1V58A

Crystal structure of the reduced protein disulfide bond isomerase dsbg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v58A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v58A02
5DQYA 1TW9A 1A8YA 1GUKA 1EZKA 2HZEA 3CXGA 3LG6A 1SD8A 1DBYA 4BWQA 4MJAA 3TOUA 2RM5A 2OA7A 5J41A 2OJLA 2LEGA 1UVZA 2HLSA 4YAPA 4Q5QA 3RAZA 1M2AA 3D4MA 4MK3A 4ZL7A 1GWCA 3TKQA 3TJGA 3F6DA 4QL9A 2RM6A 3CRTA 2AV4A 1F37A 3Q74A 1ST9A 3N9JA 2PGTA 4QQ7A 1GUMA 2KLXA 1V58A 3ZVJD 2C4JA 1B4QA 1GSEA 3P90A 1GL8A 4IVFA 4MPFA 2H0HA 2H1AA 3QMXA 1DE2A 2FCHA 2YOIA 4MZWA 1TJDA 1LU4A 3F3QA 2GGTA 2REMA 4ISDA 3F9UA 1BJXA 3QFAC 3D6IA 4XCSA 2AUVA 3FRCA 3GKNA 4V2NA 4K8MA 1SKRB 3KTLA 2PBJA 4DSQA 2IJYA 1ERUA 3TRXA 20GSA 3VK9A 1TK0B 1A2LA 2FWEA 2CZ3A 3EU4A 4MP4A 1Z9HA 5IMFA 2CT6A 3GRXA 3LJRA 4TOPA 2H75A 3WGEA 2HRNA 1JLWA 5AGYA 3HDCA 1JZRA 3EC3A 1GP1A 4XS4B 2FWHA 4ZBBA 4WBRD 1KTEA 2FUG2 5KEJA 3CSHA 3HJOA 2GSTA 3F8UA 4PXOA 2FHEA 1NSWA 2QSIA 1GH2A 2V1MA 1M2DA 4NV2A 4ACSA 2MMNA 1T1VA 2BJXA 2HE3A 4KAEA 2NTOA 1O7UA 1LJRA 1AAZA 5DJMA 2GQMA 2L4CA 1UN2A 1VGLA 5GSTA 4ILFA 3D21A 5A4UA 3VURA 2YNXA 4XS4A 1BQ7A 3HKRA 2WDUA 2YZHA 4GSSA 1XOBA 1XW9A 1OAZA 5CREA 2F8FA 1GTBA 5DALB 3KMNA 3FHKA 2JADA 4O5RA 4TR1A 4MF6A 2F3MA 1TK5B 4F03A 3TKSA 1YQ1A 6GSTA 4DSSA 4POLA 1OC8A 3GSSA 4X1UA 1EGOA 5ECIB 3KEBA 4PQHA 1X9SB 4V1Ag 3W8JA 2V6OA 2L6DA 1ABAA 2H19A 3DVXA 5ECSA 2DLXA 1A0FA 4KW6A 1Y25A 4G19A 3HZ4A 1V98A 5HR0A 4OFMA 16GSA 4XHMA 4AJ6A 4KNDA 2WULA 4D73A 3IOSA 3KGKA 3ZFLA 1B4PA 5C00A 2MBTA 2CVBA 5H5QA 2XPEA 2D2ZA 3IK7A 4TR4A 2V32A 2GZZA 4P3YB 3CSIA 1U3IA 1OKDA 1UA5A 3BD2A 3EMPA 4FYBA 1T00A 2C8UA 4K6XA 4J2FA 4ECCA 3M0FA 1O85A 3UMAA 1OKTA 2K18A 3GTUB 1AUCA 2C0EA 1H4OA 2IMEA 3GH6A 1WRYA 1PMTA 2IMKA 3O3TA 1JFUA 5JCWA 1SKWB 1ZMAA 3TKPA 4GWRA 3IXRA 2PU9C 3W6GA 3U6VA 3A2WA 2FA8A 5JWQB 5DCGA 3ZMLA 2DIZA 1U87A 4O7HA 4LMWA 5DCHA 1J0FA 3W8SA 5ECRB 1IYHA 2EIRA 3IRAA 3E9JB 4IN0A 2JZTA 2KP2A 4MLYA 2BMXA 4KSMA 2YWOA 3HZ8A 3LWAA 5CRGA 1EV4A 1EGRA 1A24A 3M3MA 4TVEA 4TXOB 1VF1A 2RLIA 3FZAA 1B8XA 5CYYA 5J5NA 4AGSA 4ZL9A 4MH3A 4KH7A 4X0XA 1YF1A 4KGIA 3SWLA 4LL1B 1ZCPA 2HSYA 3EE2A 2E2MA 2P5RA 2VCXA 4GTUA 3TJKA 3PINA 4K0NA 2GS3A 17GSA 2O8VB 3GA4A 3FR9A 2EIQA 3GH9A 2IN3A 4RQRA 5IIZA 4IBPA 2IL3A 2PUKC 2MZCA 2WCIA 2MMOA 1NW2A 1PRXA 2H73A 4KDYA 1TK8B 3QAWA 3GX0A 5IMZA 4MZCA 2LTKA 2OACA 4CW9A 3JCML 2TRCP 1EEJA 1V57A 2X64A 2LNSA 3KH7A 2CV4A 1AW9A 2OE0A 5A4WA 2L59A 1EV9A 1BX9A 2FD3A 2LRCA 2DJ3A 3CTGA 1Z5YE 4MDCA 3WT1A 2HFDA 2VCTA 2C0FA 3US3A 2I1UA 3ZITA 3ZIJA 1SK0A 3GX8A 3IC4A 5DBQA 4KX4A 2DJKA 2RUFA 1BAYA 2E2GA 2CZ2A 3I6AA 4ECJA 4TXOA 4Q5NA 3CBUA 1K0OA 4J57E 4IQ1A 2B6MA 1EP7A 1ERVA 3F4SA 1PA3A 1PL2A 3APQA 3HYPA 4OFTA 2HYXA 4WBJA 1PGTA 1A0RP 1TU7A 1MD4A 2MBSA 3IAS2 3Q6OA 4N10A 4EO3A 