1V58A

Crystal structure of the reduced protein disulfide bond isomerase dsbg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v58A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v58A02
4EDYA 2V1MA 3UIWA 4LA1A 2PUKC 2M80A 2VCXA 2QGVA 3CTFA 1QK8A 3KH9A 4K2DA 1T3BA 4F0CA 4WBRD 2A4VA 1JZOA 5CRWA 4ZB8A 2VIMA 1AUCA 3OR5A 4IVFA 2IFQA 4J56E 3ME7A 4ZB6A 2H76A 3H8QA 3FZ5A 4GSSA 6GSUA 4TN8A 3GMFA 4E8HA 3EC3A 3LORA 1X5DA 3GFKA 2V32A 3GHAA 4ULXA 1GLPA 4N10A 2VM1A 3RPNA 1SJIA 2OACA 2HI7A 2GSSA 4TXVA 1YF1A 4IGJA 1TXXA 2E0QA 4WEYA 2O7KA 3ZIJA 3QAVA 1PKZA 1TK5B 5CP1A 4JZQA 3N5OA 4MMMA 2H30A 1QUWA 4ZILA 2RUFA 3LWAA 3WT1A 3QMXA 3ZMKA 2I4AA 4O5RA 1R4WA 2X64A 5INYA 4NHWA 2OKAA 2HYXA 2R6KA 2RIIA 4O92A 1SK2A 1X5CA 2TRCP 2PVOC 4V2MA 2JZTA 3A5WA 3ZREA 4EF0A 1VF4A 4HQZA 1OE8A 2IMEA 1R5PA 3RHBA 5ECQB 3KGKA 1YF0A 3CSHA 4N0VA 4NWYA 4DEJA 5IO2A 1M2DA 1YEXA 1ERVA 4KGIA 3CBUA 5KN2A 3BBYA 1IYHA 4Q5QA 1N2AA 1U87A 2JZRA 3C1RA 2DJ2A 1R7HA 1BG5A 3ZFLA 1G7OA 4NPBA 5H5SA 3HKRA 3I6AA 19GSA 3HZ4A 4LL4B 3UVTA 5ELAA 4POLA 4RI6A 1ZYQB 4YH2A 3M8NA 3VWUA 4O7HA 4MCUA 3MDKA 3LXTA 2P31A 4NHZA 2HZEA 4I2TA 5F05A 5FHIA 1RQMA 4QL7A 3LEFA 4Q5RA 2C80A 2F8FA 4TOPA 2C3NA 2JSZA 3FR9A 2VCWA 4MZBA 2H66A 3WD6A 2I1UA 3M3MA 2OBKA 5GAPD 3MAKA 2VL3A 3TJFA 1XFLA 5JCGA 2O87A 2ON5A 1T4ZA 5JWQB 2EIRA 4HQSA 6GSWA 6GSYA 1UA5A 3CXGA 4KAEA 3WT2A 3HHVA 2J23A 2K18A 1SKWB 5IPGA 2DSAA 1SK0A 3FY7A 4MF5A 5IIZA 3GTUB 3HJPA 4I6XA 2DJ1A 5ECMB 1BYEA 2I9HA 2Z9SA 2F8AA 1PX6A 3I43A 3TRQA 5IQYA 2MYGA 3BJ5A 1OAZA 2CAQA 2HZFA 2LRNA 1ABAA 4KCAA 1EWXA 2GSQA 1PRXA 4IN0A 2LS5A 5HR2A 2JSYA 2L5LA 2FNOA 3CSIA 1OKTA 3IE3A 2MMOA 2B7KA 1ZL9A 1YKCA 4XS4B 5A4UA 1BQ7A 1QXHA 3BCKA 1VF2A 20GSA 3KP8A 3RBTA 3CYNA 1JZRA 3KMNA 1THXA 3QAWA 2H72A 2LJAA 2DIZA 4MZCA 5J4UA 1TOFA 2LV3A 2IMDA 3D4MA 3UAPA 4GXZA 4HEA2 4TR1A 4KB3A 14GSA 3HDCA 3IV4A 3VWVA 2QSIA 2L59A 3HY2A 2DJ0A 1TTZA 3QPMA 1U88A 1F2EA 2CZ2A 3ISOA 2H0GA 3EU3A 2AUVA 1ZMAA 4TXOA 1TK0B 2VLUA 2GVPA 2VD0A 2K8VA 1K0DA 3DWVA 5F0GA 3L9VA 2GLRA 3C73A 1WJKA 2CA8A 1XOBA 3ZITA 4G2EA 2GDRA 5D9WA 2HFDA 5AIVA 1EGOA 1T1VA 4E8EA 2F51A 4IBPA 4JRRA 4WR4A 3IC4A 5IOWA 2JU5A 1O8XA 3C1SA 4K7OA 1ERWA 2XHFA 4EVMA 5L71A 4YQUA 4FIWA 2FWEA 4KDUA 1E6BA 4KSMA 4BA7A 1FVJA 1G0TA 5IO0A 1N8JA 3IDVA 3RAZA 3UEMA 5ELGA 4ECIA 4V2LA 1O85A 3KJYA 1EOHA 3HYPA 1B48A 5DCGA 1A8YA 1GSEA 2LNTA 5IMDA 1X9SB 4ZBBA 4WXTA 4ILFA 3P90A 3HJMA 4GQFA 2AB6A 4NMUA 4XCSA 1BEDA 3EINA 4PGTA 5ECOB 2GTUA 4ZBAA 2H19A 1Z7RA 4KDYA 5B6NA 6GSTA 3LSZA 5D96A 3UMAA 1V2AA 3K8NA 2M72A 4GLTA 2JADA 3US3A 4WF5A 2K6VA 2R4VA 4IKHA 3PR8A 3VPQA 3Q18A 2L5OA 1OC9A 2N5AA 4G9HA 5F8BA 1ZZYA 1M9AA 2X8CA 1I5GA 2VL2A 4OFTA 3ZIVA 1PQNA 1TKDB 5D93A 1TRSA 4MH2A 3TKSE 3A3TA 1VRSD 1XIYA 2VLTA 2C1YA 3TKRA 2MBTA 3MSZA 3E0UA 3SBCA 4XTSA 1FB6A 1F3BA 1UVZA 3J7Yb 2G0FA 2V6KA 4XRAA 2CVBA 4MJEA 4BVXA 2ON7A 4F9ZA 2VL9A 3F63A 1ILOA 2KOKA 4FH8A 1MDKA 1GRXA 3VLNA 2DJJA 1PX7A 5ECPB 3M9JA 3GKXA 2KP1A 3TCOA 2LJKA 3LJRA 2HZEB 4TR4A 3S9FA 5DQYA 4OFMA 1GL8A 1SD9A 1TDIA 2DC5A 3QDNA 3EURA 3C8EA 1XVQA 5F07A 4N0ZA 2GZPA 1OC3A 1JZDA 1ML6A 1PKWA 3TOUA 1K3YA 2HSHA 1VF3A 1S3DA 3EWLA 1U3AA 5HR1A 4ZB9A 2VAFA 5GSTA 3M0FA 5ID2A 4I8BA 3Q6OA 3H4KA 1BX9A 3ED3A 1VF1A 5ECLB 4MPGA 2DIYA 4IP1A 4MJCA 5IMVA 1DE2A 1EV9A 5FWGA 4HOJA 4MA9A 3GIXA 3P2AA 4RUVA 4EL1A 2HNLA 3H1NA 1ZYEA 2MBSA 2DMLA 2GZZA 5HFGA 1AAZA 5GZZB 1IYIA 2ZUPA 4XRDA 4MZWA 1C72A 1DUGA 1J9BA 1PA3A 2JL4A 3O6TA 5IMFA 1FVKA 1W89A 2V41A 22GSA 4HJMA 2HSYA 4L8EA 2VCQA 4CDOA 4XHMA 1JFUA 3TRXA 2C0DA 4K9ZA 3W8JA 4JR4A 3ZLPA 2LEGA 1MD3A 5CAXA 2JACA 3WGXA 4XS1A 5G30A 1A0RP 2LNSA 2H1DA 5CYYA 2X8HA 3Q19A 1XWCA 1MDJA 3PH9A 5DJMA 1X9MB 3F0IA 3IK7A 1HNBA 3VI7A 1X0RA 2FA8A 2B5YA 4NXIA 4POKA 5DDLA 1HNAA 1ON4A 1YKAA 3U6VA 1M0UA 3VK9A 3WYWA 1OE7A 3IK9A 5IM9A 3L0HA 2H1AA 3MWHA 3DVXA 4DSRA 3F6DA 4KE3A 2C0GA 5DAKA 4L5LA 3TRPA 3F3RA 4EKZA 2N5BA 1YZXA 3VFIA 4ECJA 2OADA 2J9HA 1GTBA 2LQQA 3EVIA 3GL5A 1E2YA 4PNGA 3KH7A 4V2NA 2B1KA 4X43A 3ZVJA 1K0AA 4BWQA 2QC7A 1GSSA 3R2QA 3DIEA 2VCTA 4X0XA 5A4VA 3G9BA 4D73A 3UL3A 5CRGA 2DJ3A 4RI7A 2GQLA 2GT6A 1G6WA 4K7NA 1V58A 5G5EA 2PPTA 1QFNA 4AGSA 3TB2A 2VUPA 1GP1A 1J0FA 1GNEA 1V9WA 1XW6A 2QKEA 1Q4JA 2KLXA 5GAND 2E7PA 2H6ZA 1V40A 3UJ1A 9GSSA 2GSRA 4WBJA 2PN8A 17GSA 1G7EA 4TVEA 4ECBA 4V1Ag 5ECIB 3ZL5A 3TJJA 3KP9A 2NVLA 3M1GA 2OBIA 1SENA 4ZL8A 1DBYA 3FZAA 4ISDA 4MDCA 3F4SA 2NBSA 5EPFA 5F06A 1XBSA 2C4JA 5DCHA 1V57A 4IQ1A 2GZYA 1NSWA 3IRAA 4GTUA 1Y25A 4EXJA 2IMKA 2RM6A 3I69A 1MTCA 3CTGA 5H5QA 3HCZA 3FR6A 5IMCA 1K3LA 2C8UA 1MD4A 4XS6A 2FY6A 1XXUA 2LRCA 3ZZXA 2F3MA 1XW9A 4ZBDA 4IJIA 2YZUA 1ZOFA 1GULA 2CVDA 1F6MC 3ERFA 2IPAA 1O6JA 3W6GA 1A0FA 4OCEA 1EV4A 2YWMA 2PVQA 1XPVA 4HZ4A 4IS0A 4Z7XA 2G2QA 2JZSA 3EYTA 1CQGA 2FWHA 2ZNMA 2REMA 4EC0A 4IW9A 2CVKA 2HRNA 4K7IA 4ZXGA 2TIRA 1A2LA 1M2BA 2C0FA 2N5FA 3V1WA 4KA0A 2FWFA 1K0BA 1B4PA 3TKSC 2V6OA 1I9DA 4N30A 3C7MA 5DVBA 3E9JB 5DALB 4HU9A 4DSSB 4FYBA 3GURA 5J41A 2CT6A 1SJZA 3P8WA 4MP4A 5B6MA 3GH9A 3FK8A 4IHUA 3LQ7A 5KEJA 4PQIA 3FR3A 3P7XA 4V1Ap 4ID0A 1OVNA 3GSSA 3IAM2 6GSVA 4PQHA 5B7CA 3GV1A 2IY2A 1NHYA 1H75A 4IJ3A 3L9SA 1PD21 2FWGA 2A2SA 4KX4A 4GF0A 4MPFA 1WMJA 5JCWA 5DQSA 1H4OA 3RDWA 1GTAA 4HJ2A 2OE0A 3GH6A 4K6XA 3IXRA 1PGTA 4AJ8A 2YJ7A 5IMZA 1PL1A 4X1UA 1ERTA 1LJRA 3TKPA 1AQVA 1TP9A 1GH2A 3HA9A 3DGQA 3GRXA 5CRDA 3G7YA 5E4WA 4IP6A 5COHA 2MMAA 4LMVA 2GT5A 1GSFA 1TI3A 3QAGA 4Q5NA 2IFQB 1U6TA 2DJKA 5ABRA 2V2GA 3M9KA 2DMMA 3GUSA 4ZIJA 2VD1A 2H1BA 2XC2A 1GUMA 5ECHB 4JEDA 4GSNA 2IIYA 4QQ7A 2R37A 2P5QA 5HFIA 1WWJA 2H73A 2XBIA 2WCIA 2VCVA 4PUFC 3UBKA 2CQ9A 3UOMA 1Y6EA 1GWCA 2CX4A 2IMIA 1FB0A 1JLWA 2PBJA 2YANA 1ZCPA 4RQRA 4YQVA 1B9XC 1XWAA 4L0UA 2K9FA 2C3QA 2R3XA 1LU4A 2CX3A 1ST9A 2EC4A 4HDEA 2MZCA 3D22A 1ZGNA 4WF4A 2B7JA 13GSA 1MDIA 4MJBA 1KBNA 1T4YA 3QD9A 4PQ1A 5D9VA 5ECRB 2GQMA 2KP2A 2A2RA 6GSXA 1F9MA 2IL3A 2WS2A 3L4NA 4D73B 3GTUA 1AW9A 4N11A 1SL0B 1WE0A 4MF7A 12GSA 3KTLA 2RM5A 4AJ6A 1FW1A 3E3EA 3J7Yk 1WPIA 2AV4A 1V98A 3ZMLA 4BPYA 3IAS2 1VGLA 2GQKA 1K0OA 3BD2A 2AAWA 4POMA 1AQWA 2WRTA 2BJXA 8GSSA 3FKFA 1A23A 4JU5A 2H8LA 4EUYA 3RPPA 5CO3A 2M46A 3WGEA 3TKQA 2FCHA 4KUNA 5J3RA 4DVCA 3C71A 4GCIA 4Q5FA 2L4QA 4JR6A 1SJ6A 2I3YA 1XW5A 4XS4A 4HZ2A 3ERWA 4F0BA 4MJAA 5ENUA 1M2AA 4XIHA 7GSSA 3O3TA 5EVOA 1GSQA 2YV7A 4I2UA 2CZ3A 4NAXA 1CQHA 2AHEA 5A4WA 3NIVA 1AIUA 4I5QA 2WJUA 3ME8A 2FD3A 1AC1A 3TJKA 3A2VA 3DRNA 5ECKB 1SYRA 4IQAA 3F6FA 2YP6A 5D8IA 1Z7PA 3H93A 3HVXA 2CAIA 1OKDA 3HXSA 1HYUA 2LUSA 4ML6A 3KCMA 2I81A 4G10A 1EGRA 1YEPA 1NM3A 1ERUA 1TRWA 3UVHA 2VO4A 4OMVA 3BCIA 3MNGA 1XVWA 1HQOA 3DEXA 3QFBC 2LRTA 3G7IA 1QQ2A 3PINA 4EO3A 3LYKA 4PX1A 2DLXA 3L9UA 4MF6A 4WETA 3D4TA 3D5JA 2E2GA 5IMAA 1UN2A 4HU7A 5HR3A 2AYTA 2R5GA 4TW5A 3RHCA 1SL2B 4AJ7A 1BAYA 4PURA 2AJQB 4GWRA 1EEMA 4MK3A 4ML1A 3TOTA 4MH3A 4YAPA 2HRFA 5G1KA 1OYJA 3I9V2 2FHEA 3QCPA 4LLRA 3IR4A 1R26A 2E2MA 1TRUA 1YQ1A 3HJOA 6GSSA 2VOCA 4K0GA 5D9TA 3ZFBA 3CSJA 4TR1B 5IOXA 1JLVA 4CHSA 1SK1A 5AGYA 3QR6A 5KN0A 1K0CA 3KM6A 2H0HA 1RK4A 4K8MA 1WRYA 1SYXA 2BMXA 3QFAC 1MEKA 4CW9A 1BJXA 4DSQA 2ALBA 4OWYA 2XBQA 1Z3EA 2YWOA 3ZRDA 4KCEA 4TXOB 3FW2A 5JCUA 1M7TA 1O8WA 2VCZA 1T8EB 1SU9A 4PNFA 3FEUA 1PL2A 3FRCA 2PWJA 3D6IA 3CRTA 2FLSA 4P3YB 4F03A 2WGRA 3NZNA 4WKWA 3KIJA 5G31A 5LNKe 4EE0A 4ACSA 5KN1A 1EOGA 3KTBA 4BVYA 1HD2A 2FGXA 3FHKA 4BL7A 1S3CA 2D2ZA 5IPHA 3F4TA 3O76A 1GUKA 3LXZA 1A2MA 2H1GA 1EP7A 2L6DA 3LYPA 1Z6MA 2B1LA 4HUAA 3KZQA 1U3IA 1AQXA 3GL3A 3LGCA 2OE1A 2H71A 1T7PB 4I97A 1M99A 3DYRA 5GSSA 2MMZA 4OD7A 4BWSA 18GSA 1WP0A 2IJYA 3ZVJD 2YN1A 3D21A 1FOVA 2O85A 3APSA 1F37A 4LMWA 5E59A 1O81A 5JWOB 3UBLA 1Z5YE 3FYGA 2NDOA 3W8SA 1XCCA 1JHBA 1NW2A 16GSA 3HZ8A 5FT3A 3GA4A 4F2IA 1XWKA 1SKSB 2HLSA 3VI5A 3ZYWA 1K0NA 2H0IA 3IHQA 5AISA 3IBHA 4ZL7A 4MABA 3UARA 4H86A 5CNWA 5CREA 1WOUA 1SD8A 1GTIA 1OC9B 5DBQA 2H75A 10GSA 1TI1A 2IMFA 3CMIA 1KNGA 3D0ZA 5B8BA 4MLYA 4J57E 3VPTA 2HT9A 1DSBA 1W4VA 1DE1A 1FHEA 3GNJA 5AN1A 1XZOA 1PMTA 3TGZA 3EMPA 5H5RA 2YNXA 1RW1A 2YWNA 4WR5A 3F3QA 2YWIA 1GSYA 1TRVA 2C0EA 2F9SA 5C00A 4FYUA 2YOIA 5CRHA 1OC8A 2B3SA 2PERA 2L4CA 2HXKA 4TRXA 5J5NA 1TK8B 3EMXA 1SL1B 3GKKA 1EZKA 4KSOA 2B5EA 3H79A 4KH7A 3KMOA 4K1FA 2GSTA 3HVVA 2LSTA 2EIQA 3GYKA 2P0GA 3GKNA 3APOA 3GN3A 4IELA 2RLIA 1J08A 4LL1B 1PN9A 5ID2B 5AIXA 1XWGA 1X9WB 3F9UA 1GUHA 3DMLA 4TR3A 1K3OA 1HNCA 3JCML 3DXBA 2TRXA 1TW9A 5J9BA 3A2XA 2LKUA 3TKSA 2XPDA 1KTEA 3CRUA 4NV2A 1O73A 5G5FA 1S3AA 1KEBA 1EP8A 3Q74A 2H01A 2YJHA 4J2FA 1T00A 2X8GA 4K0NA 1AXDA 2WDUA 4POBA 4F82A 3TDGA 5EL8A 1GSUA 2X99A 4O32A 3FZ4A 4EDZA 1USBA 2VLVA 4TKYA 1YY7A 3KD0A 4OFNA 3TJGA 3VWWA 4ZL9A 5G1LA 5G2ZA 2R2JA 1LBKA 4GRFA 3EE2A 2ZCTA 2L57A 1URMA 1FG4A 2LTKA 3APQA 4KW6A 4YAVA 2WB9A 5HQPA 1Z9HA 4L5OA 3ERGA 11GSA 2OA7A 2WZ9A 5C04A 1R5AA 3A2WA 4OO5A 2OJLA 4L0WA 5ECSA 2BTOT 2ES7A 2OE3A 4G19A 1XWBA 4HI7A 2MMNA 3GX8A 3BOAA 4GQCA 2O8VB 1X5EA 2VL2C 4PXOA 5ECNB 5A5KA 2P5RA 4RQXA 1G6YA 1PSQA 4KNDA 3G7JA 4QL9A 1Z6NA 2YPMA 5DAKB 2PMTA 2EIOA 1FAAA 2IN3A 3KEBA 1B4QA 2NTOA 3TJBA 1GTUA 2WFCA 2L6CA 3FZ9A 5HR0A 3NOFA 3GX0A 5D73A 5LD0A 2LJRA 1TJDA 4PUAA 2YCDA 1A8LA 3GSTA 1ACVA 2K8SA 2YV9A 4FYCA 1B8XA 4OO4A 1GSDA 1QMVA 2FUG2 3F4RA 3AY8A 1FO5A 1XOAA 2HE3A 1TU8A 4GSTA 1K0MA 1M9BA 1O7UA 3WGDA 3DVWA 1A2JA 2LQOA 3N9JA 2CV4A 1GNWA 3TUEA 3SWLA 4AF2A 2IYJA 2PGTA 3LFLA 2YZHA 1F3AA 2H74A 4TR0A 2C3TA 1B9YC 4FO5A 2GGTA 3KXOA 1SKRB 4JE1A 3ZTLA 2H6YA 2WULA 1EEJA 2IWTA 2O89A 2DBCA 5DJLA 3U5RE 3PGTA 4NV5A 3GKMA 2KUCA 3EU4A 2H70A 1YJ6A 5J9CA 3QOUA 3IPZA 4HS1A 5DALA 2H6XA 4JBBA 4DSSA 2GS3A 2VM2A 1WIKA 2KHPA 1QGVA 1YDKA 1GLQA 5D9XA 3IOSA 4YQMA 4ECCA 5HFKA 1NHOA 2FA4A 2RUEA 3DD3A 3F8UA 4KDXA 3HD5A 2XPEA 2NPBA 5B8AA 3LG6A 3VURA 2B6MA 5EY6A 4OCFA 2PU9C 1UC7A 1TU7A 3IA1A 3DKSA 5LCZA 3HVSA 1A24A 5JWRB 2B5XA 3VWXA 1Q98A 3L78A 5KN3A 1JZWA 1THOA
chains in the Genus database with same CATH superfamily
