WZ9A 4HS1A 2IPAA 3EC3A 5G2ZA 5HR3A 4Z7XA 5IO0A 4F0BA 1GTAA 3EYTA 3CTFA 2I1UA 3RBTA 3QOUA 1TP9A 1SL1B 2IMEA 4JE1A 4K9ZA 3S9FA 4K6XA 2FCHA 2O7KA 4N30A 3TUEA 3IPZA 2MZCA 1FVKA 1OC3A 3QAGA 3LEFA 1TK8B 3KTLA 1GWCA 2VD1A 1YF1A 4TXVA 5CO3A 3FR9A 3FY7A 4GQCA 4O5UA 2EC4A 5ABRA 3RPPA 1M7TA 1UC7A 2HXKA 4L5OA 5ECLB 1H4OA 4EE0A 2V1MA 5EL8A 3UMAA 4CDOA 1LU4A 3TJBA 5D9VA 1X9SB 2IIYA 2O8VB 1KBNA 3QAWA 3O76A 2LNTA 4K7OA 4LL1B 2VL9A 4JR4A 2VUPA 3KEBA 2YN1A 1YEXA 2A2RA 1NHOA 4KDUA 3APQA 3VLNA 3F3RA 3L9SA 3ZL5A 1S3DA 1W89A 1CQGA 1TRVA 2GQKA 2L6CA 1HD2A 4ID0A 4XS1A 4TXOA 3IAM2 2ZCTA 4MF6A 4IJ3A 4ECCA 1MTCA 3GKMA 3A2XA 1JZOA 3ZVJD 4I2TA 3GURA 3C1SA 2CA8A 3CXGA 3LFLA 1VGLA 5C04A 4L0WA 4RI6A 7GSSA 2H0GA 4HUAA 3CMIA 1XW5A 3F6DA 1GSYA 2RUFA 5E59A 1TTZA 5IIZA 1Y25A 1TOFA 4TR1B 3UL3A 5CRGA 2K8SA 1AIUA 3GFKA 3M9JA 1A0RP 3R3EA 1AQWA 1O73A 1ZYEA 2AHEA 1RQMA 1FB0A 3E0UA 3ZIVA 3KMNA 3IDVA 4IW9A 4ZL9A 3IK7A 1JZRA 5A4UA 5G5FA 3F3QA 4ECJA 3A3TA 3BOAA 3F4SA 3G9BA 1GTBA 4WBJA 1NHYA 3D6IA 4EDYA 1WIKA 4EIQA 1X0RA 2P0GA 1O8XA 12GSA 1GH2A 3US3A 1RK4A 2LSTA 4EXJA 1WRYA 5CP1A 4NMUA 3DXBA 5CAXA 1AQVA 4OWYA 2HRFA 3HD5A 4GXZA 5KN3A 4AGSA 1M2AA 5C00A 3GUSA 2L6DA 1B48A 3KXOA 2YWOA 3CSJA 1Q4JA 1R5PA 2KP1A 4O92A 3I69A 1TI3A 2DJJA 2K18A 1SD8A 2GSQA 4JEDA 1PL2A 5G5EA 4ZILA 2RM5A 4J57E 3TRPA 1XXUA 1E2YA 2O89A 3J7Yk 3Q19A 1E6BA 4TVEA 2OA7A 1AC1A 4MF7A 4BVYA 1PSQA 5JCWA 4WBRD 4V1Ag 4ICYA 1QMVA 2FNOA 1Z7PA 3VI5A 2LJRA 1WJKA 2X49A 4NXIA 1TK5B 1GLQA 1O81A 5A4WA 3QR6A 2A4HA 2EIRA 1K3YA 3PH9A 1XWCA 2FUG2 1XWBA 6GSTA 3ZTLA 1Z6NA 4FIWA 3I9V2 6GSUA 1XZOA 2DJKA 1PX6A 2FWEA 4PQ1A 1GSDA 3P8WA 1PGTA 2B5YA 1AW9A 4WKWA 5D93A 2F8FA 1BAYA 4Z2RA 4E8HA 5H5QA 4MNNA 2VL2C 3WT2A 3GL3A 1EV4A 3O6TA 1TI1A 5HR0A 4F82A 2K9FA 3MDKA 2VOCA 3DD3A 2H76A 3M3MA 4IVFA 3U5RE 5IMVA 1QUWA 4K0NA 2GQMA 1SJ6A 2FWGA 1X9MB 3E3EA 1ZYQB 4O5QA 4YAVA 1WP0A 2WDUA 4XCSA 2VL3A 1FB6A 5J3RA 4WF4A 4LMVA 1XFLA 3GYKA 3TDGA 5DQYA 5EY6A 1U87A 2H01A 3GSTA 4BVYB 3JCML 4BA7A 1FO5A 1A8YA 4PQIA 2VCWA 3WGDA 4ZXGA 2X8CA 4HJMA 2DKIA 3HJOA 4F2IA 3E9JB 4YAPA 2EIQA 1YDKA 5KOWA 1GNWA 2YWNA 4X1UA 1QQ2A 2I4AA 2H30A 3UBLA 2LUSA 3H4KA 1X5CA 2WS2A 2TRXA 2VCZA 2CX3A 1PRXA 2I9HA 4K1FA 3LYKA 4HU9A 5G1LA 4KSOA 3M9KA 1PMTA 4BL7B 1ST9A 2R0PA 2LKUA 5LNKe 1M9BA 3LG6A 5FWGA 2CVKA 4BPYA 2G2QA 1LJRA 2JACA 1R4WA 1B4QA 4OMVA 1ACVA 4XHMA 2B7KA 4V2NA 5IMZA 3C1RA 1TW9A 2OE3A 2DMMA 2PVOC 3Q6OA 3APOA 2YV9A 1NW2A 3VI7A 4X0XA 1YZXA 4O7HA 3UARA 3O3TA 1T4YA 2H1BA 3GMFA 22GSA 1PX7A 1MDJA 1GSSA 3UAPA 3FZ4A 4KF9A 1LBKA 3M0FA 4KUNA 1GUHA 2LS5A 1JZWA 3GX8A 3CSIA 5J4UA 4JZQA 3WGXA 1A24A 3LGCA 2VLVA 3NIVA 4EUYA 1GTIA 2K6VA 4MLYA 1YKAA 2JADA 3TJJA 5JWOB 3H1NA 1K0NA 1GLPA 2CZ3A 5AGYA 2KUCA 1FG4A 1R26A 2G0FA 1GUMA 1USBA 5F0GA 3KD0A 5J5NA 4MPGA 5AIXA 2TRCP 2YZHA 3CSHA 1PD21 3Q74A 1XWGA 3EMPA 4K2XA 2PN8A 2JL4A 3TOUA 3N9JA 2H70A 3KJYA 1GSQA 3EU4A 1K3OA 1TRSA 1ABAA 2H74A 2QA2A 2VLUA 4EL1A 1JHBA 4ECIA 1MDIA 3OR5A 2PU9C 1G6YA 1A2LA 1UN2A 1QXHA 3F0IA 3EPTA 3R2QA 3ZFLA 3DKSA 3LJRA 3MSZA 4PQHA 2LV3A 1PN9A 2GDRA 4RQRA 1SJZA 2H6ZA 5IOWA 4GSSA 1BJXA 2NDOA 4V2LA 5D9XA 3GHAA 2M80A 4IS0A 3K8NA 1T4ZA 2CAQA 4GF0A 5IOXA 4GQFA 2HYXA 13GSA 4GSNA 3F63A 1GSUA 5GAND 3HZ4A 2XBIA 4HQSA 4KCEA 4HI7A 1M2BA 1EV9A 3IC8A 3KMOA 4NAXA 4TR1A 5HR1A 2E0QA 3PPUA 2MMOA 3HVVA 3GL5A 1O7UA 3DMLA 3IRAA 2JZRA 3BCKA 4LA1A 1YEPA 2DJ0A 4DSSA 4Z2UA 3SWLA 1V2AA 2OE0A 2BJXA 4EVMA 2CVDA 5BRTA 4KDYA 3D0ZA 2FY6A 2X64A 4IP6A 2IJYA 1G7EA 4IQAA 2R37A 4TOPA 1TDIA 1S3AA 1TXXA 3UVHA 1OKDA 5GSTA 3ZFBA 2VCXA 2H72A 2ZNMA 5DAKA 2LRCA 5CRWA 3AY8A 5ECOB 1CQHA 5B6NA 4RI7A 3RHBA 10GSA 2JZSA 4XRDA 4I8BA 5ID2B 2QC7A 4KAEA 1DBYA 2LTKA 4Q5FA 1T8EB 3GH6A 3TKQA 3D21A 6GSSA 4KE3A 4GTUA 3KP8A 4K8MA 2P5QA 1K3LA 1EEMA 2UZ8A 1YQ1A 1FAAA 1DE1A 5A5KA 5AN1A 3GIXA 1T3BA 3HHVA 3I43A 2IN3A 2R0CA 5D73A 3GKKA 5J9BA 2KP2A 3KH7A 3G7YA 4POBA 1OC9A 4PURA 3EE2A 5IMFA 2PERA 2GLRA 3LWAA 4EKZA 1V40A 2DKHA 2KOKA 3ERGA 4X43A 1SK2A 3IOSA 2ES7A 1SL2B 1ERVA 4DSSB 8GSSA 1B8XA 1T1VA 6GSYA 1GRXA 4IKHA 3ME7A 3TRXA 1SYXA 2LJAA 3FZAA 4HZ2A 4N0VA 1G6WA 1JLWA 2C4JA 4WEYA 4K0GA 5DAKB 2M72A 5FHIA 4IELA 3ZREA 2R2JA 5D9WA 5B8AA 2VCVA 2CAIA 2F8AA 1TKDB 4DSQA 4MF5A 2HFDA 2H8LA 1M0UA 4V2MA 2YPMA 1OE7A 5ECNB 3LW9A 1ERUA 1ZL9A 2C3QA 3A2WA 4HU7A 2YWIA 5DJMA 1URMA 3MWHA 2YOIA 1MD4A 4L8EA 3WGEA 2HSHA 3ZVJA 3TKRA 3VWWA 2GSTA 4O5RA 3TJGA 1OC9B 1O8WA 2C0EA 1V58A 2LRTA 2OJLA 1TU8A 2HZFA 2IYJA 2ON5A 2CV4A 4V1Ap 2DC5A 3KH9A 5B8BA 3LXZA 4LLRA 5JWRB 1ZYNA 5AISA 5KN1A 3A5WA 2VCTA 1EWXA 3IV4A 3IHGA 4YQUA 5E4WA 4HDEA 2RLIA 4MH2A 2C3TA 4BL7A 1OE8A 2DLXA 4KGIA 1A2JA 4OO5A 5ECIB 2FGXA 4A5PA 2A4VA 3RPNA 4N0ZA 1AXDA 3BJ5A 3F6FA 1Q98A 5FT3A 2R6KA 3P90A 2DIZA 6GSVA 6GSWA 1C72A 1OC8A 2R0GA 3IAS2 3ZITA 2HRKA 3TJKA 1S3CA 2JSZA 1XW9A 4I6XA 4F03A 1UA5A 1VF2A 3HDCA 3HA9A 2PUKC 4OO4A 2H1AA 3QFAC 5D96A 5IQYA 4OCFA 1K0CA 1O6JA 5HFKA 1XPVA 5IPHA 2OBIA 4BWSA 1ZOFA 1UVZA 5CREA 2FA8A 2QGVA 2YANA 3GH9A 1ERWA 4IP1A 3RAZA 1TK0B 3ZRDA 4QL7A 4EO3A 3IBHA 20GSA 3GKNA 4FO5A 5COHA 2MMAA 1EZKA 2C0FA 3HCZA 2RIIA 2GT5A 2GZPA 4ISDA 1JZDA 3BD2A 4G9HA 4PTSA 4YQVA 1XOAA 4USSA 3WT1A 1HQOA 2B5XA 4OFTA 1XVQA 5CNWA 2RM6A 1I5GA 1GP1A 16GSA 3MAKA 4N11A 4G2EA 2MMZA 3KGKA 1YKCA 3KP9A 4POKA 3BBYA 3FZ9A 5IO2A 1J08A 2AJQB 2DJ3A 1U88A 4MCUA 3G7JA 4IQ1A 1ZCPA 1PN0A 3ME8A 4GLTA 4PGTA 5DALB 1JLVA 2WCIA 4EC0A 4G0IA 2YWMA 4K2DA 2LJKA 5IM9A 1B9XC 2GSRA 1SK1A 2V32A 4PX1A 1SL0B 2CX4A 4ECBA 1GULA 2K8VA 3LYPA 2DIYA 1ERTA 4KX4A 5B7CA 5ELGA 4NHZA 5F05A 4ZBDA 5G1KA 4K7IA 4D73A 2DBCA 4O32A 1SK0A 2HE3A 4ULXA 3W6GA 3ZMKA 2HRAA 4ZB8A 1OVNA 2H1GA 3UEMA 1GSEA 4ZB6A 1YY7A 3FR6A 3TB2A 5IPGA 1SENA 4CW9A 2X8HA 1THOA 1VF3A 2HRNA 2F51A 4KH7A 5D8IA 3PINA 4MK3A 4YQMA 3W8JA 5DCHA 5F07A 1XWKA 2H71A 2YJ7A 1AQXA 4BWQA 3CTGA 1W4VA 4ZL8A 4DEJA 4K5SA 2L5OA 1OYJA 4JR6A 3W8SA 4NV5A 1K0DA 5HQPA 1SKSB 3CRTA 5IMCA 3TKSE 3GV1A 1X5DA 3HXSA 2VM1A 3DIEA 3MYDA 4MJBA 2OE1A 3GNJA 2V6OA 1YJ6A 2OKAA 5ID2A 2JSYA 2H6YA 3C8EA 4YKGA 3H93A 3L0HA 3ZZXA 18GSA 2C8UA 3ZYWA 1OKTA 3N5OA 5KN2A 1WMJA 1A0FA 3QCPA 4AJ6A 2NVLA 1EP7A 4DSRA 3EWLA 3TKSA 4IJIA 1BQ7A 4P3YB 1T7PB 2C1YA 3ZIJA 4IBPA 5GZZB 1Z9HA 2PVQA 2PMTA 3NZNA 5ECQB 3KCMA 2IFQA 5GSSA 17GSA 5IMDA 3Q18A 3EVIA 1KNGA 2H0HA 5H5RA 3V1WA 1PQNA 2CZ2A 5J41A 2H6XA 2O85A 1V9WA 3ERWA 5DBQA 3KIJA 2MYGA 1THXA 2YZUA 5LCZA 1PKZA 3UJ1A 1MD3A 1EOGA 4MJCA 3ISOA 4XRAA 1ZGNA 4IGJA 3TKPA 4I97A 1R5AA 3D4TA 5ENUA 5HR2A 4G0LA 1M99A 2GQLA 11GSA 1SKWB 2GSSA 1SKRB 5F8BA 2C0DA 1K0MA 5CYYA 3KZQA 4TKYA 1Z5YE 2V2GA 2J23A 1FVJA 4MJAA 4BVXA 4NWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9U A;  1JFU A;  5G30 A;  1GL8 A;  2PBJ A;  2ON7 A;  1VF1 A;  2FHE A;  2FD3 A;  2B1K A;  1QK8 A;  4H86 A;  1Z3E A;  1GNE A;  2HZE A;  1Y6E A;  3LSZ A;  2WFC A;  4OD7 A;  2L4Q A;  3HJM A;  5LD0 A;  2Z9S A;  5CRH A;  3DRN A;  1F3A A;  3RHC A;  2H1D A;  1F9M A;  4WR4 A;  1X9W B;  1TRU A;  5DDL A;  2E7P A;  3KTB A;  3TJF A;  4KW6 A;  3UVT A;  1N2A A;  3GA4 A;  5INY A;  3DYR A;  2FWH A;  4TN8 A;  2N5A A;  3FRC A;  1NSW A;  3U6V A;  2GVP A;  3WD6 A;  1FHE A;  4DVC A;  2YV7 A;  1J0F A;  2H75 A;  3QMX A;  1KTE A;  4I2U A;  3HVS A;  1M2D A;  4EDZ A;  3ED3 A;  1T00 A;  1G7O A;  1PL1 A;  3TRQ A;  2BTO T;  4WET A;  2H66 A;  1ML6 A;  1N8J A;  1SD9 A;  1BG5 A;  3CYN A;  3UBK A;  3DEX A;  2FLS A;  3IA1 A;  2L59 A;  2CT6 A;  1EOH A;  3BCI A;  3VK9 A;  3FYG A;  3I6A A;  4FYC A;  1WOU A;  4MDC A;  4MMM A;  4CHS A;  2LNS A;  1PA3 A;  1B4P A;  1F6M C;  3ERF A;  1O85 A;  4GWR A;  3MNG A;  1HNB A;  4MPF A;  1BED A;  3GX0 A;  