4YAVA 4KCAA 3GMFA 4MJEA 3LGCA 2M46A 2LRNA 3OR5A 2IMIA 1T4YA 2C80A 3GURA 3N5OA 2LQOA 3J7Yk 3LXZA 1TRUA 3LSZA 3RHBA 5KN1A 4DSRA 1YDKA 4XIHA 3GV1A 3K8NA 2QC7A 1T7PB 4KDXA 1Z6MA 2DIYA 3QDNA 1GTIA 4EL1A 3VFIA 4JR6A 2C0GA 3IA1A 3VWVA 2RUEA 4F82A 2EC4A 3A5WA 1QMVA 2HRFA 2N5FA 2GQKA 2H71A 1U3AA 1AQWA 1G7OA 2H1DA 3AY8A 2HSHA 4WETA 3CTFA 1XWAA 4JR4A 3G7IA 4PNGA 3APOA 4HDEA 4MABA 5H5RA 4MF5A 2GLRA 2B1LA 3A2VA 3BCIA 4LLRA 3TUEA 1C72A 3F3RA 1G7EA 1GSDA 3D0ZA 6GSYA 2YWMA 1YF0A 3WGXA 5E59A 1F9MA 1DSBA 1HNAA 3G7YA 3CYNA 2JU5A 4OMVA 1A2JA 4O92A 3FK8A 5HFIA 1CQGA 3C1SA 2DJ2A 3ME7A 4O32A 3FZ4A 3UBKA 1YY7A 1BYEA 1RW1A 4EE0A 1URMA 3DWVA 2ES7A 1FB0A 3DKSA 1R4WA 4K0GA 4MCUA 1XWKA 1EP8A 1NHYA 2H66A 3G9BA 2LSTA 3HVSA 1Q98A 4IQAA 3H93A 2H01A 3IHQA 3E3EA 1Z7PA 3D22A 1GUHA 3C71A 4E8EA 5IOWA 1NM3A 4KUNA 2GT5A 18GSA 4GSNA 1XFLA 1ZGNA 1X5CA 4G9HA 3C73A 3H79A 3VPQA 4EUYA 2G0FA 5IMDA 1TP9A 3UOMA 4ZB9A 1HNCA 2HT9A 3M1GA 3UARA 2VLTA 2V2GA 4KA0A 4XS1A 5G5FA 4MF7A 4WR5A 4EKZA 3MAKA 5ID2A 1M9AA 1GSFA 1K0NA 5JWRB 1SU9A 2KOKA 4H86A 3WGDA 2L5OA 2DJJA 2VL2A 4IP6A 2B5YA 2YV9A 1KEBA 3BCKA 4DVCA 4K7IA 3TKSE 1T3BA 4RQXA 1ILOA 1I5GA 2VCWA 5EVOA 1O73A 2K8VA 2LJRA 3IAM2 1E2YA 3I9V2 2XHFA 3LFLA 7GSSA 3LORA 4LMVA 4EC0A 1HD2A 2K8SA 2VCZA 2OE1A 4IW9A 3GHAA 3L4NA 2HZFA 5CRHA 2FNOA 4V2LA 2C0DA 1FVKA 2HXKA 3GKMA 5DAKA 1X9MB 4JBBA 2AAWA 4GSTA 1S3DA 5D96A 1OC3A 1DE1A 2LV3A 5JCGA 3KCMA 4F0BA 2OBIA 4GF0A 2VM1A 1EEMA 1BG5A 4G2EA 4POMA 3TKSC 4Q5RA 1G6YA 2C1YA 2VLUA 5B8BA 1GSUA 1Q4JA 2F51A 3IE3A 3FYGA 2H30A 1THOA 5IOXA 3L9VA 5IPGA 3FW2A 1MD3A 2OADA 4EDZA 1XPVA 1A23A 2VL9A 4NAXA 1VRSD 3HY2A 4EVMA 1GSSA 4MZBA 1PN9A 2XBIA 4NHWA 3M9KA 2PWJA 3GFKA 3TKRA 13GSA 2IIYA 1FB6A 4XRAA 1XVQA 6GSUA 2IMFA 3QPMA 2HZEB 4RUVA 4DEJA 4TKYA 2FY6A 4ZB6A 3LXTA 3A3TA 3VI5A 2OBKA 2P0GA 3VWUA 1V2AA 4YQVA 4HZ2A 2MYGA 3ED3A 5F8BA 1IYIA 2M80A 5DAKB 2IMDA 4BWSA 2H76A 2VL2C 1V9WA 4L5LA 3GTUA 1R7HA 5C04A 1TKDB 1OVNA 3P8WA 3TJFA 1G0TA 3DIEA 2PMTA 4MJBA 2VL3A 4XS6A 3MDKA 5E4WA 3D5JA 2O89A 3GNJA 4TXVA 2YANA 2R2JA 2VM2A 4JU5A 2I81A 1K0CA 5HFKA 2V6KA 2VLVA 3RHCA 1PX6A 3G7JA 4WF4A 2YWIA 1SL2B 5ECQB 1K0BA 1SYXA 1K3OA 1YKCA 1AQXA 2CVKA 3RDWA 2B7JA 5ECNB 3LYPA 4V1Ap 3WD6A 4WKWA 4E8HA 1M7TA 3HJPA 2H70A 2VD0A 5D8IA 1J08A 1DUGA 2ZNMA 2JL4A 4GQCA 4XTSA 4N0ZA 2VAFA 1USBA 4RI6A 3ZZXA 1TU8A 1PX7A 1J9BA 3L78A 5AIXA 4CDOA 4ZBAA 1JLVA 5CRDA 1XCCA 4ZXGA 2AJQB 3ERGA 1JZOA 3WYWA 1QGVA 4PGTA 4HQSA 3ZVJA 3NIVA 3UAPA 5KN0A 4BVYA 5IQYA 3NOFA 1GTUA 4PX1A 2H0GA 1GNWA 4TN8A 1R26A 1O6JA 4K7NA 2HNLA 3L0HA 3VLNA 5IO2A 4I5QA 5IO0A 1GTAA 4ECBA 4NV5A 1TRSA 2H6YA 1XIYA 4KSOA 3SBCA 4NHZA 3O6TA 2HI7A 1U6TA 2R6KA 3FKFA 3HXSA 4HJMA 4ZILA 2DJ1A 1PKZA 3KH9A 4F2IA 5DALA 1O8WA 1PD21 3MNGA 1OC9A 5JCUA 5KN2A 1MTCA 4IGJA 4ZL8A 4TR1B 