3X40A 4EDYA 3GRDA 2V1MA 3UIWA 4LA1A 1AR0A 2PUKC 2M80A 2VCXA 5AIFA 2QGVA 3CTFA 4K61A 1QK8A 3KH9A 4K2DA 1T3BA 4F0CA 4WBRD 2A4VA 1JZOA 4HSCX 5CRWA 4ZB8A 3MSOA 4HM5B 3A76A 2VIMA 1AUCA 3OR5A 4IVFA 1B2MA 2IFQA 4J56E 3UB1A 2UZ8A 3CCR3 3IJEB 3ME7A 2QA43 1X1UA 4ZB6A 2H76A 1TP6A 3H8QA 3FZ5A 2RSXA 4FMDA 1ZS7A 4GSSA 1RKYA 1N8QA 1IYYA 6GSUA 4TN8A 3GMFA 4E8HA 3EC3A 4HM3B 4HM7B 3LORA 1BOXA 1X5DA 3GFKA 1R4CA 3V99A 2V32A 3EQQB 4N6LA 3GHAA 4ULXA 1WMPA 1GLPA 3CNXA 4N10A 2PNCA 3G4S3 2VM1A 3RPNA 2YFLB 1SJIA 1RHLA 2OACA 2HI7A 2GSSA 4TXVA 1YF1A 4IGJA 1TXXA 4K1UA 1BGSA 4J5GA 2E0QA 4WEYA 1OUNA 2O7KA 3ZIJA 3QAVA 1PKZA 1TK5B 5CP1A 4JZQA 3WODG 1X1YA 3M8CA 3N5OA 4MMMA 1LNIA 2YFJB 2CH9A 1EQKA 1QUWA 1ZX2A 5BU4A 2H30A 4ZILA 2RUFA 3LWAA 3WT1A 3QMXA 3ZMKA 4K1VA 2I4AA 4O5RA 1R4WA 2X64A 5INYA 1S5AA 4NHWA 4ICYA 2OKAA 2HYXA 2R6KA 4O2HA 1TRQA 1YHQ3 2RIIA 2CFWA 1RJOA 4O92A 1SK2A 4Z2UA 3Q3FA 1X5CA 2TRCP 2KF5A 3Q2PA 2PVOC 4V2MA 4NREA 2JZTA 2K54A 3N9HA 3A5WA 3ZREA 4EF0A 1VF4A 4HQZA 1OE8A 3EX9A 2IMEA 1KSIA 1R5PA 3RHBA 1ROVA 3NX0A 3NUVA 5ECQB 4O8SA 3FZWA 3KGKA 2BMOB 1YF0A 3CSHA 4N0VA 4NWYA 3SOYA 4DEJA 5IO2A 1M2DA 1SPUA 1YEXA 1ERVA 4KGIA 3CBUA 5KN2A 3BBYA 1IYHA 4Q5QA 4HBRA 2CWVA 1N2AA 1B2SA 1U87A 3PCSA 3IMAB 2JZRA 3C1RA 4KFDA 2DJ2A 1NO3A 6RNTA 1M3IA 4G0LA 1R7HA 3WA3A 1BG5A 1LVNA 2QA2A 3ZFLA 1G7OA 4NPBA 5H5SA 3HKRA 3I6AA 1NB3I 1DMMA 1T5YA 1WNHA 1MNLA 19GSA 5EEOA 3HZ4A 2WO0A 4J8TA 4LL4B 3UVTA 3GZRA 5ELAA 4RI6A 4POLA 1ZYQB 1IQXA 2HRKA 4YH2A 5I97A 3M8NA 3KE7A 1FUTA 1RMSA 1KC84 3VWUA 1RGEA 4O7HA 4MCUA 3MDKA 1DMNA 3LXTA 3D5IA 1Q40B 2P31A 1GS3A 2HZEA 4I2TA 3DM8A 5BVBA 4NHZA 1AVKA 5F05A 5FHIA 1VQO3 3LTAA 1RQMA 1MOLA 3FKAA 4QL7A 4WFOA 1WMOA 4FMBA 2OCTA 3LEFA 1JB2A 4Q5RA 4XBYA 1N5HA 5BXQA 1TUHA 2C80A 2F8FA 1K8A4 1MWRA 1NJI4 2C3NA 4TOPA 2JSZA 3FR9A 2HMOB 2VCWA 4MZBA 2H66A 3WD6A 3KSPA 2GBWB 2I1UA 3M3MA 2OBKA 3DGOA 5IENA 5GAPD 1YGEA 1LXEA 4KVHA 3MAKA 2UX0A 5LC6A 3STDA 2VL3A 3TJFA 1XFLA 5JCGA 2O87A 3F7XA 4L8OA 2ON5A 1T4ZA 5JWQB 2EIRA 1UCIA 4HQSA 6GSWA 6GSYA 1UA5A 3CXGA 4KAEA 3WT2A 3HHVA 2J23A 2K18A 1SKWB 5IPGA 2DSAA 1SK0A 5AIIA 2HRAA 3FY7A 4MF5A 5IIZA 3GTUB 3HJPA 4I6XA 2DJ1A 3CC73 5ECMB 2STDA 1BYEA 1IK3A 2I9HA 1SARA 2CHCA 2CWTA 3NV0A 2Z9SA 2F8AA 1PX6A 3PXMA 1YVBI 3I43A 3TRQA 5IQYA 2MYGA 2KF3A 3BJ5A 4K2XA 1Q7Y4 1OAZA 2CAQA 2HZFA 1K734 2LRNA 1ABAA 4WYKB 4KCAA 1EWXA 1JJ22 1X1WA 2GSQA 1PRXA 4LEHA 2LS5A 2ZDJA 4IN0A 2YX9A 5HR2A 2JSYA 2L5LA 2FNOA 2F99A 3LW9A 5IG0A 1Q7HA 3CSIA 1OKTA 5IF6A 3IE3A 5IG4A 2MMOA 2B7KA 2CW9A 1ZL9A 2XGNA 1YKCA 3T0UA 4XS4B 5A4UA 3PGBA 1BQ7A 1QXHA 3BCKA 1VF2A 20GSA 3KP8A 3RBTA 3CYNA 3KKGA 1JZRA 3KMNA 5TGNA 2KXGA 1THXA 3QAWA 2ZHXB 2MC8A 1A2PA 2W0QA 1BANA 2H72A 1W2ZA 2LJAA 2DIZA 3CNMA 3MHEA 4MZCA 1AQZA 5J4UA 3H51A 4TX4A 1TOFA 2LV3A 2IMDA 3D4MA 3UAPA 4GXZA 4HEA2 3CCM3 4TR1A 4KB3A 3DGNA 14GSA 1FGRA 2Z7AA 3HDCA 1A2KA 3IV4A 3VWVA 2QSIA 2L59A 3HY2A 2DKIA 1FOHA 1PN0A 2DJ0A 1TTZA 1F2EA 1UGHI 1U88A 5IW9A 2CZ2A 1RSNA 3ISOA 2H0GA 3PCRA 3EU3A 3R3EA 2E2TA 1G02A 1VQQA 2QEX3 2AUVA 1ZMAA 4TXOA 3OWSA 1TK0B 4JF8A 2VLUA 2HOHA 2GVPA 2VD0A 2K8VA 1K0DA 3EN1B 1I70A 3DWVA 5F0GA 3L9VA 2GLRA 3C73A 3KIIA 1WJKA 1A90A 4Z2RA 2CA8A 1M904 1IQ8A 1XOBA 4CY8A 3JUNA 3ZITA 4G2EA 2GDRA 5D9WA 2HFDA 1UDII 5AIVA 1EGOA 2OOVA 1T1VA 4E8EA 2AADA 4BU4A 1ASKA 2F51A 4IBPA 4JRRA 4WR4A 3IC4A 4FCZA 5IOWA 2JU5A 3VSYA 1O8XA 3C1SA 4K7OA 1ERWA 2XHFA 4EVMA 3MKIA 3DUKA 5L71A 2QGUA 4YQUA 2CWUA 1C7HA 4FIWA 1BIRA 2FWEA 4KDUA 1E6BA 2QA1A 2W56B 3MWZA 3ECFA 4KSMA 4BA7A 2WGQA 1FVJA 1G0TA 5IO0A 2XGLA 1N8JA 3IDVA 3WHOA 1I2GA 4HM4B 3RAZA 3UEMA 4YKFA 5ELGA 4ECIA 3CCJ3 4I4KA 1O85A 4V2LA 3KJYA 1EOHA 3HYPA 1YVSA 1B48A 5DCGA 4U13A 1A8YA 1GSEA 4RZMA 2LNTA 1SIHA 5IMDA 4ZBBA 4WXTA 1X9SB 4ILFA 3P90A 2L4VA 3HJMA 4WP5A 4GQFA 2AB6A 1T2HA 3K0ZA 4NMUA 4XCSA 1BEDA 3EINA 4PGTA 5ECOB 2GTUA 4ZBAA 3B7CA 4N6TA 2KCDA 2H19A 2UGIA 1Z7RA 5FGOA 4KDYA 1HU9A 3NQYA 1RCLA 5B6NA 6GSTA 3LSZA 3EE1A 5D96A 3T8UA 1PY3A 2A15A 3UMAA 1V2AA 4OUQA 1YJ93 3K8NA 4X2OA 2M72A 4GLTA 2JADA 3US3A 3EBTA 3UNLA 4WF5A 2K6VA 2R4VA 1BSAA 3CPW2 1EA2A 4IKHA 2K0MA 2ZL8A 3FLJA 3PR8A 1VQL3 1M3JA 3VPQA 4R80A 4HM2B 5BIRA 3Q18A 2L5OA 1OC9A 2N5AA 2Z6BA 4G9HA 5F8BA 3CCS3 1ZZYA 4O02B 1M9AA 2CX1A 2X8CA 1I5GA 3CD63 2VL2A 4OFTA 3ZIVA 1FUSA 1PQNA 3CU3A 1TKDB 5D93A 4LZIA 1TRSA 2OTL3 4RNTA 4MH2A 1DETA 3TKSE 3A3TA 7RNTA 2L1SA 1VRSD 1XIYA 2VLTA 2C1YA 3TKRA 1YIT3 2MBTA 1K28A 1Q42A 3MSZA 4EIQA 3E0UA 3SBCA 1WQLB 4XTSA 1J2BA 1FB6A 1R4YA 1F3BA 1UVZA 1M1K4 2E2VA 3NM2A 3B4PA 3J7Yb 3OXAA 4HYZA 2G0FA 1FGTA 2V6KA 4XRAA 3RGAA 2CVBA 4MJEA 4BVXA 1BRJA 1IQYA 2ON7A 1AVLA 4F9ZA 4WHAA 2VL9A 3F63A 1ILOA 1B2XA 2KOKA 4FH8A 1LRAA 5AIHA 2Q07A 2Z76A 3BNBA 1MDKA 1GRXA 3CQFA 3VLNA 2DJJA 1PX7A 5ECPB 3M9JA 2WOHA 2RCDA 2KP1A 3GKXA 2LJKA 3TCOA 5AIGA 3LJRA 2HZEB 4TR4A 3S9FA 5DQYA 4OFMA 1GL8A 1SD9A 1TDIA 2DC5A 3QDNA 2RBIA 1D6YA 4XDVA 2P0XA 3EURA 3C8EA 1XVQA 5F07A 4N0ZA 2Z77A 2W04A 2GZPA 1OC3A 1JZDA 1ML6A 1S3RA 1PKWA 2HSMA 1K3YA 3TOUA 3H3HA 2HSHA 5KP1A 1S3DA 1VF3A 3EPTA 3EWLA 1U3AA 5HR1A 4ZB9A 2VAFA 4XB5A 3M0FA 5GSTA 5ID2A 1RLSA 4L8PA 1UUGB 3OWYA 4I8BA 3Q6OA 3H4KA 1BX9A 3ED3A 1VF1A 3WOEB 5ECLB 4MPGA 2DIYA 4IP1A 4MJCA 5IMVA 1DE2A 1EV9A 5FWGA 3K9MC 1RNBA 1BNJA 3HZPA 4HOJA 4MA9A 3GIXA 3P2AA 4RUVA 4EL1A 2HNLA 3H1NA 4G0IA 4EC6A 1ZYEA 2MBSA 4N6MA 2DMLA 2GZZA 5HFGA 1AAZA 5GZZB 1IYIA 2ZUPA 4XRDA 4MZWA 1C72A 1DUGA 1J9BA 3SEDA 1PA3A 2JL4A 3O6TA 5IMFA 1FVKA 1W89A 1U8CB 2V41A 22GSA 4O3VA 4HJMA 1MWSA 5DREA 2HSYA 4L8EA 1IT7A 2CK3H 3U1WA 2VCQA 4CDOA 4XHMA 1JFUA 3TRXA 2C0DA 1NWWA 3EBYA 4K9ZA 3W8JA 4JR4A 3ZLPA 4EBGA 2LEGA 1MD3A 1A67A 5CAXA 3MG2A 3KSED 2JACA 3DGYA 1QVF2 3EHCA 3HI7A 3WGXA 4XS1A 3AMOB 5G30A 3LZAA 1A0RP 2ML5A 2D1WA 2LNSA 2H1DA 5CYYA 1YIJ3 2X8HA 1O7NB 3Q19A 1XWCA 1MDJA 3PH9A 5DJMA 1X9MB 1FGMA 3F0IA 3IK7A 1HNBA 2HMLB 1VQ43 5M1AA 1BNGA 3VI7A 1JBSA 3F14A 1GY6A 2OQEA 2OTJ3 1BRSA 1X0RA 4HM1B 2FA8A 2B5YA 4NXIA 4POKA 4MMXB 1B21A 5DDLA 1HNAA 1ON4A 1OGXA 1YKAA 1YGWA 3U6VA 1M0UA 2W9PA 3VK9A 3WYWA 4BIRA 1W5ZA 1OE7A 3IK9A 1IT8A 5IM9A 3L0HA 2H1AA 2F5WA 5G2GA 3MWHA 2R4IA 3DVXA 4DSRA 3F6DA 4KE3A 1LQMB 3LYGA 2C0GA 5DAKA 4L5LA 3TRPA 3F3RA 2FGTA 4EKZA 2N5BA 1TU5A 1UCKA 1YZXA 3VFIA 1LOYA 3K7CA 4ECJA 2OADA 2J9HA 1TRPA 1GTBA 2LQQA 5BRTA 3EVIA 4H3UA 4KT3B 1VQ53 3GL5A 1E2YA 4PNGA 3QPMA 1RGKA 3KH7A 4V2NA 2B1KA 4X43A 3ZVJA 1K0AA 4BWQA 2QC7A 1GSSA 1QJGA 3R2QA 3DIEA 4X4JA 5GSPA 2VCTA 2W9QA 3UJMA 4X0XA 5A4VA 3G9BA 4D73A 3UL3A 5CRGA 2DJ3A 4RI7A 1PYLA 2GQLA 2GT6A 1G6WA 2X4AA 4K7NA 1V58A 5IG5A 5G5EA 2HMKB 2PPTA 1QFNA 4AGSA 1O7GB 3TB2A 1OF5B 2VUPA 1SJWA 1GP1A 1J0FA 2IUKA 1FA3A 1GNEA 1V9WA 1XW6A 2QKEA 3S28A 2WOFA 1A2VA 3FCSB 1Q4JA 2KLXA 5GAND 2E7PA 4K5RA 2H6ZA 1V40A 1STFI 3UJ1A 1N8R4 9GSSA 1QMAA 1JRQA 1JV2B 2GSRA 4WBJA 2BIRA 2PN8A 2P05A 17GSA 1G7EA 3HK4A 3AHSA 4TVEA 4AEQA 4ECBA 7GSPA 1E3VA 1S723 1N9JA 1I8VA 5JBSA 4R9LA 3FG4A 2P0MA 4V1Ag 5ECIB 3WOFB 2FNQA 1ZYNA 3ZL5A 3TJJA 1RCKA 2GBXB 3KP9A 3VGNA 2NVLA 3M1GA 2XR8B 3NXJA 4CJNA 2OBIA 2GEYA 1EKMA 1SENA 3I553 4ZL8A 1DBYA 3FZAA 1RRHA 3S27A 4ISDA 4MDCA 3F4SA 3NQZA 3PZWA 2NBSA 5EPFA 5F06A 5RNTA 1XBSA 2C4JA 4MMZB 5DCHA 1V57A 4IQ1A 1YI23 2GZYA 2D42A 1NSWA 3IRAA 4GTUA 3PPUA 1Y4KA 1Y25A 4EXJA 2IMKA 2RM6A 3I69A 1MTCA 3CTGA 5H5QA 3HCZA 2GU3A 1E3RA 2B1XB 3PS8A 3FR6A 3F7SA 5IMCA 1K3LA 2C8UA 1MD4A 3FG3A 1BNFA 4XS6A 2R41A 1XXUA 2FY6A 2LRCA 3ZZXA 2F3MA 1XW9A 4ZBDA 4IJIA 2YZUA 1YJW3 2UUGC 1ZOFA 1GULA 1LOXA 2Y73A 2CVDA 1F6MC 3ERFA 1JKGA 2IPAA 1O6JA 3W6GA 2F4YA 1A0FA 4OCEA 2RFRA 1EV4A 2YWMA 2PVQA 1XPVA 4HZ4A 4IS0A 4BTWA 1RTUA 4Z7XA 1RGCA 3QRDA 2G2QA 2JZSA 3JUPA 1MGRA 3EYTA 4XBTA 1RRLA 4CDLA 1CQGA 2FWHA 8RNTA 2ZNMA 2REMA 4EC0A 4IW9A 2CVKA 2HRNA 4K7IA 4ZXGA 2TIRA 1A2LA 1M2BA 2C0FA 2N5FA 3V1WA 1IV7A 4KA0A 2FWFA 2CFGA 1K0BA 1B4PA 3HVNA 3TKSC 5HGRA 2HMJB 2INXA 2V6OA 1I9DA 3JUQA 4N30A 3C7MA 5DVBA 1EG9B 3ALAA 3F40A 2A2PA 3E9JB 4N6OB 1OHOA 5DALB 4HU9A 4DSSB 2CC3A 4FYBA 3GURA 5J41A 2CT6A 1SJZA 3P8WA 4MP4A 4RBNA 5B6MA 3NM7A 3GH9A 3FK8A 4MNNA 4IHUA 3LQ7A 5KEJA 4PQIA 5JPPA 3CPOA 3FR3A 1I3IA 5KOXA 6GSPA 3HIGA 3P7XA 4V1Ap 4ID0A 1OVNA 1B3SA 3GSSA 1BRIA 3IAM2 6GSVA 4PQHA 5B7CA 4O5QA 1JB5A 1MGWA 2IY2A 4HKVB 1NHYA 3GV1A 1H75A 4FR9A 1GMRA 4IJ3A 3G8ZA 3L9SA 1PD21 3MYTA 2FWGA 2A2SA 4KX4A 4GF0A 4X2HA 4MPFA 1WMJA 2CX0A 4GB5A 5IERA 5JCWA 5DQSA 1H4OA 3RDWA 1GTAA 4HJ2A 1BAOA 5KP4A 2OE0A 3GH6A 4K6XA 5IG3A 1ZYPA 3IXRA 1PGTA 4FQUA 4AJ8A 2YJ7A 4KFEA 5IMZA 1PL1A 4Q53A 4X1UA 4XM4A 3EC9A 1RN7A 4BL2A 1ERTA 1LJRA 3DXOA 3E99A 4J9AA 2KF4A 3TKPA 1AQVA 3IHGA 1DVDA 1JN5A 1TP9A 1GH2A 1JBTA 3OV4A 3HA9A 3DGQA 3GRXA 1PU4A 5CRDA 3G7YA 5E4WA 4IP6A 5COHA 3HX8A 4HAAA 1I0VA 3MG3A 2Y74A 3KN4A 2MMAA 4ZM8A 1GYBA 4LMVA 5LC7A 2GT5A 3G0KA 1MWUA 4IIAA 1GSFA 1D6ZA 1TI3A 3QAGA 4Q5NA 5ELJA 2IFQB 5CXOA 1FYSA 2B24B 1U6TA 3V92A 2DJKA 5ABRA 1IVUA 1VQP3 2V2GA 3M9KA 2DMMA 3GUSA 3KZTA 1W4NA 2IUJA 4ZIJA 2VD1A 2H1BA 3FSDA 1KD14 2XC2A 2DKHA 1GUMA 5ECHB 4JEDA 4GSNA 2IIYA 4N6V0 1AV4A 3G16A 4OVMA 1RGGA 4QQ7A 2R37A 1M9GA 2P5QA 4LGQA 5HFIA 4R4KA 4Z2TA 1WWJA 2H73A 2XBIA 3IC8A 4JRFA 2WCIA 2VCVA 4PUFC 4G0KA 3UBKA 1PFPA 2CQ9A 3GZBA 3UOMA 1Y6EA 1GWCA 2CX4A 1FGOA 2IMIA 5BMUA 1JLWA 2SARA 1FB0A 2PBJA 2YANA 4PTSA 1L5GB 1ZCPA 3OWUA 3D9RA 4CPKA 4RQRA 4YQVA 1B9XC 1XWAA 4L0UA 2K9FA 2C3QA 2R3XA 1LU4A 2F98A 2HMNB 4STDA 2BMQB 2CX3A 1ST9A 2EC4A 2CG1A 5M19A 1UCJA 4HDEA 3F8HA 2MZCA 3A5EA 3D22A 4USSA 1ZGNA 4WF4A 2B7JA 13GSA 3DGMA 1MDIA 4KF9A 3A5IA 4MJBA 2KF6A 1KBNA 1T4YA 3LTBA 1NDOB 3BNEA 1XG8A 3CCQ3 3QD9A 4PQ1A 5D83A 1FZUA 2R0GA 5D9VA 5ECRB 1GD4A 2GQMA 2KP2A 2A2RA 6GSXA 1F9MA 2IL3A 1OGZA 2I9WA 1CYVA 2WS2A 3L4NA 4GL6A 3GTUA 4D73B 2XEPA 1AW9A 4N11A 3KCHA 3CCE3 3F8XA 1SL0B 1WE0A 4MF7A 12GSA 3KTLA 2RM5A 4AJ6A 2F5MA 3D79A 1FW1A 3E3EA 1FGQA 4EXRA 3J7Yk 1WPIA 2AV4A 1V98A 3ZMLA 4BPYA 1W02A 3IAS2 1JBRA 1VGLA 3QK9A 1NNVA 2GEXA 2GQKA 3I0YA 1K0OA 3BD2A 2AAWA 1UUVB 4POMA 3ZG5A 1AQWA 2WRTA 2BJXA 8GSSA 3FKFA 1A23A 4WYKA 4JU5A 3CC43 3G713 2H8LA 2XSHB 4EUYA 3LOYA 1VQ83 3CMA3 3RPPA 5CO3A 2M46A 3WGEA 3TKQA 1D6UA 2FCHA 1O7HB 4KUNA 1DMQA 5J3RA 4DVCA 3WA2X 3C71A 1BNEA 1Q824 4GCIA 5D82A 4Q5FA 1WMNA 3FG1A 2YFIB 2L4QA 2C11A 2ML6A 4JR6A 3DGLA 3LH4A 1SJ6A 2I3YA 3S67A 1XW5A 4XS4A 4HZ2A 3ERWA 4F0BA 3PYJA 4BTXA 4MJAA 5ENUA 4EIPA 1M2AA 4XIHA 7GSSA 3O3TA 5EVOA 1GSQA 2YV7A 4I2UA 1RGFA 1UCLA 3I563 1UGIA 3BNCA 2CZ3A 1CQHA 4NAXA 2AHEA 4H61A 5A4WA 3NIVA 5CF2A 1IDPA 3DZLA 1AIUA 4I5QA 2WJUA 1ULJB 3ME8A 2FD3A 1AC1A 3TJKA 3A2VA 3DRNA 3S29A 5ECKB 1SYRA 4IQAA 3F6FA 2YP6A 5D8IA 1Z7PA 3H93A 4HZ9B 3HVXA 3RDEA 2CAIA 1OKDA 3HXSA 1HYUA 2LUSA 4ML6A 3KCMA 1BSDA 4NHFA 2I81A 4G10A 2O3OA 1EGRA 1B20A 2F86B 2KAAA 1YEPA 1NM3A 1ERUA 1TRWA 1B27A 2BU4A 3X42A 3UVHA 1WTHA 2VO4A 4OMVA 1BVIA 3BCIA 3MNGA 1XVWA 1HQOA 1W2B2 1VQ63 3DEXA 3NV0B 3QFBC 2LRTA 2KRTA 1W00A 1JKGB 3G7IA 1QQ2A 2IMJA 3PINA 4EO3A 1BUJA 1PFOA 3LYKA 4PX1A 2DLXA 5KOWA 1BNIA 4K90B 3L9UA 4MF6A 4WETA 3D4TA 3D5JA 2E2GA 1HKXA 3FH1A 4R1KA 3GZXB 3SXXA 5IMAA 3JUMA 4YKGA 1UN2A 3WMDA 4HU7A 1VZZA 1OHPA 5HR3A 1VQ93 3BB9A 2LQVA 2AYTA 2R5GA 1NB5I 3DH2A 2XSOB 4TW5A 3RHCA 1GOUA 1C54A 4AJ7A 1OHSA 1SL2B 1B2ZA 1BAYA 4PURA 2AJQB 1CEWI 3NBBA 1GY7A 4GWRA 1EEMA 4MK3A 4FCJA 4ML1A 3X41A 3TOTA 4MH3A 4YAPA 2HRFA 5G1KA 1OYJA 3I9V2 2FHEA 3L0RA 3QCPA 2W56A 3WR2A 4LLRA 4RNZA 3BLZA 1BNSA 3IR4A 4DKIA 1RGAA 1R26A 2PZVA 1BRGA 2E2MA 2RGQA 2XH9A 4OK0A 1TRUA 1Z1SA 3ZFZA 1YQ1A 3HJOA 6GSSA 2VOCA 2AAEA 1OCVA 4K0GA 5D9TA 3ZFBA 3CSJA 4TR1B 5IOXA 1JLVA 4CHSA 1SK1A 5AGYA 3QR6A 5KN0A 1K0CA 7STDA 2H0HA 3KM6A 1RK4A 4K8MA 1I3FA 3T8NA 3JVCA 3MPHA 1WRYA 1SYXA 1OPYA 2BMXA 3Q90A 3QFAC 2XFSA 1MEKA 4CW9A 1BJXA 2QIYA 4DSQA 2ALBA 1W01A 4OWYA 1N5PA 2XBQA 1I0XA 1Z3EA 3O8YA 2YWOA 3ZRDA 4KCEA 1SIIA 4TXOB 1W6YA 1B2UA 3GAXA 3FW2A 5JCUA 1M7TA 3FF0A 1UI8A 2FXTA 5DRVA 3LT8A 3SOAA 1O8WA 2VCZA 3MYDA 4BL3A 1T8EB 1JN5B 1CH0A 1TTOA 2O9UX 1SU9A 3FEUA 4PNFA 1PL2A 3FRCA 1KQS2 2PWJA 1BRKA 3D6IA 3CRTA 2FLSA 4P3YB 4F03A 2WGRA 3NZNA 1GSPA 4WKWA 3KIJA 5G31A 5LNKe 4EE0A 3MIXA 1BSBA 4ACSA 5KN1A 1EOGA 3KTBA 4BVYA 1HD2A 4LMIA 2GXFA 1TIJA 4RNYA 3RNTA 2FGXA 1MWTA 3FHKA 3RGRA 4BL7A 3AHWA 1S3CA 2D2ZA 5IPHA 3Q1CA 1UI7A 3LXUX 4FMAA 4HM8B 3F4TA 3O76A 1W7CA 3FMWA 1GUKA 1ROAA 3LXZA 1A2MA 3DMCA 2H1GA 3V98A 1EP7A 2L6DA 2BHMA 3BNDA 1DVCA 1GMQA 3LYPA 3SX1A 1Z6MA 2B1LA 4HUAA 3KZQA 5IEOA 1U3IA 1AQXA 3GL3A 3LGCA 4FCMA 2RNTA 3LT9A 2OE1A 2A4HA 2H71A 1T7PB 1IVWA 4I97A 1T2IA 3MG1A 1M99A 3DYRA 3LTCA 2M7OA 5GSSA 2LYXA 2MMZA 4OD7A 4BWSA 18GSA 1WP0A 2IJYA 3ZVJD 2YN1A 3D21A 1FOVA 2O85A 5ELUA 3FGYA 4XDWA 3G6E3 3CC23 3APSA 1F37A 4LMWA 4FMCA 5E59A 4O5UA 2C10A 5EQLA 2JDIH 1O81A 5JWOB 5EVHA 3UBLA 4MMYB 1DE3A 1Z5YE 3FYGA 2NDOA 2W03A 1W6CA 3W8SA 1XCCA 1JHBA 2CFDA 1NW2A 16GSA 3HZ8A 5FT3A 3GA4A 4XBXA 2XRXB 2XFTA 4G1MB 