4I5Q A;  1ZMA A;  4NHW A;  3TCO A;  2I81 A;  2F3M A;  4XS4 B;  1IYH A;  4Q5Q A;  3PGT A;  4AJ7 A;  3M1G A;  4KSM A;  4J56 E;  1U3A A;  2B1L A;  4KCA A;  2B7J A;  3DVX A;  4HJ2 A;  2VM2 A;  3FEU A;  3HJP A;  1BYE A;  2MBT A;  3P2A A;  4ZBB A;  2MBS A;  2PGT A;  1V57 A;  1Z6M A;  4LMW A;  2XPE A;  4PNG A;  3FHK A;  4KB3 A;  4GCI A;  2CVB A;  5A4V A;  2N5B A;  3KM6 A;  4HZ4 A;  2MMN A;  4ML1 A;  5ECR B;  4WF5 A;  2GT6 A;  5KN0 A;  4MH3 A;  4PXO A;  4Q5N A;  3HKR A;  2C80 A;  2RUE A;  3C73 A;  3F8U A;  1R7H A;  4ZBA A;  1A2M A;  2V6K A;  1M9A A;  4XS6 A;  1XOB A;  1XVW A;  2HT9 A;  3QFB C;  5JCG A;  2P31 A;  3EU3 A;  4WR5 A;  1WPI A;  4FYB A;  2VL2 A;  4MJE A;  4XIH A;  5CRD A;  3VWU A;  2CQ9 A;  5ELA A;  1NM3 A;  2H73 A;  3WYW A;  1F3B A;  5ECS A;  2FA4 A;  4G19 A;  1FW1 A;  2XPD A;  1AUC A;  3DWV A;  4F0C A;  5DAL A;  4PUA A;  2OAC A;  3UOM A;  3IE3 A;  4XS4 A;  2F9S A;  5ECP B;  2R4V A;  1XWA A;  4POM A;  1A8L A;  4MZB A;  4TRX A;  5GAP D;  1TU7 A;  2OBK A;  1KEB A;  2WRT A;  5EVO A;  1XIY A;  4L5L A;  4GST A;  2IY2 A;  2PWJ A;  3TKS C;  2AB6 A;  1BX9 A;  4AF2 A;  2H19 A;  2HLS A;  2NBS A;  4HEA 2;  2DSA A;  1TRW A;  3LXT A;  2XBQ A;  3GTU B;  4D73 B;  3D5J A;  3GKX A;  4RUV A;  4TR3 A;  4YH2 A;  4F9Z A;  2JU5 A;  3G7I A;  5DVB A;  2LQQ A;  3TGZ A;  3GN3 A;  4LL4 B;  2O87 A;  3P7X A;  3FKF A;  3CRU A;  3IR4 A;  3A2V A;  2AAW A;  2YNX A;  3HZ8 A;  1IYI A;  3SBC A;  5KEJ A;  4MZC A;  2KLX A;  2PPT A;  4OCE A;  4IHU A;  2WGR A;  2A2S A;  2AYT A;  1VRS D;  2V41 A;  2D2Z A;  2B3S A;  2X8G A;  4KA0 A;  3D4M A;  2LRN A;  3L9V A;  5H5S A;  2M46 A;  2L57 A;  1XW6 A;  3LQ7 A;  1MDK A;  4JU5 A;  1EGR A;  5ECH B;  4G10 A;  4E8E A;  1SU9 A;  2VD0 A;  2VAF A;  2DJ2 A;  1EGO A;  1VF4 A;  2WB9 A;  5F06 A;  4GRF A;  3IXR A;  1V98 A;  2GGT A;  2FWF A;  1DSB A;  1Z7R A;  2B6M A;  2YCD A;  1AAZ A;  4JBB A;  2P5R A;  2N5F A;  2IMD A;  3M8N A;  3H8Q A;  4HOJ A;  1K0O A;  3TOT A;  9GSS A;  1HNA A;  4EF0 A;  2IMF A;  2NPB A;  4TR0 A;  2JZT A;  2X99 A;  3GTU A;  5HFG A;  1GTU A;  2IFQ B;  2QKE A;  4AJ8 A;  5DJL A;  5DCG A;  5JWQ B;  2GZY A;  2IMK A;  2HNL A;  1J9B A;  2ZUP A;  3APS A;  3VPQ A;  2YP6 A;  2HI7 A;  4PNF A;  1MEK A;  2OAD A;  2C0G A;  3HY2 A;  2EIO A;  1HNC A;  4OFM A;  4KND A;  4N10 A;  1H75 A;  3VPT A;  4POL A;  3VWX A;  3FZ5 A;  4FH8 A;  3FW2 A;  3QD9 A;  4FYU A;  2WJU A;  14GS A;  4ZIJ A;  2GS3 A;  3PR8 A;  1A23 A;  4NV2 A;  2B5E A;  3FR3 A;  1F2E A;  2VCQ A;  4MA9 A;  3FK8 A;  2VO4 A;  1F37 A;  2IWT A;  2REM A;  2VLT A;  3IHQ A;  2AUV A;  3RDW A;  3QAV A;  1K0B A;  1WE0 A;  1G0T A;  1GSF A;  1QGV A;  1DE2 A;  1QFN A;  3GSS A;  3L4N A;  3HVX A;  1TJD A;  3QDN A;  1EP8 A;  4L0U A;  5B6M A;  3IC4 A;  2HZE B;  5J9C A;  1I9D A;  2WUL A;  3VUR A;  2ALB A;  1B9Y C;  3EMX A;  3DGQ A;  4ILF A;  2R3X A;  3H79 A;  5HFI A;  4ZB9 A;  1SJI A;  3QPM A;  3EIN A;  5JCU A;  1XCC A;  4KDX A;  2AV4 A;  1FOV A;  3VFI A;  2IMI A;  19GS A;  4IN0 A;  2LEG A;  4RQX A;  3VWV A;  1ZZY A;  2E2G A;  2NTO A;  2VIM A;  5EPF A;  1X5E A;  3F4T A;  4HQZ A;  5IMA A;  6GSX A;  4QL9 A;  2XC2 A;  1HYU A;  2DML A;  4WXT A;  3DVW A;  3NOF A;  2J9H A;  3J7Y b;  1U6T A;  1EEJ A;  3C7M A;  2HSY A;  3D22 A;  4Q5R A;  3HYP A;  4PUF C;  4NPB A;  2YJH A;  2BMX A;  2GZZ A;  4ACS A;  2C3N A;  1XBS A;  5L71 A;  1SYR A;  4MP4 A;  2QSI A;  1ILO A;  3IK9 A;  3L78 A;  2L4C A;  4ML6 A;  5ECK B;  5DQS A;  4QQ7 A;  1PKW A;  2H0I A;  4OFN A;  1U3I A;  1RW1 A;  3C71 A;  2L5L A;  2IL3 A;  2DJ1 A;  3ZLP A;  5D9T A;  2R5G A;  5AIV A;  4TW5 A;  1WWJ A;  2I3Y A;  5ECM B;  1GUK A;  4MZW A;  1YF0 A;  3UIW A;  4MAB A;  1DUG A;  1ON4 A;  4JRR A;  5G31 A;  4XTS A;  3F9U A;  4J2F A;  3F4R A;  4TR4 A;  3GRX A;  3LOR A;  2GTU A;  1K0A A;  2KHP A;  2XHF A;  4ZL7 A;  2TIR A;  4TXO B;  3EUR A;  3ZML A;  2LQO A;  2E2M A;  4K7N A;  3CBU A;  1OAZ A;  2WZ9 A;  4HS1 A;  2IPA A;  3EC3 A;  5G2Z A;  5HR3 A;  4Z7X A;  5IO0 A;  4F0B A;  1GTA A;  3EYT A;  3CTF A;  2I1U A;  3RBT A;  3QOU A;  1TP9 A;  1SL1 B;  2IME A;  4JE1 A;  4K9Z A;  3S9F A;  4K6X A;  2FCH A;  2O7K A;  4N30 A;  3TUE A;  3IPZ A;  2MZC A;  1FVK A;  1OC3 A;  3QAG A;  3LEF A;  1TK8 B;  3KTL A;  1GWC A;  2VD1 A;  1YF1 A;  4TXV A;  5CO3 A;  3FR9 A;  3FY7 A;  4GQC A;  2EC4 A;  5ABR A;  3RPP A;  1M7T A;  1UC7 A;  2HXK A;  4L5O A;  5ECL B;  1H4O A;  4EE0 A;  2V1M A;  5EL8 A;  3UMA A;  4CDO A;  1LU4 A;  3TJB A;  5D9V A;  1X9S B;  2IIY A;  2O8V B;  1KBN A;  3QAW A;  3O76 A;  2LNT A;  4K7O A;  4LL1 B;  2VL9 A;  4JR4 A;  2VUP A;  3KEB A;  2YN1 A;  1YEX A;  2A2R A;  1NHO A;  4KDU A;  3APQ A;  3VLN A;  3F3R A;  3L9S A;  3ZL5 A;  1S3D A;  1W89 A;  1CQG A;  1TRV A;  2GQK A;  2L6C A;  1HD2 A;  4ID0 A;  4XS1 A;  4TXO A;  3IAM 2;  2ZCT A;  4MF6 A;  4IJ3 A;  4ECC A;  1MTC A;  3GKM A;  3A2X A;  1JZO A;  3ZVJ D;  4I2T A;  3GUR A;  3C1S A;  2CA8 A;  3CXG A;  3LFL A;  1VGL A;  5C04 A;  4L0W A;  4RI6 A;  7GSS A;  2H0G A;  4HUA A;  3CMI A;  1XW5 A;  3F6D A;  1GSY A;  2RUF A;  5E59 A;  1TTZ A;  5IIZ A;  1Y25 A;  1TOF A;  4TR1 B;  3UL3 A;  5CRG A;  2K8S A;  1AIU A;  3GFK A;  3M9J A;  1A0R P;  1AQW A;  1O73 A;  1ZYE A;  2AHE A;  1RQM A;  1FB0 A;  3E0U A;  3ZIV A;  3KMN A;  3IDV A;  4IW9 A;  4ZL9 A;  3IK7 A;  1JZR A;  5A4U A;  5G5F A;  3F3Q A;  4ECJ A;  3A3T A;  3BOA A;  3F4S A;  3G9B A;  1GTB A;  4WBJ A;  1NHY A;  3D6I A;  4EDY A;  1WIK A;  1X0R A;  2P0G A;  1O8X A;  12GS A;  1GH2 A;  3US3 A;  1RK4 A;  2LST A;  4EXJ A;  1WRY A;  5CP1 A;  4NMU A;  3DXB A;  5CAX A;  1AQV A;  4OWY A;  2HRF A;  3HD5 A;  4GXZ A;  5KN3 A;  4AGS A;  1M2A A;  5C00 A;  3GUS A;  2L6D A;  1B48 A;  3KXO A;  2YWO A;  2KP1 A;  1Q4J A;  1R5P A;  3CSJ A;  4O92 A;  3I69 A;  1TI3 A;  2DJJ A;  2K18 A;  1SD8 A;  2GSQ A;  4JED A;  1PL2 A;  5G5E A;  4ZIL A;  2RM5 A;  4J57 E;  3TRP A;  1XXU A;  1E2Y A;  2O89 A;  3J7Y k;  3Q19 A;  1E6B A;  4TVE A;  2OA7 A;  1AC1 A;  4MF7 A;  4BVY A;  1PSQ A;  5JCW A;  4WBR D;  4V1A g;  1QMV A;  2FNO A;  1Z7P A;  3VI5 A;  2LJR A;  1WJK A;  4NXI A;  1TK5 B;  1GLQ A;  1O81 A;  5A4W A;  3QR6 A;  2EIR A;  1K3Y A;  3PH9 A;  1XWC A;  2FUG 2;  1XWB A;  6GST A;  3ZTL A;  1Z6N A;  4FIW A;  3I9V 2;  6GSU A;  1XZO A;  2DJK A;  1PX6 A;  2FWE A;  4PQ1 A;  1GSD A;  3P8W A;  1PGT A;  2B5Y A;  1AW9 A;  4WKW A;  5D93 A;  2F8F A;  1BAY A;  4E8H A;  5H5Q A;  2VL2 C;  3WT2 A;  3GL3 A;  1EV4 A;  3O6T A;  1TI1 A;  5HR0 A;  4F82 A;  2K9F A;  3MDK A;  2VOC A;  3DD3 A;  2H76 A;  3M3M A;  4IVF A;  3U5R E;  5IMV A;  1QUW A;  4K0N A;  2GQM A;  1SJ6 A;  2FWG A;  1X9M B;  3E3E A;  1ZYQ B;  4YAV A;  1WP0 A;  2WDU A;  4XCS A;  2VL3 A;  1FB6 A;  5J3R A;  4WF4 A;  4LMV A;  1XFL A;  3GYK A;  3TDG A;  5DQY A;  5EY6 A;  1U87 A;  2H01 A;  3GST A;  3JCM L;  4BA7 A;  1FO5 A;  1A8Y A;  4PQI A;  2VCW A;  3WGD A;  4ZXG A;  2X8C A;  4HJM A;  3HJO A;  4F2I A;  3E9J B;  4YAP A;  2EIQ A;  1YDK A;  1GNW A;  2YWN A;  4X1U A;  1QQ2 A;  2I4A A;  2H30 A;  3UBL A;  2LUS A;  3H4K A;  1X5C A;  2WS2 A;  2TRX A;  2VCZ A;  2CX3 A;  1PRX A;  2I9H A;  4K1F A;  3LYK A;  4HU9 A;  5G1L A;  4KSO A;  3M9K A;  1PMT A;  1ST9 A;  2LKU A;  5LNK e;  1M9B A;  3LG6 A;  5FWG A;  2CVK A;  4BPY A;  2G2Q A;  1LJR A;  2JAC A;  1R4W A;  1B4Q A;  4OMV A;  1ACV A;  4XHM A;  2B7K A;  4V2N A;  5IMZ A;  3C1R A;  1TW9 A;  2OE3 A;  2DMM A;  2PVO C;  3Q6O A;  3APO A;  2YV9 A;  1NW2 A;  3VI7 A;  4X0X A;  1YZX A;  4O7H A;  3UAR A;  3O3T A;  1T4Y A;  2H1B A;  3GMF A;  22GS