3GKXA 4OO4A 4YH2A 4Z7XA 1B9YC 1WP0A 3UJ1A 4K1FA 1FHEA 1R5AA 2PVOC 5LNKe 1U88A 2C3TA 3R2QA 3KZQA 2WB9A 4PQIA 2CQ9A 1N8JA 5J9CA 2H6XA 1XWCA 5F0GA 1MDKA 2KHPA 3CMIA 10GSA 2LRTA 4V2MA 1AXDA 3LYKA 5A5KA 3GSTA 2G2QA 4NMUA 1SKSB 1ZYQB 3GN3A 3FR3A 1THXA 1WJKA 3FY7A 3HCZA 5ID2B 3ISOA 5GZZB 3HHVA 3IBHA 2H6ZA 2I4AA 3EINA 4WEYA 2B7KA 3D4TA 4PURA 5EL8A 2ON7A 5G31A 1TI3A 2DSAA 2TIRA 1YJ6A 5ABRA 4HZ4A 5DJLA 5ECPB 1XW5A 3KJYA 2P5QA 1JHBA 2VO4A 1Z7RA 3C8EA 3QOUA 4I6XA 4EF0A 2MMAA 3MWHA 4NWYA 1S3AA 4HUAA 1X9WB 5ECLB 4MMMA 1QQ2A 3IPZA 3KM6A 4L0UA 5EPFA 1X0RA 2CX3A 1HNBA 2A2RA 1GNEA 3A2XA 1KBNA 2C3NA 2JACA 4IHUA 4J56E 2X99A 2ZUPA 6GSSA 5IM9A 3FZ9A 2H74A 1XOAA 5INYA 2EIOA 1EOGA 4F0CA 2Z9SA 3DYRA 3KTBA 2RIIA 2C3QA 4K2DA 3LEFA 3KIJA 2O7KA 3ME8A 2NDOA 3CRUA 2CAIA 1TRVA 2WS2A 2TRXA 5DVBA 5G5EA 1ZOFA 2GZYA 2BTOT 4ULXA 4BVXA 4GCIA 2YWNA 1T4ZA 2N5BA 4FYUA 4GRFA 4IS0A 1JZWA 4I2TA 2J23A 1YZXA 5KN3A 5HR2A 5LCZA 5AISA 2XBQA 4POBA 4PNFA 5IMAA 5G30A 4MJCA 1SD9A 5COHA 4F9ZA 4MH2A 3RPNA 2LQQA 1XWGA 4L8EA 2FGXA 22GSA 2CVDA 2IWTA 8GSSA 2QGVA 2GTUA 2K6VA 3VPTA 1SK2A 1B48A 3UVHA 1EOHA 3F0IA 3FZ5A 6GSXA 1AIUA 3VWWA 1A2MA 3ZLPA 4HU7A 1XXUA 4HQZA 1SL1B 3DMLA 4DSSB 1E6BA 6GSVA 2LKUA 2V41A 4KCEA 2B5EA 3ZTLA 4IJIA 4TR3A 3PH9A 1PKWA 3IV4A 2LS5A 5ELGA 9GSSA 3TJBA 3O76A 2X8GA 1V40A 3ZYWA 4I97A 1I9DA 4OO5A 4IP1A 1K0MA 2KUCA 4YQMA 1ML6A 1O81A 3H8QA 2H1GA 4HU9A 1F2EA 4TRXA 3KP8A 2ON5A 2H1BA 1MDJA 1K0AA 2YN1A 1SJIA 1MEKA 2VD1A 4JE1A 4ECIA 5JWOB 2R3XA 1QXHA 5HR1A 3L9SA 1F3AA 4HS1A 3TB2A 5D73A 1B9XC 1ERWA 4MA9A 2J9HA 3RBTA 3TRPA 1XZOA 5FHIA 1RQMA 3HJMA 4WXTA 3P7XA 2GQLA 1YKAA 3F6FA 5L71A 4XRDA 1XW6A 5GAPD 6GSWA 3UIWA 3FEUA 3ERFA 1OE8A 2P31A 3EURA 3DRNA 2DJ0A 2WGRA 1UC7A 1M2BA 2VCQA 3EU3A 5D9XA 4ML1A 1TDIA 3QFBC 1NHOA 4EDYA 3IR4A 4G10A 5CP1A 1CQHA 5D9WA 4HOJA 3C1RA 1OC9B 5DDLA 2GSSA 1GSQA 3DXBA 3DEXA 3RPPA 2WZ9A 4ID0A 3ZFBA 3UEMA 3F4RA 1H75A 2I3YA 2LJAA 4NXIA 3L9UA 2PVQA 4WF5A 2VUPA 1WIKA 1YEXA 1XVWA 5B6NA 4LL4B 1F3BA 3EYTA 1XBSA 5D9TA 3VWXA 2IFQA 4YQUA 2GZPA 1HQOA 2LJKA 1HYUA 4GXZA 2MMZA 4EXJA 3EVIA 3I69A 4AJ8A 3GYKA 2A2SA 2M72A 4JRRA 1S3CA 2FA4A 1PSQA 3J7Yb 1SYRA 5FWGA 1GRXA 2NVLA 2VOCA 5IPHA 1TRWA 5ECKB 3U5RE 3WT2A 4FYCA 4IELA 3Q18A 1SK1A 1K3LA 3M8NA 4HJ2A 5B8AA 2YPMA 2L6CA 1GULA 2L4QA 2GVPA 3DD3A 2NPBA 3KP9A 4N0VA 2YJ7A 3UBLA 3ZRDA 2AB6A 3QCPA 5F05A 1M0UA 4GLTA 1FW1A 2O85A 2IYJA 1VF3A 4BL7A 2O87A 2X8CA 2JZRA 2L57A 2IFQB 2ALBA 2H0IA 4N30A 1QK8A 2CA8A 2DC5A 4LA1A 2H8LA 3H1NA 19GSA 2F9SA 5IMVA 3KXOA 1GSYA 4KDUA 1X5EA 2A4VA 3TGZA 1VF2A 3LQ7A 2R5GA 1FO5A 3KMOA 2KP1A 2VCVA 3HVVA 2JSYA 3BBYA 3QR6A 5A4VA 2IPAA 2CX4A 3HD5A 3GL3A 1N2AA 3I43A 5G2ZA 5IMCA 1M9BA 4QL7A 2YV7A 4PUAA 2JSZA 3Q19A 4D73B 3GIXA 5D93A 1FOVA 4FH8A 4CHSA 1O8XA 5B6MA 3QAGA 3APSA 