1XWKA 3K5TA 4BIKA 4F2IA 1SKSB 2HLSA 3VI5A 3ZYWA 1K0NA 2H0IA 3IHQA 5AISA 9RNTA 3IBHA 3URPA 4ZL7A 4MABA 3UARA 5HOHA 4H86A 5CNWA 5CREA 3SVAA 1WOUA 2R0PA 1SD8A 3WDGB 1GTIA 1OC9B 2P09A 1RGLA 1I2FA 3VF1A 2H75A 3F9SA 5DBQA 10GSA 1TI1A 1VQ73 2IMFA 1QVG2 3BU4A 1O7MB 3AGNA 1BRHA 3GWRA 3CMIA 5AEWB 1KNGA 3D0ZA 4HM6B 5B8BA 2CIUA 3J7Yd 4MLYA 4J57E 4EW5A 1N9EA 1RN4A 3VPTA 4MEIA 1YNVX 2HT9A 1DSBA 3CCV3 1W4VA 1DE1A 1E97A 1FHEA 3GNJA 5AN1A 1XZOA 1PMTA 5AEUB 3TGZA 3EMPA 5H5RA 2YNXA 1ISKA 1RW1A 2YWNA 4WR5A 3F3QA 2YWIA 4KZ1A 3X3XA 1GSYA 1TRVA 2C0EA 2F9SA 5C00A 4FYUA 2YOIA 5CRHA 1OC8A 4BVXB 2GSPA 2B3SA 1OH0A 2PERA 2ZA4A 4R9KA 2L4CA 2R0CA 5IEPA 4CCVA 4EV2A 2HXKA 4TRXA 1TFKA 5J5NA 3UL5A 1QAFA 3AMOA 1YJN3 1TK8B 2CKFB 3EMXA 1SL1B 3GKKA 4AKYA 1I2EA 1EZKA 2K3DA 3B4OA 1X1XA 4KSOA 1STDA 5A0OB 3OW22 2CFKA 4N3VA 1M1XB 2B5EA 4PEJA 1RNTA 4LSOA 3H79A 4KH7A 5JPUA 3KMOA 4K1FA 2GSTA 1V74A 3HVVA 3D3LA 3CXC2 3B8LA 2LSTA 2OWPA 4CY6A 2EIQA 3GYKA 3U97A 2P0GA 4IPBA 3EF8A 4HZBB 3GKNA 3APOA 3GN3A 4LYLB 1GD3A 4IELA 3X3ZA 2RLIA 1J08A 4LL1B 1PN9A 5ID2B 5AIXA 2OOVC 2MF7A 3GSPA 1EUIC 1K9M4 1XWGA 1UUWB 3LMLA 1IV9A 2BT3A 1X9WB 3AGOA 1GUHA 3DMLA 3F9UA 1K3OA 4TR3A 3EB8A 1FUWA 1HNCA 3JCML 2P38A 3DXBA 2SBLA 2TRXA 3FF2A 1US1A 3ER7A 1TW9A 5J9BA 1IVXA 3A2XA 2LKUA 3TKSA 1RGHA 2XPDA 1KTEA 5KP3A 3CRUA 4NV2A 1W6GA 1O73A 5G5FA 4HJLB 1S3AA 1KEBA 1EP8A 3Q74A 2H01A 2YJHA 4J2FA 3SLUA 1T00A 2X8GA 4K0NA 1ULIB 2HMMB 1AXDA 3N54B 2WDUA 4POBA 4HVNA 4QWTA 4F82A 1GOVA 3TDGA 5EL8A 1GSUA 2X99A 4O32A 3FZ4A 4EDZA 1BUQA 1USBA 2VLVA 1ZGXA 1VQN3 4TKYA 5STDA 1YY7A 3NHXA 3KD0A 4OFNA 3TJGA 3VWWA 3NBRA 4ZL9A 3JUOA 5G1LA 1IVVA 4KFFA 2F56A 5G2ZA 2R2JA 1LOWA 1LBKA 1OF5A 2BMRB 2ZCTA 3EE2A 4GRFA 2L57A 3SYUA 1URMA 1FG4A 2LTKA 3APQA 2X49A 4KW6A 4YAVA 2WB9A 5HQPA 2W6JH 3IPTA 1Z9HA 4J5KA 4L5OA 3ERGA 11GSA 2OA7A 2WZ9A 5C04A 5D81A 1R5AA 3A2WA 4OO5A 2OJLA 4L0WA 3ROBA 5ECSA 3UL6A 2BTOT 2ES7A 3LTDA 2OE3A 4G19A 1XWBA 1LOVA 4HI7A 1O7PB 1Q9EA 2MMNA 3GX8A 1GY5A 1Q40A 3CCU3 3BOAA 4GQCA 2O8VB 3KFQC 1X5EA 3D4AA 4GSPA 2VL2C 4PXOA 5ECNB 5A5KA 2P5RA 4RQXA 1G6YA 1Q864 1PSQA 4KNDA 4HM0B 3G7JA 4QL9A 1LQGC 1Z6NA 2YPMA 4EYCA 5DAKB 4GHOA 2PMTA 1TFOA 1IU7A 2EIOA 1FAAA 1BSCA 5AYRB 2V1LA 2IN3A 3HIIA 3KEBA 1B4QA 1AY7A 1HZ1A 2XF3A 2NTOA 3TJBA 1F8NA 2JQ5A 1GTUA 2WFCA 1Q814 2L6CA 3FZ9A 3NBJA 5HR0A 3NOFA 3GX0A 4EV5A 5D73A 2BO9B 2BNGA 5LD0A 3HOHA 3N8BA 2LJRA 1TJDA 4PUAA 2YCDA 1A8LA 2CG0A 3GSTA 1ACVA 2CFLA 2K8SA 2YV9A 4FYCA 3OX9A 3K63A 1B8XA 1G96A 4OO4A 1GSDA 1QMVA 2FUG2 3F4RA 3AY8A 1FO5A 1XOAA 2HE3A 1TU8A 4GSTA 3DY5A 1M9BA 1K0MA 4IT7A 1O7UA 4BVYB 4ORLA 3WGDA 3DVWA 1O7WB 4BL7B 1A2JA 4AKZA 1DYUA 2LQOA 1U5OA 3N9JA 3CME3 3S5CA 2CV4A 4MJDA 1QALA 1GNWA 3TUEA 3GZYB 3SWLA 2E2UA 4AF2A 2IA7A 2IYJA 2PGTA 3LFLA 2YZHA 1F3AA 3BIRA 1K41A 2H74A 4TR0A 2C3TA 1B9YC 4FO5A 5CK6A 1CQSA 2GGTA 3KXOA 1SKRB 6STDA 2C4BA 4JE1A 3ZTLA 1KWIA 1RDSA 2H6YA 2J8XB 2WULA 1EEJA 1VQM3 2IWTA 4K5SA 4WWUC 1RN1A 2DBCA 2O89A 2WGOA 5DJLA 3U5RE 3PGTA 4NV5A 5CLKA 3GKMA 2KUCA 3EU4A 1JB4A 5M18A 1YJ6A 2H70A 5J9CA 3QOUA 3IPZA 4HS1A 5DALA 4N6UA 2H6XA 8CHOA 4JBBA 4DSSA 2GS3A 2VM2A 1WIKA 3ZG0A 2KHPA 1QGVA 1YDKA 1GLQA 4BTYA 2W2CA 5D9XA 1ZO2A 1GMPA 3IOSA 4YQMA 4ECCA 1BRNL 5HFKA 1NHOA 4A5PA 3D5GA 2FA4A 2RUEA 5FW5A 3DD3A 3F8UA 1BSEA 4KDXA 3HD5A 2XPEA 4L7KA 1UW1A 1CYUA 3EJVA 2NPBA 1FW7A 5B8AA 1NU3A 1BNRA 3LG6A 1GOYA 3VURA 5CF1A 2B6MA 5EY6A 4OCFA 1HYFA 2PU9C 1UC7A 1TU7A 2OQEC 4N6NB 3IA1A 3DKSA 1LNHA 5LCZA 1OACA 5AYSC 3CCL3 3HVSA 1A24A 5AI1A 4HOHA 5JWRB 2B5XA 3VWXA 3X3YA 1Q98A 3L78A 1QAKA 1BU4A 1VQK3 5KN3A 2GU1A 1SQWA 1JZWA 3EN8A 1THOA 1JNQA
chains in the Genus database with same CATH topology
4EDYA 2V1MA 3UIWA 4LA1A 2PUKC 2M80A 2VCXA 2QGVA 3CTFA 1QK8A 3KH9A 4K2DA 1T3BA 4F0CA 4WBRD 2A4VA 1JZOA 5CRWA 4ZB8A 2VIMA 1AUCA 3OR5A 4IVFA 2IFQA 4J56E 2UZ8A 3ME7A 4ZB6A 2H76A 3H8QA 3FZ5A 4GSSA 6GSUA 4TN8A 3GMFA 4E8HA 3EC3A 3LORA 1X5DA 3GFKA 2V32A 3GHAA 4ULXA 1GLPA 4N10A 2VM1A 3RPNA 1SJIA 2OACA 2HI7A 2GSSA 4TXVA 1YF1A 4IGJA 1TXXA 2E0QA 4WEYA 2O7KA 3ZIJA 3QAVA 1PKZA 1TK5B 5CP1A 4JZQA 3N5OA 4MMMA 2H30A 1QUWA 4ZILA 2RUFA 3LWAA 3WT1A 3QMXA 3ZMKA 2I4AA 4O5RA 1R4WA 2X64A 5INYA 4NHWA 4ICYA 2OKAA 2HYXA 2R6KA 2RIIA 4O92A 4Z2UA 1SK2A 1X5CA 2TRCP 2PVOC 4V2MA 2JZTA 3A5WA 3ZREA 4EF0A 1VF4A 4HQZA 1OE8A 2IMEA 1R5PA 3RHBA 5ECQB 3KGKA 1YF0A 3CSHA 4N0VA 4NWYA 4DEJA 5IO2A 1M2DA 1YEXA 1ERVA 4KGIA 3CBUA 5KN2A 3BBYA 1IYHA 4Q5QA 1N2AA 1U87A 2JZRA 3C1RA 2DJ2A 4G0LA 1R7HA 1BG5A 2QA2A 3ZFLA 1G7OA 4NPBA 5H5SA 3HKRA 3I6AA 19GSA 3HZ4A 4LL4B 3UVTA 5ELAA 4POLA 4RI6A 1ZYQB 2HRKA 4YH2A 3M8NA 3VWUA 4O7HA 4MCUA 3MDKA 3LXTA 2P31A 4NHZA 2HZEA 4I2TA 5F05A 5FHIA 1RQMA 4QL7A 3LEFA 4Q5RA 2C80A 2F8FA 4TOPA 2C3NA 2JSZA 3FR9A 2VCWA 4MZBA 2H66A 3WD6A 2I1UA 3M3MA 2OBKA 5GAPD 3MAKA 2VL3A 3TJFA 1XFLA 5JCGA 2O87A 2ON5A 1T4ZA 5JWQB 2EIRA 4HQSA 6GSWA 6GSYA 1UA5A 3CXGA 4KAEA 3WT2A 3HHVA 2J23A 2K18A 1SKWB 5IPGA 2DSAA 1SK0A 2HRAA 3FY7A 4MF5A 5IIZA 3GTUB 3HJPA 4I6XA 2DJ1A 5ECMB 1BYEA 2I9HA 2Z9SA 2F8AA 1PX6A 3I43A 3TRQA 5IQYA 2MYGA 3BJ5A 1OAZA 2CAQA 2HZFA 2LRNA 1ABAA 4KCAA 1EWXA 2GSQA 1PRXA 4IN0A 2LS5A 5HR2A 2JSYA 2L5LA 2FNOA 3LW9A 3CSIA 1OKTA 3IE3A 2MMOA 2B7KA 1ZL9A 1YKCA 4XS4B 5A4UA 1BQ7A 1QXHA 3BCKA 1VF2A 20GSA 3KP8A 3RBTA 3CYNA 1JZRA 3KMNA 1THXA 3QAWA 2H72A 2LJAA 2DIZA 4MZCA 5J4UA 1TOFA 2LV3A 2IMDA 3D4MA 3UAPA 4GXZA 4HEA2 4TR1A 4KB3A 14GSA 3HDCA 3IV4A 3VWVA 2QSIA 2L59A 3HY2A 2DKIA 1FOHA 1PN0A 2DJ0A 1TTZA 3QPMA 4K2XA 1U88A 1F2EA 2CZ2A 3ISOA 2H0GA 3EU3A 3R3EA 2AUVA 1ZMAA 4TXOA 1TK0B 2VLUA 2GVPA 2VD0A 2K8VA 1K0DA 3DWVA 5F0GA 3L9VA 2GLRA 3C73A 1WJKA 4Z2RA 2CA8A 1XOBA 4CY8A 3ZITA 4G2EA 2GDRA 5D9WA 2HFDA 5AIVA 1EGOA 1T1VA 4E8EA 2F51A 4IBPA 4JRRA 4WR4A 3IC4A 5IOWA 2JU5A 1O8XA 3C1SA 4K7OA 1ERWA 2XHFA 4EVMA 5L71A 4YQUA 4FIWA 2FWEA 4KDUA 1E6BA 2QA1A 4KSMA 4BA7A 1FVJA 1G0TA 5IO0A 1N8JA 3IDVA 3RAZA 3UEMA 4YKFA 5ELGA 4ECIA 4V2LA 1O85A 3KJYA 1EOHA 3HYPA 1B48A 5DCGA 1A8YA 1GSEA 2LNTA 5IMDA 1X9SB 4ZBBA 4WXTA 4ILFA 3P90A 3HJMA 4GQFA 2AB6A 4NMUA 4XCSA 1BEDA 3EINA 4PGTA 5ECOB 2GTUA 4ZBAA 2H19A 1Z7RA 4KDYA 5B6NA 6GSTA 3LSZA 5D96A 3UMAA 1V2AA 3K8NA 2M72A 4GLTA 2JADA 3US3A 4WF5A 2K6VA 2R4VA 4IKHA 3PR8A 3VPQA 3Q18A 2L5OA 1OC9A 2N5AA 4G9HA 5F8BA 1ZZYA 1M9AA 2X8CA 1I5GA 2VL2A 4OFTA 3ZIVA 1PQNA 1TKDB 5D93A 1TRSA 4MH2A 3TKSE 3A3TA 1VRSD 1XIYA 2VLTA 2C1YA 3TKRA 2MBTA 3MSZA 4EIQA 3E0UA 3SBCA 4XTSA 1FB6A 1F3BA 1UVZA 3J7Yb 2G0FA 2V6KA 4XRAA 2CVBA 4MJEA 4BVXA 2ON7A 4F9ZA 2VL9A 3F63A 1ILOA 2KOKA 4FH8A 1MDKA 1GRXA 3VLNA 2DJJA 1PX7A 5ECPB 3M9JA 3GKXA 2KP1A 3TCOA 2LJKA 3LJRA 2HZEB 4TR4A 3S9FA 5DQYA 4OFMA 1GL8A 1SD9A 1TDIA 2DC5A 3QDNA 3EURA 3C8EA 1XVQA 5F07A 4N0ZA 2GZPA 1OC3A 1JZDA 1ML6A 1PKWA 2HSMA 3TOUA 1K3YA 2HSHA 1VF3A 1S3DA 3EPTA 3EWLA 1U3AA 5HR1A 4ZB9A 2VAFA 5GSTA 3M0FA 5ID2A 4I8BA 3Q6OA 3H4KA 1BX9A 3ED3A 1VF1A 5ECLB 4MPGA 2DIYA 4IP1A 4MJCA 5IMVA 1DE2A 1EV9A 5FWGA 4HOJA 4MA9A 3GIXA 3P2AA 4RUVA 4EL1A 2HNLA 3H1NA 4G0IA 1ZYEA 2MBSA 2DMLA 2GZZA 5HFGA 1AAZA 5GZZB 1IYIA 2ZUPA 4XRDA 4MZWA 1C72A 1DUGA 1J9BA 1PA3A 2JL4A 3O6TA 5IMFA 1FVKA 1W89A 2V41A 22GSA 4HJMA 2HSYA 4L8EA 2VCQA 4CDOA 4XHMA 1JFUA 3TRXA 2C0DA 4K9ZA 3W8JA 4JR4A 3ZLPA 2LEGA 1MD3A 5CAXA 2JACA 3WGXA 4XS1A 5G30A 1A0RP 2LNSA 2H1DA 5CYYA 2X8HA 3Q19A 1XWCA 1MDJA 3PH9A 5DJMA 1X9MB 3F0IA 3IK7A 1HNBA 3VI7A 1X0RA 2FA8A 2B5YA 4NXIA 4POKA 5DDLA 1HNAA 1ON4A 1YKAA 3U6VA 1M0UA 3VK9A 3WYWA 1OE7A 3IK9A 5IM9A 3L0HA 2H1AA 3MWHA 3DVXA 4DSRA 3F6DA 4KE3A 2C0GA 5DAKA 4L5LA 3TRPA 3F3RA 4EKZA 2N5BA 1YZXA 3VFIA 4ECJA 2OADA 2J9HA 1GTBA 5BRTA 2LQQA 3EVIA 3GL5A 1E2YA 4PNGA 3KH7A 4V2NA 2B1KA 4X43A 3ZVJA 1K0AA 4BWQA 2QC7A 1GSSA 3R2QA 3DIEA 4X4JA 2VCTA 4X0XA 5A4VA 3G9BA 4D73A 3UL3A 5CRGA 2DJ3A 4RI7A 2GQLA 2GT6A 1G6WA 2X4AA 4K7NA 1V58A 5G5EA 2PPTA 1QFNA 4AGSA 3TB2A 2VUPA 1GP1A 1J0FA 1GNEA 1V9WA 1XW6A 2QKEA 1Q4JA 2KLXA 5GAND 2E7PA 4K5RA 2H6ZA 1V40A 3UJ1A 9GSSA 2GSRA 4WBJA 2PN8A 17GSA 1G7EA 4TVEA 4ECBA 4V1Ag 5ECIB 1ZYNA 3ZL5A 3TJJA 3KP9A 2NVLA 3M1GA 2OBIA 1SENA 4ZL8A 1DBYA 3FZAA 4ISDA 4MDCA 3F4SA 2NBSA 5EPFA 5F06A 1XBSA 2C4JA 5DCHA 1V57A 4IQ1A 2GZYA 1NSWA 3IRAA 4GTUA 3PPUA 1Y25A 4EXJA 2IMKA 2RM6A 3I69A 1MTCA 3CTGA 5H5QA 3HCZA 3FR6A 5IMCA 1K3LA 2C8UA 1MD4A 4XS6A 2FY6A 1XXUA 2LRCA 3ZZXA 2F3MA 1XW9A 4ZBDA 4IJIA 2YZUA 1ZOFA 1GULA 2CVDA 1F6MC 3ERFA 2IPAA 1O6JA 3W6GA 1A0FA 4OCEA 1EV4A 2YWMA 2PVQA 1XPVA 4HZ4A 4IS0A 4Z7XA 2G2QA 2JZSA 3EYTA 1CQGA 2FWHA 2ZNMA 2REMA 4EC0A 4IW9A 2CVKA 2HRNA 4K7IA 4ZXGA 2TIRA 1A2LA 1M2BA 2C0FA 2N5FA 3V1WA 4KA0A 2FWFA 1K0BA 1B4PA 3TKSC 2V6OA 1I9DA 4N30A 3C7MA 5DVBA 2A2PA 3E9JB 5DALB 4HU9A 4DSSB 4FYBA 3GURA 5J41A 2CT6A 1SJZA 3P8WA 4MP4A 5B6MA 3GH9A 3FK8A 4MNNA 4IHUA 3LQ7A 5KEJA 4PQIA 3FR3A 5KOXA 3P7XA 4V1Ap 4ID0A 1OVNA 3GSSA 3IAM2 6GSVA 4PQHA 5B7CA 4O5QA 3GV1A 2IY2A 1NHYA 1H75A 4IJ3A 3L9SA 1PD21 2FWGA 2A2SA 4KX4A 4GF0A 4MPFA 1WMJA 5JCWA 5DQSA 1H4OA 3RDWA 1GTAA 4HJ2A 2OE0A 3GH6A 4K6XA 1ZYPA 3IXRA 1PGTA 4FQUA 4AJ8A 2YJ7A 5IMZA 1PL1A 4X1UA 1ERTA 1LJRA 3TKPA 1AQVA 3IHGA 1TP9A 1GH2A 3HA9A 3DGQA 3GRXA 5CRDA 3G7YA 5E4WA 4IP6A 5COHA 2MMAA 4LMVA 2GT5A 1GSFA 1TI3A 3QAGA 4Q5NA 2IFQB 1U6TA 2DJKA 5ABRA 2V2GA 3M9KA 2DMMA 3GUSA 4ZIJA 2VD1A 2H1BA 2XC2A 2DKHA 1GUMA 5ECHB 4JEDA 4GSNA 2IIYA 4QQ7A 2R37A 2P5QA 5HFIA 4Z2TA 1WWJA 2H73A 2XBIA 3IC8A 2WCIA 2VCVA 4PUFC 4G0KA 3UBKA 2CQ9A 3UOMA 1Y6EA 1GWCA 2CX4A 2IMIA 5BMUA 1FB0A 1JLWA 4PTSA 2PBJA 2YANA 1ZCPA 4RQRA 4YQVA 1B9XC 1XWAA 4L0UA 2K9FA 2C3QA 2R3XA 1LU4A 2CX3A 1ST9A 2EC4A 4HDEA 2MZCA 3D22A 4USSA 1ZGNA 4WF4A 2B7JA 13GSA 1MDIA 4KF9A 3A5IA 4MJBA 1KBNA 1T4YA 3QD9A 4PQ1A 2R0GA 5D9VA 5ECRB 2GQMA 2KP2A 2A2RA 6GSXA 1F9MA 2IL3A 2WS2A 3L4NA 4D73B 3GTUA 1AW9A 4N11A 1SL0B 1WE0A 4MF7A 12GSA 3KTLA 2RM5A 4AJ6A 1FW1A 3E3EA 3J7Yk 1WPIA 2AV4A 1V98A 3ZMLA 4BPYA 3IAS2 1VGLA 2GQKA 1K0OA 3BD2A 2AAWA 4POMA 1AQWA 2WRTA 2BJXA 8GSSA 3FKFA 1A23A 4JU5A 2H8LA 4EUYA 3RPPA 5CO3A 2M46A 3WGEA 3TKQA 2FCHA 4KUNA 5J3RA 4DVCA 3C71A 4GCIA 4Q5FA 2L4QA 4JR6A 1SJ6A 2I3YA 1XW5A 4XS4A 4HZ2A 3ERWA 4F0BA 4MJAA 5ENUA 4EIPA 1M2AA 4XIHA 7GSSA 3O3TA 5EVOA 1GSQA 2YV7A 4I2UA 2CZ3A 4NAXA 1CQHA 2AHEA 5A4WA 3NIVA 1AIUA 4I5QA 2WJUA 3ME8A 2FD3A 1AC1A 3TJKA 3A2VA 3DRNA 5ECKB 1SYRA 4IQAA 3F6FA 2YP6A 5D8IA 1Z7PA 3H93A 3HVXA 2CAIA 1OKDA 3HXSA 1HYUA 2LUSA 4ML6A 3KCMA 2I81A 4G10A 1EGRA 1YEPA 1NM3A 1ERUA 1TRWA 3UVHA 2VO4A 4OMVA 3BCIA 3MNGA 1XVWA 1HQOA 3DEXA 3QFBC 2LRTA 3G7IA 1QQ2A 3PINA 4EO3A 3LYKA 4PX1A 2DLXA 5KOWA 3L9UA 4MF6A 4WETA 3D4TA 3D5JA 2E2GA 5IMAA 4YKGA 1UN2A 4HU7A 5HR3A 2AYTA 2R5GA 4TW5A 3RHCA 1SL2B 4AJ7A 1BAYA 4PURA 2AJQB 4GWRA 1EEMA 4MK3A 4ML1A 3TOTA 4MH3A 4YAPA 2HRFA 5G1KA 1OYJA 3I9V2 2FHEA 3QCPA 4LLRA 3IR4A 1R26A 2E2MA 1TRUA 1YQ1A 3HJOA 6GSSA 2VOCA 4K0GA 5D9TA 3ZFBA 3CSJA 4TR1B 5IOXA 1JLVA 4CHSA 1SK1A 5AGYA 3QR6A 5KN0A 1K0CA 3KM6A 2H0HA 1RK4A 4K8MA 1WRYA 1SYXA 2BMXA 3QFAC 1MEKA 4CW9A 1BJXA 4DSQA 2ALBA 4OWYA 2XBQA 1Z3EA 2YWOA 3ZRDA 4KCEA 4TXOB 3FW2A 5JCUA 1M7TA 1O8WA 2VCZA 3MYDA 1T8EB 1SU9A 4PNFA 3FEUA 1PL2A 3FRCA 2PWJA 3D6IA 3CRTA 2FLSA 4P3YB 4F03A 2WGRA 3NZNA 4WKWA 3KIJA 5G31A 5LNKe 4EE0A 3MIXA 4ACSA 5KN1A 1EOGA 3KTBA 4BVYA 1HD2A 2FGXA 3FHKA 4BL7A 1S3CA 2D2ZA 5IPHA 3F4TA 3O76A 3FMWA 1GUKA 3LXZA 1A2MA 2H1GA 1EP7A 2L6DA 3LYPA 1Z6MA 2B1LA 4HUAA 3KZQA 1U3IA 1AQXA 3GL3A 3LGCA 2OE1A 2A4HA 2H71A 1T7PB 4I97A 1M99A 3DYRA 5GSSA 