A;  1PX7 A;  1MDJ A;  1GSS A;  3UAP A;  3FZ4 A;  1LBK A;  3M0F A;  4KUN A;  1GUH A;  2LS5 A;  1JZW A;  3GX8 A;  3CSI A;  5J4U A;  4JZQ A;  3WGX A;  1A24 A;  3LGC A;  2VLV A;  3NIV A;  4EUY A;  1GTI A;  2K6V A;  4MLY A;  1YKA A;  2JAD A;  3TJJ A;  5JWO B;  3H1N A;  1K0N A;  1GLP A;  2CZ3 A;  5AGY A;  2KUC A;  1FG4 A;  1R26 A;  2G0F A;  1GUM A;  1USB A;  5F0G A;  3KD0 A;  5J5N A;  4MPG A;  5AIX A;  2TRC P;  2YZH A;  3CSH A;  1PD2 1;  3Q74 A;  1XWG A;  3EMP A;  2PN8 A;  2JL4 A;  3TOU A;  3N9J A;  2H70 A;  3KJY A;  1GSQ A;  3EU4 A;  1K3O A;  1TRS A;  1ABA A;  2H74 A;  2VLU A;  4EL1 A;  1JHB A;  4ECI A;  1MDI A;  3OR5 A;  2PU9 C;  1G6Y A;  1A2L A;  1UN2 A;  1QXH A;  3F0I A;  3R2Q A;  3ZFL A;  3DKS A;  3LJR A;  3MSZ A;  4PQH A;  2LV3 A;  1PN9 A;  2GDR A;  4RQR A;  1SJZ A;  2H6Z A;  5IOW A;  4GSS A;  1BJX A;  2NDO A;  4V2L A;  5D9X A;  3GHA A;  2M80 A;  4IS0 A;  3K8N A;  1T4Z A;  2CAQ A;  4GF0 A;  5IOX A;  4GQF A;  2HYX A;  13GS A;  4GSN A;  3F63 A;  1GSU A;  5GAN D;  3HZ4 A;  2XBI A;  4HQS A;  4KCE A;  4HI7 A;  1M2B A;  1EV9 A;  3KMO A;  4NAX A;  4TR1 A;  2E0Q A;  5HR1 A;  2MMO A;  3HVV A;  3GL5 A;  1O7U A;  3DML A;  3IRA A;  2JZR A;  3BCK A;  4LA1 A;  1YEP A;  2DJ0 A;  4DSS A;  3SWL A;  1V2A A;  2OE0 A;  2BJX A;  4EVM A;  2CVD A;  4KDY A;  3D0Z A;  2FY6 A;  2X64 A;  4IP6 A;  2IJY A;  1G7E A;  4IQA A;  2R37 A;  4TOP A;  1TDI A;  1S3A A;  1TXX A;  3UVH A;  1OKD A;  3ZFB A;  5GST A;  2VCX A;  2H72 A;  2ZNM A;  5DAK A;  2LRC A;  5CRW A;  3AY8 A;  5ECO B;  1CQH A;  5B6N A;  4RI7 A;  3RHB A;  10GS A;  2JZS A;  4XRD A;  4I8B A;  5ID2 B;  2QC7 A;  4KAE A;  1DBY A;  2LTK A;  4Q5F A;  1T8E B;  3GH6 A;  3TKQ A;  3D21 A;  6GSS A;  4KE3 A;  4GTU A;  3KP8 A;  4K8M A;  2P5Q A;  1K3L A;  1EEM A;  1YQ1 A;  1FAA A;  1DE1 A;  5A5K A;  5AN1 A;  3GIX A;  1T3B A;  3HHV A;  3I43 A;  2IN3 A;  5D73 A;  3GKK A;  5J9B A;  2KP2 A;  3KH7 A;  3G7Y A;  4POB A;  1OC9 A;  4PUR A;  3EE2 A;  5IMF A;  2PER A;  2GLR A;  3LWA A;  4EKZ A;  1V40 A;  2KOK A;  3ERG A;  4X43 A;  1SK2 A;  3IOS A;  2ES7 A;  1SL2 B;  1ERV A;  4DSS B;  8GSS A;  1B8X A;  1T1V A;  6GSY A;  1GRX A;  4IKH A;  3ME7 A;  3TRX A;  1SYX A;  2LJA A;  3FZA A;  4HZ2 A;  4N0V A;  1G6W A;  1JLW A;  2C4J A;  4WEY A;  4K0G A;  5DAK B;  2M72 A;  5FHI A;  4IEL A;  3ZRE A;  2R2J A;  5D9W A;  5B8A A;  2VCV A;  2CAI A;  2F8A A;  1TKD B;  4DSQ A;  4MF5 A;  2HFD A;  2H8L A;  1M0U A;  4V2M A;  2YPM A;  1OE7 A;  5ECN B;  1ERU A;  1ZL9 A;  2C3Q A;  3A2W A;  4HU7 A;  2YWI A;  5DJM A;  1URM A;  3MWH A;  2YOI A;  1MD4 A;  4L8E A;  3WGE A;  2HSH A;  3ZVJ A;  3TKR A;  3VWW A;  2GST A;  4O5R A;  3TJG A;  1OC9 B;  1O8W A;  2C0E A;  1V58 A;  2LRT A;  2OJL A;  1TU8 A;  2HZF A;  2IYJ A;  2ON5 A;  2CV4 A;  4V1A p;  2DC5 A;  3KH9 A;  5B8B A;  3LXZ A;  4LLR A;  5JWR B;  5AIS A;  5KN1 A;  3A5W A;  2VCT A;  1EWX A;  3IV4 A;  4YQU A;  5E4W A;  4HDE A;  2RLI A;  4MH2 A;  2C3T A;  4BL7 A;  1OE8 A;  2DLX A;  4KGI A;  1A2J A;  4OO5 A;  5ECI B;  2FGX A;  2A4V A;  3RPN A;  4N0Z A;  1AXD A;  3BJ5 A;  3F6F A;  1Q98 A;  5FT3 A;  2R6K A;  3P90 A;  2DIZ A;  6GSV A;  6GSW A;  1C72 A;  1OC8 A;  3IAS 2;  3ZIT A;  3TJK A;  1S3C A;  2JSZ A;  1XW9 A;  4I6X A;  4F03 A;  1UA5 A;  1VF2 A;  3HDC A;  3HA9 A;  2PUK C;  4OO4 A;  2H1A A;  3QFA C;  5D96 A;  5IQY A;  4OCF A;  1K0C A;  1O6J A;  5HFK A;  1XPV A;  5IPH A;  2OBI A;  4BWS A;  1ZOF A;  1UVZ A;  5CRE A;  2FA8 A;  2QGV A;  2YAN A;  3GH9 A;  1ERW A;  4IP1 A;  3RAZ A;  1TK0 B;  3ZRD A;  4QL7 A;  4EO3 A;  3IBH A;  20GS A;  3GKN A;  4FO5 A;  5COH A;  2MMA A;  1EZK A;  2C0F A;  3HCZ A;  2RII A;  2GT5 A;  2GZP A;  4ISD A;  1JZD A;  3BD2 A;  4G9H A;  4YQV A;  1XOA A;  3WT1 A;  1HQO A;  2B5X A;  4OFT A;  1XVQ A;  5CNW A;  2RM6 A;  1I5G A;  1GP1 A;  16GS A;  3MAK A;  4N11 A;  4G2E A;  2MMZ A;  3KGK A;  1YKC A;  3KP9 A;  4POK A;  3BBY A;  3FZ9 A;  5IO2 A;  1J08 A;  2AJQ B;  2DJ3 A;  1U88 A;  4MCU A;  3G7J A;  4IQ1 A;  1ZCP A;  3ME8 A;  4GLT A;  4PGT A;  5DAL B;  1JLV A;  2WCI A;  4EC0 A;  2YWM A;  4K2D A;  2LJK A;  5IM9 A;  1B9X C;  2GSR A;  1SK1 A;  2V32 A;  4PX1 A;  1SL0 B;  2CX4 A;  4ECB A;  1GUL A;  2K8V A;  3LYP A;  2DIY A;  1ERT A;  4KX4 A;  5B7C A;  5ELG A;  4NHZ A;  5F05 A;  4ZBD A;  5G1K A;  4K7I A;  4D73 A;  2DBC A;  4O32 A;  1SK0 A;  2HE3 A;  4ULX A;  3W6G A;  3ZMK A;  4ZB8 A;  1OVN A;  2H1G A;  3UEM A;  1GSE A;  4ZB6 A;  1YY7 A;  3FR6 A;  3TB2 A;  5IPG A;  1SEN A;  4CW9 A;  2X8H A;  1THO A;  1VF3 A;  2HRN A;  2F51 A;  4KH7 A;  5D8I A;  3PIN A;  4MK3 A;  4YQM A;  3W8J A;  5DCH A;  5F07 A;  1XWK A;  2H71 A;  2YJ7 A;  1AQX A;  4BWQ A;  3CTG A;  1W4V A;  4ZL8 A;  4DEJ A;  2L5O A;  1OYJ A;  4JR6 A;  3W8S A;  4NV5 A;  1K0D A;  5HQP A;  1SKS B;  3CRT A;  5IMC A;  3TKS E;  3GV1 A;  1X5D A;  3HXS A;  2VM1 A;  3DIE A;  4MJB A;  2OE1 A;  3GNJ A;  2V6O A;  1YJ6 A;  2OKA A;  5ID2 A;  2JSY A;  2H6Y A;  3C8E A;  3H93 A;  3L0H A;  3ZZX A;  18GS A;  2C8U A;  3ZYW A;  1OKT A;  3N5O A;  5KN2 A;  1WMJ A;  1A0F A;  3QCP A;  4AJ6 A;  2NVL A;  1EP7 A;  4DSR A;  3EWL A;  3TKS A;  4IJI A;  1BQ7 A;  4P3Y B;  1T7P B;  2C1Y A;  3ZIJ A;  4IBP A;  5GZZ B;  1Z9H A;  2PVQ A;  2PMT A;  3NZN A;  5ECQ B;  3KCM A;  2IFQ A;  5GSS A;  17GS A;  5IMD A;  3Q18 A;  3EVI A;  1KNG A;  2H0H A;  5H5R A;  3V1W A;  1PQN A;  2CZ2 A;  5J41 A;  2H6X A;  2O85 A;  1V9W A;  3ERW A;  5DBQ A;  3KIJ A;  2MYG A;  1THX A;  2YZU A;  5LCZ A;  1PKZ A;  3UJ1 A;  1MD3 A;  1EOG A;  4MJC A;  3ISO A;  4XRA A;  1ZGN A;  4IGJ A;  3TKP A;  4I97 A;  1R5A A;  3D4T A;  5ENU A;  5HR2 A;  1M99 A;  2GQL A;  11GS A;  1SKW B;  2GSS A;  1SKR B;  5F8B A;  2C0D A;  1K0M A;  5CYY A;  3KZQ A;  4TKY A;  1Z5Y E;  2V2G A;  2J23 A;  1FVJ A;  4MJA A;  4BVX A;  4NWY A; 
#chains in the Genus database with same CATH topology
 3L9U A;  1JFU A;  5G30 A;  2KF6 A;  9RNT A;  1GL8 A;  2PBJ A;  3PYJ A;  2ON7 A;  1UUG B;  1VF1 A;  2FHE A;  1B2U A;  2FD3 A;  3Q90 A;  2B1K A;  1QK8 A;  4H86 A;  1Z3E A;  1GNE A;  2HZE A;  3CCM 3;  1RKY A;  1Y6E A;  3LSZ A;  1UI7 A;  4N3V A;  1TFO A;  2WFC A;  3KN4 A;  1SQW A;  2QEX 3;  4OD7 A;  2L4Q A;  1NB5 I;  3HJM A;  2E2T A;  5LD0 A;  4BTW A;  2Z9S A;  5KP1 A;  5CRH A;  3DRN A;  1F3A A;  1STD A;  3I0Y A;  3RHC A;  2H1D A;  2CFK A;  2F86 B;  1BUJ A;  1F9M A;  4BIR A;  4WR4 A;  1X9W B;  1TRU A;  5DDL A;  2E7P A;  3KTB A;  5BMU A;  3TJF A;  1T5Y A;  5IG3 A;  1BAN A;  3LYG A;  4KW6 A;  3UVT A;  3O8Y A;  3JUM A;  1N2A A;  3GA4 A;  5INY A;  1RN1 A;  3DYR A;  2FWH A;  4TN8 A;  2WOH A;  2N5A A;  1JRQ A;  1UGH I;  3FRC A;  1NSW A;  3U6V A;  2GVP A;  3WD6 A;  1FHE A;  2QA1 A;  4DVC A;  1FGQ A;  2YV7 A;  1J0F A;  4EW5 A;  2H75 A;  3QMX A;  5CK6 A;  1KTE A;  4G0K A;  4I2U A;  1JKG B;  5A0O B;  1GOV A;  3HVS A;  1M2D A;  3NUV A;  4EDZ A;  3ED3 A;  1T00 A;  1W00 A;  2XF3 A;  1G7O A;  1PL1 A;  3TRQ A;  5JPU A;  2BTO T;  4WET A;  2H66 A;  1ML6 A;  3FH1 A;  1N8J A;  1BVI A;  1SD9 A;  1I3F A;  4O3V A;  1BG5 A;  3PGB A;  3CYN A;  3UBK A;  3DEX A;  2FLS A;  3IA1 A;  2L59 A;  2CT6 A;  2MC8 A;  1EOH A;  3BCI A;  3VK9 A;  1K9M 4;  3FYG A;  1S72 3;  4J5G A;  3I6A A;  4FYC A;  1WOU A;  3H51 A;  4MDC A;  4MMM A;  3HOH A;  2FXT A;  4CHS A;  2LNS A;  5CXO A;  1PA3 A;  3SOA A;  1B4P A;  1F6M C;  3ERF A;  3DGN A;  2GU1 A;  1UUW B;  1O85 A;  2Z76 A;  4WYK A;  4GWR A;  1R4C A;  3MNG A;  1HNB A;  4MPF A;  4PEJ A;  1RGH A;  1BED A;  3GX0 A;  4I5Q A;  1JJ2 2;  1ZMA A;  4NHW A;  3TCO A;  2I81 A;  2CKF