1PQNA 5J3RA 2YP6A 5J9BA 1OE7A 1RK4A 1K3YA 14GSA 3ERWA 1SL0B 4ZIJA 2DMMA 1W89A 3VI7A 3KD0A 3NZNA 1K0DA 2H72A 4OCFA 2B3SA 3V1WA 1FAAA 3E0UA 4TW5A 1F6MC 3P2AA 1QFNA 1XWBA 2FWGA 3BJ5A 4K7OA 4FIWA 3UL3A 5B7CA 1Z6NA 3BOAA 11GSA 4HEA2 4IKHA 2PPTA 5G1LA 4HI7A 1W4VA 4RI7A 2AHEA 2XC2A 2VIMA 3UVTA 4BA7A 3PR8A 4X43A 5FT3A 2PN8A 2OKAA 5ELAA 2JZSA 2PERA 1GLPA 1ON4A 1ZL9A 3S9FA 2DBCA 3QD9A 4I2UA 4ZB8A 4L0WA 2WFCA 5AIVA 3H4KA 1G6WA 5G1KA 2GSRA 5ECOB 1SJZA 4AF2A 5GAND 5D9VA 2WJUA 2I9HA 3EWLA 1WPIA 1ACVA 2ZCTA 1WWJA 4ZBDA 3TCOA 4MPGA 1TI1A 5HFGA 3GL5A 1SENA 1YEPA 5ECMB 2YCDA 5AN1A 5ECHB 1ERTA 2DMLA 4POKA 4OCEA 4K9ZA 5LD0A 1VF4A 3IK9A 1WE0A 2E0QA 1EWXA 5GSSA 5ENUA 4I8BA 2LNTA 3M9JA 4OD7A 1M99A 5DQSA 3ZIVA 1MDIA 2L5LA 1ZZYA 3HA9A 4JZQA 1AQVA 5CNWA 3C7MA 1PL1A 2X8HA 4KE3A 4Q5FA 1GLQA 1FVJA 1TXXA 5CO3A 1FG4A 1T8EB 4NPBA 4TR0A 1AC1A 2YJHA 2R4VA 3TJJA 5CRWA 3F4TA 1OYJA 4N11A 3IDVA 4WR4A 3ZL5A 1A8LA 3DVWA 1SJ6A 2LUSA 1Y6EA 2N5AA 5F06A 2OE3A 5HR3A 4JEDA 3HVXA 1ZYEA 3TOTA 4AJ7A 1QUWA 2FLSA 2YZUA 4FO5A 2B1KA 5CAXA 5HQPA 1JZDA 4PQ1A 3ZMKA 2GT6A 2B5XA 2QKEA 3FR6A 5J4UA 4BPYA 4PUFC 1Z3EA 1TOFA 4L5OA 1WOUA 3EMXA 1BEDA 5EY6A 3GKKA 5H5SA 4KB3A 2K9FA 3CSJA 2F8AA 3TDGA 3F63A 2E7PA 2GSQA 3MSZA 1WMJA 1KNGA 1R5PA 4ML6A 2WRTA 4OFNA 2XPDA 2NBSA 2IY2A 1X5DA 3QAVA 4GQFA 4IJ3A 2CAQA 3TRQA 2FWFA 2AYTA 3PGTA 12GSA 3DGQA 2GDRA 3GUSA 5F07A 3ZREA 2R37A 1TTZA 4OWYA 1LBKA
chains in the Genus database with same CATH superfamily
4G0LA 5DQYA 1TW9A 3CC23 1A8YA 1GUKA 1EZKA 3MYTA 2HZEA 3CXGA 3LG6A 1SD8A 4GL6A 1DBYA 4BWQA 4MJAA 2Y73A 3TOUA 2JQ5A 4KFDA 2RM5A 5IF6A 1GMPA 2OA7A 5J41A 4N6NB 2OJLA 4CJNA 4CDLA 2LEGA 5CK6A 1M1XB 1RMSA 1UVZA 2HLSA 4YAPA 4Q5QA 3IJEB 1M2AA 3D4MA 3RAZA 3CNXA 1I2FA 1EA2A 4MK3A 4ZL7A 1GWCA 3TKQA 3TJGA 3LTBA 3F6DA 4QL9A 4EIQA 2RM6A 3CRTA 2AV4A 3WHOA 1F37A 3KKGA 3Q74A 1ST9A 3N9JA 2XGLA 4N6V0 2PGTA 4QQ7A 1QAKA 1GUMA 2A15A 1V58A 2KLXA 3ZVJD 2C4JA 1B4QA 1GSEA 3P90A 2XSOB 3F7XA 1GL8A 4IVFA 1A2PA 4MPFA 5BVBA 2H0HA 2H1AA 2BMOB 3QMXA 1DE2A 2FCHA 2YOIA 4MZWA 1TJDA 1LU4A 1VQQA 4RBNA 3F3QA 4OVMA 2V1LA 2GGTA 3G4S3 2REMA 4ISDA 4YKGA 4ORLA 3F9UA 2D1WA 9RNTA 1BJXA 1RGGA 1GOUA 3QFAC 3D6IA 4XCSA 2AUVA 3FRCA 3GKNA 4V2NA 1Q40A 4K8MA 1SKRB 3KTLA 4O5UA 2PBJA 4DSQA 1CEWI 1YVSA 3F7SA 2IJYA 1ERUA 3TRXA 1SARA 20GSA 1Q864 3VK9A 1TK0B 1A2LA 2FWEA 1RDSA 2CZ3A 3EU4A 4MP4A 1Z9HA 5IMFA 2C11A 2CT6A 2DKIA 3GRXA 3LJRA 4TOPA 2CFWA 2H75A 3WGEA 2HRNA 1JLWA 5AGYA 3HDCA 4GHOA 1JZRA 1GYBA 1RTUA 3EC3A 1GP1A 3D5GA 4N6TA 5CXOA 4XS4B 2RSXA 2YX9A 2FWHA 4ZBBA 4WBRD 1KTEA 2FUG2 3F8HA 5KEJA 3CSHA 3NM2A 1RGLA 3HJOA 3JVCA 2GSTA 3F8UA 2PNCA 4PXOA 2FHEA 3PPUA 3ZG5A 1NSWA 1IVUA 3DUKA 2QSIA 1GH2A 2V1MA 3OWUA 5D82A 1M2DA 3E99A 4O2HA 1BRGA 4NV2A 2ZA4A 1IV9A 1DMQA 4L8PA 4ACSA 2MMNA 