2MMZA 4OD7A 4BWSA 18GSA 1WP0A 2IJYA 3ZVJD 2YN1A 3D21A 1FOVA 2O85A 3APSA 1F37A 4LMWA 5E59A 4O5UA 1O81A 5JWOB 3UBLA 1Z5YE 3FYGA 2NDOA 3W8SA 1XCCA 1JHBA 1NW2A 16GSA 3HZ8A 5FT3A 3GA4A 4F2IA 1XWKA 1SKSB 2HLSA 3VI5A 3ZYWA 1K0NA 2H0IA 3IHQA 5AISA 3IBHA 4ZL7A 4MABA 3UARA 4H86A 5CNWA 5CREA 1WOUA 2R0PA 1SD8A 1GTIA 1OC9B 5DBQA 2H75A 10GSA 1TI1A 2IMFA 3CMIA 1KNGA 3D0ZA 5B8BA 4MLYA 4J57E 3VPTA 2HT9A 1DSBA 1W4VA 1DE1A 1FHEA 3GNJA 5AN1A 1XZOA 1PMTA 3TGZA 3EMPA 5H5RA 2YNXA 1RW1A 2YWNA 4WR5A 3F3QA 2YWIA 1GSYA 1TRVA 2C0EA 2F9SA 5C00A 4FYUA 2YOIA 5CRHA 1OC8A 4BVXB 2B3SA 2PERA 2R0CA 2L4CA 2HXKA 4TRXA 5J5NA 1TK8B 3EMXA 1SL1B 3GKKA 1EZKA 4KSOA 2B5EA 3H79A 4KH7A 3KMOA 4K1FA 2GSTA 3HVVA 2LSTA 4CY6A 2EIQA 3GYKA 2P0GA 3GKNA 3APOA 3GN3A 4IELA 2RLIA 1J08A 4LL1B 1PN9A 5ID2B 5AIXA 1XWGA 1X9WB 3F9UA 1GUHA 4TR3A 3DMLA 1K3OA 1HNCA 3JCML 3DXBA 2TRXA 1TW9A 5J9BA 3A2XA 2LKUA 3TKSA 2XPDA 1KTEA 3CRUA 4NV2A 1O73A 5G5FA 1S3AA 1KEBA 1EP8A 3Q74A 2H01A 2YJHA 4J2FA 1T00A 2X8GA 4K0NA 1AXDA 2WDUA 4POBA 4F82A 3TDGA 5EL8A 1GSUA 2X99A 4O32A 3FZ4A 4EDZA 1USBA 2VLVA 4TKYA 1YY7A 3KD0A 4OFNA 3TJGA 3VWWA 4ZL9A 5G1LA 5G2ZA 2R2JA 1LBKA 4GRFA 3EE2A 2ZCTA 2L57A 1URMA 1FG4A 2LTKA 3APQA 2X49A 4KW6A 4YAVA 2WB9A 5HQPA 1Z9HA 4L5OA 3ERGA 11GSA 2OA7A 2WZ9A 5C04A 1R5AA 3A2WA 4OO5A 2OJLA 4L0WA 5ECSA 2BTOT 2ES7A 2OE3A 4G19A 1XWBA 4HI7A 2MMNA 3GX8A 3BOAA 4GQCA 2O8VB 1X5EA 2VL2C 4PXOA 5ECNB 5A5KA 2P5RA 4RQXA 1G6YA 1PSQA 4KNDA 3G7JA 4QL9A 1Z6NA 2YPMA 5DAKB 2PMTA 2EIOA 1FAAA 2IN3A 3KEBA 1B4QA 2NTOA 3TJBA 1GTUA 2WFCA 2L6CA 3FZ9A 5HR0A 3NOFA 3GX0A 5D73A 5LD0A 2LJRA 1TJDA 4PUAA 2YCDA 1A8LA 3GSTA 1ACVA 2K8SA 2YV9A 4FYCA 1B8XA 4OO4A 1GSDA 1QMVA 2FUG2 3F4RA 3AY8A 1FO5A 1XOAA 2HE3A 1TU8A 4GSTA 1K0MA 1M9BA 1O7UA 4BVYB 3WGDA 3DVWA 4BL7B 1A2JA 2LQOA 3N9JA 2CV4A 1GNWA 3TUEA 3SWLA 4AF2A 2IYJA 2PGTA 3LFLA 2YZHA 1F3AA 2H74A 4TR0A 2C3TA 1B9YC 4FO5A 2GGTA 3KXOA 1SKRB 4JE1A 3ZTLA 2H6YA 2WULA 1EEJA 2IWTA 4K5SA 2O89A 2DBCA 5DJLA 3U5RE 3PGTA 4NV5A 3GKMA 2KUCA 3EU4A 2H70A 1YJ6A 5J9CA 3QOUA 3IPZA 4HS1A 5DALA 2H6XA 4JBBA 4DSSA 2GS3A 2VM2A 1WIKA 2KHPA 1QGVA 1YDKA 1GLQA 5D9XA 3IOSA 4YQMA 4ECCA 5HFKA 1NHOA 4A5PA 2FA4A 2RUEA 3DD3A 3F8UA 4KDXA 3HD5A 2XPEA 2NPBA 5B8AA 3LG6A 3VURA 2B6MA 5EY6A 4OCFA 2PU9C 1UC7A 1TU7A 3IA1A 3DKSA 5LCZA 3HVSA 1A24A 5JWRB 2B5XA 3VWXA 1Q98A 3L78A 5KN3A 1JZWA 1THOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDY A;  2V1M A;  3UIW A;  4LA1 A;  2PUK C;  2M80 A;  2VCX A;  2QGV A;  3CTF A;  1QK8 A;  3KH9 A;  4K2D A;  1T3B A;  4F0C A;  4WBR D;  2A4V A;  1JZO A;  5CRW A;  4ZB8 A;  2VIM A;  1AUC A;  3OR5 A;  4IVF A;  2IFQ A;  4J56 E;  3ME7 A;  4ZB6 A;  2H76 A;  3H8Q A;  3FZ5 A;  4GSS A;  6GSU A;  4TN8 A;  3GMF A;  4E8H A;  3EC3 A;  3LOR A;  1X5D A;  3GFK A;  2V32 A;  3GHA A;  4ULX A;  1GLP A;  4N10 A;  2VM1 A;  3RPN A;  1SJI A;  2OAC A;  2HI7 A;  2GSS A;  4TXV A;  1YF1 A;  4IGJ A;  1TXX A;  2E0Q A;  4WEY A;  2O7K A;  3ZIJ A;  3QAV A;  1PKZ A;  1TK5 B;  5CP1 A;  4JZQ A;  3N5O A;  4MMM A;  2H30 A;  1QUW A;  4ZIL A;  2RUF A;  3LWA A;  3WT1 A;  3QMX A;  3ZMK A;  2I4A A;  4O5R A;  1R4W A;  2X64 A;  5INY A;  4NHW A;  2OKA A;  2HYX A;  2R6K A;  2RII A;  4O92 A;  1SK2 A;  1X5C A;  2TRC P;  2PVO C;  4V2M A;  2JZT A;  3A5W A;  3ZRE A;  4EF0 A;  1VF4 A;  4HQZ A;  1OE8 A;  2IME A;  1R5P A;  3RHB A;  5ECQ B;  3KGK A;  1YF0 A;  3CSH A;  4N0V A;  4NWY A;  4DEJ A;  5IO2 A;  1M2D A;  1YEX A;  1ERV A;  4KGI A;  3CBU A;  5KN2 A;  3BBY A;  1IYH A;  4Q5Q A;  1N2A A;  1U87 A;  2JZR A;  3C1R A;  2DJ2 A;  1R7H A;  1BG5 A;  3ZFL A;  1G7O A;  4NPB A;  5H5S A;  3HKR A;  3I6A A;  19GS A;  3HZ4 A;  4LL4 B;  3UVT A;  5ELA A;  4POL A;  4RI6 A;  1ZYQ B;  4YH2 A;  3M8N A;  3VWU A;  4O7H A;  4MCU A;  3MDK A;  3LXT A;  2P31 A;  4NHZ A;  2HZE A;  4I2T A;  5F05 A;  5FHI A;  1RQM A;  4QL7 A;  3LEF A;  4Q5R A;  2C80 A;  2F8F A;  4TOP A;  2C3N A;  2JSZ A;  3FR9 A;  2VCW A;  4MZB A;  2H66 A;  3WD6 A;  2I1U A;  3M3M A;  2OBK A;  5GAP D;  3MAK A;  2VL3 A;  3TJF A;  1XFL A;  5JCG A;  2O87 A;  2ON5 A;  1T4Z A;  5JWQ B;  2EIR A;  4HQS A;  6GSW A;  6GSY A;  1UA5 A;  3CXG A;  4KAE A;  3WT2 A;  3HHV A;  2J23 A;  2K18 A;  1SKW B;  5IPG A;  2DSA A;  1SK0 A;  3FY7 A;  4MF5 A;  5IIZ A;  3GTU B;  3HJP A;  4I6X A;  2DJ1 A;  5ECM B;  1BYE A;  2I9H A;  2Z9S A;  2F8A A;  1PX6 A;  3I43 A;  3TRQ A;  5IQY A;  2MYG A;  3BJ5 A;  1OAZ A;  2CAQ A;  2HZF A;  2LRN A;  1ABA A;  4KCA A;  1EWX A;  2GSQ A;  1PRX A;  4IN0 A;  2LS5 A;  5HR2 A;  2JSY A;  2L5L A;  2FNO A;  3CSI A;  1OKT A;  3IE3 A;  2MMO A;  2B7K A;  1ZL9 A;  1YKC A;  4XS4 B;  5A4U A;  1BQ7 A;  1QXH A;  3BCK A;  1VF2 A;  20GS A;  3KP8 A;  3RBT A;  3CYN A;  1JZR A;  3KMN A;  1THX A;  3QAW A;  2H72 A;  2LJA A;  2DIZ A;  4MZC A;  5J4U A;  1TOF A;  2LV3 A;  2IMD A;  3D4M A;  3UAP A;  4GXZ A;  4HEA 2;  4TR1 A;  4KB3 A;  14GS A;  3HDC A;  3IV4 A;  3VWV A;  2QSI A;  2L59 A;  3HY2 A;  2DJ0 A;  1TTZ A;  3QPM A;  1U88 A;  1F2E A;  2CZ2 A;  3ISO A;  2H0G A;  3EU3 A;  2AUV A;  1ZMA A;  4TXO A;  1TK0 B;  2VLU A;  2GVP A;  2VD0 A;  2K8V A;  1K0D A;  3DWV A;  5F0G A;  3L9V A;  2GLR A;  3C73 A;  1WJK A;  2CA8 A;  1XOB A;  3ZIT A;  4G2E A;  2GDR A;  5D9W A;  2HFD A;  5AIV A;  1EGO A;  1T1V A;  4E8E A;  2F51 A;  4IBP A;  4JRR A;  4WR4 A;  3IC4 A;  5IOW A;  2JU5 A;  1O8X A;  3C1S A;  4K7O A;  1ERW A;  2XHF A;  4EVM A;  5L71 A;  4YQU A;  4FIW A;  2FWE A;  4KDU A;  1E6B A;  4KSM A;  4BA7 A;  1FVJ A;  1G0T A;  5IO0 A;  1N8J A;  3IDV A;  3RAZ A;  3UEM A;  5ELG A;  4ECI A;  4V2L A;  1O85 A;  3KJY A;  1EOH A;  3HYP A;  1B48 A;  5DCG A;  1A8Y A;  1GSE A;  2LNT A;  5IMD A;  1X9S B;  4ZBB A;  4WXT A;  4ILF A;  3P90 A;  3HJM A;  4GQF A;  2AB6 A;  4NMU A;  4XCS A;  1BED A;  3EIN A;  4PGT A;  5ECO B;  2GTU A;  4ZBA A;  2H19 A;  1Z7R A;  4KDY A;  5B6N A;  6GST A;  3LSZ A;  5D96 A;  3UMA A;  1V2A A;  3K8N A;  2M72 A;  4GLT A;  2JAD A;  3US3 A;  4WF5 A;  2K6V A;  2R4V A;  4IKH A;  3PR8 A;  3VPQ A;  3Q18 A;  2L5O A;  1OC9 A;  2N5A A;  4G9H A;  5F8B A;  1ZZY A;  1M9A A;  2X8C A;  1I5G A;  2VL2 A;  4OFT A;  3ZIV A;  1PQN A;  1TKD B;  5D93 A;  1TRS A;  4MH2 A;  3TKS E;  3A3T A;  1VRS D;  1XIY A;  2VLT A;  2C1Y A;  3TKR A;  2MBT A;  3MSZ A;  3E0U A;  3SBC A;  4XTS A;  1FB6 A;  1F3B A;  1UVZ A;  3J7Y b;  2G0F A;  2V6K A;  4XRA A;  2CVB A;  4MJE A;  4BVX A;  2ON7 A;  4F9Z A;  2VL9 A;  3F63 A;  1ILO A;  2KOK A;  4FH8 A;  1MDK A;  1GRX A;  3VLN A;  2DJJ A;  1PX7 A;  5ECP B;  3M9J A;  3GKX A;  2KP1 A;  3TCO A;  2LJK A;  3LJR A;  2HZE B;  4TR4 A;  3S9F A;  5DQY A;  4OFM A;  1GL8 A;  1SD9 A;  1TDI A;  2DC5 A;  3QDN A;  3EUR A;  3C8E A;  1XVQ A;  5F07 A;  4N0Z A;  2GZP A;  1OC3 A;  1JZD A;  1ML6 A;  1PKW A;  3TOU A;  1K3Y A;  2HSH A;  1VF3 A;  1S3D A;  3EWL A;  1U3A A;  5HR1 A;  4ZB9 A;  2VAF A;  5GST A;  3M0F A;  5ID2 A;  4I8B A;  3Q6O A;  3H4K A;  1BX9 A;  3ED3 A;  1VF1 A;  5ECL B;  4MPG A;  2DIY A;  4IP1 A;  4MJC A;  5IMV A;  1DE2 A;  1EV9 A;  5FWG A;  4HOJ A;  4MA9 A;  3GIX A;  3P2A A;  4RUV A;  4EL1 A;  2HNL A;  3H1N A;  1ZYE A;  2MBS A;  2DML A;  2GZZ A;  5HFG A;  1AAZ A;  5GZZ B;  1IYI A;  2ZUP A;  4XRD A;  4MZW A;  1C72 A;  1DUG A;  1J9B A;  1PA3 A;  2JL4 A;  3O6T A;  5IMF A;  1FVK A;  1W89 A;  2V41 A;  22GS A;  4HJM A;  2HSY A;  4L8E A;  2VCQ A;  4CDO A;  4XHM A;  1JFU A;  3TRX A;  2C0D A;  4K9Z A;  3W8J A;  4JR4 A;  3ZLP A;  2LEG A;  1MD3 A;  5CAX A;  2JAC A;  3WGX A;  4XS1 A;  5G30 A;  1A0R P;  2LNS A;  2H1D A;  5CYY A;  2X8H A;  3Q19 A;  1XWC A;  1MDJ A;  3PH9 A;  5DJM A;  1X9M B;  3F0I A;  3IK7 A;  1HNB A;  3VI7 A;  1X0R A;  2FA8 A;  2B5Y A;  4NXI A;  4POK A;  5DDL A;  1HNA A;  1ON4 A;  1YKA A;  3U6V A;  1M0U A;  3VK9 A;  3WYW A;  1OE7 A;  3IK9 A;  5IM9 A;  3L0H A;  2H1A A;  3MWH A;  3DVX A;  4DSR A;  3F6D A;  4KE3 A;  2C0G A;  5DAK A;  4L5L A;  3TRP A;  3F3R A;  4EKZ A;  2N5B A;  1YZX A;  3VFI A;  4ECJ A;  2OAD A;  2J9H A;  1GTB A;  2LQQ A;  3EVI A;  3GL5 A;  1E2Y A;  4PNG A;  3KH7 A;  4V2N A;  2B1K A;  4X43 A;  3ZVJ A;  1K0A A;  4BWQ A;  2QC7 A;  1GSS A;  3R2Q A;  3DIE A;  2VCT A;  4X0X A;  5A4V A;  3G9B A;  4D73 A;  3UL3 A;  5CRG A;  2DJ3 A;  4RI7 A;  2GQL A;  2GT6 A;  1G6W A;  4K7N A;  1V58 A;  5G5E A;  2PPT A;  1QFN A;  4AGS A;  3TB2 A;  2VUP A;  1GP1 A;  1J0F A;  1GNE A;  1V9W A;  1XW6 A;  2QKE A;  1Q4J A;  2KLX A;  5GAN D;  2E7P A;  2H6Z A;  1V40 A;  3UJ1 A;  9GSS A;  2GSR A;  4WBJ A;  2PN8 A;  17GS A;  1G7E A;  4TVE A;  4ECB A;  4V1A g;  5ECI B;  3ZL5 A;  3TJJ A;  3KP9 A;  2NVL A;  3M1G A;  2OBI A;  1SEN A;  4ZL8 A;  1DBY A;  3FZA A;  4ISD A;  4MDC A;  3F4S A;  2NBS A;  5EPF A;  5F06 A;  1XBS A;  2C4J A;  5DCH A;  1V57 A;  4IQ1 A;  2GZY A;  1NSW A;  3IRA A;  4GTU A;  1Y25 A;  4EXJ A;  2IMK A;  2RM6 A;  3I69 A;  1MTC A;  3CTG A;  5H5Q A;  3HCZ A;  3FR6 A;  5IMC A;  1K3L A;  2C8U A;  1MD4 A;  4XS6 A;  2FY6 A;  1XXU A;  2LRC A;  3ZZX A;  2F3M A;  1XW9 A;  4ZBD A;  4IJI A;  2YZU A;  1ZOF A;  1GUL A;  2CVD A;  1F6M C;  3ERF A;  2IPA A;  1O6J A;  3W6G A;  1A0F A;  4OCE A;  1EV4 A;  2YWM A;  2PVQ A;  1XPV A;  4HZ4 A;  4IS0 A;  4Z7X A;  2G2Q A;  2JZS A;  3EYT A;  1CQG A;  2FWH A;  2ZNM A;  2REM A;  4EC0 A;  4IW9 A;  2CVK A;  2HRN A;  4K7I A;  4ZXG A;  2TIR A;  1A2L A;  1M2B A;  2C0F A;  2N5F A;  3V1W A;  4KA0 A;  2FWF A;  1K0B A;  1B4P A;  3TKS C;  2V6O A;  1I9D A;  4N30 A;  3C7M A;  5DVB A;  3E9J B;  5DAL B;  4HU9 A;  4DSS B;  4FYB A;  3GUR A;  5J41 A;  2CT6 A;  1SJZ A;  3P8W A;  4MP4 A;  5B6M A;  3GH9 A;  3FK8 A;  4IHU A;  3LQ7 A;  5KEJ A;  4PQI A;  3FR3 A;  3P7X A;  4V1A p;  4ID0 A;  1OVN A;  3GSS A;  3IAM 2;  6GSV A;  4PQH A;  5B7C A;  3GV1 A;  2IY2 A;  1NHY A;  1H75 A;  4IJ3 A;  3L9S A;  1PD2 1;  2FWG A;  2A2S A;  4KX4 A;  4GF0 A;  4MPF A;  1WMJ A;  5JCW A;  5DQS A;  1H4O A;  3RDW A;  1GTA A;  4HJ2 A;  2OE0 A;  3GH6 A;  4K6X A;  3IXR A;  1PGT A;  4AJ8 A;  2YJ7 A;  5IMZ A;  1PL1 A;  4X1U A;  1ERT A;  1LJR A;  3TKP A;  1AQV A;  1TP9 A;  1GH2 A;  3HA9 A;  3DGQ A;  3GRX A;  5CRD A;  3G7Y A;  5E4W A;  4IP6 A;  5COH A;  2MMA A;  4LMV A;  2GT5 A;  1GSF A;  1TI3 A;  3QAG A;  4Q5N A;  2IFQ B;  1U6T A;  2DJK A;  5ABR A;  2V2G A;  3M9K A;  2DMM A;  3GUS A;  4ZIJ A;  2VD1 A;  2H1B A;  2XC2 A;  1GUM A;  5ECH B;  4JED A;  4GSN A;  2IIY A;  4QQ7 A;  2R37 A;  2P5Q A;  5HFI A;  1WWJ A;  2H73 A;  2XBI A;  2WCI A;  2VCV A;  4PUF C;  3UBK A;  2CQ9 A;  3UOM A;  1Y6E A;  1GWC A;  2CX4 A;  2IMI A;  1FB0 A;  1JLW A;  2PBJ A;  2YAN A;  1ZCP A;  4RQR A;  4YQV A;  1B9X C;  1XWA A;  4L0U A;  2K9F A;  2C3Q A;  2R3X A;  1LU4 A;  2CX3 A;  1ST9 A;  2EC4 A;  4HDE A;  2MZC A;  3D22 A;  1ZGN A;  4WF4 A;  2B7J A;  13GS A;  1MDI A;  4MJB A;  1KBN A;  1T4Y A;  3QD9 A;  4PQ1 A;  5D9V A;  5ECR B;  2GQM A;  2KP2 A;  2A2R A;  6GSX A;  1F9M A;  2IL3 A;  2WS2 A;  3L4N A;  4D73 B;  3GTU A;  1AW9 A;  4N11 A;  1SL0 B;  1WE0 A;  4MF7 A;  12GS A;  3KTL A;  2RM5 A;  4AJ6 A;  1FW1 A;  3E3E A;  3J7Y k;  1WPI A;  2AV4 A;  1V98 A;  3ZML A;  4BPY A;  3IAS 2;  1VGL A;  2GQK A;  1K0O A;  3BD2 A;  2AAW A;  4POM A;  1AQW A;  2WRT A;  2BJX A;  8GSS A;  3FKF A;  1A23 A;  4JU5 A;  2H8L A;  4EUY A;  3RPP A;  5CO3 A;  2M46 A;  3WGE A;  