B;  2F3M A;  4XS4 B;  3X3Z A;  1IYH A;  4Q5Q A;  3DZL A;  3PGT A;  3MIX A;  4AJ7 A;  1U5O A;  3M1G A;  4KSM A;  4J56 E;  1U3A A;  2B1L A;  4KCA A;  2B7J A;  1OHP A;  3DVX A;  4HJ2 A;  2VM2 A;  2V1L A;  3FEU A;  1A90 A;  3JVC A;  5BVB A;  6GSP A;  5IG5 A;  1BYE A;  2MBT A;  3HJP A;  1BRK A;  3P2A A;  4ZBB A;  2Q07 A;  2MBS A;  1MNL A;  2PGT A;  1VQQ A;  1V57 A;  3CCQ 3;  1Z6M A;  4LMW A;  2XPE A;  4PNG A;  4FR9 A;  1FGR A;  3FHK A;  4KB3 A;  7GSP A;  4GCI A;  2CVB A;  4MEI A;  5A4V A;  2N5B A;  3KM6 A;  2C4B A;  4HZ4 A;  2MMN A;  4ML1 A;  5ECR B;  4WF5 A;  3DMC A;  3GRD A;  1NJI 4;  2GT6 A;  5KN0 A;  2BHM A;  4MH3 A;  4CDL A;  4PXO A;  4Q5N A;  3HKR A;  2C80 A;  2RUE A;  1DET A;  2IUJ A;  3C73 A;  3F8U A;  1ZYP A;  1R7H A;  2A15 A;  4ZBA A;  1MOL A;  1A2M A;  2V6K A;  1M9A A;  4XS6 A;  1XOB A;  1XVW A;  2HT9 A;  1FGM A;  3QFB C;  1NB3 I;  5JCG A;  2P31 A;  3EU3 A;  4WR5 A;  1WPI A;  4FYB A;  4WP5 A;  2VL2 A;  4MJE A;  4XIH A;  5CRD A;  3VWU A;  2CQ9 A;  5ELA A;  1KD1 4;  4RNT A;  3CCU 3;  1NM3 A;  2H73 A;  3WYW A;  2ZA4 A;  2FNQ A;  1F3B A;  5ECS A;  1WMN A;  3K63 A;  2FA4 A;  4G19 A;  2OTJ 3;  1VQ6 3;  1FW1 A;  2XPD A;  4X4J A;  2QGU A;  1AUC A;  3SXX A;  2E2U A;  1VQN 3;  3DWV A;  4F0C A;  5DAL A;  4PUA A;  3GWR A;  2OAC A;  3UOM A;  3IE3 A;  4XS4 A;  2F9S A;  3X41 A;  4TX4 A;  4XBY A;  2CX1 A;  5ECP B;  2R4V A;  1XWA A;  4POM A;  2WGO A;  1A8L A;  5I97 A;  4MZB A;  1IDP A;  1W4N A;  4TRX A;  5GAP D;  1NO3 A;  1TU7 A;  1L5G B;  2OBK A;  1KEB A;  3NX0 A;  2WRT A;  4FCM A;  5EVO A;  1XIY A;  4L8P A;  4L5L A;  4GST A;  2IY2 A;  3K9M C;  2PWJ A;  3TKS C;  2AB6 A;  1BX9 A;  4AF2 A;  1CEW I;  2H19 A;  2HLS A;  1RN7 A;  2NBS A;  4HEA 2;  2DSA A;  1QVF 2;  1TRW A;  3LXT A;  1IV9 A;  2Z77 A;  4AKZ A;  2XBQ A;  3GTU B;  2QIY A;  1EG9 B;  1VQK 3;  4D73 B;  1O7P B;  3D5J A;  3GKX A;  4RUV A;  1G02 A;  4TR3 A;  4YH2 A;  3PCR A;  4F9Z A;  2JU5 A;  3G7I A;  5DVB A;  2LQQ A;  4LL4 B;  3GN3 A;  1GD4 A;  3TGZ A;  2O87 A;  3P7X A;  3AGN A;  3FKF A;  3CRU A;  3IR4 A;  3DY5 A;  3A2V A;  3N54 B;  5D81 A;  2AAW A;  2YNX A;  3HZ8 A;  1IYI A;  4HM4 B;  3LXU X;  3SBC A;  5KEJ A;  4MZC A;  1Q42 A;  2KLX A;  2PPT A;  1O7W B;  1D6U A;  4R4K A;  3PZW A;  4OCE A;  4IHU A;  2CW9 A;  1W2Z A;  2ML5 A;  2WGR A;  3SOY A;  4HAA A;  2A2S A;  4KFD A;  5LC6 A;  4HSC X;  2AYT A;  1RLS A;  1VRS D;  3NV0 B;  2V41 A;  2D2Z A;  2B3S A;  2X8G A;  1GMQ A;  3D4M A;  5EVH A;  2LRN A;  1BOX A;  2F5M A;  4KA0 A;  3L9V A;  2L1S A;  1W6G A;  5H5S A;  1J2B A;  2YX9 A;  1NWW A;  2M46 A;  1UDI I;  2HMO B;  1I8V A;  1X1X A;  3EB8 A;  2L57 A;  1XW6 A;  3LQ7 A;  1MDK A;  4JU5 A;  1EGR A;  5ECH B;  3HII A;  4G10 A;  2W56 B;  4E8E A;  1SU9 A;  3AHW A;  1FGT A;  2VD0 A;  2VAF A;  4N6T A;  2DJ2 A;  1EGO A;  1VF4 A;  2WB9 A;  3S27 A;  4FQU A;  5CF1 A;  5F06 A;  4KFE A;  4GRF A;  3IXR A;  1V98 A;  2GGT A;  5EEO A;  1DSB A;  2FWF A;  1Z7R A;  2B6M A;  4YKF A;  2YCD A;  3WMD A;  1NDO B;  1AAZ A;  4JBB A;  2P5R A;  1RDS A;  1Y4K A;  2N5F A;  2IMD A;  1LRA A;  3M8N A;  1ZO2 A;  3H8Q A;  1YHQ 3;  4HOJ A;  1K0O A;  1RGL A;  3TOT A;  9GSS A;  1HNA A;  4EF0 A;  2IMF A;  2NPB A;  3RGR A;  2JZT A;  2A2P A;  4TR0 A;  2X99 A;  3GTU A;  4LZI A;  4OK0 A;  5HFG A;  1DVC A;  1U8C B;  1GTU A;  2IFQ B;  2F4Y A;  2QKE A;  4AJ8 A;  5DJL A;  5DCG A;  3WA2 X;  1BRG A;  1PYL A;  1ULI B;  5JWQ B;  2W2C A;  3NHX A;  2GZY A;  2IMK A;  1JNQ A;  3U97 A;  2HNL A;  4XDV A;  1J9B A;  2ZUP A;  3APS A;  3CCS 3;  3VPQ A;  2CHC A;  2YP6 A;  2HI7 A;  3WR2 A;  4PNF A;  1MEK A;  3Q2P A;  2OAD A;  2C0G A;  1X1U A;  3HY2 A;  3IJE B;  2EIO A;  1HNC A;  4OFM A;  2XEP A;  4KFF A;  4KND A;  4N10 A;  1H75 A;  1B3S A;  1LNI A;  3VPT A;  4POL A;  1RCL A;  3VWX A;  3A5E A;  3A5I A;  4N6O B;  3FZ5 A;  4FH8 A;  3FW2 A;  3V98 A;  3QD9 A;  4FYU A;  2WJU A;  14GS A;  4ZIJ A;  1JBS A;  1E97 A;  2GS3 A;  3PR8 A;  3MG2 A;  1A23 A;  4NV2 A;  2B5E A;  3X40 A;  4CY8 A;  3FR3 A;  1F2E A;  4KVH A;  2W6J H;  2CG1 A;  2VCQ A;  4MA9 A;  2CK3 H;  2INX A;  3FK8 A;  2VO4 A;  1F37 A;  2IWT A;  2REM A;  2VLT A;  3IHQ A;  4BVX B;  1QAF A;  2AUV A;  3RDW A;  3QAV A;  3J7Y d;  4CY6 A;  1K0B A;  2P09 A;  1WE0 A;  1G0T A;  1PFO A;  1GSF A;  1QGV A;  1DE2 A;  1VQL 3;  1QFN A;  3EF8 A;  3GSS A;  5RNT A;  3L4N A;  3HVX A;  1TJD A;  2QA4 3;  3QDN A;  1EP8 A;  1I3I A;  4LGQ A;  3KZT A;  4L0U A;  5B6M A;  3IC4 A;  4Z2T A;  2HZE B;  1Q9E A;  3V92 A;  5J9C A;  1I9D A;  1CYV A;  2WUL A;  4KT3 B;  3VUR A;  1UI8 A;  2KRT A;  2ALB A;  1B9Y C;  3EMX A;  3NBR A;  5TGN A;  4MMY B;  3DGQ A;  4ILF A;  2R3X A;  3H79 A;  4Q53 A;  5HFI A;  2Y73 A;  4ZB9 A;  1FOH A;  1SJI A;  3QPM A;  3EIN A;  5JCU A;  1XCC A;  3WOF B;  4KDX A;  4EIP A;  2AV4 A;  1FOV A;  3VFI A;  3FZW A;  2IMI A;  19GS A;  5STD A;  3CCJ 3;  4IN0 A;  1BSE A;  2LEG A;  4RQX A;  3VWV A;  4O02 B;  1ZZY A;  2E2G A;  2NTO A;  5KOX A;  2VIM A;  5EPF A;  1X5E A;  3F4T A;  1VQ4 3;  3WHO A;  4HQZ A;  5IMA A;  4LMI A;  3EN1 B;  6GSX A;  4QL9 A;  2XC2 A;  1HYU A;  3FKA A;  2DML A;  4WXT A;  1UCJ A;  4GSP A;  3DVW A;  3G8Z A;  3GZB A;  1QAL A;  3NOF A;  2J9H A;  3J7Y b;  1U6T A;  1EEJ A;  2X4A A;  3C7M A;  2HSY A;  2CWT A;  3D22 A;  1AQZ A;  4Q5R A;  3D3L A;  1VQO 3;  3HYP A;  2XFT A;  4NPB A;  4PUF C;  2YJH A;  2BMX A;  2LYX A;  2Z7A A;  2GZZ A;  4ACS A;  2C3N A;  2K0M A;  1BRS A;  1XBS A;  5L71 A;  1SYR A;  3JUO A;  4MP4 A;  2QSI A;  4K5R A;  1RCK A;  1ILO A;  3IK9 A;  3L78 A;  2L4C A;  4WYK B;  4ML6 A;  1IU7 A;  5ECK B;  2AAD A;  5DQS A;  4QQ7 A;  3GZR A;  1PKW A;  3LZA A;  1JB4 A;  2KAA A;  5AIG A;  2HSM A;  2H0I A;  1B20 A;  4OFN A;  1U3I A;  4HM8 B;  1SIH A;  1NU3 A;  1RW1 A;  3C71 A;  1DMM A;  2L5L A;  2IL3 A;  2DJ1 A;  1GOY A;  3ZLP A;  1OPY A;  5D9T A;  2R5G A;  5AIV A;  4TW5 A;  1WWJ A;  2I3Y A;  5ECM B;  1GUK A;  4MZW A;  1T2H A;  1YF0 A;  3UIW A;  4MAB A;  1DUG A;  1ON4 A;  4JRR A;  1MWT A;  1LVN A;  4BTX A;  3FMW A;  5G31 A;  4XTS A;  4R9L A;  3F9U A;  4J2F A;  3F4R A;  4TR4 A;  3OX9 A;  3GRX A;  4R1K A;  3LOR A;  4R9K A;  2GTU A;  1K0A A;  2KHP A;  2XHF A;  3MYT A;  4ZL7 A;  2TIR A;  4TXO B;  3EUR A;  3HK4 A;  3ZML A;  2LQO A;  3OWY A;  2E2M A;  4K7N A;  3CBU A;  4ZM8 A;  1BU4 A;  1OAZ A;  1TRP A;  2UGI A;  1W2B 2;  2WZ9 A;  4I4K A;  1MGW A;  1W5Z A;  3KSP A;  4HS1 A;  2IPA A;  2FGT A;  1QJG A;  3EC3 A;  5G2Z A;  5HR3 A;  4U13 A;  4Z7X A;  5IO0 A;  5AIH A;  4F0B A;  1GTA A;  3EYT A;  1A2V A;  3CTF A;  5HGR A;  2I1U A;  4XBT A;  3RBT A;  3QOU A;  1TP9 A;  1SL1 B;  4STD A;  4IIA A;  2IME A;  4JE1 A;  4K9Z A;  3S9F A;  2HMN B;  4K6X A;  3HIG A;  2FCH A;  1HKX A;  1AY7 A;  2O7K A;  3KKG A;  4N30 A;  3TUE A;  3IPZ A;  2SAR A;  1QAK A;  2MZC A;  1FVK A;  1OC3 A;  1K28 A;  3DM8 A;  3QAG A;  3LEF A;  1A2K A;  1TK8 B;  3KTL A;  1GWC A;  2VD1 A;  1YF1 A;  2XR8 B;  3D4A A;  4TXV A;  5CO3 A;  2OOV A;  3FR9 A;  3FY7 A;  4GQC A;  4O5U A;  2EC4 A;  1IQX A;  5ABR A;  3RPP A;  1M7T A;  1UC7 A;  2HXK A;  4L5O A;  5ECL B;  5IEP A;  1H4O A;  1VQ7 3;  4EE0 A;  1IK3 A;  2V1M A;  3SVA A;  5EL8 A;  4RZM A;  3UMA A;  4CDO A;  4LYL B;  1LU4 A;  3TJB A;  2BMO B;  5D9V A;  3LTD A;  2BO9 B;  1X9S B;  1SII A;  2IIY A;  2O8V B;  1KBN A;  1K41 A;  3CPW 2;  3QAW A;  3O76 A;  3KCH A;  1SJW A;  2LNT A;  4K7O A;  4LL1 B;  2VL9 A;  4JR4 A;  2VUP A;  4BTY A;  3KEB A;  6RNT A;  1YEX A;  2A2R A;  2YN1 A;  1KC8 4;  1YJW 3;  1NHO A;  4KDU A;  3APQ A;  3VLN