4HZBB 5AYRB 1T1VA 2BJXA 2HE3A 4KAEA 4HM1B 2NTOA 1M3JA 1O7UA 1LJRA 1ISKA 3PXMA 1V74A 4YKFA 5M18A 1AVLA 4HAAA 1AAZA 3G0KA 5DJMA 2GQMA 1PYLA 5I97A 2L4CA 4N6OB 1UN2A 3DGYA 1VGLA 2X4AA 1HKXA 3DH2A 5GSTA 4ILFA 3D21A 5A4UA 3VURA 2YNXA 4XS4A 1BQ7A 3HKRA 2WDUA 5D83A 2YZHA 2CH9A 4LEHA 4GSSA 3EBYA 1XOBA 1XW9A 4BVXB 1OAZA 1RHLA 5CREA 4HM6B 1K28A 4CY8A 2F8FA 1GTBA 1KD14 5DALB 3KMNA 4MMXB 2JADA 1YJ93 3FHKA 4O5RA 2YFIB 4TR1A 4MF6A 3K5TA 3CD63 2F3MA 1VQP3 1TK5B 1TFOA 4F03A 3TKSA 3UL5A 3VGNA 2HMMB 1YQ1A 6GSTA 2F4YA 4DSSA 4POLA 1OC8A 3BNDA 3WA2X 3GSSA 4X1UA 1EGOA 2GSPA 3BNBA 5ECIB 1I2GA 3KEBA 1EQKA 4PQHA 1X9SB 3CCM3 4V1Ag 3W8JA 2V6OA 2L6DA 1ABAA 4O3VA 2H19A 1YNVX 3DVXA 5ECSA 2DLXA 5GSPA 1BNSA 1A0FA 3PCSA 5IG4A 4KW6A 1Y25A 1STDA 5IG3A 1QVG2 4G19A 1FYSA 3T8NA 3FLJA 3HZ4A 1V98A 1D6UA 1VQO3 1FW7A 5HR0A 1HYFA 4OFMA 16GSA 4XHMA 4AJ6A 4KNDA 2WULA 4D73A 3IOSA 3KGKA 3ZFLA 1B4PA 1J2BA 3KFQC 4OUQA 5C00A 1YJN3 2MBTA 3KSPA 1BVIA 2CVBA 5H5QA 3CCE3 2XPEA 2HMNB 2D2ZA 3IK7A 1ASKA 4GSPA 4TR4A 1NWWA 2V32A 2GZZA 1JRQA 4P3YB 3CSIA 3CCQ3 1NB5I 1U3IA 1OKDA 1UA5A 3BD2A 3EMPA 4FYBA 1T00A 4WHAA 1K9M4 2C8UA 4K6XA 2CG0A 4J2FA 4ECCA 3M0FA 1O85A 3UMAA 3RDEA 1OKTA 2K18A 1AUCA 3GTUB 3G8ZA 2C0EA 1H4OA 1YI23 4HM5B 2IMEA 3GH6A 5EQLA 1WRYA 1PMTA 2IMKA 3O3TA 1JFUA 2R0CA 5JCWA 2A2PA 1SKWB 1Q9EA 1BRIA 1ZMAA 3TKPA 4GWRA 3KIIA 1W7CA 3IXRA 2PU9C 2W03A 3W6GA 3U6VA 3A2WA 2FA8A 3ALAA 3EF8A 2OOVA 5JWQB 5DCGA 5AYSC 4RNYA 3ZMLA 3SXXA 2DIZA 1OF5A 1U87A 4O7HA 2CW9A 4LMWA 5DCHA 1J0FA 3CQFA 3W8SA 5ECRB 1IYHA 2EIRA 5AEWB 3IRAA 3U1WA 4H61A 1DVCA 1RGHA 3E9JB 2B24B 1Z1SA 4N3VA 4IN0A 3WR2A 2JZTA 3NQZA 2KP2A 1VQ63 4MLYA 2BMXA 4KSMA 2YWOA 3HZ8A 3LWAA 5CRGA 1EV4A 1EGRA 2X49A 1A24A 3M3MA 4KZ1A 3CPW2 2YFJB 3SEDA 3CCU3 4TVEA 4TXOB 1UI7A 1VF1A 1TIJA 2RLIA 3FZAA 1B8XA 2HMOB 3URPA 5CYYA 5IERA 3STDA 5J5NA 4AGSA 4ZL9A 2Z6BA 4MH3A 2RBIA 5STDA 4KH7A 1BAOA 4BTYA 4X0XA 1GMQA 1YF1A 4KGIA 2FXTA 4FCJA 3SWLA 3HOHA 1JN5A 2W56A 4LL1B 1MWTA 1ZCPA 1JBSA 5HGRA 3LTCA 2HSYA 3EE2A 2E2MA 2P5RA 2VCXA 2KCDA 4GTUA 3TJKA 3DY5A 3PINA 4K0NA 3OV4A 2GS3A 17GSA 2O8VB 3GA4A 3CU3A 3X42A 3FR9A 4WP5A 2EIQA 1HU9A 3GH9A 2IN3A 4RQRA 4EV2A 5IIZA 4IBPA 2IL3A 2PUKC 4GB5A 2MZCA 2WCIA 1LRAA 2MMOA 1NW2A 1PRXA 2H73A 4KDYA 1TK8B 3QAWA 5AIIA 1Q7HA 2IUKA 2Z77A 3GX0A 2INXA 3DZLA 5IMZA 4XBXA 4MZCA 1F8NA 2LTKA 3SOYA 2OACA 4CW9A 1IV7A 3JCML 2TRCP 1EEJA 3GRDA 1V57A 2Q07A 2ZL8A 2LNSA 2CV4A 2X64A 3KH7A 4R9KA 5EEOA 1AW9A 2OE0A 5A4WA 2L59A 6GSPA 2Z7AA 5EVHA 1EV9A 1BX9A 2FD3A 3PZWA 2LRCA 3DM8A 3KN4A 2DJ3A 3CTGA 4HM4B 3FF0A 1Z5YE 3NHXA 4MDCA 3WT1A 1GMRA 2HFDA 2VCTA 4MMYB 2BU4A 2C0FA 3US3A 2QIYA 2I1UA 3ZIJA 3ZITA 1SK0A 4K1UA 1MOLA 3GX8A 5ELJA 3T8UA 3IC4A 5DBQA 1TP6A 4KX4A 3LT8A 2DJKA 2RUFA 1BAYA 2E2GA 1PN0A 3K9MC 2CZ2A 3I6AA 1VQK3 