3TKQ A;  2FCH A;  4KUN A;  5J3R A;  4DVC A;  3C71 A;  4GCI A;  4Q5F A;  2L4Q A;  4JR6 A;  1SJ6 A;  2I3Y A;  1XW5 A;  4XS4 A;  4HZ2 A;  3ERW A;  4F0B A;  4MJA A;  5ENU A;  1M2A A;  4XIH A;  7GSS A;  3O3T A;  5EVO A;  1GSQ A;  2YV7 A;  4I2U A;  2CZ3 A;  4NAX A;  1CQH A;  2AHE A;  5A4W A;  3NIV A;  1AIU A;  4I5Q A;  2WJU A;  3ME8 A;  2FD3 A;  1AC1 A;  3TJK A;  3A2V A;  3DRN A;  5ECK B;  1SYR A;  4IQA A;  3F6F A;  2YP6 A;  5D8I A;  1Z7P A;  3H93 A;  3HVX A;  2CAI A;  1OKD A;  3HXS A;  1HYU A;  2LUS A;  4ML6 A;  3KCM A;  2I81 A;  4G10 A;  1EGR A;  1YEP A;  1NM3 A;  1ERU A;  1TRW A;  3UVH A;  2VO4 A;  4OMV A;  3BCI A;  3MNG A;  1XVW A;  1HQO A;  3DEX A;  3QFB C;  2LRT A;  3G7I A;  1QQ2 A;  3PIN A;  4EO3 A;  3LYK A;  4PX1 A;  2DLX A;  3L9U A;  4MF6 A;  4WET A;  3D4T A;  3D5J A;  2E2G A;  5IMA A;  1UN2 A;  4HU7 A;  5HR3 A;  2AYT A;  2R5G A;  4TW5 A;  3RHC A;  1SL2 B;  4AJ7 A;  1BAY A;  4PUR A;  2AJQ B;  4GWR A;  1EEM A;  4MK3 A;  4ML1 A;  3TOT A;  4MH3 A;  4YAP A;  2HRF A;  5G1K A;  1OYJ A;  3I9V 2;  2FHE A;  3QCP A;  4LLR A;  3IR4 A;  1R26 A;  2E2M A;  1TRU A;  1YQ1 A;  3HJO A;  6GSS A;  2VOC A;  4K0G A;  5D9T A;  3ZFB A;  3CSJ A;  4TR1 B;  5IOX A;  1JLV A;  4CHS A;  1SK1 A;  5AGY A;  3QR6 A;  5KN0 A;  1K0C A;  3KM6 A;  2H0H A;  1RK4 A;  4K8M A;  1WRY A;  1SYX A;  2BMX A;  3QFA C;  1MEK A;  4CW9 A;  1BJX A;  4DSQ A;  2ALB A;  4OWY A;  2XBQ A;  1Z3E A;  2YWO A;  3ZRD A;  4KCE A;  4TXO B;  3FW2 A;  5JCU A;  1M7T A;  1O8W A;  2VCZ A;  1T8E B;  1SU9 A;  4PNF A;  3FEU A;  1PL2 A;  3FRC A;  2PWJ A;  3D6I A;  3CRT A;  2FLS A;  4P3Y B;  4F03 A;  2WGR A;  3NZN A;  4WKW A;  3KIJ A;  5G31 A;  5LNK e;  4EE0 A;  4ACS A;  5KN1 A;  1EOG A;  3KTB A;  4BVY A;  1HD2 A;  2FGX A;  3FHK A;  4BL7 A;  1S3C A;  2D2Z A;  5IPH A;  3F4T A;  3O76 A;  1GUK A;  3LXZ A;  1A2M A;  2H1G A;  1EP7 A;  2L6D A;  3LYP A;  1Z6M A;  2B1L A;  4HUA A;  3KZQ A;  1U3I A;  1AQX A;  3GL3 A;  3LGC A;  2OE1 A;  2H71 A;  1T7P B;  4I97 A;  1M99 A;  3DYR A;  5GSS A;  2MMZ A;  4OD7 A;  4BWS A;  18GS A;  1WP0 A;  2IJY A;  3ZVJ D;  2YN1 A;  3D21 A;  1FOV A;  2O85 A;  3APS A;  1F37 A;  4LMW A;  5E59 A;  1O81 A;  5JWO B;  3UBL A;  1Z5Y E;  3FYG A;  2NDO A;  3W8S A;  1XCC A;  1JHB A;  1NW2 A;  16GS A;  3HZ8 A;  5FT3 A;  3GA4 A;  4F2I A;  1XWK A;  1SKS B;  2HLS A;  3VI5 A;  3ZYW A;  1K0N A;  2H0I A;  3IHQ A;  5AIS A;  3IBH A;  4ZL7 A;  4MAB A;  3UAR A;  4H86 A;  5CNW A;  5CRE A;  1WOU A;  1SD8 A;  1GTI A;  1OC9 B;  5DBQ A;  2H75 A;  10GS A;  1TI1 A;  2IMF A;  3CMI A;  1KNG A;  3D0Z A;  5B8B A;  4MLY A;  4J57 E;  3VPT A;  2HT9 A;  1DSB A;  1W4V A;  1DE1 A;  1FHE A;  3GNJ A;  5AN1 A;  1XZO A;  1PMT A;  3TGZ A;  3EMP A;  5H5R A;  2YNX A;  1RW1 A;  2YWN A;  4WR5 A;  3F3Q A;  2YWI A;  1GSY A;  1TRV A;  2C0E A;  2F9S A;  5C00 A;  4FYU A;  2YOI A;  5CRH A;  1OC8 A;  2B3S A;  2PER A;  2L4C A;  2HXK A;  4TRX A;  5J5N A;  1TK8 B;  3EMX A;  1SL1 B;  3GKK A;  1EZK A;  4KSO A;  2B5E A;  3H79 A;  4KH7 A;  3KMO A;  4K1F A;  2GST A;  3HVV A;  2LST A;  2EIQ A;  3GYK A;  2P0G A;  3GKN A;  3APO A;  3GN3 A;  4IEL A;  2RLI A;  1J08 A;  4LL1 B;  1PN9 A;  5ID2 B;  5AIX A;  1XWG A;  1X9W B;  3F9U A;  1GUH A;  3DML A;  4TR3 A;  1K3O A;  1HNC A;  3JCM L;  3DXB A;  2TRX A;  1TW9 A;  5J9B A;  3A2X A;  2LKU A;  3TKS A;  2XPD A;  1KTE A;  3CRU A;  4NV2 A;  1O73 A;  5G5F A;  1S3A A;  1KEB A;  1EP8 A;  3Q74 A;  2H01 A;  2YJH A;  4J2F A;  1T00 A;  2X8G A;  4K0N A;  1AXD A;  2WDU A;  4POB A;  4F82 A;  3TDG A;  5EL8 A;  1GSU A;  2X99 A;  4O32 A;  3FZ4 A;  4EDZ A;  1USB A;  2VLV A;  4TKY A;  1YY7 A;  3KD0 A;  4OFN A;  3TJG A;  3VWW A;  4ZL9 A;  5G1L A;  5G2Z A;  2R2J A;  1LBK A;  4GRF A;  3EE2 A;  2ZCT A;  2L57 A;  1URM A;  1FG4 A;  2LTK A;  3APQ A;  4KW6 A;  4YAV A;  2WB9 A;  5HQP A;  1Z9H A;  4L5O A;  3ERG A;  11GS A;  2OA7 A;  2WZ9 A;  5C04 A;  1R5A A;  3A2W A;  4OO5 A;  2OJL A;  4L0W A;  5ECS A;  2BTO T;  2ES7 A;  2OE3 A;  4G19 A;  1XWB A;  4HI7 A;  2MMN A;  3GX8 A;  3BOA A;  4GQC A;  2O8V B;  1X5E A;  2VL2 C;  4PXO A;  5ECN B;  5A5K A;  2P5R A;  4RQX A;  1G6Y A;  1PSQ A;  4KND A;  3G7J A;  4QL9 A;  1Z6N A;  2YPM A;  5DAK B;  2PMT A;  2EIO A;  1FAA A;  2IN3 A;  3KEB A;  1B4Q A;  2NTO A;  3TJB A;  1GTU A;  2WFC A;  2L6C A;  3FZ9 A;  5HR0 A;  3NOF A;  3GX0 A;  5D73 A;  5LD0 A;  2LJR A;  1TJD A;  4PUA A;  2YCD A;  1A8L A;  3GST A;  1ACV A;  2K8S A;  2YV9 A;  4FYC A;  1B8X A;  4OO4 A;  1GSD A;  1QMV A;  2FUG 2;  3F4R A;  3AY8 A;  1FO5 A;  1XOA A;  2HE3 A;  1TU8 A;  4GST A;  1K0M A;  1M9B A;  1O7U A;  3WGD A;  3DVW A;  1A2J A;  2LQO A;  3N9J A;  2CV4 A;  1GNW A;  3TUE A;  3SWL A;  4AF2 A;  2IYJ A;  2PGT A;  3LFL A;  2YZH A;  1F3A A;  2H74 A;  4TR0 A;  2C3T A;  1B9Y C;  4FO5 A;  2GGT A;  3KXO A;  1SKR B;  4JE1 A;  3ZTL A;  2H6Y A;  2WUL A;  1EEJ A;  2IWT A;  2O89 A;  2DBC A;  5DJL A;  3U5R E;  3PGT A;  4NV5 A;  3GKM A;  2KUC A;  3EU4 A;  2H70 A;  1YJ6 A;  5J9C A;  3QOU A;  3IPZ A;  4HS1 A;  5DAL A;  2H6X A;  4JBB A;  4DSS A;  2GS3 A;  2VM2 A;  1WIK A;  2KHP A;  1QGV A;  1YDK A;  1GLQ A;  5D9X A;  3IOS A;  4YQM A;  4ECC A;  5HFK A;  1NHO A;  2FA4 A;  2RUE A;  3DD3 A;  3F8U A;  4KDX A;  3HD5 A;  2XPE A;  2NPB A;  5B8A A;  3LG6 A;  3VUR A;  2B6M A;  5EY6 A;  4OCF A;  2PU9 C;  1UC7 A;  1TU7 A;  3IA1 A;  3DKS A;  5LCZ A;  3HVS A;  1A24 A;  5JWR B;  2B5X A;  3VWX A;  1Q98 A;  3L78 A;  5KN3 A;  1JZW A;  1THO A; 
#chains in the Genus database with same CATH topology
 3X40 A;  4EDY A;  3GRD A;  2V1M A;  3UIW A;  4LA1 A;  1AR0 A;  2PUK C;  2M80 A;  2VCX A;  5AIF A;  2QGV A;  3CTF A;  4K61 A;  1QK8 A;  3KH9 A;  4K2D A;  1T3B A;  4F0C A;  4WBR D;  2A4V A;  1JZO A;  4HSC X;  5CRW A;  4ZB8 A;  3MSO A;  4HM5 B;  3A76 A;  2VIM A;  1AUC A;  3OR5 A;  4IVF A;  1B2M A;  2IFQ A;  4J56 E;  3UB1 A;  2UZ8 A;  3CCR 3;  3IJE B;  3ME7 A;  2QA4 3;  1X1U A;  4ZB6 A;  2H76 A;  1TP6 A;  3H8Q A;  3FZ5 A;  2RSX A;  4FMD A;  1ZS7 A;  4GSS A;  1RKY A;  1N8Q A;  1IYY A;  6GSU A;  4TN8 A;  3GMF A;  4E8H A;  3EC3 A;  4HM3 B;  4HM7 B;  3LOR A;  1BOX A;  1X5D A;  3GFK A;  1R4C A;  3V99 A;  2V32 A;  3EQQ B;  4N6L A;  3GHA A;  4ULX A;  1WMP A;  1GLP A;  3CNX A;  4N10 A;  2PNC A;  3G4S 3;  2VM1 A;  3RPN A;  2YFL B;  1SJI A;  1RHL A;  2OAC A;  2HI7 A;  2GSS A;  4TXV A;  1YF1 A;  4IGJ A;  1TXX A;  4K1U A;  1BGS A;  4J5G A;  2E0Q A;  4WEY A;  1OUN A;  2O7K A;  3ZIJ A;  3QAV A;  1PKZ A;  1TK5 B;  5CP1 A;  4JZQ A;  3WOD G;  1X1Y A;  3M8C A;  3N5O A;  4MMM A;  1LNI A;  2YFJ B;  2CH9 A;  1EQK A;  1QUW A;  1ZX2 A;  5BU4 A;  2H30 A;  4ZIL A;  2RUF A;  3LWA A;  3WT1 A;  3QMX A;  3ZMK A;  4K1V A;  2I4A A;  4O5R A;  1R4W A;  2X64 A;  5INY A;  1S5A A;  4NHW A;  4ICY A;  2OKA A;  2HYX A;  2R6K A;  4O2H A;  1TRQ A;  1YHQ 3;  2RII A;  2CFW A;  1RJO A;  4O92 A;  1SK2 A;  4Z2U A;  3Q3F A;  1X5C A;  2TRC P;  2KF5 A;  3Q2P A;  2PVO C;  4V2M A;  4NRE A;  2JZT A;  2K54 A;  3N9H A;  3A5W A;  3ZRE A;  4EF0 A;  1VF4 A;  4HQZ A;  1OE8 A;  3EX9 A;  2IME A;  1KSI A;  1R5P A;  3RHB A;  1ROV A;  3NX0 A;  3NUV A;  5ECQ B;  4O8S A;  3FZW A;  3KGK A;  2BMO B;  1YF0 A;  3CSH A;  4N0V A;  4NWY A;  3SOY A;  4DEJ A;  5IO2 A;  1M2D A;  1SPU A;  1YEX A;  1ERV A;  4KGI A;  3CBU A;  5KN2 A;  3BBY A;  1IYH A;  4Q5Q A;  4HBR A;  2CWV A;  1N2A A;  1B2S A;  1U87 A;  3PCS A;  3IMA B;  2JZR A;  3C1R A;  4KFD A;  2DJ2 A;  1NO3 A;  6RNT A;  1M3I A;  4G0L A;  1R7H A;  3WA3 A;  1BG5 A;  1LVN A;  2QA2 A;  3ZFL A;  1G7O A;  4NPB A;  5H5S A;  3HKR A;  3I6A A;  1NB3 I;  1DMM A;  1T5Y A;  1WNH A;  1MNL A;  19GS A;  5EEO A;  3HZ4 A;  2WO0 A;  4J8T A;  4LL4 B;  3UVT A;  3GZR A;  5ELA A;  4RI6 A;  4POL A;  1ZYQ B;  1IQX A;  2HRK A;  4YH2 A;  5I97 A;  3M8N A;  3KE7 A;  1FUT A;  1RMS A;  1KC8 4;  3VWU A;  1RGE A;  4O7H A;  4MCU A;  3MDK A;  1DMN A;  3LXT A;  3D5I A;  1Q40 B;  2P31 A;  1GS3 A;  2HZE A;  4I2T A;  3DM8 A;  5BVB A;  4NHZ A;  1AVK A;  5F05 A;  5FHI A;  1VQO 3;  3LTA A;  1RQM A;  1MOL A;  3FKA A;  4QL7 A;  4WFO A;  1WMO A;  4FMB A;  2OCT A;  3LEF A;  1JB2 A;  4Q5R A;  4XBY A;  1N5H A;  5BXQ A;  1TUH A;  2C80 A;  2F8F A;  1K8A 4;  1MWR A;  1NJI 4;  2C3N A;  4TOP A;  2JSZ A;  3FR9 A;  2HMO B;  2VCW A;  4MZB A;  2H66 A;  3WD6 A;  3KSP A;  2GBW B;  2I1U A;  3M3M A;  2OBK A;  3DGO A;  5IEN A;  5GAP D;  1YGE A;  1LXE A;  4KVH A;  3MAK A;  2UX0 A;  5LC6 A;  3STD A;  2VL3 A;  3TJF A;  1XFL A;  5JCG A;  2O87 A;  3F7X A;  4L8O A;  2ON5 A;  1T4Z A;  5JWQ B;  2EIR A;  1UCI A;  4HQS A;  6GSW A;  6GSY A;  1UA5 A;  3CXG A;  4KAE A;  3WT2 A;  3HHV A;  2J23 A;  2K18 A;  1SKW B;  5IPG A;  2DSA A;  1SK0 A;  5AII A;  2HRA A;  3FY7 A;  4MF5 A;  5IIZ A;  3GTU B;  3HJP A;  4I6X A;  2DJ1 A;  3CC7 3;  5ECM B;  2STD A;  1BYE A;  1IK3 A;  2I9H A;  1SAR A;  2CHC A;  2CWT A;  3NV0 A;  2Z9S A;  2F8A A;  1PX6 A;  3PXM A;  1YVB I;  3I43 A;  3TRQ A;  5IQY A;  2MYG A;  2KF3 A;  3BJ5 A;  4K2X A;  1Q7Y 4;  1OAZ A;  2CAQ A;  2HZF A;  1K73 4;  2LRN A;  1ABA A;  4WYK B;  4KCA A;  1EWX A;  1JJ2 2;  1X1W A;  2GSQ A;  1PRX A;  4LEH A;  2LS5 A;  2ZDJ A;  4IN0 A;  2YX9 A;  5HR2 A;  2JSY A;  2L5L A;  2FNO A;  2F99 A;  3LW9 A;  5IG0 A;  1Q7H A;  3CSI A;  1OKT A;  5IF6 A;  3IE3 A;  5IG4 A;  2MMO A;  2B7K A;  2CW9 A;  1ZL9 A;  2XGN A;  1YKC A;  3T0U A;  4XS4 B;  5A4U A;  3PGB A;  1BQ7 A;  1QXH A;  3BCK A;  1VF2 A;  20GS A;  3KP8 A;  3RBT A;  3CYN A;  3KKG A;  1JZR A;  3KMN A;  5TGN A;  2KXG A;  1THX A;  3QAW A;  2ZHX B;  2MC8 A;  1A2P A;  2W0Q A;  1BAN A;  2H72 A;  1W2Z A;  2LJA A;  2DIZ A;  3CNM A;  3MHE A;  4MZC A;  1AQZ A;  5J4U A;  3H51 A;  4TX4 A;  1TOF A;  2LV3 A;  2IMD A;  3D4M A;  3UAP A;  4GXZ A;  4HEA 2;  3CCM 3;  4TR1 A;  4KB3 A;  3DGN A;  14GS A;  1FGR A;  2Z7A A;  3HDC A;  1A2K A;  3IV4 A;  3VWV A;  2QSI A;  2L59 A;  3HY2 A;  2DKI A;  1FOH A;  1PN0 A;  2DJ0 A;  1TTZ A;  1F2E A;  1UGH I;  1U88 A;  5IW9 A;  2CZ2 A;  1RSN A;  3ISO A;  2H0G A;  3PCR A;  3EU3 A;  3R3E A;  2E2T A;  1G02 A;  1VQQ A;  2QEX 3;  2AUV A;  1ZMA A;  4TXO A;  3OWS A;  1TK0 B;  4JF8 A;  2VLU A;  2HOH A;  2GVP A;  2VD0 A;  2K8V A;  1K0D A;  3EN1 B;  1I70 A;  3DWV A;  5F0G A;  3L9V A;  2GLR A;  3C73 A;  3KII A;  1WJK A;  1A90 A;  4Z2R A;  2CA8 A;  1M90 4;  1IQ8 A;  1XOB A;  4CY8 A;  3JUN A;  3ZIT A;  4G2E A;  2GDR A;  5D9W A;  2HFD A;  1UDI I;  5AIV A;  1EGO A;  2OOV A;  1T1V A;  4E8E A;  2AAD A;  4BU4 A;  1ASK A;  2F51 A;  4IBP A;  4JRR A;  4WR4 A;  3IC4 A;  4FCZ A;  5IOW A;  2JU5 A;  3VSY A;  1O8X A;  3C1S A;  4K7O A;  1ERW A;  2XHF A;  4EVM A;  3MKI A;  3DUK A;  5L71 A;  2QGU A;  4YQU A;  2CWU A;  1C7H A;  4FIW A;  1BIR A;  2FWE A;  4KDU A;  1E6B A;  2QA1 A;  2W56 B;  3MWZ A;  3ECF A;  4KSM A;  4BA7 A;  2WGQ A;  1FVJ A;  1G0T A;  5IO0 A;  2XGL A;  1N8J A;  3IDV A;  3WHO A;  1I2G A;  4HM4 B;  3RAZ A;  3UEM A;  4YKF A;  5ELG A;  4ECI A;  3CCJ 3;  4I4K A;  1O85 A;  4V2L A;  3KJY A;  1EOH A;  3HYP A;  1YVS A;  1B48 A;  5DCG A;  4U13 A;  1A8Y A;  1GSE A;  4RZM A;  2LNT A;  1SIH A;  5IMD A;  4ZBB A;  4WXT A;  1X9S B;  4ILF A;  3P90 A;  2L4V A;  3HJM A;  4WP5 A;  4GQF A;  2AB6 A;  1T2H A;  3K0Z A;  4NMU A;  4XCS A;  1BED A;  