A;  3IPT A;  3F3R A;  2OCT A;  3EBY A;  3L9S A;  1OCV A;  3G0K A;  3ZL5 A;  3N9H A;  3CCR 3;  1S3D A;  1W89 A;  5CF2 A;  1CQG A;  3DGO A;  1TRV A;  4MMZ B;  2GQK A;  2L6C A;  3Q3F A;  1HD2 A;  4ID0 A;  4XS1 A;  4TXO A;  1I2G A;  3DH2 A;  1W6Y A;  3IAM 2;  1GYB A;  3MHE A;  2ZCT A;  4MF6 A;  3RDE A;  4IJ3 A;  4ECC A;  1MTC A;  3GKM A;  3A2X A;  1I70 A;  1JZO A;  3ZVJ D;  4I2T A;  3GUR A;  3C1S A;  1B2X A;  2CA8 A;  2MF7 A;  3CXG A;  1N5P A;  3FG3 A;  1OH0 A;  1VGL A;  3LFL A;  5C04 A;  4L0W A;  4RI6 A;  7GSS A;  2H0G A;  4HUA A;  3CMI A;  3X3X A;  1XW5 A;  2GBW B;  3F6D A;  1ZGX A;  5AEW B;  3EQQ B;  1GSY A;  2RUF A;  5E59 A;  1TTZ A;  3NV0 A;  5IIZ A;  1Y25 A;  1TOF A;  2C10 A;  4TR1 B;  3UL3 A;  2BT3 A;  5CRG A;  2K8S A;  1AIU A;  3GFK A;  4FMD A;  1MGR A;  3A76 A;  1BNI A;  2CX0 A;  2RNT A;  2RSX A;  2YFJ B;  1A0R P;  1AQW A;  1WMO A;  1O73 A;  3M9J A;  3R3E A;  1ZYE A;  2W56 A;  2AHE A;  1RQM A;  1WQL B;  3S29 A;  3K5T A;  1FB0 A;  4RNZ A;  3EX9 A;  3E0U A;  3ZIV A;  2KF5 A;  3KMN A;  1VQM 3;  3IDV A;  4IW9 A;  4ZL9 A;  3IK7 A;  3PXM A;  1JZR A;  3WA3 A;  5A4U A;  5G5F A;  1FGO A;  3F3Q A;  4ECJ A;  3A3T A;  3BOA A;  3F4S A;  3G9B A;  1GTB A;  4WBJ A;  1NHY A;  3T8N A;  2P05 A;  3D6I A;  3VGN A;  4EDY A;  1WIK A;  4EIQ A;  1X0R A;  2P0G A;  1O8X A;  12GS A;  1GH2 A;  3US3 A;  1RK4 A;  2LST A;  1RGF A;  4EXJ A;  1WRY A;  5CP1 A;  3L0R A;  3DXB A;  4NMU A;  5CAX A;  1AQV A;  1BRI A;  4OWY A;  2HRF A;  3HD5 A;  4GXZ A;  4WHA A;  5KN3 A;  4AGS A;  3VF1 A;  3SLU A;  1M2A A;  4L7K A;  5C00 A;  3G16 A;  3GUS A;  2L6D A;  1IV7 A;  1B48 A;  2CWU A;  3KXO A;  2L4V A;  2YWO A;  2KP1 A;  1Q4J A;  1R5P A;  3CSJ A;  5M19 A;  3I69 A;  1TI3 A;  4O92 A;  2DJJ A;  2K18 A;  1SD8 A;  2GSQ A;  4JED A;  1PL2 A;  1AR0 A;  3ROB A;  5G5E A;  4ZIL A;  2RM5 A;  4J57 E;  5IER A;  4RBN A;  3TRP A;  1BNE A;  3KFQ C;  1XXU A;  1FA3 A;  1E2Y A;  2O89 A;  3BU4 A;  3Q19 A;  1E6B A;  1Q7H A;  4TVE A;  1W01 A;  3J7Y k;  3OV4 A;  4X2O A;  2OA7 A;  1AC1 A;  3FF0 A;  4O2H A;  4MF7 A;  4BVY A;  1PSQ A;  5JCW A;  5IF6 A;  4WBR D;  4V1A g;  4ICY A;  1QMV A;  2FNO A;  1Z7P A;  3EHC A;  3VI5 A;  4HM0 B;  2LJR A;  1WJK A;  2X49 A;  4QWT A;  4NXI A;  1TK5 B;  1GLQ A;  1O81 A;  5A4W A;  1RNT A;  3QR6 A;  1FUW A;  3MG3 A;  2E2V A;  2A4H A;  1O7M B;  2EIR A;  2ZHX B;  1K3Y A;  3PH9 A;  1XWC A;  4DKI A;  3JUP A;  4HZ9 B;  2FUG 2;  1XWB A;  6GST A;  3ZTL A;  2F5W A;  3F7S A;  1Z6N A;  1GSP A;  4FIW A;  3I9V 2;  3FG4 A;  3CC7 3;  6GSU A;  1LOV A;  1SPU A;  1XZO A;  2DJK A;  3ALA A;  3EBT A;  2R41 A;  1PX6 A;  2FWE A;  4PQ1 A;  1GSD A;  4EYC A;  3P8W A;  3BLZ A;  1PGT A;  2B5Y A;  2Y74 A;  1AW9 A;  2F8F A;  1MWS A;  4WKW A;  5D93 A;  1BAY A;  4Z2R A;  4E8H A;  1HYF A;  5H5Q A;  3AMO A;  2XH9 A;  3F14 A;  3MWZ A;  4MNN A;  2VL2 C;  3WT2 A;  3GL3 A;  1OUN A;  1EV4 A;  3O6T A;  2CG0 A;  3IMA B;  2UUG C;  8CHO A;  1BRN L;  5HOH A;  1TI1 A;  5HR0 A;  3G6E 3;  4F82 A;  2K9F A;  3MDK A;  2VOC A;  3DD3 A;  2F98 A;  3AGO A;  2P38 A;  2H76 A;  1W02 A;  2BMR B;  1RMS A;  4G1M B;  3M3M A;  4IVF A;  3U5R E;  1IVV A;  5IMV A;  1QUW A;  3CU3 A;  2GQM A;  1YJ9 3;  4K0N A;  1SJ6 A;  2FWG A;  1AV4 A;  1MWU A;  1X9M B;  2CFW A;  3E3E A;  5FGO A;  1Z1S A;  1ZYQ B;  4O5Q A;  4YAV A;  1E3R A;  1WP0 A;  2WDU A;  4XCS A;  2YFI B;  1PY3 A;  2VL3 A;  1GY6 A;  1FB6 A;  3FCS B;  1CQS A;  4FMA A;  2M7O A;  5J3R A;  1IVX A;  4WF4 A;  4XBX A;  2JQ5 A;  2LQV A;  4LMV A;  1XFL A;  3EC9 A;  3TDG A;  3GYK A;  5DQY A;  5EY6 A;  1U87 A;  2H01 A;  3GST A;  1GMR A;  2BNG A;  4BVY B;  3JCM L;  5ELJ A;  4BA7 A;  1FO5 A;  1A8Y A;  4MJD A;  4PQI A;  2VCW A;  4OVM A;  1JBT A;  4NRE A;  3WGD A;  4ZXG A;  2X8C A;  4HJM A;  2DKI A;  3HJO A;  3SX1 A;  4F2I A;  3E9J B;  1O7N B;  4YAP A;  2EIQ A;  1ZX2 A;  3D5I A;  1JN5 A;  2HMM B;  1YDK A;  2PNC A;  5KOW A;  1I2F A;  1GNW A;  2YWN A;  4X1U A;  1QQ2 A;  2I4A A;  4LSO A;  2H30 A;  3UBL A;  3LTA A;  2LUS A;  4H61 A;  3H4K A;  1X5C A;  2WS2 A;  2TRX A;  1A67 A;  2VCZ A;  3STD A;  2CX3 A;  1PRX A;  2I9H A;  3B4P A;  3FG1 A;  4K1F A;  3LYK A;  4HU9 A;  1CH0 A;  5G1L A;  4KSO A;  3M9K A;  1PMT A;  4BL7 B;  1ST9 A;  2R0P A;  4OUQ A;  2LKU A;  5LNK e;  1M9B A;  3LG6 A;  1D6Y A;  3AMO B;  5FWG A;  2CVK A;  4BPY A;  1RHL A;  2G2Q A;  1YGE A;  2GEY A;  1LJR A;  2JAC A;  2STD A;  1X1Y A;  1R4W A;  1B27 A;  4HM7 B;  3QK9 A;  1B4Q A;  4OMV A;  1ACV A;  4XHM A;  2B7K A;  4V2N A;  5IMZ A;  4AEQ A;  5AI1 A;  3C1R A;  1BRH A;  1TW9 A;  4K1V A;  3GAX A;  2OE3 A;  1ZS7 A;  2DMM A;  2PVO C;  3Q6O A;  2W0Q A;  3APO A;  2YV9 A;  1NW2 A;  3VI7 A;  4X0X A;  1YZX A;  4O7H A;  3NBB A;  3O3T A;  3UAR A;  1T4Y A;  3NM7 A;  2H1B A;  3Q1C A;  3GMF A;  22GS A;  1PX7 A;  5LC7 A;  1MDJ A;  1GSS A;  3UAP A;  3LH4 A;  3FZ4 A;  4KF9 A;  3JUQ A;  3F9S A;  1LBK A;  3M0F A;  4KUN A;  1GUH A;  2CFD A;  2LS5 A;  3DUK A;  2HOH A;  1JZW A;  3GX8 A;  3CSI A;  1N5H A;  4HM5 B;  1K73 4;  5J4U A;  1M1K 4;  4JZQ A;  1BSA A;  3WGX A;  3KII A;  1Q40 B;  1DVD A;  1A24 A;  3LGC A;  2VLV A;  3NIV A;  3VSY A;  1YJN 3;  2I9W A;  4EUY A;  1DMN A;  3CPO A;  3OW2 2;  1YI2 3;  1O7H B;  1VZZ A;  1JN5 B;  1GTI A;  1O7G B;  2K6V A;  3KE7 A;  4MLY A;  1TIJ A;  3LOY A;  3KSE D;  1YKA A;  2IMJ A;  3HX8 A;  4BL3 A;  2CIU A;  1B2Z A;  2JAD A;  3TJJ A;  5JWO B;  3G4S 3;  3H1N A;  1K0N A;  3GZX B;  1GLP A;  2CZ3 A;  1STF I;  2XGN A;  1ROV A;  5AGY A;  2KUC A;  1FG4 A;  1R26 A;  2G0F A;  5JPP A;  2HMK B;  1GUM A;  1GMP A;  1USB A;  1EA2 A;  1IVU A;  5F0G A;  5KP4 A;  1ISK A;  3ZFZ A;  3KD0 A;  3CC2 3;  1RRH A;  5J5N A;  2B24 B;  1ULJ B;  4FCZ A;  1QVG 2;  1IQY A;  1GY7 A;  4MPG A;  5AIX A;  3RGA A;  2TRC P;  2YZH A;  1US1 A;  3WDG B;  3CSH A;  1PD2 1;  3Q74 A;  1OF5 A;  3HI7 A;  2W9P A;  1XWG A;  1M90 4;  3M8C A;  3EMP A;  2PN8 A;  4K2X A;  2JL4 A;  1DYU A;  3N9J A;  3TOU A;  4WWU C;  2H70 A;  3KJY A;  2YFL B;  1GSQ A;  3EU4 A;  1K3O A;  1TRS A;  1OGX A;  1ABA A;  2H74 A;  2QA2 A;  2VLU A;  2PZV A;  4EL1 A;  1JHB A;  4ECI A;  1MDI A;  3OR5 A;  3URP A;  2PU9 C;  1G6Y A;  1E3V A;  1A2L A;  1UN2 A;  1QXH A;  3F0I A;  3EPT A;  1FW7 A;  3R2Q A;  3ZFL A;  1WTH A;  1YIT 3;  3DKS A;  3LJR A;  3NXJ A;  2GXF A;  3MSZ A;  4PQH A;  3EN8 A;  3NBJ A;  2LV3 A;  2KCD A;  1PN9 A;  2GDR A;  2ML6 A;  4RQR A;  2OTL 3;  1SJZ A;  5IG0 A;  2H6Z A;  1VQ5 3;  5IOW A;  3OWU A;  4IT7 A;  3HVN A;  4GSS A;  1BJX A;  2NDO A;  4V2L A;  5D9X A;  3GHA A;  2M80 A;  3U1W A;  4IS0 A;  1EQK A;  3K8N A;  1T4Z A;  2CAQ A;  4GF0 A;  3HZP A;  5IOX A;  4GQF A;  1I0X A;  1Q40 A;  2HYX A;  13GS A;  4GSN A;  3F63 A;  1TU5 A;  1MWR A;  1GSU A;  5GAN D;  1LQM B;  3HZ4 A;  3DGM A;  2XBI A;  5BU4 A;  3WOE B;  4HQS A;  4HVN A;  4KCE A;  4HI7 A;  1BSD A;  1M2B A;  1EV9 A;  3IC8 A;  3KMO A;  4NAX A;  4TR1 A;  3K0Z A;  2E0Q A;  5HR1 A;  3PPU A;  2MMO A;  3HVV A;  1RGK A;  3GL5 A;  2F99 A;  1O7U A;  3LTB A;  3DML A;  3IRA A;  2JZR A;  3BCK A;  4LA1 A;  3CXC 2;  1YEP A;  2DJ0 A;  4DSS A;  4Z2U A;  3SWL A;  1V2A A;  1M3J A;  2OE0 A;  2BJX A;  4EVM A;  2CVD A;  4HBR A;  4KDY A;  3D0Z A;  5BRT A;  1QMA A;  2FY6 A;  2X64 A;  4IP6 A;  3MSO A;  2RGQ A;  2IJY A;  1G7E A;  4IQA A;  2R37 A;  4TOP A;  1TDI A;  1Q7Y 4;  1S3A A;  1TXX A;  3UVH A;  1OKD A;  5GST A;  3ZFB A;  2VCX A;  2H72 A;  2ZNM A;  5DAK A;  2LRC A;  5CRW A;  3AY8 A;  5ECO B;  1CQH A;  5B6N A;  4RI7 A;  3RHB A;  2OOV C;  10GS A;  1BNR A;  