4ECJA 4TXOA 4Q5NA 3CBUA 1K0OA 2GBWB 1WMPA 4J57E 1MGRA 4IQ1A 2P0MA 2B6MA 1EP7A 1ERVA 4JRFA 3F4SA 1EG9B 1PA3A 1PL2A 4BL7B 3APQA 8RNTA 3HYPA 1BUQA 1Q42A 2HYXA 2UZ8A 4OFTA 4WBJA 1NDOB 3NUVA 1PGTA 1A0RP 2OQEC 1TU7A 1MD4A 2MBSA 3IAS2 3Q6OA 4N10A 4EO3A 4YAVA 4KCAA 3S27A 3GMFA 4MJEA 1W6CA 2HRKA 3LH4A 4QWTA 1N9EA 1UDII 3LGCA 2M46A 1UCJA 1YHQ3 1W5ZA 2LRNA 1BRJA 4J5GA 1FUSA 3OR5A 2IMIA 2LQVA 1BNIA 1T4YA 2C80A 2QA2A 3GURA 3N5OA 1RRHA 1OGZA 2LQOA 2QA1A 3J7Yk 3LXZA 2K0MA 4Z2TA 1TRUA 3LSZA 3RHBA 3EN8A 5KN1A 4DSRA 1YDKA 4XIHA 3GV1A 2UX0A 1BIRA 1JB5A 3K8NA 2QC7A 1YJW3 4KDXA 1T7PB 1GY5A 2WO0A 1Z6MA 2DIYA 3QDNA 4O8SA 1GTIA 4EL1A 3MYDA 3FG1A 1FUWA 3VFIA 4JR6A 4BIRA 2C0GA 1NNVA 1XG8A 3IA1A 3VWVA 2RUEA 1W02A 1UW1A 4LZIA 4F82A 4HM3B 2EC4A 2IA7A 3A5WA 3X3ZA 1QMVA 2HRFA 2N5FA 2GQKA 2H71A 1U3AA 1AQWA 1G7OA 2H1DA 3AY8A 2HSHA 4WETA 3CTFA 1XWAA 2K3DA 4JR4A 2XH9A 3G7IA 4PNGA 3APOA 4HDEA 1D6YA 1E3RA 4MABA 1LOVA 5H5RA 4BTXA 4MF5A 2GLRA 2B1LA 3A2VA 4XM4A 1OPYA 3BCIA 4LMIA 3NBRA 4LLRA 3TUEA 1C72A 3F3RA 2XF3A 1G7EA 1GSDA 3D0ZA 6GSYA 2YWMA 1YF0A 4R80A 3WGXA 5E59A 3EX9A 1F9MA 1DSBA 1HNAA 3G7YA 3OXAA 3CYNA 4KVHA 1S5AA 2WGQA 2JU5A 4OMVA 1A2JA 1KWIA 4J5KA 1K8A4 3FK8A 4O92A 3MHEA 5HFIA 3NV0A 1CQGA 2R0GA 3C1SA 1FZUA 2DJ2A 3I553 3ME7A 4O32A 1AQZA 3FZ4A 3UBKA 1YY7A 1BYEA 1RW1A 1BRNL 2XR8B 4EE0A 1URMA 3DWVA 2ES7A 1FB0A 3DKSA 2WOHA 1R4WA 4K0GA 4MCUA 1Q40B 1XWKA 1ZYNA 1EP8A 1NHYA 3FSDA 1QVF2 2H66A 3G9BA 2LSTA 1JV2B 2P38A 1D6ZA 1RNBA 3HVSA 1Q98A 4IQAA 1IVXA 3H93A 2H01A 3IHQA 3E3EA 4EXRA 1Z7PA 3D22A 3A76A 1GUHA 3C71A 4E8EA 5IOWA 1NM3A 6RNTA 3CXC2 4KUNA 3N8BA 1IK3A 2GT5A 3UNLA 18GSA 4GSNA 3EQQB 1XFLA 1B2XA 3GZXB 1ZGNA 1X5CA 3O8YA 4G9HA 3C73A 3H79A 2W6JH 3N9HA 4CCVA 3VPQA 1E3VA 2HMJB 3FCSB 2G0FA 1TP9A 5IMDA 3UOMA 4EUYA 4ZB9A 1TFKA 4K2XA 1HNCA 2HT9A 3M1GA 3UARA 5DRVA 2VLTA 2V2GA 4KA0A 4XS1A 5G5FA 3WOFB 1VZZA 4MF7A 3EB8A 4WR5A 4EKZA 3Q1CA 3MAKA 5ID2A 2AAEA 3F9SA 1M9AA 1Q7Y4 1GSFA 1K0NA 5JWRB 4AEQA 1SU9A 2KOKA 4H86A 3WGDA 1RNTA 3RNTA 2DJJA 2L5OA 2VL2A 3AHSA 4BU4A 2BMQB 3HX8A 4IP6A 2B5YA 2YV9A 1KEBA 3BCKA 4DVCA 4K7IA 1ZS7A 1O7WB 2FNQA 1GD4A 4FMDA 4G0IA 3TKSE 1T3BA 4HM7B 4RQXA 5FGOA 5IEPA 1ILOA 1I5GA 2VCWA 2W0QA 1BNFA 5EVOA 1O73A 2K8VA 2LJRA 3A5IA 3IAM2 1E2YA 3I9V2 2XHFA 3LFLA 1MNLA 1YGWA 3SYUA 7GSSA 1UGHI 3LORA 4LMVA 1VQ53 4EC0A 1HD2A 1NU3A 2K8SA 2VCZA 1IU7A 2OE1A 4IW9A 3GHAA 3L4NA 2HZFA 5CRHA 3MWZA 2FNOA 4V2LA 2C0DA 4WYKA 6STDA 3NQYA 1PFPA 1FVKA 2HXKA 1IQ8A 3GKMA 5DAKA 1X9MB 1ULJB 4JBBA 2AAWA 3EJVA 4K61A 4GSTA 1S3DA 5D96A 3G16A 4N6UA 1OC3A 1DE1A 2LV3A 5JCGA 4EYCA 3KCMA 1YIT3 4F0BA 2R41A 2OTJ3 2OBIA 4GF0A 5KOWA 2VM1A 1K41A 5BXQA 1KSIA 2CKFB 2E2TA 1EEMA 1BG5A 1N5HA 4G2EA 2XEPA 1RSNA 4POMA 1IDPA 3TKSC 4Q5RA 1ROAA 1G6YA 2C1YA 2VLUA 5B8BA 3AGOA 