3EIN A;  4PGT A;  5ECO B;  2GTU A;  4ZBA A;  3B7C A;  4N6T A;  2KCD A;  2H19 A;  2UGI A;  1Z7R A;  5FGO A;  4KDY A;  1HU9 A;  3NQY A;  1RCL A;  5B6N A;  6GST A;  3LSZ A;  3EE1 A;  5D96 A;  3T8U A;  1PY3 A;  2A15 A;  3UMA A;  1V2A A;  4OUQ A;  1YJ9 3;  3K8N A;  4X2O A;  2M72 A;  4GLT A;  2JAD A;  3US3 A;  3EBT A;  3UNL A;  4WF5 A;  2K6V A;  2R4V A;  1BSA A;  3CPW 2;  1EA2 A;  4IKH A;  2K0M A;  2ZL8 A;  3FLJ A;  3PR8 A;  1VQL 3;  1M3J A;  3VPQ A;  4R80 A;  4HM2 B;  5BIR A;  3Q18 A;  2L5O A;  1OC9 A;  2N5A A;  2Z6B A;  4G9H A;  5F8B A;  3CCS 3;  1ZZY A;  4O02 B;  1M9A A;  2CX1 A;  2X8C A;  1I5G A;  3CD6 3;  2VL2 A;  4OFT A;  3ZIV A;  1FUS A;  1PQN A;  3CU3 A;  1TKD B;  5D93 A;  4LZI A;  1TRS A;  2OTL 3;  4RNT A;  4MH2 A;  1DET A;  3TKS E;  3A3T A;  7RNT A;  2L1S A;  1VRS D;  1XIY A;  2VLT A;  2C1Y A;  3TKR A;  1YIT 3;  2MBT A;  1K28 A;  1Q42 A;  3MSZ A;  4EIQ A;  3E0U A;  3SBC A;  1WQL B;  4XTS A;  1J2B A;  1FB6 A;  1R4Y A;  1F3B A;  1UVZ A;  1M1K 4;  2E2V A;  3NM2 A;  3B4P A;  3J7Y b;  3OXA A;  4HYZ A;  2G0F A;  1FGT A;  2V6K A;  4XRA A;  3RGA A;  2CVB A;  4MJE A;  4BVX A;  1BRJ A;  1IQY A;  2ON7 A;  1AVL A;  4F9Z A;  4WHA A;  2VL9 A;  3F63 A;  1ILO A;  1B2X A;  2KOK A;  4FH8 A;  1LRA A;  5AIH A;  2Q07 A;  2Z76 A;  3BNB A;  1MDK A;  1GRX A;  3CQF A;  3VLN A;  2DJJ A;  1PX7 A;  5ECP B;  3M9J A;  2WOH A;  2RCD A;  2KP1 A;  3GKX A;  2LJK A;  3TCO A;  5AIG A;  3LJR A;  2HZE B;  4TR4 A;  3S9F A;  5DQY A;  4OFM A;  1GL8 A;  1SD9 A;  1TDI A;  2DC5 A;  3QDN A;  2RBI A;  1D6Y A;  4XDV A;  2P0X A;  3EUR A;  3C8E A;  1XVQ A;  5F07 A;  4N0Z A;  2Z77 A;  2W04 A;  2GZP A;  1OC3 A;  1JZD A;  1ML6 A;  1S3R A;  1PKW A;  2HSM A;  1K3Y A;  3TOU A;  3H3H A;  2HSH A;  5KP1 A;  1S3D A;  1VF3 A;  3EPT A;  3EWL A;  1U3A A;  5HR1 A;  4ZB9 A;  2VAF A;  4XB5 A;  3M0F A;  5GST A;  5ID2 A;  1RLS A;  4L8P A;  1UUG B;  3OWY A;  4I8B A;  3Q6O A;  3H4K A;  1BX9 A;  3ED3 A;  1VF1 A;  3WOE B;  5ECL B;  4MPG A;  2DIY A;  4IP1 A;  4MJC A;  5IMV A;  1DE2 A;  1EV9 A;  5FWG A;  3K9M C;  1RNB A;  1BNJ A;  3HZP A;  4HOJ A;  4MA9 A;  3GIX A;  3P2A A;  4RUV A;  4EL1 A;  2HNL A;  3H1N A;  4G0I A;  4EC6 A;  1ZYE A;  2MBS A;  4N6M A;  2DML A;  2GZZ A;  5HFG A;  1AAZ A;  5GZZ B;  1IYI A;  2ZUP A;  4XRD A;  4MZW A;  1C72 A;  1DUG A;  1J9B A;  3SED A;  1PA3 A;  2JL4 A;  3O6T A;  5IMF A;  1FVK A;  1W89 A;  1U8C B;  2V41 A;  22GS A;  4O3V A;  4HJM A;  1MWS A;  5DRE A;  2HSY A;  4L8E A;  1IT7 A;  2CK3 H;  3U1W A;  2VCQ A;  4CDO A;  4XHM A;  1JFU A;  3TRX A;  2C0D A;  1NWW A;  3EBY A;  4K9Z A;  3W8J A;  4JR4 A;  3ZLP A;  4EBG A;  2LEG A;  1MD3 A;  1A67 A;  5CAX A;  3MG2 A;  3KSE D;  2JAC A;  3DGY A;  1QVF 2;  3EHC A;  3HI7 A;  3WGX A;  4XS1 A;  3AMO B;  5G30 A;  3LZA A;  1A0R P;  2ML5 A;  2D1W A;  2LNS A;  2H1D A;  5CYY A;  1YIJ 3;  2X8H A;  1O7N B;  3Q19 A;  1XWC A;  1MDJ A;  3PH9 A;  5DJM A;  1X9M B;  1FGM A;  3F0I A;  3IK7 A;  1HNB A;  2HML B;  1VQ4 3;  5M1A A;  1BNG A;  3VI7 A;  1JBS A;  3F14 A;  1GY6 A;  2OQE A;  2OTJ 3;  1BRS A;  1X0R A;  4HM1 B;  2FA8 A;  2B5Y A;  4NXI A;  4POK A;  4MMX B;  1B21 A;  5DDL A;  1HNA A;  1ON4 A;  1OGX A;  1YKA A;  1YGW A;  3U6V A;  1M0U A;  2W9P A;  3VK9 A;  3WYW A;  4BIR A;  1W5Z A;  1OE7 A;  3IK9 A;  1IT8 A;  5IM9 A;  3L0H A;  2H1A A;  2F5W A;  5G2G A;  3MWH A;  2R4I A;  3DVX A;  4DSR A;  3F6D A;  4KE3 A;  1LQM B;  3LYG A;  2C0G A;  5DAK A;  4L5L A;  3TRP A;  3F3R A;  2FGT A;  4EKZ A;  2N5B A;  1TU5 A;  1UCK A;  1YZX A;  3VFI A;  1LOY A;  3K7C A;  4ECJ A;  2OAD A;  2J9H A;  1TRP A;  1GTB A;  2LQQ A;  5BRT A;  3EVI A;  4H3U A;  4KT3 B;  1VQ5 3;  3GL5 A;  1E2Y A;  4PNG A;  3QPM A;  1RGK A;  3KH7 A;  4V2N A;  2B1K A;  4X43 A;  3ZVJ A;  1K0A A;  4BWQ A;  2QC7 A;  1GSS A;  1QJG A;  3R2Q A;  3DIE A;  4X4J A;  5GSP A;  2VCT A;  2W9Q A;  3UJM A;  4X0X A;  5A4V A;  3G9B A;  4D73 A;  3UL3 A;  5CRG A;  2DJ3 A;  4RI7 A;  1PYL A;  2GQL A;  2GT6 A;  1G6W A;  2X4A A;  4K7N A;  1V58 A;  5IG5 A;  5G5E A;  2HMK B;  2PPT A;  1QFN A;  4AGS A;  1O7G B;  3TB2 A;  1OF5 B;  2VUP A;  1SJW A;  1GP1 A;  1J0F A;  2IUK A;  1FA3 A;  1GNE A;  1V9W A;  1XW6 A;  2QKE A;  3S28 A;  2WOF A;  1A2V A;  3FCS B;  1Q4J A;  2KLX A;  5GAN D;  2E7P A;  4K5R A;  2H6Z A;  1V40 A;  1STF I;  3UJ1 A;  1N8R 4;  9GSS A;  1QMA A;  1JRQ A;  1JV2 B;  2GSR A;  4WBJ A;  2BIR A;  2PN8 A;  2P05 A;  17GS A;  1G7E A;  3HK4 A;  3AHS A;  4TVE A;  4AEQ A;  4ECB A;  7GSP A;  1E3V A;  1S72 3;  1N9J A;  1I8V A;  5JBS A;  4R9L A;  3FG4 A;  2P0M A;  4V1A g;  5ECI B;  3WOF B;  2FNQ A;  1ZYN A;  3ZL5 A;  3TJJ A;  1RCK A;  2GBX B;  3KP9 A;  3VGN A;  2NVL A;  3M1G A;  2XR8 B;  3NXJ A;  4CJN A;  2OBI A;  2GEY A;  1EKM A;  1SEN A;  3I55 3;  4ZL8 A;  1DBY A;  3FZA A;  1RRH A;  3S27 A;  4ISD A;  4MDC A;  3F4S A;  3NQZ A;  3PZW A;  2NBS A;  5EPF A;  5F06 A;  5RNT A;  1XBS A;  2C4J A;  4MMZ B;  5DCH A;  1V57 A;  4IQ1 A;  1YI2 3;  2GZY A;  2D42 A;  1NSW A;  3IRA A;  4GTU A;  3PPU A;  1Y4K A;  1Y25 A;  4EXJ A;  2IMK A;  2RM6 A;  3I69 A;  1MTC A;  3CTG A;  5H5Q A;  3HCZ A;  2GU3 A;  1E3R A;  2B1X B;  3PS8 A;  3FR6 A;  3F7S A;  5IMC A;  1K3L A;  2C8U A;  1MD4 A;  3FG3 A;  1BNF A;  4XS6 A;  2R41 A;  1XXU A;  2FY6 A;  2LRC A;  3ZZX A;  2F3M A;  1XW9 A;  4ZBD A;  4IJI A;  2YZU A;  1YJW 3;  2UUG C;  1ZOF A;  1GUL A;  1LOX A;  2Y73 A;  2CVD A;  1F6M C;  3ERF A;  1JKG A;  2IPA A;  1O6J A;  3W6G A;  2F4Y A;  1A0F A;  4OCE A;  2RFR A;  1EV4 A;  2YWM A;  2PVQ A;  1XPV A;  4HZ4 A;  4IS0 A;  4BTW A;  1RTU A;  4Z7X A;  1RGC A;  3QRD A;  2G2Q A;  2JZS A;  3JUP A;  1MGR A;  3EYT A;  4XBT A;  1RRL A;  4CDL A;  1CQG A;  2FWH A;  8RNT A;  2ZNM A;  2REM A;  4EC0 A;  4IW9 A;  2CVK A;  2HRN A;  4K7I A;  4ZXG A;  2TIR A;  1A2L A;  1M2B A;  2C0F A;  2N5F A;  3V1W A;  1IV7 A;  4KA0 A;  2FWF A;  2CFG A;  1K0B A;  1B4P A;  3HVN A;  3TKS C;  5HGR A;  2HMJ B;  2INX A;  2V6O A;  1I9D A;  3JUQ A;  4N30 A;  3C7M A;  5DVB A;  1EG9 B;  3ALA A;  3F40 A;  2A2P A;  3E9J B;  4N6O B;  1OHO A;  5DAL B;  4HU9 A;  4DSS B;  2CC3 A;  4FYB A;  3GUR A;  5J41 A;  2CT6 A;  1SJZ A;  3P8W A;  4MP4 A;  4RBN A;  5B6M A;  3NM7 A;  3GH9 A;  3FK8 A;  4MNN A;  4IHU A;  3LQ7 A;  5KEJ A;  4PQI A;  5JPP A;  3CPO A;  3FR3 A;  1I3I A;  5KOX A;  6GSP A;  3HIG A;  3P7X A;  4V1A p;  4ID0 A;  1OVN A;  1B3S A;  3GSS A;  1BRI A;  3IAM 2;  6GSV A;  4PQH A;  5B7C A;  4O5Q A;  1JB5 A;  1MGW A;  2IY2 A;  4HKV B;  1NHY A;  3GV1 A;  1H75 A;  4FR9 A;  1GMR A;  4IJ3 A;  3G8Z A;  3L9S A;  1PD2 1;  3MYT A;  2FWG A;  2A2S A;  4KX4 A;  4GF0 A;  4X2H A;  4MPF A;  1WMJ A;  2CX0 A;  4GB5 A;  5IER A;  5JCW A;  5DQS A;  1H4O A;  3RDW A;  1GTA A;  4HJ2 A;  1BAO A;  5KP4 A;  2OE0 A;  3GH6 A;  4K6X A;  5IG3 A;  1ZYP A;  3IXR A;  1PGT A;  4FQU A;  4AJ8 A;  2YJ7 A;  4KFE A;  5IMZ A;  1PL1 A;  4Q53 A;  4X1U A;  4XM4 A;  3EC9 A;  1RN7 A;  4BL2 A;  1ERT A;  1LJR A;  3DXO A;  3E99 A;  4J9A A;  2KF4 A;  3TKP A;  1AQV A;  3IHG A;  1DVD A;  1JN5 A;  1TP9 A;  1GH2 A;  1JBT A;  3OV4 A;  3HA9 A;  3DGQ A;  3GRX A;  1PU4 A;  5CRD A;  3G7Y A;  5E4W A;  4IP6 A;  5COH A;  3HX8 A;  4HAA A;  1I0V A;  3MG3 A;  2Y74 A;  3KN4 A;  2MMA A;  4ZM8 A;  1GYB A;  4LMV A;  5LC7 A;  2GT5 A;  3G0K A;  1MWU A;  4IIA A;  1GSF A;  1D6Z A;  1TI3 A;  3QAG A;  4Q5N A;  5ELJ A;  2IFQ B;  5CXO A;  1FYS A;  2B24 B;  1U6T A;  3V92 A;  2DJK A;  5ABR A;  1IVU A;  1VQP 3;  2V2G A;  3M9K A;  2DMM A;  3GUS A;  3KZT A;  1W4N A;  2IUJ A;  4ZIJ A;  2VD1 A;  2H1B A;  3FSD A;  1KD1 4;  2XC2 A;  2DKH A;  1GUM A;  5ECH B;  4JED A;  4GSN A;  2IIY A;  4N6V 0;  1AV4 A;  3G16 A;  4OVM A;  1RGG A;  4QQ7 A;  2R37 A;  1M9G A;  2P5Q A;  4LGQ A;  5HFI A;  4R4K A;  4Z2T A;  1WWJ A;  2H73 A;  2XBI A;  3IC8 A;  4JRF A;  2WCI A;  2VCV A;  4PUF C;  4G0K A;  3UBK A;  1PFP A;  2CQ9 A;  3GZB A;  3UOM A;  1Y6E A;  1GWC A;  2CX4 A;  1FGO A;  2IMI A;  5BMU A;  1JLW A;  2SAR A;  1FB0 A;  2PBJ A;  2YAN A;  4PTS A;  1L5G B;  1ZCP A;  3OWU A;  3D9R A;  4CPK A;  4RQR A;  4YQV A;  1B9X C;  1XWA A;  4L0U A;  2K9F A;  2C3Q A;  2R3X A;  1LU4 A;  2F98 A;  2HMN B;  4STD A;  2BMQ B;  2CX3 A;  1ST9 A;  2EC4 A;  2CG1 A;  5M19 A;  1UCJ A;  4HDE A;  3F8H A;  2MZC A;  3A5E A;  3D22 A;  4USS A;  1ZGN A;  4WF4 A;  2B7J A;  13GS A;  3DGM A;  1MDI A;  4KF9 A;  3A5I A;  4MJB A;  2KF6 A;  1KBN A;  1T4Y A;  3LTB A;  1NDO B;  3BNE A;  1XG8 A;  3CCQ 3;  3QD9 A;  4PQ1 A;  5D83 A;  1FZU A;  2R0G A;  5D9V A;  5ECR B;  1GD4 A;  2GQM A;  2KP2 A;  2A2R A;  6GSX A;  1F9M A;  2IL3 A;  1OGZ A;  2I9W A;  1CYV A;  2WS2 A;  3L4N A;  4GL6 A;  3GTU A;  4D73 B;  2XEP A;  1AW9 A;  4N11 A;  3KCH A;  3CCE 3;  3F8X A;  1SL0 B;  1WE0 A;  4MF7 A;  12GS A;  3KTL A;  2RM5 A;  4AJ6 A;  2F5M A;  3D79 A;  1FW1 A;  3E3E A;  1FGQ A;  4EXR A;  3J7Y k;  1WPI A;  2AV4 A;  1V98 A;  3ZML A;  4BPY A;  1W02 A;  3IAS 2;  1JBR A;  1VGL A;  3QK9 A;  1NNV A;  2GEX A;  2GQK A;  3I0Y A;  1K0O A;  3BD2 A;  2AAW A;  1UUV B;  4POM A;  3ZG5 A;  1AQW A;  2WRT A;  2BJX A;  8GSS A;  3FKF A;  1A23 A;  4WYK A;  4JU5 A;  3CC4 3;  3G71 3;  2H8L A;  2XSH B;  4EUY A;  3LOY A;  1VQ8 3;  3CMA 3;  3RPP A;  5CO3 A;  2M46 A;  3WGE A;  3TKQ A;  1D6U A;  2FCH A;  1O7H B;  4KUN A;  1DMQ A;  5J3R A;  4DVC A;  3WA2 X;  3C71 A;  1BNE A;  1Q82 4;  4GCI A;  5D82 A;  4Q5F A;  1WMN A;  3FG1 A;  2YFI B;  2L4Q A;  2C11 A;  2ML6 A;  4JR6 A;  3DGL A;  3LH4 A;  1SJ6 A;  2I3Y A;  3S67 A;  1XW5 A;  4XS4 A;  4HZ2 A;  3ERW A;  4F0B A;  3PYJ A;  4BTX A;  4MJA A;  5ENU A;  4EIP A;  1M2A A;  4XIH A;  7GSS A;  3O3T A;  5EVO A;  1GSQ A;  2YV7 A;  4I2U A;  1RGF A;  1UCL A;  3I56 3;  1UGI A;  3BNC A;  2CZ3 A;  1CQH A;  4NAX A;  2AHE A;  4H61 A;  5A4W A;  3NIV A;  5CF2 A;  1IDP A;  3DZL A;  1AIU A;  4I5Q A;  2WJU A;  1ULJ B;  3ME8 A;  2FD3 A;  1AC1 A;  3TJK A;  3A2V A;  3DRN A;  3S29 A;  5ECK B;  1SYR A;  4IQA A;  3F6F A;  2YP6 A;  5D8I A;  1Z7P A;  3H93 A;  4HZ9 B;  3HVX A;  3RDE A;  2CAI A;  1OKD A;  3HXS A;  1HYU A;  2LUS A;  4ML6 A;  3KCM A;  1BSD A;  4NHF A;  2I81 A;  4G10 A;  2O3O A;  1EGR A;  1B20 A;  2F86 B;  2KAA A;  1YEP A;  1NM3 A;  1ERU A;  1TRW A;  1B27 A;  2BU4 A;  3X42 A;  3UVH A;  1WTH A;  2VO4 A;  4OMV A;  1BVI A;  3BCI A;  3MNG A;  1XVW A;  1HQO A;  1W2B 2;  1VQ6 3;  3DEX A;  3NV0 B;  3QFB C;  2LRT A;  2KRT A;  1W00 A;  1JKG B;  3G7I A;  1QQ2 A;  2IMJ A;  3PIN A;  4EO3 A;  1BUJ A;  1PFO A;  3LYK A;  4PX1 A;  2DLX A;  5KOW A;  1BNI A;  4K90 B;  3L9U A;  4MF6 A;  4WET A;  3D4T A;  3D5J A;  2E2G A;  1HKX A;  3FH1 A;  4R1K A;  3GZX B;  3SXX A;  5IMA A;  3JUM A;  4YKG A;  1UN2 A;  3WMD A;  4HU7 A;  1VZZ A;  1OHP A;  5HR3 A;  1VQ9 3;  3BB9 A;  2LQV A;  2AYT A;  2R5G A;  1NB5 I;  3DH2 A;  2XSO B;  4TW5 A;  3RHC A;  1GOU A;  1C54 A;  4AJ7 A;  1OHS A;  1SL2 B;  1B2Z A;  1BAY A;  4PUR A;  2AJQ B;  1CEW I;  3NBB A;  1GY7 A;  4GWR A;  1EEM A;  4MK3 A;  4FCJ A;  4ML1 A;  3X41 A;  3TOT A;  4MH3 A;  4YAP A;  2HRF A;  5G1K A;  1OYJ A;  3I9V 2;  2FHE A;  3L0R A;  3QCP A;  2W56 A;  3WR2 A;  4LLR A;  4RNZ A;  3BLZ A;  1BNS A;  3IR4 A;  4DKI A;  1RGA A;  1R26 A;  2PZV A;  1BRG A;  2E2M A;  2RGQ A;  2XH9 A;  4OK0 A;  1TRU A;  