1RTU A;  3FF2 A;  3N8B A;  2JZS A;  4XRD A;  4I8B A;  5ID2 B;  4N6U A;  1KWI A;  1KSI A;  1M1X B;  2QC7 A;  4KAE A;  1DBY A;  2LTK A;  2SBL A;  1HU9 A;  4Q5F A;  1T8E B;  2D1W A;  4HM3 B;  3CQF A;  3GH6 A;  3TKQ A;  3D21 A;  1FUT A;  1YVB I;  6GSS A;  4KE3 A;  2UX0 A;  4HM6 B;  4GTU A;  3KP8 A;  1TP6 A;  1ROA A;  4K8M A;  3LTC A;  2P5Q A;  1IQ8 A;  1AVL A;  2HMJ B;  1K3L A;  5FW5 A;  1EEM A;  3LT8 A;  2UZ8 A;  1YQ1 A;  1FAA A;  1B21 A;  3BB9 A;  1DE1 A;  1KQS 2;  5A5K A;  1JV2 B;  6STD A;  3GIX A;  5AN1 A;  1G96 A;  1T3B A;  3HHV A;  3I43 A;  2GBX B;  2IN3 A;  2R0C A;  1RSN A;  5D73 A;  3GKK A;  3FLJ A;  5J9B A;  1PFP A;  3EE1 A;  5AEU B;  4EBG A;  4K1U A;  2KP2 A;  3KH7 A;  3G7Y A;  4POB A;  1OC9 A;  4PUR A;  3EE2 A;  1GS3 A;  5IMF A;  4WFO A;  2GLR A;  2PER A;  2ZDJ A;  3LWA A;  2BU4 A;  4EKZ A;  3DGL A;  1V40 A;  3S5C A;  4FCJ A;  3BND A;  2DKH A;  1F8N A;  2KOK A;  3ERG A;  4X43 A;  1SK2 A;  3IOS A;  2ES7 A;  1SL2 B;  1ERV A;  4DSS B;  8GSS A;  1WMP A;  1B8X A;  1BUQ A;  1T1V A;  3CCL 3;  6GSY A;  1GRX A;  4HZB B;  1BRJ A;  2R4I A;  4CCV A;  4IKH A;  3ME7 A;  3TRX A;  3PCS A;  1SYX A;  3E99 A;  2LJA A;  3FZA A;  2K3D A;  4HZ2 A;  3LML A;  1LOW A;  4N0V A;  3CNX A;  1G6W A;  4BIK A;  2ZL8 A;  3DXO A;  1JLW A;  2C4J A;  4WEY A;  3F8X A;  1I2E A;  4K0G A;  5DAK B;  2M72 A;  1UW1 A;  4FMC A;  2CFL A;  3D9R A;  5FHI A;  2RBI A;  4IEL A;  3ZRE A;  2KF3 A;  2R2J A;  5D9W A;  5B8A A;  2VCV A;  2CAI A;  4MMX B;  2F8A A;  1JB5 A;  1TKD B;  5JBS A;  4DSQ A;  1GY5 A;  2GSP A;  4MF5 A;  2HFD A;  1EKM A;  2H8L A;  4LEH A;  1M0U A;  4V2M A;  2YPM A;  1UGI A;  1OE7 A;  3S28 A;  3SED A;  1TTO A;  4J5K A;  5ECN B;  4N6N B;  1FYS A;  3V99 A;  2W9Q A;  3LW9 A;  3DGY A;  1ERU A;  1ZL9 A;  3QRD A;  3D79 A;  4GL6 A;  2C3Q A;  3A2W A;  4HU7 A;  2YWI A;  4HM1 B;  1XG8 A;  3S67 A;  5DJM A;  1URM A;  3MWH A;  2XGL A;  2YOI A;  1RGE A;  1MD4 A;  4L8E A;  3WGE A;  3UB1 A;  3CD6 3;  2HSH A;  1JBR A;  1BSB A;  3ZVJ A;  3TKR A;  4N6M A;  1YIJ 3;  1DMQ A;  3I56 3;  2BMQ B;  3ZG0 A;  3VWW A;  2B1X B;  2GST A;  4O5R A;  3TJG A;  1OC9 B;  1O8W A;  2C0E A;  1V58 A;  4ORL A;  2LRT A;  2OJL A;  1TU8 A;  2HZF A;  2IYJ A;  3GSP A;  2ON5 A;  2CV4 A;  4V1A p;  2RFR A;  2DC5 A;  3KH9 A;  5B8B A;  3LXZ A;  4LLR A;  2D42 A;  5JWR B;  1EUI C;  1ZYN A;  5AIS A;  3PS8 A;  5KN1 A;  1IT8 A;  3A5W A;  2OQE C;  4BL2 A;  2VCT A;  4K90 B;  1EWX A;  1S5A A;  5GSP A;  3IHG A;  3IV4 A;  8RNT A;  4YQU A;  3JUN A;  4EXR A;  5E4W A;  1N8Q A;  4HDE A;  2RLI A;  4MH2 A;  2C3T A;  1JB2 A;  2XFS A;  4BL7 A;  1OE8 A;  1PU4 A;  2DLX A;  2CH9 A;  4NHF A;  1Q81 4;  2P0X A;  1A2J A;  4KGI A;  4OO5 A;  5ECI B;  1RJO A;  3F8H A;  4EV2 A;  2FGX A;  4A5P A;  1FUS A;  1N9J A;  1RGC A;  2A4V A;  1UUV B;  3RPN A;  3FSD A;  4N0Z A;  1AXD A;  4J9A A;  1CYU A;  5CLK A;  3BNE A;  3BJ5 A;  3F6F A;  1Q98 A;  5FT3 A;  2R6K A;  1C54 A;  1W6C A;  3P90 A;  3UJM A;  2DIZ A;  6GSV A;  3NQZ A;  6GSW A;  1C72 A;  1NNV A;  3OXA A;  1OC8 A;  1M9G A;  2R0G A;  3IAS 2;  3ZIT A;  2HRK A;  3TJK A;  1SAR A;  1S3C A;  1XW9 A;  2JSZ A;  4I6X A;  1AVK A;  1UA5 A;  4F03 A;  1VF2 A;  3UNL A;  3HDC A;  3HA9 A;  2PUK C;  1Q82 4;  4OO4 A;  1X1W A;  2H1A A;  3FGY A;  3QFA C;  3GZY B;  4BU4 A;  4HJL B;  5D96 A;  3ZG5 A;  4OCF A;  5IQY A;  1K0C A;  1O6J A;  1LOX A;  5DRV A;  5HFK A;  1VQ8 3;  1XPV A;  5IPH A;  1ASK A;  2OBI A;  4BWS A;  1B2S A;  1BNG A;  1ZOF A;  1A2P A;  1UVZ A;  5CRE A;  3BNC A;  2FA8 A;  2QGV A;  2YAN A;  4HM2 B;  3GH9 A;  1ERW A;  4IP1 A;  3RAZ A;  1TK0 B;  3ZRD A;  4QL7 A;  4EO3 A;  1OHO A;  3IBH A;  1WNH A;  20GS A;  1BNF A;  3GKN A;  3X42 A;  1TFK A;  2GEX A;  4FO5 A;  5COH A;  2MMA A;  3BNB A;  3B7C A;  4RNY A;  1EZK A;  3B4O A;  2C0F A;  3HCZ A;  2RII A;  2GT5 A;  2GZP A;  4ISD A;  1JZD A;  4AKY A;  3CMA 3;  3RNT A;  3BD2 A;  4G9H A;  4PTS A;  4YQV A;  1XOA A;  3AHS A;  4USS A;  3WT1 A;  1HQO A;  1I0V A;  3T8U A;  4N6V 0;  2B5X A;  1YNV X;  4OFT A;  2WGQ A;  2WO0 A;  1XVQ A;  5ELU A;  1T2I A;  5CNW A;  2RM6 A;  1I5G A;  3UL6 A;  2AAE A;  1GP1 A;  1Q86 4;  16GS A;  3MAK A;  4N11 A;  2F56 A;  4G2E A;  2MMZ A;  1S3R A;  3KGK A;  3F40 A;  1YKC A;  3KP9 A;  4JRF A;  1DE3 A;  1OF5 B;  4POK A;  3BBY A;  3FZ9 A;  5IO2 A;  1J08 A;  2AJQ B;  2DJ3 A;  1U88 A;  5M1A A;  1BIR A;  4MCU A;  3G7J A;  4IQ1 A;  1ZCP A;  1PN0 A;  1B2M A;  3ME8 A;  4GLT A;  4PGT A;  4KZ1 A;  5DAL B;  1JLV A;  2WCI A;  4EC0 A;  2RCD A;  5AIF A;  4G0I A;  2YWM A;  5D83 A;  5BIR A;  4K2D A;  1FZU A;  2LJK A;  1RGA A;  3F7X A;  1IT7 A;  5IM9 A;  1B9X C;  3CME 3;  4XB5 A;  1OGZ A;  2GSR A;  1SK1 A;  2V32 A;  2J8X B;  4PX1 A;  1SL0 B;  2CX4 A;  5EQL A;  1D6Z A;  4IPB A;  4ECB A;  1GUL A;  2K8V A;  3LYP A;  2DIY A;  3CNM A;  3ER7 A;  1ERT A;  4KX4 A;  2CWV A;  1IVW A;  5B7C A;  5ELG A;  3ECF A;  4NHZ A;  3MG1 A;  4EC6 A;  4X2H A;  5F05 A;  2IA7 A;  4ZBD A;  3B8L A;  5G1K A;  1BAO A;  4XDW A;  4K7I A;  4D73 A;  2DBC A;  3T0U A;  4O32 A;  1SK0 A;  2HE3 A;  4ULX A;  3W6G A;  3ZMK A;  5D82 A;  3LT9 A;  2HRA A;  5IEN A;  4ZB8 A;  1BSC A;  3I55 3;  2O3O A;  1OVN A;  2H1G A;  1M3I A;  3UEM A;  1GSE A;  4ZB6 A;  2XSH B;  1YY7 A;  2XSO B;  3FR6 A;  3TB2 A;  1YVS A;  5IPG A;  1SEN A;  4CW9 A;  1BGS A;  2X8H A;  4HKV B;  1THO A;  1LNH A;  1VF3 A;  2HRN A;  2F51 A;  4KH7 A;  1UCK A;  5D8I A;  3PIN A;  4MK3 A;  3CC4 3;  4YQM A;  3W8J A;  5DCH A;  5F07 A;  1RRL A;  1XWK A;  2H71 A;  2YJ7 A;  4GHO A;  1AQX A;  4BWQ A;  2Z6B A;  3CTG A;  2IUK A;  1W4V A;  2O9U X;  4ZL8 A;  1K8A 4;  4DEJ A;  2KF4 A;  4K5S A;  2L5O A;  1OYJ A;  5KP3 A;  2BIR A;  2HML B;  4JR6 A;  3W8S A;  4NV5 A;  1N9E A;  1K0D A;  3OWS A;  5HQP A;  3CCV 3;  1W7C A;  4HYZ A;  1VQ9 3;  1LQG C;  4CJN A;  3D5G A;  3CRT A;  1SKS B;  5IMC A;  3TKS E;  3GV1 A;  1X5D A;  3HXS A;  1UCI A;  2VM1 A;  3DIE A;  3MYD A;  4MJB A;  4EV5 A;  1VQP 3;  2OE1 A;  3GNJ A;  2V6O A;  1YJ6 A;  2OKA A;  5ID2 A;  2JSY A;  3X3Y A;  2H6Y A;  2W03 A;  1LOY A;  3C8E A;  4YKG A;  3H93 A;  2WOF A;  5IEO A;  3L0H A;  3ZZX A;  18GS A;  4H3U A;  2C8U A;  4N6L A;  3ZYW A;  2W04 A;  4CPK A;  5AYR B;  1OKT A;  4J8T A;  3N5O A;  5KN2 A;  3H3H A;  1WMJ A;  1A0F A;  3QCP A;  4AJ6 A;  2NVL A;  1EP7 A;  4DSR A;  1UCL A;  3EWL A;  3TKS A;  3K7C A;  4IJI A;  1R4Y A;  4FMB A;  4GB5 A;  1BQ7 A;  1YGW A;  4P3Y B;  1T7P B;  2C1Y A;  3ZIJ A;  4HOH A;  4IBP A;  2C11 A;  1IYY A;  5GZZ B;  1OAC A;  1RNB A;  1Z9H A;  2PVQ A;  2PMT A;  3NZN A;  4K61 A;  1OHS A;  3WOD G;  3NQY A;  4L8O A;  3KCM A;  5ECQ B;  3SYU A;  2IFQ A;  5M18 A;  2GU3 A;  1TUH A;  3G71 3;  1TRQ A;  5GSS A;  1GOU A;  17GS A;  5IMD A;  3Q18 A;  2OQE A;  3EVI A;  1KNG A;  2CFG A;  2H0H A;  5H5R A;  3V1W A;  3MKI A;  1PQN A;  2CZ2 A;  5J41 A;  2H6X A;  2O85 A;  1V9W A;  3ERW A;  1RGG A;  5DBQ A;  1JKG A;  3KIJ A;  2MYG A;  1THX A;  2XRX B;  1N8R 4;  2YZU A;  1C7H A;  1PKZ A;  5LCZ A;  7STD A;  3UJ1 A;  5IW9 A;  4R80 A;  1MD3 A;  1EOG A;  2KXG A;  4MJC A;  3ISO A;  1BNJ A;  4XRA A;  1ZGN A;  4IGJ A;  3TKP A;  4I97 A;  2JDI H;  1RN4 A;  1R5A A;  2K54 A;  3D4T A;  1GD3 A;  5ENU A;  5HR2 A;  4G0L A;  1M99 A;  1HZ1 A;  2GQL A;  5BXQ A;  11GS A;  3NM2 A;  1SKW B;  2GSS A;  1SKR B;  3BIR A;  5F8B A;  2C0D A;  2CC3 A;  5IG4 A;  1K0M A;  5CYY A;  3KZQ A;  2P0M A;  4XM4 A;  5AII A;  1Z5Y E;  4TKY A;  1LXE A;  2V2G A;  3UL5 A;  2J23 A;  4JF8 A;  4O8S A;  5DRE A;  1FVJ A;  5AYS C;  7RNT A;  4MJA A;  1BNS A;  1V74 A;  3CCE 3;  4BVX A;  4NWY A;  3MPH A;  5G2G A;  3EJV A;  2OWP A; 