1RGFA 3MIXA 1GSUA 3ECFA 1Q4JA 2F51A 3ER7A 3IE3A 3FYGA 2H30A 1U8CB 2I9WA 1THOA 5IOXA 1WMNA 3L9VA 5IPGA 3FW2A 1MD3A 3LYGA 5LC6A 2OADA 4EDZA 1XPVA 1A23A 2VL9A 3CPOA 3F14A 2GXFA 4IIAA 3OX9A 4NAXA 1VRSD 3HY2A 4EVMA 1GSSA 4MZBA 1PN9A 2CFGA 2XBIA 4NHWA 3M9KA 1GY7A 2PWJA 2XRXB 3GFKA 3TKRA 13GSA 3GZRA 2IIYA 1LNHA 2A4HA 1FB6A 4XRAA 3NXJA 3NBBA 1XVQA 1I3FA 6GSUA 1OUNA 2IMFA 3QPMA 3CCJ3 2HZEB 4RUVA 4DEJA 4TKYA 1BRHA 5AIGA 2FY6A 4ZB6A 3PCRA 3LXTA 1MWUA 3A3TA 3VI5A 1BRKA 2OBKA 2P0GA 3VWUA 1V2AA 4YQVA 4HZ2A 2J8XB 2MYGA 3ED3A 5F8BA 1IYIA 1N9JA 2M80A 5DAKB 1G96A 2IMDA 3KE7A 4BWSA 1JB4A 2H76A 1RN4A 2SBLA 2VL2C 1JKGA 1V9WA 4L5LA 3GTUA 1R7HA 5C04A 2O3OA 1TKDB 1OVNA 3P8WA 1RLSA 3TJFA 1G0TA 3DIEA 2PMTA 4MJBA 2VL3A 4XS6A 3VF1A 3MDKA 5E4WA 3D5JA 3F8XA 1JB2A 2O89A 1S723 3GNJA 4TXVA 2YANA 1WNHA 1R4CA 3B4OA 2R2JA 2VM2A 3CNMA 4JU5A 3X41A 2I81A 1K0CA 3EE1A 4STDA 1ZO2A 2V6KA 2VLVA 5HFKA 3RHCA 1BNGA 1A2VA 1VQ83 4RNZA 1N8R4 2R0PA 1PX6A 3G7JA 3KSED 1FGOA 5RNTA 4WF4A 1E97A 2UGIA 2GU3A 2KRTA 5TGNA 2YWIA 1SL2B 5ECQB 1K0BA 1SYXA 1K3OA 1YKCA 1AQXA 1M904 1BSDA 2CVKA 2CX1A 5FW5A 3RDWA 5IG5A 2B7JA 3MKIA 5ECNB 3LYPA 4V1Ap 3WD6A 5CF2A 4WKWA 4E8HA 1M7TA 3HIGA 2E2VA 3U97A 2HSMA 5BMUA 3HJPA 2H70A 2VD0A 4EW5A 1RKYA 5D8IA 1J08A 5G2GA 1RCKA 4FMCA 1DUGA 2ZNMA 4BIKA 4R1KA 3BNEA 2JL4A 3B7CA 4GQCA 1IYYA 1I3IA 4FCMA 4XTSA 4N0ZA 2VAFA 1USBA 3MSOA 1VQ43 3JUOA 4RI6A 2BT3A 3ZZXA 3IPTA 1TU8A 1PX7A 1J9BA 3L78A 5AIXA 3GZYB 2Y74A 4ZM8A 4CDOA 4ZBAA 1UI8A 1JLVA 5CRDA 1XCCA 4ZXGA 2AJQB 3ERGA 1UCIA 1JZOA 2QEX3 3WYWA 1QGVA 4PGTA 4HQSA 1LOWA 3ZVJA 1LNIA 1Q824 3NIVA 3UAPA 5KN0A 4BVYA 5IQYA 3NOFA 4Z2UA 1GTUA 4PX1A 2H0GA 1GNWA 4TN8A 1R26A 1Y4KA 1O6JA 4K7NA 1OHSA 2HNLA 3L0HA 3VLNA 5IO2A 4I5QA 5IO0A 1GTAA 4ECBA 3QK9A 4NV5A 1TRQA 3Q2PA 3ZG0A 1TRSA 2H6YA 3LTAA 1XIYA 4KSOA 3SBCA 1M3IA 2B1XB 4NHZA 4X2HA 4O5QA 3X3XA 3O6TA 5JPUA 2HI7A 4TX4A 1TTOA 1VQ93 1U6TA 1N5PA 2R6KA 3FKFA 2OWPA 3HXSA 5KP3A 4HJMA 2DJ1A 4ZILA 3LXUX 3CC73 1I8VA 1PKZA 3KH9A 4F2IA 5DALA 1O8WA 1PD21 3MNGA 4K1VA 1OC9A 5JCUA 5KN2A 1MTCA 4IGJA 4ZL8A 4TR1B 7GSPA 2K54A 3GKXA 4OO4A 2KF5A 4YH2A 4Z7XA 1B9YC 1WP0A 3UJ1A 4K1FA 1FHEA 4K5SA 1R5AA 1BOXA 2PVOC 1BGSA 5LNKe 1U88A 2C3TA 3R2QA 3KZQA 2WB9A 1DMMA 3PS8A 4PQIA 2CQ9A 1N8JA 1GD3A 5J9CA 2H6XA 1STFI 1UCLA 1XWCA 3FF2A 5F0GA 1MDKA 2KHPA 3CMIA 4N6MA 10GSA 2LRTA 4V2MA 1AXDA 3LYKA 5A5KA 3GSTA 2G2QA 3I0YA 2CFDA 4NMUA 1SKSB 1ZYQB 3GN3A 3FR3A 1US1A 1THXA 1WJKA 3FY7A 1NB3I 3A5EA 2XGNA 3HCZA 5ID2B 3J7Yd 3ISOA 3HZPA 1OHPA 1W2B2 5GZZB 3D9RA 3HHVA 1BSCA 3M8CA 3IBHA 4USSA 1OH0A 2H6ZA 2I4AA 4WWUC 3EINA 4WEYA 2B7KA 4BVYB 3D4TA 1OACA 5CF1A 4PURA 5EL8A 2ON7A 3AGNA 4XBYA 5G31A 1TI3A 2BMRB 2DSAA 2TIRA 1IVVA 1TRPA 1YJ6A 1VQL3 5ABRA 3GWRA 4HZ4A 5DJLA 4X2OA 1KC84 5ECPB 4HBRA 1XW5A 3KJYA 