1Z1S A;  3ZFZ A;  1YQ1 A;  3HJO A;  6GSS A;  2VOC A;  2AAE A;  1OCV A;  4K0G A;  5D9T A;  3ZFB A;  3CSJ A;  4TR1 B;  5IOX A;  1JLV A;  4CHS A;  1SK1 A;  5AGY A;  3QR6 A;  5KN0 A;  1K0C A;  7STD A;  2H0H A;  3KM6 A;  1RK4 A;  4K8M A;  1I3F A;  3T8N A;  3JVC A;  3MPH A;  1WRY A;  1SYX A;  1OPY A;  2BMX A;  3Q90 A;  3QFA C;  2XFS A;  1MEK A;  4CW9 A;  1BJX A;  2QIY A;  4DSQ A;  2ALB A;  1W01 A;  4OWY A;  1N5P A;  2XBQ A;  1I0X A;  1Z3E A;  3O8Y A;  2YWO A;  3ZRD A;  4KCE A;  1SII A;  4TXO B;  1W6Y A;  1B2U A;  3GAX A;  3FW2 A;  5JCU A;  1M7T A;  3FF0 A;  1UI8 A;  2FXT A;  5DRV A;  3LT8 A;  3SOA A;  1O8W A;  2VCZ A;  3MYD A;  4BL3 A;  1T8E B;  1JN5 B;  1CH0 A;  1TTO A;  2O9U X;  1SU9 A;  3FEU A;  4PNF A;  1PL2 A;  3FRC A;  1KQS 2;  2PWJ A;  1BRK A;  3D6I A;  3CRT A;  2FLS A;  4P3Y B;  4F03 A;  2WGR A;  3NZN A;  1GSP A;  4WKW A;  3KIJ A;  5G31 A;  5LNK e;  4EE0 A;  3MIX A;  1BSB A;  4ACS A;  5KN1 A;  1EOG A;  3KTB A;  4BVY A;  1HD2 A;  4LMI A;  2GXF A;  1TIJ A;  4RNY A;  3RNT A;  2FGX A;  1MWT A;  3FHK A;  3RGR A;  4BL7 A;  3AHW A;  1S3C A;  2D2Z A;  5IPH A;  3Q1C A;  1UI7 A;  3LXU X;  4FMA A;  4HM8 B;  3F4T A;  3O76 A;  1W7C A;  3FMW A;  1GUK A;  1ROA A;  3LXZ A;  1A2M A;  3DMC A;  2H1G A;  3V98 A;  1EP7 A;  2L6D A;  2BHM A;  3BND A;  1DVC A;  1GMQ A;  3LYP A;  3SX1 A;  1Z6M A;  2B1L A;  4HUA A;  3KZQ A;  5IEO A;  1U3I A;  1AQX A;  3GL3 A;  3LGC A;  4FCM A;  2RNT A;  3LT9 A;  2OE1 A;  2A4H A;  2H71 A;  1T7P B;  1IVW A;  4I97 A;  1T2I A;  3MG1 A;  1M99 A;  3DYR A;  3LTC A;  2M7O A;  5GSS A;  2LYX A;  2MMZ A;  4OD7 A;  4BWS A;  18GS A;  1WP0 A;  2IJY A;  3ZVJ D;  2YN1 A;  3D21 A;  1FOV A;  2O85 A;  5ELU A;  3FGY A;  4XDW A;  3G6E 3;  3CC2 3;  3APS A;  1F37 A;  4LMW A;  4FMC A;  5E59 A;  4O5U A;  2C10 A;  5EQL A;  2JDI H;  1O81 A;  5JWO B;  5EVH A;  3UBL A;  4MMY B;  1DE3 A;  1Z5Y E;  3FYG A;  2NDO A;  2W03 A;  1W6C A;  3W8S A;  1XCC A;  1JHB A;  2CFD A;  1NW2 A;  16GS A;  3HZ8 A;  5FT3 A;  3GA4 A;  4XBX A;  2XRX B;  2XFT A;  4G1M B;  1XWK A;  3K5T A;  4BIK A;  4F2I A;  1SKS B;  2HLS A;  3VI5 A;  3ZYW A;  1K0N A;  2H0I A;  3IHQ A;  5AIS A;  9RNT A;  3IBH A;  3URP A;  4ZL7 A;  4MAB A;  3UAR A;  5HOH A;  4H86 A;  5CNW A;  5CRE A;  3SVA A;  1WOU A;  2R0P A;  1SD8 A;  3WDG B;  1GTI A;  1OC9 B;  2P09 A;  1RGL A;  1I2F A;  3VF1 A;  2H75 A;  3F9S A;  5DBQ A;  10GS A;  1TI1 A;  1VQ7 3;  2IMF A;  1QVG 2;  3BU4 A;  1O7M B;  3AGN A;  1BRH A;  3GWR A;  3CMI A;  5AEW B;  1KNG A;  3D0Z A;  4HM6 B;  5B8B A;  2CIU A;  3J7Y d;  4MLY A;  4J57 E;  4EW5 A;  1N9E A;  1RN4 A;  3VPT A;  4MEI A;  1YNV X;  2HT9 A;  1DSB A;  3CCV 3;  1W4V A;  1DE1 A;  1E97 A;  1FHE A;  3GNJ A;  5AN1 A;  1XZO A;  1PMT A;  5AEU B;  3TGZ A;  3EMP A;  5H5R A;  2YNX A;  1ISK A;  1RW1 A;  2YWN A;  4WR5 A;  3F3Q A;  2YWI A;  4KZ1 A;  3X3X A;  1GSY A;  1TRV A;  2C0E A;  2F9S A;  5C00 A;  4FYU A;  2YOI A;  5CRH A;  1OC8 A;  4BVX B;  2GSP A;  2B3S A;  1OH0 A;  2PER A;  2ZA4 A;  4R9K A;  2L4C A;  2R0C A;  5IEP A;  4CCV A;  4EV2 A;  2HXK A;  4TRX A;  1TFK A;  5J5N A;  3UL5 A;  1QAF A;  3AMO A;  1YJN 3;  1TK8 B;  2CKF B;  3EMX A;  1SL1 B;  3GKK A;  4AKY A;  1I2E A;  1EZK A;  2K3D A;  3B4O A;  1X1X A;  4KSO A;  1STD A;  5A0O B;  3OW2 2;  2CFK A;  4N3V A;  1M1X B;  2B5E A;  4PEJ A;  1RNT A;  4LSO A;  3H79 A;  4KH7 A;  5JPU A;  3KMO A;  4K1F A;  2GST A;  1V74 A;  3HVV A;  3D3L A;  3CXC 2;  3B8L A;  2LST A;  2OWP A;  4CY6 A;  2EIQ A;  3GYK A;  3U97 A;  2P0G A;  4IPB A;  3EF8 A;  4HZB B;  3GKN A;  3APO A;  3GN3 A;  4LYL B;  1GD3 A;  4IEL A;  3X3Z A;  2RLI A;  1J08 A;  4LL1 B;  1PN9 A;  5ID2 B;  5AIX A;  2OOV C;  2MF7 A;  3GSP A;  1EUI C;  1K9M 4;  1XWG A;  1UUW B;  3LML A;  1IV9 A;  2BT3 A;  1X9W B;  3AGO A;  1GUH A;  3DML A;  3F9U A;  1K3O A;  4TR3 A;  3EB8 A;  1FUW A;  1HNC A;  3JCM L;  2P38 A;  3DXB A;  2SBL A;  2TRX A;  3FF2 A;  1US1 A;  3ER7 A;  1TW9 A;  5J9B A;  1IVX A;  3A2X A;  2LKU A;  3TKS A;  1RGH A;  2XPD A;  1KTE A;  5KP3 A;  3CRU A;  4NV2 A;  1W6G A;  1O73 A;  5G5F A;  4HJL B;  1S3A A;  1KEB A;  1EP8 A;  3Q74 A;  2H01 A;  2YJH A;  4J2F A;  3SLU A;  1T00 A;  2X8G A;  4K0N A;  1ULI B;  2HMM B;  1AXD A;  3N54 B;  2WDU A;  4POB A;  4HVN A;  4QWT A;  4F82 A;  1GOV A;  3TDG A;  5EL8 A;  1GSU A;  2X99 A;  4O32 A;  3FZ4 A;  4EDZ A;  1BUQ A;  1USB A;  2VLV A;  1ZGX A;  1VQN 3;  4TKY A;  5STD A;  1YY7 A;  3NHX A;  3KD0 A;  4OFN A;  3TJG A;  3VWW A;  3NBR A;  4ZL9 A;  3JUO A;  5G1L A;  1IVV A;  4KFF A;  2F56 A;  5G2Z A;  2R2J A;  1LOW A;  1LBK A;  1OF5 A;  2BMR B;  2ZCT A;  3EE2 A;  4GRF A;  2L57 A;  3SYU A;  1URM A;  1FG4 A;  2LTK A;  3APQ A;  2X49 A;  4KW6 A;  4YAV A;  2WB9 A;  5HQP A;  2W6J H;  3IPT A;  1Z9H A;  4J5K A;  4L5O A;  3ERG A;  11GS A;  2OA7 A;  2WZ9 A;  5C04 A;  5D81 A;  1R5A A;  3A2W A;  4OO5 A;  2OJL A;  4L0W A;  3ROB A;  5ECS A;  3UL6 A;  2BTO T;  2ES7 A;  3LTD A;  2OE3 A;  4G19 A;  1XWB A;  1LOV A;  4HI7 A;  1O7P B;  1Q9E A;  2MMN A;  3GX8 A;  1GY5 A;  1Q40 A;  3CCU 3;  3BOA A;  4GQC A;  2O8V B;  3KFQ C;  1X5E A;  3D4A A;  4GSP A;  2VL2 C;  4PXO A;  5ECN B;  5A5K A;  2P5R A;  4RQX A;  1G6Y A;  1Q86 4;  1PSQ A;  4KND A;  4HM0 B;  3G7J A;  4QL9 A;  1LQG C;  1Z6N A;  2YPM A;  4EYC A;  5DAK B;  4GHO A;  2PMT A;  1TFO A;  1IU7 A;  2EIO A;  1FAA A;  1BSC A;  5AYR B;  2V1L A;  2IN3 A;  3HII A;  3KEB A;  1B4Q A;  1AY7 A;  1HZ1 A;  2XF3 A;  2NTO A;  3TJB A;  1F8N A;  2JQ5 A;  1GTU A;  2WFC A;  1Q81 4;  2L6C A;  3FZ9 A;  3NBJ A;  5HR0 A;  3NOF A;  3GX0 A;  4EV5 A;  5D73 A;  2BO9 B;  2BNG A;  5LD0 A;  3HOH A;  3N8B A;  2LJR A;  1TJD A;  4PUA A;  2YCD A;  1A8L A;  2CG0 A;  3GST A;  1ACV A;  2CFL A;  2K8S A;  2YV9 A;  4FYC A;  3OX9 A;  3K63 A;  1B8X A;  1G96 A;  4OO4 A;  1GSD A;  1QMV A;  2FUG 2;  3F4R A;  3AY8 A;  1FO5 A;  1XOA A;  2HE3 A;  1TU8 A;  4GST A;  3DY5 A;  1M9B A;  1K0M A;  4IT7 A;  1O7U A;  4BVY B;  4ORL A;  3WGD A;  3DVW A;  1O7W B;  4BL7 B;  1A2J A;  4AKZ A;  1DYU A;  2LQO A;  1U5O A;  3N9J A;  3CME 3;  3S5C A;  2CV4 A;  4MJD A;  1QAL A;  1GNW A;  3TUE A;  3GZY B;  3SWL A;  2E2U A;  4AF2 A;  2IA7 A;  2IYJ A;  2PGT A;  3LFL A;  2YZH A;  1F3A A;  3BIR A;  1K41 A;  2H74 A;  4TR0 A;  2C3T A;  1B9Y C;  4FO5 A;  5CK6 A;  1CQS A;  2GGT A;  3KXO A;  1SKR B;  6STD A;  2C4B A;  4JE1 A;  3ZTL A;  1KWI A;  1RDS A;  2H6Y A;  2J8X B;  2WUL A;  1EEJ A;  1VQM 3;  2IWT A;  4K5S A;  4WWU C;  1RN1 A;  2DBC A;  2O89 A;  2WGO A;  5DJL A;  3U5R E;  3PGT A;  4NV5 A;  5CLK A;  3GKM A;  2KUC A;  3EU4 A;  1JB4 A;  5M18 A;  1YJ6 A;  2H70 A;  5J9C A;  3QOU A;  3IPZ A;  4HS1 A;  5DAL A;  4N6U A;  2H6X A;  8CHO A;  4JBB A;  4DSS A;  2GS3 A;  2VM2 A;  1WIK A;  3ZG0 A;  2KHP A;  1QGV A;  1YDK A;  1GLQ A;  4BTY A;  2W2C A;  5D9X A;  1ZO2 A;  1GMP A;  3IOS A;  4YQM A;  4ECC A;  1BRN L;  5HFK A;  1NHO A;  4A5P A;  3D5G A;  2FA4 A;  2RUE A;  5FW5 A;  3DD3 A;  3F8U A;  1BSE A;  4KDX A;  3HD5 A;  2XPE A;  4L7K A;  1UW1 A;  1CYU A;  3EJV A;  2NPB A;  1FW7 A;  5B8A A;  1NU3 A;  1BNR A;  3LG6 A;  1GOY A;  3VUR A;  5CF1 A;  2B6M A;  5EY6 A;  4OCF A;  1HYF A;  2PU9 C;  1UC7 A;  1TU7 A;  2OQE C;  4N6N B;  3IA1 A;  3DKS A;  1LNH A;  5LCZ A;  1OAC A;  5AYS C;  3CCL 3;  3HVS A;  1A24 A;  5AI1 A;  4HOH A;  5JWR B;  2B5X A;  3VWX A;  3X3Y A;  1Q98 A;  3L78 A;  1QAK A;  1BU4 A;  1VQK 3;  5KN3 A;  2GU1 A;  1SQW A;  1JZW A;  3EN8 A;  1THO A;  1JNQ A; 
#chains in the Genus database with same CATH homology
 4EDY A;  2V1M A;  3UIW A;  4LA1 A;  2PUK C;  2M80 A;  2VCX A;  2QGV A;  3CTF A;  1QK8 A;  3KH9 A;  4K2D A;  1T3B A;  4F0C A;  4WBR D;  2A4V A;  1JZO A;  5CRW A;  4ZB8 A;  2VIM A;  1AUC A;  3OR5 A;  4IVF A;  2IFQ A;  4J56 E;  2UZ8 A;  3ME7 A;  4ZB6 A;  2H76 A;  3H8Q A;  3FZ5 A;  4GSS A;  6GSU A;  4TN8 A;  3GMF A;  4E8H A;  3EC3 A;  3LOR A;  1X5D A;  3GFK A;  2V32 A;  3GHA A;  4ULX A;  1GLP A;  4N10 A;  2VM1 A;  3RPN A;  1SJI A;  2OAC A;  2HI7 A;  2GSS A;  4TXV A;  1YF1 A;  4IGJ A;  1TXX A;  2E0Q A;  4WEY A;  2O7K A;  3ZIJ A;  3QAV A;  1PKZ A;  1TK5 B;  5CP1 A;  4JZQ A;  3N5O A;  4MMM A;  2H30 A;  1QUW A;  4ZIL A;  2RUF A;  3LWA A;  3WT1 A;  3QMX A;  3ZMK A;  2I4A A;  4O5R A;  1R4W A;  2X64 A;  5INY A;  4NHW A;  4ICY A;  2OKA A;  2HYX A;  2R6K A;  2RII A;  4O92 A;  4Z2U A;  1SK2 A;  1X5C A;  2TRC P;  2PVO C;  4V2M A;  2JZT A;  3A5W A;  3ZRE A;  4EF0 A;  1VF4 A;  4HQZ A;  1OE8 A;  2IME A;  1R5P A;  3RHB A;  5ECQ B;  3KGK A;  1YF0 A;  3CSH A;  4N0V A;  4NWY A;  4DEJ A;  5IO2 A;  1M2D A;  1YEX A;  1ERV A;  4KGI A;  3CBU A;  5KN2 A;  3BBY A;  1IYH A;  4Q5Q A;  1N2A A;  1U87 A;  2JZR A;  3C1R A;  2DJ2 A;  4G0L A;  1R7H A;  1BG5 A;  2QA2 A;  3ZFL A;  1G7O A;  4NPB A;  5H5S A;  3HKR A;  3I6A A;  19GS A;  3HZ4 A;  4LL4 B;  3UVT A;  5ELA A;  4POL A;  4RI6 A;  1ZYQ B;  2HRK A;  4YH2 A;  3M8N A;  3VWU A;  4O7H A;  4MCU A;  3MDK A;  3LXT A;  2P31 A;  4NHZ A;  2HZE A;  4I2T A;  5F05 A;  5FHI A;  1RQM A;  4QL7 A;  3LEF A;  4Q5R A;  2C80 A;  2F8F A;  4TOP A;  2C3N A;  2JSZ A;  3FR9 A;  2VCW A;  4MZB A;  2H66 A;  3WD6 A;  2I1U A;  3M3M A;  2OBK A;  5GAP D;  3MAK A;  2VL3 A;  3TJF A;  1XFL A;  5JCG A;  2O87 A;  2ON5 A;  1T4Z A;  5JWQ B;  2EIR A;  4HQS A;  6GSW A;  6GSY A;  1UA5 A;  3CXG A;  4KAE A;  3WT2 A;  3HHV A;  2J23 A;  2K18 A;  1SKW B;  5IPG A;  2DSA A;  1SK0 A;  2HRA A;  3FY7 A;  4MF5 A;  5IIZ A;  3GTU B;  3HJP A;  4I6X A;  2DJ1 A;  5ECM B;  1BYE A;  2I9H A;  2Z9S A;  2F8A A;  1PX6 A;  3I43 A;  3TRQ A;  5IQY A;  2MYG A;  3BJ5 A;  1OAZ A;  2CAQ A;  2HZF A;  2LRN A;  1ABA A;  4KCA A;  1EWX A;  2GSQ A;  1PRX A;  4IN0 A;  2LS5 A;  5HR2 A;  2JSY A;  2L5L A;  2FNO A;  3LW9 A;  3CSI A;  1OKT A;  3IE3 A;  2MMO A;  2B7K A;  1ZL9 A;  1YKC A;  4XS4 B;  5A4U A;  1BQ7 A;  1QXH A;  3BCK A;  1VF2 A;  20GS A;  3KP8 A;  3RBT A;  3CYN A;  1JZR A;  3KMN A;  1THX A;  3QAW A;  2H72 A;  2LJA A;  2DIZ A;  4MZC A;  5J4U A;  1TOF A;  2LV3 A;  2IMD A;  3D4M A;  3UAP A;  4GXZ A;  4HEA 2;  4TR1 A;  4KB3 A;  14GS A;  3HDC A;  3IV4 A;  3VWV A;  2QSI A;  2L59 A;  3HY2 A;  2DKI A;  1FOH A;  1PN0 A;  2DJ0 A;  1TTZ A;  3QPM A;  4K2X A;  1U88 A;  1F2E A;  2CZ2 A;  3ISO A;  2H0G A;  3EU3 A;  3R3E A;  2AUV A;  1ZMA A;  4TXO A;  1TK0 B;  2VLU A;  2GVP A;  2VD0 A;  2K8V A;  1K0D A;  3DWV A;  5F0G A;  3L9V A;  2GLR A;  3C73 A;  1WJK A;  4Z2R A;  2CA8 A;  1XOB A;  4CY8 A;  3ZIT A;  4G2E A;  2GDR A;  5D9W A;  2HFD A;  5AIV A;  1EGO A;  1T1V A;  4E8E A;  2F51 A;  4IBP A;  4JRR A;  4WR4 A;  3IC4 A;  5IOW A;  2JU5 A;  1O8X A;  3C1S A;  4K7O A;  1ERW A;  2XHF A;  4EVM A;  5L71 A;  4YQU A;  4FIW A;  2FWE A;  4KDU A;  1E6B A;  2QA1 A;  4KSM A;  4BA7 A;  1FVJ A;  1G0T A;  5IO0 A;  1N8J A;  3IDV A;  3RAZ A;  3UEM A;  4YKF A;  5ELG A;  4ECI A;  4V2L A;  1O85 A;  3KJY A;  1EOH A;  3HYP A;  1B48 A;  5DCG A;  1A8Y A;  1GSE A;  2LNT A;  5IMD A;  1X9S B;  4ZBB A;  4WXT A;  4ILF A;  3P90 A;  3HJM A;  4GQF A;  2AB6 A;  4NMU A;  4XCS A;  1BED A;  3EIN A;  4PGT A;  5ECO B;  2GTU A;  4ZBA A;  2H19 A;  1Z7R A;  4KDY A;  5B6N A;  6GST A;  3LSZ A;  5D96 A;  3UMA A;  1V2A A;  3K8N A;  2M72 A;  4GLT A;  2JAD A;  3US3 A;  4WF5 A;  2K6V