#chains in the Genus database with same CATH homology
 3L9U A;  1JFU A;  5G30 A;  1GL8 A;  2PBJ A;  2ON7 A;  1VF1 A;  2FHE A;  2FD3 A;  2B1K A;  1QK8 A;  4H86 A;  1Z3E A;  1GNE A;  2HZE A;  1Y6E A;  3LSZ A;  2WFC A;  4OD7 A;  2L4Q A;  3HJM A;  5LD0 A;  2Z9S A;  5CRH A;  3DRN A;  1F3A A;  3RHC A;  2H1D A;  1F9M A;  4WR4 A;  1X9W B;  1TRU A;  5DDL A;  2E7P A;  3KTB A;  5BMU A;  3TJF A;  4KW6 A;  3UVT A;  1N2A A;  3GA4 A;  5INY A;  3DYR A;  2FWH A;  4TN8 A;  2N5A A;  3FRC A;  1NSW A;  3U6V A;  2GVP A;  3WD6 A;  1FHE A;  2QA1 A;  4DVC A;  2YV7 A;  1J0F A;  2H75 A;  3QMX A;  1KTE A;  4G0K A;  4I2U A;  3HVS A;  1M2D A;  4EDZ A;  3ED3 A;  1T00 A;  1G7O A;  1PL1 A;  3TRQ A;  2BTO T;  4WET A;  2H66 A;  1ML6 A;  1N8J A;  1SD9 A;  1BG5 A;  3CYN A;  3UBK A;  3DEX A;  2FLS A;  3IA1 A;  2L59 A;  2CT6 A;  1EOH A;  3BCI A;  3VK9 A;  3FYG A;  3I6A A;  4FYC A;  1WOU A;  4MDC A;  4MMM A;  4CHS A;  2LNS A;  1PA3 A;  1B4P A;  1F6M C;  3ERF A;  1O85 A;  4GWR A;  3MNG A;  1HNB A;  4MPF A;  1BED A;  3GX0 A;  4I5Q A;  1ZMA A;  4NHW A;  3TCO A;  2I81 A;  2F3M A;  4XS4 B;  1IYH A;  4Q5Q A;  3PGT A;  3MIX A;  4AJ7 A;  3M1G A;  4KSM A;  4J56 E;  1U3A A;  2B1L A;  4KCA A;  2B7J A;  3DVX A;  4HJ2 A;  2VM2 A;  3FEU A;  3HJP A;  1BYE A;  2MBT A;  3P2A A;  4ZBB A;  2MBS A;  2PGT A;  1V57 A;  1Z6M A;  4LMW A;  2XPE A;  4PNG A;  3FHK A;  4KB3 A;  4GCI A;  2CVB A;  5A4V A;  2N5B A;  3KM6 A;  4HZ4 A;  2MMN A;  4ML1 A;  5ECR B;  4WF5 A;  2GT6 A;  5KN0 A;  4MH3 A;  4PXO A;  4Q5N A;  3HKR A;  2C80 A;  2RUE A;  3C73 A;  3F8U A;  1ZYP A;  1R7H A;  4ZBA A;  1A2M A;  2V6K A;  1M9A A;  4XS6 A;  1XOB A;  1XVW A;  2HT9 A;  3QFB C;  5JCG A;  2P31 A;  3EU3 A;  4WR5 A;  1WPI A;  4FYB A;  2VL2 A;  4MJE A;  4XIH A;  5CRD A;  3VWU A;  2CQ9 A;  5ELA A;  1NM3 A;  2H73 A;  3WYW A;  1F3B A;  5ECS A;  2FA4 A;  4G19 A;  1FW1 A;  2XPD A;  4X4J A;  1AUC A;  3DWV A;  4F0C A;  5DAL A;  4PUA A;  2OAC A;  3UOM A;  3IE3 A;  4XS4 A;  2F9S A;  5ECP B;  2R4V A;  1XWA A;  4POM A;  1A8L A;  4MZB A;  4TRX A;  5GAP D;  1TU7 A;  2OBK A;  1KEB A;  2WRT A;  5EVO A;  1XIY A;  4L5L A;  4GST A;  2IY2 A;  2PWJ A;  3TKS C;  2AB6 A;  1BX9 A;  4AF2 A;  2H19 A;  2HLS A;  2NBS A;  4HEA 2;  2DSA A;  1TRW A;  3LXT A;  2XBQ A;  3GTU B;  4D73 B;  3D5J A;  3GKX A;  4RUV A;  4TR3 A;  4YH2 A;  4F9Z A;  2JU5 A;  3G7I A;  5DVB A;  4LL4 B;  3TGZ A;  2LQQ A;  3GN3 A;  2O87 A;  3P7X A;  3FKF A;  3CRU A;  3IR4 A;  3A2V A;  2AAW A;  2YNX A;  3HZ8 A;  1IYI A;  3SBC A;  5KEJ A;  4MZC A;  2KLX A;  2PPT A;  4OCE A;  4IHU A;  2WGR A;  2A2S A;  2AYT A;  1VRS D;  2V41 A;  2D2Z A;  2B3S A;  2X8G A;  4KA0 A;  3D4M A;  2LRN A;  3L9V A;  5H5S A;  2M46 A;  2L57 A;  1XW6 A;  3LQ7 A;  1MDK A;  4JU5 A;  1EGR A;  5ECH B;  4G10 A;  4E8E A;  1SU9 A;  2VD0 A;  2VAF A;  2DJ2 A;  1EGO A;  1VF4 A;  2WB9 A;  4FQU A;  5F06 A;  4GRF A;  3IXR A;  1V98 A;  2GGT A;  2FWF A;  1DSB A;  1Z7R A;  2B6M A;  4YKF A;  2YCD A;  1AAZ A;  4JBB A;  2P5R A;  2N5F A;  2IMD A;  3M8N A;  3H8Q A;  4HOJ A;  1K0O A;  3TOT A;  9GSS A;  1HNA A;  4EF0 A;  2IMF A;  2NPB A;  4TR0 A;  2JZT A;  2A2P A;  2X99 A;  3GTU A;  5HFG A;  1GTU A;  2IFQ B;  2QKE A;  4AJ8 A;  5DJL A;  5DCG A;  5JWQ B;  2GZY A;  2IMK A;  2HNL A;  1J9B A;  2ZUP A;  3APS A;  3VPQ A;  2YP6 A;  2HI7 A;  4PNF A;  1MEK A;  2OAD A;  2C0G A;  3HY2 A;  2EIO A;  1HNC A;  4OFM A;  4KND A;  4N10 A;  1H75 A;  3VPT A;  4POL A;  3VWX A;  3A5I A;  3FZ5 A;  4FH8 A;  3FW2 A;  3QD9 A;  4FYU A;  2WJU A;  14GS A;  4ZIJ A;  2GS3 A;  3PR8 A;  1A23 A;  4NV2 A;  2B5E A;  4CY8 A;  3FR3 A;  1F2E A;  2VCQ A;  4MA9 A;  3FK8 A;  2VO4 A;  1F37 A;  2IWT A;  2REM A;  2VLT A;  3IHQ A;  4BVX B;  2AUV A;  3RDW A;  3QAV A;  4CY6 A;  1K0B A;  1WE0 A;  1G0T A;  1GSF A;  1QGV A;  1DE2 A;  1QFN A;  3GSS A;  3L4N A;  3HVX A;  1TJD A;  3QDN A;  1EP8 A;  4L0U A;  5B6M A;  3IC4 A;  4Z2T A;  2HZE B;  5J9C A;  1I9D A;  2WUL A;  3VUR A;  2ALB A;  1B9Y C;  3EMX A;  3DGQ A;  4ILF A;  2R3X A;  3H79 A;  5HFI A;  4ZB9 A;  1FOH A;  1SJI A;  3QPM A;  3EIN A;  5JCU A;  1XCC A;  4KDX A;  4EIP A;  2AV4 A;  1FOV A;  3VFI A;  2IMI A;  19GS A;  4IN0 A;  2LEG A;  4RQX A;  3VWV A;  1ZZY A;  2E2G A;  2NTO A;  5KOX A;  2VIM A;  5EPF A;  1X5E A;  3F4T A;  4HQZ A;  5IMA A;  6GSX A;  4QL9 A;  2XC2 A;  1HYU A;  2DML A;  4WXT A;  3DVW A;  3NOF A;  2J9H A;  3J7Y b;  1U6T A;  1EEJ A;  2X4A A;  3C7M A;  2HSY A;  3D22 A;  4Q5R A;  3HYP A;  4PUF C;  4NPB A;  2YJH A;  2BMX A;  2GZZ A;  4ACS A;  2C3N A;  1XBS A;  5L71 A;  1SYR A;  4MP4 A;  2QSI A;  4K5R A;  1ILO A;  3IK9 A;  3L78 A;  2L4C A;  4ML6 A;  5ECK B;  5DQS A;  4QQ7 A;  1PKW A;  2HSM A;  2H0I A;  4OFN A;  1U3I A;  1RW1 A;  3C71 A;  2L5L A;  2IL3 A;  2DJ1 A;  3ZLP A;  5D9T A;  2R5G A;  5AIV A;  4TW5 A;  1WWJ A;  2I3Y A;  5ECM B;  1GUK A;  4MZW A;  1YF0 A;  3UIW A;  4MAB A;  1DUG A;  1ON4 A;  4JRR A;  3FMW A;  5G31 A;  4XTS A;  3F9U A;  4J2F A;  3F4R A;  4TR4 A;  3GRX A;  3LOR A;  2GTU A;  1K0A A;  2KHP A;  2XHF A;  4ZL7 A;  2TIR A;  4TXO B;  3EUR A;  3ZML A;  2LQO A;  2E2M A;  4K7N A;  3CBU A;  1OAZ A;  2WZ9 A;  4HS1 A;  2IPA A;  3EC3 A;  5G2Z A;  5HR3 A;  4Z7X A;  5IO0 A;  4F0B A;  1GTA A;  3EYT A;  3CTF A;  2I1U A;  3RBT A;  3QOU A;  1TP9 A;  1SL1 B;  2IME A;  4JE1 A;  4K9Z A;  3S9F A;  4K6X A;  2FCH A;  2O7K A;  4N30 A;  3TUE A;  3IPZ A;  2MZC A;  1FVK A;  1OC3 A;  3QAG A;  3LEF A;  1TK8 B;  3KTL A;  1GWC A;  2VD1 A;  1YF1 A;  4TXV A;  5CO3 A;  3FR9 A;  3FY7 A;  4GQC A;  4O5U A;  2EC4 A;  5ABR A;  3RPP A;  1M7T A;  1UC7 A;  2HXK A;  4L5O A;  5ECL B;  1H4O A;  4EE0 A;  2V1M A;  5EL8 A;  3UMA A;  4CDO A;  1LU4 A;  3TJB A;  5D9V A;  1X9S B;  2IIY A;  2O8V B;  1KBN A;  3QAW A;  3O76 A;  2LNT A;  4K7O A;  4LL1 B;  2VL9 A;  4JR4 A;  2VUP A;  3KEB A;  2YN1 A;  1YEX A;  2A2R A;  1NHO A;  4KDU A;  3APQ A;  3VLN A;  3F3R A;  3L9S A;  3ZL5 A;  1S3D A;  1W89 A;  1CQG A;  1TRV A;  2GQK A;  2L6C A;  1HD2 A;  4ID0 A;  4XS1 A;  4TXO A;  3IAM 2;  2ZCT A;  4MF6 A;  4IJ3 A;  4ECC A;  1MTC A;  3GKM A;  3A2X A;  1JZO A;  3ZVJ D;  4I2T A;  3GUR A;  3C1S A;  2CA8 A;  3CXG A;  3LFL A;  1VGL A;  5C04 A;  4L0W A;  4RI6 A;  7GSS A;  2H0G A;  4HUA A;  3CMI A;  1XW5 A;  3F6D A;  1GSY A;  2RUF A;  5E59 A;  1TTZ A;  5IIZ A;  1Y25 A;  1TOF A;  4TR1 B;  3UL3 A;  5CRG A;  2K8S A;  1AIU A;  3GFK A;  3M9J A;  1A0R P;  3R3E A;  1AQW A;  1O73 A;  1ZYE A;  2AHE A;  1RQM A;  1FB0 A;  3E0U A;  3ZIV A;  3KMN A;  3IDV A;  4IW9 A;  4ZL9 A;  3IK7 A;  1JZR A;  5A4U A;  5G5F A;  3F3Q A;  4ECJ A;  3A3T A;  3BOA A;  3F4S A;  3G9B A;  1GTB A;  4WBJ A;  1NHY A;  3D6I A;  4EDY A;  1WIK A;  4EIQ A;  1X0R A;  2P0G A;  1O8X A;  12GS A;  1GH2 A;  3US3 A;  1RK4 A;  2LST A;  4EXJ A;  1WRY A;  5CP1 A;  4NMU A;  3DXB A;  5CAX A;  1AQV A;  4OWY A;  2HRF A;  3HD5 A;  4GXZ A;  5KN3 A;  4AGS A;  1M2A A;  5C00 A;  3GUS A;  2L6D A;  1B48 A;  3KXO A;  2YWO A;  3CSJ A;  1Q4J A;  1R5P A;  2KP1 A;  4O92 A;  3I69 A;  1TI3 A;  2DJJ A;  2K18 A;  1SD8 A;  2GSQ A;  4JED A;  1PL2 A;  5G5E A;  4ZIL A;  2RM5 A;  4J57 E;  3TRP A;  1XXU A;  1E2Y A;  2O89 A;  3J7Y k;  3Q19 A;  1E6B A;  4TVE A;  2OA7 A;  1AC1 A;  4MF7 A;  4BVY A;  1PSQ A;  5JCW A;  4WBR D;  4V1A g;  4ICY A;  1QMV A;  2FNO A;  1Z7P A;  3VI5 A;  2LJR A;  1WJK A;  2X49 A;  4NXI A;  1TK5 B;  1GLQ A;  1O81 A;  5A4W A;  3QR6 A;  2A4H A;  2EIR A;  1K3Y A;  3PH9 