A;  2R4V A;  4IKH A;  3PR8 A;  3VPQ A;  3Q18 A;  2L5O A;  1OC9 A;  2N5A A;  4G9H A;  5F8B A;  1ZZY A;  1M9A A;  2X8C A;  1I5G A;  2VL2 A;  4OFT A;  3ZIV A;  1PQN A;  1TKD B;  5D93 A;  1TRS A;  4MH2 A;  3TKS E;  3A3T A;  1VRS D;  1XIY A;  2VLT A;  2C1Y A;  3TKR A;  2MBT A;  3MSZ A;  4EIQ A;  3E0U A;  3SBC A;  4XTS A;  1FB6 A;  1F3B A;  1UVZ A;  3J7Y b;  2G0F A;  2V6K A;  4XRA A;  2CVB A;  4MJE A;  4BVX A;  2ON7 A;  4F9Z A;  2VL9 A;  3F63 A;  1ILO A;  2KOK A;  4FH8 A;  1MDK A;  1GRX A;  3VLN A;  2DJJ A;  1PX7 A;  5ECP B;  3M9J A;  3GKX A;  2KP1 A;  3TCO A;  2LJK A;  3LJR A;  2HZE B;  4TR4 A;  3S9F A;  5DQY A;  4OFM A;  1GL8 A;  1SD9 A;  1TDI A;  2DC5 A;  3QDN A;  3EUR A;  3C8E A;  1XVQ A;  5F07 A;  4N0Z A;  2GZP A;  1OC3 A;  1JZD A;  1ML6 A;  1PKW A;  2HSM A;  3TOU A;  1K3Y A;  2HSH A;  1VF3 A;  1S3D A;  3EPT A;  3EWL A;  1U3A A;  5HR1 A;  4ZB9 A;  2VAF A;  5GST A;  3M0F A;  5ID2 A;  4I8B A;  3Q6O A;  3H4K A;  1BX9 A;  3ED3 A;  1VF1 A;  5ECL B;  4MPG A;  2DIY A;  4IP1 A;  4MJC A;  5IMV A;  1DE2 A;  1EV9 A;  5FWG A;  4HOJ A;  4MA9 A;  3GIX A;  3P2A A;  4RUV A;  4EL1 A;  2HNL A;  3H1N A;  4G0I A;  1ZYE A;  2MBS A;  2DML A;  2GZZ A;  5HFG A;  1AAZ A;  5GZZ B;  1IYI A;  2ZUP A;  4XRD A;  4MZW A;  1C72 A;  1DUG A;  1J9B A;  1PA3 A;  2JL4 A;  3O6T A;  5IMF A;  1FVK A;  1W89 A;  2V41 A;  22GS A;  4HJM A;  2HSY A;  4L8E A;  2VCQ A;  4CDO A;  4XHM A;  1JFU A;  3TRX A;  2C0D A;  4K9Z A;  3W8J A;  4JR4 A;  3ZLP A;  2LEG A;  1MD3 A;  5CAX A;  2JAC A;  3WGX A;  4XS1 A;  5G30 A;  1A0R P;  2LNS A;  2H1D A;  5CYY A;  2X8H A;  3Q19 A;  1XWC A;  1MDJ A;  3PH9 A;  5DJM A;  1X9M B;  3F0I A;  3IK7 A;  1HNB A;  3VI7 A;  1X0R A;  2FA8 A;  2B5Y A;  4NXI A;  4POK A;  5DDL A;  1HNA A;  1ON4 A;  1YKA A;  3U6V A;  1M0U A;  3VK9 A;  3WYW A;  1OE7 A;  3IK9 A;  5IM9 A;  3L0H A;  2H1A A;  3MWH A;  3DVX A;  4DSR A;  3F6D A;  4KE3 A;  2C0G A;  5DAK A;  4L5L A;  3TRP A;  3F3R A;  4EKZ A;  2N5B A;  1YZX A;  3VFI A;  4ECJ A;  2OAD A;  2J9H A;  1GTB A;  5BRT A;  2LQQ A;  3EVI A;  3GL5 A;  1E2Y A;  4PNG A;  3KH7 A;  4V2N A;  2B1K A;  4X43 A;  3ZVJ A;  1K0A A;  4BWQ A;  2QC7 A;  1GSS A;  3R2Q A;  3DIE A;  4X4J A;  2VCT A;  4X0X A;  5A4V A;  3G9B A;  4D73 A;  3UL3 A;  5CRG A;  2DJ3 A;  4RI7 A;  2GQL A;  2GT6 A;  1G6W A;  2X4A A;  4K7N A;  1V58 A;  5G5E A;  2PPT A;  1QFN A;  4AGS A;  3TB2 A;  2VUP A;  1GP1 A;  1J0F A;  1GNE A;  1V9W A;  1XW6 A;  2QKE A;  1Q4J A;  2KLX A;  5GAN D;  2E7P A;  4K5R A;  2H6Z A;  1V40 A;  3UJ1 A;  9GSS A;  2GSR A;  4WBJ A;  2PN8 A;  17GS A;  1G7E A;  4TVE A;  4ECB A;  4V1A g;  5ECI B;  1ZYN A;  3ZL5 A;  3TJJ A;  3KP9 A;  2NVL A;  3M1G A;  2OBI A;  1SEN A;  4ZL8 A;  1DBY A;  3FZA A;  4ISD A;  4MDC A;  3F4S A;  2NBS A;  5EPF A;  5F06 A;  1XBS A;  2C4J A;  5DCH A;  1V57 A;  4IQ1 A;  2GZY A;  1NSW A;  3IRA A;  4GTU A;  3PPU A;  1Y25 A;  4EXJ A;  2IMK A;  2RM6 A;  3I69 A;  1MTC A;  3CTG A;  5H5Q A;  3HCZ A;  3FR6 A;  5IMC A;  1K3L A;  2C8U A;  1MD4 A;  4XS6 A;  2FY6 A;  1XXU A;  2LRC A;  3ZZX A;  2F3M A;  1XW9 A;  4ZBD A;  4IJI A;  2YZU A;  1ZOF A;  1GUL A;  2CVD A;  1F6M C;  3ERF A;  2IPA A;  1O6J A;  3W6G A;  1A0F A;  4OCE A;  1EV4 A;  2YWM A;  2PVQ A;  1XPV A;  4HZ4 A;  4IS0 A;  4Z7X A;  2G2Q A;  2JZS A;  3EYT A;  1CQG A;  2FWH A;  2ZNM A;  2REM A;  4EC0 A;  4IW9 A;  2CVK A;  2HRN A;  4K7I A;  4ZXG A;  2TIR A;  1A2L A;  1M2B A;  2C0F A;  2N5F A;  3V1W A;  4KA0 A;  2FWF A;  1K0B A;  1B4P A;  3TKS C;  2V6O A;  1I9D A;  4N30 A;  3C7M A;  5DVB A;  2A2P A;  3E9J B;  5DAL B;  4HU9 A;  4DSS B;  4FYB A;  3GUR A;  5J41 A;  2CT6 A;  1SJZ A;  3P8W A;  4MP4 A;  5B6M A;  3GH9 A;  3FK8 A;  4MNN A;  4IHU A;  3LQ7 A;  5KEJ A;  4PQI A;  3FR3 A;  5KOX A;  3P7X A;  4V1A p;  4ID0 A;  1OVN A;  3GSS A;  3IAM 2;  6GSV A;  4PQH A;  5B7C A;  4O5Q A;  3GV1 A;  2IY2 A;  1NHY A;  1H75 A;  4IJ3 A;  3L9S A;  1PD2 1;  2FWG A;  2A2S A;  4KX4 A;  4GF0 A;  4MPF A;  1WMJ A;  5JCW A;  5DQS A;  1H4O A;  3RDW A;  1GTA A;  4HJ2 A;  2OE0 A;  3GH6 A;  4K6X A;  1ZYP A;  3IXR A;  1PGT A;  4FQU A;  4AJ8 A;  2YJ7 A;  5IMZ A;  1PL1 A;  4X1U A;  1ERT A;  1LJR A;  3TKP A;  1AQV A;  3IHG A;  1TP9 A;  1GH2 A;  3HA9 A;  3DGQ A;  3GRX A;  5CRD A;  3G7Y A;  5E4W A;  4IP6 A;  5COH A;  2MMA A;  4LMV A;  2GT5 A;  1GSF A;  1TI3 A;  3QAG A;  4Q5N A;  2IFQ B;  1U6T A;  2DJK A;  5ABR A;  2V2G A;  3M9K A;  2DMM A;  3GUS A;  4ZIJ A;  2VD1 A;  2H1B A;  2XC2 A;  2DKH A;  1GUM A;  5ECH B;  4JED A;  4GSN A;  2IIY A;  4QQ7 A;  2R37 A;  2P5Q A;  5HFI A;  4Z2T A;  1WWJ A;  2H73 A;  2XBI A;  3IC8 A;  2WCI A;  2VCV A;  4PUF C;  4G0K A;  3UBK A;  2CQ9 A;  3UOM A;  1Y6E A;  1GWC A;  2CX4 A;  2IMI A;  5BMU A;  1FB0 A;  1JLW A;  4PTS A;  2PBJ A;  2YAN A;  1ZCP A;  4RQR A;  4YQV A;  1B9X C;  1XWA A;  4L0U A;  2K9F A;  2C3Q A;  2R3X A;  1LU4 A;  2CX3 A;  1ST9 A;  2EC4 A;  4HDE A;  2MZC A;  3D22 A;  4USS A;  1ZGN A;  4WF4 A;  2B7J A;  13GS A;  1MDI A;  4KF9 A;  3A5I A;  4MJB A;  1KBN A;  1T4Y A;  3QD9 A;  4PQ1 A;  2R0G A;  5D9V A;  5ECR B;  2GQM A;  2KP2 A;  2A2R A;  6GSX A;  1F9M A;  2IL3 A;  2WS2 A;  3L4N A;  4D73 B;  3GTU A;  1AW9 A;  4N11 A;  1SL0 B;  1WE0 A;  4MF7 A;  12GS A;  3KTL A;  2RM5 A;  4AJ6 A;  1FW1 A;  3E3E A;  3J7Y k;  1WPI A;  2AV4 A;  1V98 A;  3ZML A;  4BPY A;  3IAS 2;  1VGL A;  2GQK A;  1K0O A;  3BD2 A;  2AAW A;  4POM A;  1AQW A;  2WRT A;  2BJX A;  8GSS A;  3FKF A;  1A23 A;  4JU5 A;  2H8L A;  4EUY A;  3RPP A;  5CO3 A;  2M46 A;  3WGE A;  3TKQ A;  2FCH A;  4KUN A;  5J3R A;  4DVC A;  3C71 A;  4GCI A;  4Q5F A;  2L4Q A;  4JR6 A;  1SJ6 A;  2I3Y A;  1XW5 A;  4XS4 A;  4HZ2 A;  3ERW A;  4F0B A;  4MJA A;  5ENU A;  4EIP A;  1M2A A;  4XIH A;  7GSS A;  3O3T A;  5EVO A;  1GSQ A;  2YV7 A;  4I2U A;  2CZ3 A;  4NAX A;  1CQH A;  2AHE A;  5A4W A;  3NIV A;  1AIU A;  4I5Q A;  2WJU A;  3ME8 A;  2FD3 A;  1AC1 A;  3TJK A;  3A2V A;  3DRN A;  5ECK B;  1SYR A;  4IQA A;  3F6F A;  2YP6 A;  5D8I A;  1Z7P A;  3H93 A;  3HVX A;  2CAI A;  1OKD A;  3HXS A;  1HYU A;  2LUS A;  4ML6 A;  3KCM A;  2I81 A;  4G10 A;  1EGR A;  1YEP A;  1NM3 A;  1ERU A;  1TRW A;  3UVH A;  2VO4 A;  4OMV A;  3BCI A;  3MNG A;  1XVW A;  1HQO A;  3DEX A;  3QFB C;  2LRT A;  3G7I A;  1QQ2 A;  3PIN A;  4EO3 A;  3LYK A;  4PX1 A;  2DLX A;  5KOW A;  3L9U A;  4MF6 A;  4WET A;  3D4T A;  3D5J A;  2E2G A;  5IMA A;  4YKG A;  1UN2 A;  4HU7 A;  5HR3 A;  2AYT A;  2R5G A;  4TW5 A;  3RHC A;  1SL2 B;  4AJ7 A;  1BAY A;  4PUR A;  2AJQ B;  4GWR A;  1EEM A;  4MK3 A;  4ML1 A;  3TOT A;  4MH3 A;  4YAP A;  2HRF A;  5G1K A;  1OYJ A;  3I9V 2;  2FHE A;  3QCP A;  4LLR A;  3IR4 A;  1R26 A;  2E2M A;  1TRU A;  1YQ1 A;  3HJO A;  6GSS A;  2VOC A;  4K0G A;  5D9T A;  3ZFB A;  3CSJ A;  4TR1 B;  5IOX A;  1JLV A;  4CHS A;  1SK1 A;  5AGY A;  3QR6 A;  5KN0 A;  1K0C A;  3KM6 A;  2H0H A;  1RK4 A;  4K8M A;  1WRY A;  1SYX A;  2BMX A;  3QFA C;  1MEK A;  4CW9 A;  1BJX A;  4DSQ A;  2ALB A;  4OWY A;  2XBQ A;  1Z3E A;  2YWO A;  3ZRD A;  4KCE A;  4TXO B;  3FW2 A;  5JCU A;  1M7T A;  1O8W A;  2VCZ A;  3MYD A;  1T8E B;  1SU9 A;  4PNF A;  3FEU A;  1PL2 A;  3FRC A;  2PWJ A;  3D6I A;  3CRT A;  2FLS A;  4P3Y B;  4F03 A;  2WGR A;  3NZN A;  4WKW A;  3KIJ A;  5G31 A;  5LNK e;  4EE0 A;  3MIX A;  4ACS A;  5KN1 A;  1EOG A;  3KTB A;  4BVY A;  1HD2 A;  2FGX A;  3FHK A;  4BL7 A;  1S3C A;  2D2Z A;  5IPH A;  3F4T A;  3O76 A;  3FMW A;  1GUK A;  3LXZ A;  1A2M A;  2H1G A;  1EP7 A;  2L6D A;  3LYP A;  1Z6M A;  2B1L A;  4HUA A;  3KZQ A;  1U3I A;  1AQX A;  3GL3 A;  3LGC A;  2OE1 A;  2A4H A;  2H71 A;  1T7P B;  4I97 A;  1M99 A;  3DYR A;  5GSS A;  2MMZ A;  4OD7 A;  4BWS A;  18GS A;  1WP0 A;  2IJY A;  3ZVJ D;  2YN1 A;  3D21 A;  1FOV A;  2O85 A;  3APS A;  1F37 A;  4LMW A;  5E59 A;  4O5U A;  1O81 A;  5JWO B;  3UBL A;  1Z5Y E;  3FYG A;  2NDO A;  3W8S A;  1XCC A;  1JHB A;  1NW2 A;  16GS A;  3HZ8 A;  5FT3 A;  3GA4 A;  4F2I A;  1XWK A;  1SKS B;  2HLS A;  3VI5 A;  3ZYW A;  1K0N A;  2H0I A;  3IHQ A;  5AIS A;  3IBH A;  4ZL7 A;  4MAB A;  3UAR A;  4H86 A;  5CNW A;  5CRE A;  1WOU A;  2R0P A;  1SD8 A;  1GTI A;  1OC9 B;  5DBQ A;  2H75 A;  10GS A;  1TI1 A;  2IMF A;  3CMI A;  1KNG A;  3D0Z A;  5B8B A;  4MLY A;  4J57 E;  3VPT A;  2HT9 A;  1DSB A;  1W4V A;  1DE1 A;  1FHE A;  3GNJ A;  5AN1 A;  1XZO A;  1PMT A;  3TGZ A;  3EMP A;  5H5R A;  2YNX A;  1RW1 A;  2YWN A;  4WR5 A;  3F3Q A;  2YWI A;  1GSY A;  1TRV A;  2C0E A;  2F9S A;  5C00 A;  4FYU A;  2YOI A;  5CRH A;  1OC8 A;  4BVX B;  2B3S A;  2PER A;  2R0C A;  2L4C A;  2HXK A;  4TRX A;  5J5N A;  1TK8 B;  3EMX A;  1SL1 B;  3GKK A;  1EZK A;  4KSO A;  2B5E A;  3H79 A;  4KH7 A;  3KMO A;  4K1F A;  2GST A;  3HVV A;  2LST A;  4CY6 A;  2EIQ A;  3GYK A;  2P0G A;  3GKN A;  3APO A;  3GN3 A;  4IEL A;  2RLI A;  1J08 A;  4LL1 B;  1PN9 A;  5ID2 B;  5AIX A;  1XWG A;  1X9W B;  3F9U A;  1GUH A;  4TR3 A;  3DML A;  1K3O A;  1HNC A;  3JCM L;  3DXB A;  2TRX A;  1TW9 A;  5J9B A;  3A2X A;  2LKU A;  3TKS A;  2XPD A;  1KTE A;  3CRU A;  4NV2 A;  1O73 A;  5G5F A;  1S3A A;  1KEB A;  1EP8 A;  3Q74 A;  2H01 A;  2YJH A;  4J2F A;  1T00 A;  2X8G A;  4K0N A;  1AXD A;  2WDU A;  4POB A;  4F82 A;  3TDG A;  5EL8 A;  1GSU A;  2X99 A;  4O32 A;  3FZ4 A;  4EDZ A;  1USB A;  2VLV A;  4TKY A;  1YY7 A;  3KD0 A;  4OFN A;  3TJG A;  3VWW A;  4ZL9 A;  5G1L A;  5G2Z A;  2R2J A;  1LBK A;  4GRF A;  3EE2 A;  2ZCT A;  2L57 A;  1URM A;  1FG4 A;  2LTK A;  3APQ A;  2X49 A;  4KW6 A;  4YAV A;  2WB9 A;  5HQP A;  1Z9H A;  4L5O A;  3ERG A;  11GS A;  2OA7 A;  2WZ9 A;  5C04 A;  1R5A A;  3A2W A;  4OO5 A;  2OJL A;  4L0W A;  5ECS A;  2BTO T;  2ES7 A;  2OE3 A;  4G19 A;  1XWB A;  4HI7 A;  2MMN A;  3GX8 A;  3BOA A;  4GQC A;  2O8V B;  1X5E A;  2VL2 C;  4PXO A;  5ECN B;  5A5K A;  2P5R A;  4RQX A;  1G6Y A;  1PSQ A;  4KND A;  3G7J A;  4QL9 A;  1Z6N A;  2YPM A;  5DAK B;  2PMT A;  2EIO A;  1FAA A;  2IN3 A;  3KEB A;  1B4Q A;  2NTO A;  3TJB A;  1GTU A;  2WFC A;  2L6C A;  3FZ9 A;  5HR0 A;  3NOF A;  3GX0 A;  5D73 A;  5LD0 A;  2LJR A;  1TJD A;  4PUA A;  2YCD A;  1A8L A;  3GST A;  1ACV A;  2K8S A;  2YV9 A;  4FYC A;  1B8X A;  4OO4 A;  1GSD A;  1QMV A;  2FUG 2;  3F4R A;  3AY8 A;  1FO5 A;  1XOA A;  2HE3 A;  1TU8 A;  4GST A;  1K0M A;  1M9B A;  1O7U A;  4BVY B;  3WGD A;  3DVW A;  4BL7 B;  1A2J A;  2LQO A;  3N9J A;  2CV4 A;  1GNW A;  3TUE A;  3SWL A;  4AF2 A;  2IYJ A;  2PGT A;  3LFL A;  2YZH A;  1F3A A;  2H74 A;  4TR0 A;  2C3T A;  1B9Y C;  4FO5 A;  2GGT A;  3KXO A;  1SKR B;  4JE1 A;  3ZTL A;  2H6Y A;  2WUL A;  1EEJ A;  2IWT A;  4K5S A;  2O89 A;  2DBC A;  5DJL A;  3U5R E;  3PGT A;  4NV5 A;  3GKM A;  2KUC A;  3EU4 A;  2H70 A;  1YJ6 A;  5J9C A;  3QOU A;  3IPZ A;  4HS1 A;  5DAL A;  2H6X A;  4JBB A;  4DSS A;  2GS3 A;  2VM2 A;  1WIK A;  2KHP A;  1QGV A;  1YDK A;  1GLQ A;  5D9X A;  3IOS A;  4YQM A;  4ECC A;  5HFK A;  1NHO A;  4A5P A;  2FA4 A;  2RUE A;  3DD3 A;  3F8U A;  4KDX A;  3HD5 A;  2XPE A;  2NPB A;  5B8A A;  3LG6 A;  3VUR A;  2B6M A;  5EY6 A;  4OCF A;  2PU9 C;  1UC7 A;  1TU7 A;  3IA1 A;  3DKS A;  5LCZ A;  3HVS A;  1A24 A;  5JWR B;  2B5X A;  3VWX A;  1Q98 A;  3L78 A;  5KN3 A;  1JZW A;  1THO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...