A;  1XWC A;  2FUG 2;  1XWB A;  6GST A;  3ZTL A;  1Z6N A;  4FIW A;  3I9V 2;  6GSU A;  1XZO A;  2DJK A;  1PX6 A;  2FWE A;  4PQ1 A;  1GSD A;  3P8W A;  1PGT A;  2B5Y A;  1AW9 A;  4WKW A;  5D93 A;  2F8F A;  1BAY A;  4Z2R A;  4E8H A;  5H5Q A;  4MNN A;  2VL2 C;  3WT2 A;  3GL3 A;  1EV4 A;  3O6T A;  1TI1 A;  5HR0 A;  4F82 A;  2K9F A;  3MDK A;  2VOC A;  3DD3 A;  2H76 A;  3M3M A;  4IVF A;  3U5R E;  5IMV A;  1QUW A;  4K0N A;  2GQM A;  1SJ6 A;  2FWG A;  1X9M B;  3E3E A;  1ZYQ B;  4O5Q A;  4YAV A;  1WP0 A;  2WDU A;  4XCS A;  2VL3 A;  1FB6 A;  5J3R A;  4WF4 A;  4LMV A;  1XFL A;  3GYK A;  3TDG A;  5DQY A;  5EY6 A;  1U87 A;  2H01 A;  3GST A;  4BVY B;  3JCM L;  4BA7 A;  1FO5 A;  1A8Y A;  4PQI A;  2VCW A;  3WGD A;  4ZXG A;  2X8C A;  4HJM A;  2DKI A;  3HJO A;  4F2I A;  3E9J B;  4YAP A;  2EIQ A;  1YDK A;  5KOW A;  1GNW A;  2YWN A;  4X1U A;  1QQ2 A;  2I4A A;  2H30 A;  3UBL A;  2LUS A;  3H4K A;  1X5C A;  2WS2 A;  2TRX A;  2VCZ A;  2CX3 A;  1PRX A;  2I9H A;  4K1F A;  3LYK A;  4HU9 A;  5G1L A;  4KSO A;  3M9K A;  1PMT A;  4BL7 B;  1ST9 A;  2R0P A;  2LKU A;  5LNK e;  1M9B A;  3LG6 A;  5FWG A;  2CVK A;  4BPY A;  2G2Q A;  1LJR A;  2JAC A;  1R4W A;  1B4Q A;  4OMV A;  1ACV A;  4XHM A;  2B7K A;  4V2N A;  5IMZ A;  3C1R A;  1TW9 A;  2OE3 A;  2DMM A;  2PVO C;  3Q6O A;  3APO A;  2YV9 A;  1NW2 A;  3VI7 A;  4X0X A;  1YZX A;  4O7H A;  3UAR A;  3O3T A;  1T4Y A;  2H1B A;  3GMF A;  22GS A;  1PX7 A;  1MDJ A;  1GSS A;  3UAP A;  3FZ4 A;  4KF9 A;  1LBK A;  3M0F A;  4KUN A;  1GUH A;  2LS5 A;  1JZW A;  3GX8 A;  3CSI A;  5J4U A;  4JZQ A;  3WGX A;  1A24 A;  3LGC A;  2VLV A;  3NIV A;  4EUY A;  1GTI A;  2K6V A;  4MLY A;  1YKA A;  2JAD A;  3TJJ A;  5JWO B;  3H1N A;  1K0N A;  1GLP A;  2CZ3 A;  5AGY A;  2KUC A;  1FG4 A;  1R26 A;  2G0F A;  1GUM A;  1USB A;  5F0G A;  3KD0 A;  5J5N A;  4MPG A;  5AIX A;  2TRC P;  2YZH A;  3CSH A;  1PD2 1;  3Q74 A;  1XWG A;  3EMP A;  4K2X A;  2PN8 A;  2JL4 A;  3TOU A;  3N9J A;  2H70 A;  3KJY A;  1GSQ A;  3EU4 A;  1K3O A;  1TRS A;  1ABA A;  2H74 A;  2QA2 A;  2VLU A;  4EL1 A;  1JHB A;  4ECI A;  1MDI A;  3OR5 A;  2PU9 C;  1G6Y A;  1A2L A;  1UN2 A;  1QXH A;  3F0I A;  3EPT A;  3R2Q A;  3ZFL A;  3DKS A;  3LJR A;  3MSZ A;  4PQH A;  2LV3 A;  1PN9 A;  2GDR A;  4RQR A;  1SJZ A;  2H6Z A;  5IOW A;  4GSS A;  1BJX A;  2NDO A;  4V2L A;  5D9X A;  3GHA A;  2M80 A;  4IS0 A;  3K8N A;  1T4Z A;  2CAQ A;  4GF0 A;  5IOX A;  4GQF A;  2HYX A;  13GS A;  4GSN A;  3F63 A;  1GSU A;  5GAN D;  3HZ4 A;  2XBI A;  4HQS A;  4KCE A;  4HI7 A;  1M2B A;  1EV9 A;  3IC8 A;  3KMO A;  4NAX A;  4TR1 A;  5HR1 A;  2E0Q A;  3PPU A;  2MMO A;  3HVV A;  3GL5 A;  1O7U A;  3DML A;  3IRA A;  2JZR A;  3BCK A;  4LA1 A;  1YEP A;  2DJ0 A;  4DSS A;  4Z2U A;  3SWL A;  1V2A A;  2OE0 A;  2BJX A;  4EVM A;  2CVD A;  5BRT A;  4KDY A;  3D0Z A;  2FY6 A;  2X64 A;  4IP6 A;  2IJY A;  1G7E A;  4IQA A;  2R37 A;  4TOP A;  1TDI A;  1S3A A;  1TXX A;  3UVH A;  1OKD A;  5GST A;  3ZFB A;  2VCX A;  2H72 A;  2ZNM A;  5DAK A;  2LRC A;  5CRW A;  3AY8 A;  5ECO B;  1CQH A;  5B6N A;  4RI7 A;  3RHB A;  10GS A;  2JZS A;  4XRD A;  4I8B A;  5ID2 B;  2QC7 A;  4KAE A;  1DBY A;  2LTK A;  4Q5F A;  1T8E B;  3GH6 A;  3TKQ A;  3D21 A;  6GSS A;  4KE3 A;  4GTU A;  3KP8 A;  4K8M A;  2P5Q A;  1K3L A;  1EEM A;  2UZ8 A;  1YQ1 A;  1FAA A;  1DE1 A;  5A5K A;  5AN1 A;  3GIX A;  1T3B A;  3HHV A;  3I43 A;  2IN3 A;  2R0C A;  5D73 A;  3GKK A;  5J9B A;  2KP2 A;  3KH7 A;  3G7Y A;  4POB A;  1OC9 A;  4PUR A;  3EE2 A;  5IMF A;  2PER A;  2GLR A;  3LWA A;  4EKZ A;  1V40 A;  2DKH A;  2KOK A;  3ERG A;  4X43 A;  1SK2 A;  3IOS A;  2ES7 A;  1SL2 B;  1ERV A;  4DSS B;  8GSS A;  1B8X A;  1T1V A;  6GSY A;  1GRX A;  4IKH A;  3ME7 A;  3TRX A;  1SYX A;  2LJA A;  3FZA A;  4HZ2 A;  4N0V A;  1G6W A;  1JLW A;  2C4J A;  4WEY A;  4K0G A;  5DAK B;  2M72 A;  5FHI A;  4IEL A;  3ZRE A;  2R2J A;  5D9W A;  5B8A A;  2VCV A;  2CAI A;  2F8A A;  1TKD B;  4DSQ A;  4MF5 A;  2HFD A;  2H8L A;  1M0U A;  4V2M A;  2YPM A;  1OE7 A;  5ECN B;  3LW9 A;  1ERU A;  1ZL9 A;  2C3Q A;  3A2W A;  4HU7 A;  2YWI A;  5DJM A;  1URM A;  3MWH A;  2YOI A;  1MD4 A;  4L8E A;  3WGE A;  2HSH A;  3ZVJ A;  3TKR A;  3VWW A;  2GST A;  4O5R A;  3TJG A;  1OC9 B;  1O8W A;  2C0E A;  1V58 A;  2LRT A;  2OJL A;  1TU8 A;  2HZF A;  2IYJ A;  2ON5 A;  2CV4 A;  4V1A p;  2DC5 A;  3KH9 A;  5B8B A;  3LXZ A;  4LLR A;  5JWR B;  1ZYN A;  5AIS A;  5KN1 A;  3A5W A;  2VCT A;  1EWX A;  3IV4 A;  3IHG A;  4YQU A;  5E4W A;  4HDE A;  2RLI A;  4MH2 A;  2C3T A;  4BL7 A;  1OE8 A;  2DLX A;  4KGI A;  1A2J A;  4OO5 A;  5ECI B;  2FGX A;  4A5P A;  2A4V A;  3RPN A;  4N0Z A;  1AXD A;  3BJ5 A;  3F6F A;  1Q98 A;  5FT3 A;  2R6K A;  3P90 A;  2DIZ A;  6GSV A;  6GSW A;  1C72 A;  1OC8 A;  2R0G A;  3IAS 2;  3ZIT A;  2HRK A;  3TJK A;  1S3C A;  2JSZ A;  1XW9 A;  4I6X A;  4F03 A;  1UA5 A;  1VF2 A;  3HDC A;  3HA9 A;  2PUK C;  4OO4 A;  2H1A A;  3QFA C;  5D96 A;  5IQY A;  4OCF A;  1K0C A;  1O6J A;  5HFK A;  1XPV A;  5IPH A;  2OBI A;  4BWS A;  1ZOF A;  1UVZ A;  5CRE A;  2FA8 A;  2QGV A;  2YAN A;  3GH9 A;  1ERW A;  4IP1 A;  3RAZ A;  1TK0 B;  3ZRD A;  4QL7 A;  4EO3 A;  3IBH A;  20GS A;  3GKN A;  4FO5 A;  5COH A;  2MMA A;  1EZK A;  2C0F A;  3HCZ A;  2RII A;  2GT5 A;  2GZP A;  4ISD A;  1JZD A;  3BD2 A;  4G9H A;  4PTS A;  4YQV A;  1XOA A;  4USS A;  3WT1 A;  1HQO A;  2B5X A;  4OFT A;  1XVQ A;  5CNW A;  2RM6 A;  1I5G A;  1GP1 A;  16GS A;  3MAK A;  4N11 A;  4G2E A;  2MMZ A;  3KGK A;  1YKC A;  3KP9 A;  4POK A;  3BBY A;  3FZ9 A;  5IO2 A;  1J08 A;  2AJQ B;  2DJ3 A;  1U88 A;  4MCU A;  3G7J A;  4IQ1 A;  1ZCP A;  1PN0 A;  3ME8 A;  4GLT A;  4PGT A;  5DAL B;  1JLV A;  2WCI A;  4EC0 A;  4G0I A;  2YWM A;  4K2D A;  2LJK A;  5IM9 A;  1B9X C;  2GSR A;  1SK1 A;  2V32 A;  4PX1 A;  1SL0 B;  2CX4 A;  4ECB A;  1GUL A;  2K8V A;  3LYP A;  2DIY A;  1ERT A;  4KX4 A;  5B7C A;  5ELG A;  4NHZ A;  5F05 A;  4ZBD A;  5G1K A;  4K7I A;  4D73 A;  2DBC A;  4O32 A;  1SK0 A;  2HE3 A;  4ULX A;  3W6G A;  3ZMK A;  2HRA A;  4ZB8 A;  1OVN A;  2H1G A;  3UEM A;  1GSE A;  4ZB6 A;  1YY7 A;  3FR6 A;  3TB2 A;  5IPG A;  1SEN A;  4CW9 A;  2X8H A;  1THO A;  1VF3 A;  2HRN A;  2F51 A;  4KH7 A;  5D8I A;  3PIN A;  4MK3 A;  4YQM A;  3W8J A;  5DCH A;  5F07 A;  1XWK A;  2H71 A;  2YJ7 A;  1AQX A;  4BWQ A;  3CTG A;  1W4V A;  4ZL8 A;  4DEJ A;  4K5S A;  2L5O A;  1OYJ A;  4JR6 A;  3W8S A;  4NV5 A;  1K0D A;  5HQP A;  1SKS B;  3CRT A;  5IMC A;  3TKS E;  3GV1 A;  1X5D A;  3HXS A;  2VM1 A;  3DIE A;  3MYD A;  4MJB A;  2OE1 A;  3GNJ A;  2V6O A;  1YJ6 A;  2OKA A;  5ID2 A;  2JSY A;  2H6Y A;  3C8E A;  4YKG A;  3H93 A;  3L0H A;  3ZZX A;  18GS A;  2C8U A;  3ZYW A;  1OKT A;  3N5O A;  5KN2 A;  1WMJ A;  1A0F A;  3QCP A;  4AJ6 A;  2NVL A;  1EP7 A;  4DSR A;  3EWL A;  3TKS A;  4IJI A;  1BQ7 A;  4P3Y B;  1T7P B;  2C1Y A;  3ZIJ A;  4IBP A;  5GZZ B;  1Z9H A;  2PVQ A;  2PMT A;  3NZN A;  5ECQ B;  3KCM A;  2IFQ A;  5GSS A;  17GS A;  5IMD A;  3Q18 A;  3EVI A;  1KNG A;  2H0H A;  5H5R A;  3V1W A;  1PQN A;  2CZ2 A;  5J41 A;  2H6X A;  2O85 A;  1V9W A;  3ERW A;  5DBQ A;  3KIJ A;  2MYG A;  1THX A;  2YZU A;  5LCZ A;  1PKZ A;  3UJ1 A;  1MD3 A;  1EOG A;  4MJC A;  3ISO A;  4XRA A;  1ZGN A;  4IGJ A;  3TKP A;  4I97 A;  1R5A A;  3D4T A;  5ENU A;  5HR2 A;  4G0L A;  1M99 A;  2GQL A;  11GS A;  1SKW B;  2GSS A;  1SKR B;  5F8B A;  2C0D A;  1K0M A;  5CYY A;  3KZQ A;  4TKY A;  1Z5Y E;  2V2G A;  2J23 A;  1FVJ A;  4MJA A;  4BVX A;  4NWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...