2P5QA 1JHBA 3PGBA 2VO4A 4HM0B 1Z7RA 4KFFA 3C8EA 3QOUA 4I6XA 4EF0A 3V98A 1O7GB 4WFOA 2MMAA 3VSYA 2MF7A 3MWHA 4NWYA 1S3AA 4HUAA 2W04A 1X9WB 5ECLB 1GOYA 1T2HA 2E2UA 3DGNA 3H3HA 4MMMA 1QQ2A 3IPZA 2O9UX 3KM6A 4L0UA 2QA43 3IC8A 1U5OA 5EPFA 2D42A 3K63A 1CQSA 1KQS2 1X0RA 2CX3A 1HNBA 1FA3A 1CH0A 3UL6A 2A2RA 3CC43 1GNEA 3A2XA 2HOHA 1KBNA 2C3NA 3T0UA 2WGOA 1W00A 2JACA 4IHUA 4MNNA 4J56E 2X99A 2ZUPA 6GSSA 2JDIH 5IM9A 3FG3A 3SX1A 4HOHA 3FZ9A 3CCS3 2F5WA 1QAFA 2H74A 1XOAA 5INYA 2EIOA 1EOGA 1AVKA 4F0CA 2Z9SA 4HYZA 3DYRA 3KTBA 2RIIA 2C3QA 4K2DA 1VQ73 3LEFA 1B2MA 3KIJA 2O7KA 3ME8A 2NDOA 3CRUA 2CAIA 2P05A 1TRVA 2WS2A 2TRXA 5DVBA 2CK3H 2KF4A 5G5EA 3BNCA 3LOYA 1ZOFA 2GZYA 1LQMB 4MJDA 4BTWA 3HVNA 2BTOT 4ULXA 1ZGXA 1LXEA 4BVXA 4GCIA 2YWNA 1T4ZA 1JN5B 2W56B 2GEXA 2N5BA 2GU1A 4FYUA 4GRFA 4R9LA 3OWYA 7STDA 1JBRA 4IS0A 1VQN3 1JZWA 4I2TA 2J23A 4K90B 1YZXA 5KN3A 5HR2A 5LCZA 5AISA 2XBQA 4POBA 4PNFA 5IMAA 5G30A 4MJCA 1SD9A 5COHA 2KXGA 4F9ZA 1N8QA 4MH2A 3GAXA 1B21A 3RPNA 3NBJA 2RGQA 3MG3A 2LQQA 1XWGA 4L8EA 2FGXA 3WOEB 22GSA 2CVDA 5A0OB 1L5GB 3S5CA 1C54A 2IWTA 8GSSA 1B2UA 2QGVA 2GTUA 1TUHA 2K6VA 1SK2A 3S67A 3VPTA 1B48A 5AIFA 1T2IA 3UVHA 1EOHA 3F0IA 3FZ5A 6GSXA 1X1UA 1AIUA 3LW9A 3VWWA 2BHMA 1A2MA 3CCV3 4G0KA 3ZLPA 1AY7A 1XXUA 2C4BA 4HU7A 3CCL3 5BRTA 1BSAA 4RZMA 4HQZA 4XB5A 1SL1B 3DMLA 1O7PB 4DSSB 1E6BA 1W01A 6GSVA 1RGKA 2LKUA 2V41A 4KCEA 1DYUA 3B8LA 1JJ22 2B5EA 5M1AA 3ZTLA 4IJIA 3GZBA 4TR3A 3WODG 1NO3A 3PH9A 1PKWA 4I4KA 3IV4A 2LS5A 5ELGA 9GSSA 1SIHA 3TJBA 3MG2A 1DVDA 3O76A 3FKAA 2GBXB 2X8GA 1V40A 4KF9A 3ZYWA 4I97A 3K0ZA 1I9DA 4OO5A 3LT9A 4IP1A 4LSOA 3FH1A 1K0MA 1RRLA 4IT7A 2KUCA 4YQMA 3H51A 1ML6A 1O81A 1BANA 3I563 3H8QA 2H1GA 4HU9A 1F2EA 3KP8A 4TRXA 2ON5A 3OWSA 4WYKB 2H1BA 3N54B 1MDJA 2PZVA 1K0AA 2YN1A 1HZ1A 1MEKA 1SJIA 2VD1A 2ML5A 4JE1A 4ECIA 5JWOB 2R3XA 1QXHA 5HR1A 3L9SA 1F3AA 1QALA 4HS1A 3TB2A 1UUGB 5D73A 1B9XC 1ERWA 4KFEA 3DMCA 4K5RA 3ZFZA 7RNTA 4MA9A 2J9HA 3RBTA 3TRPA 1XZOA 3FMWA 5FHIA 4LYLB 3JUPA 1PFOA 1RQMA 2L4VA 3HJMA 3MG1A 4WXTA 3P7XA 2GQLA 1YKAA 3F6FA 5L71A 2HRAA 1R4YA 4XRDA 1XW6A 5GAPD 6GSWA 4HJLB 3UIWA 3FEUA 3ERFA 5ELUA 1YIJ3 5KP4A 1OE8A 2P31A 3EURA 3Q90A 1YVBI 3S28A 3DRNA 2DJ0A 2WGRA 1UC7A 1M2BA 3FZWA 2VCQA 3EU3A 5D9XA 4ML1A 1DE3A 1MGWA 1TDIA 1RGAA 3QFBC 2GEYA 1NHOA 4EDYA 3IR4A 4G10A 5CP1A 1CQHA 3WA3A 4A5PA 5D9WA 3C1RA 4HOJA 1OC9B 5DDLA 2GSSA 1GSQA 3DXBA 3DEXA 1PY3A 3AMOB 2WZ9A 3D3LA 4AKYA 3RGRA 4ID0A 3RPPA 3MPHA 3ZFBA 1O7NB 1W6GA 3UEMA 3EN1B 3F4RA 1H75A 2I3YA 2LJAA 4NXIA 3L9UA 2PVQA 1YGEA 4WF5A 2VUPA 1FGTA 1WIKA 1YEXA 2IUJA 1XVWA 5B6NA 1O7HB 4XBTA 4LL4B 1F3BA 3EYTA 2STDA 1XBSA 5D9TA 2OQEA 3VWXA 1I0VA 2IFQA 1FUTA 3JUQA 1GY6A 2YFLB 4EBGA 4N6LA 4YQUA 2GZPA 1HQOA 2LJKA 1HYUA 4GXZA 2MMZA 4EXJA 3UB1A 3EVIA 3I69A 4FQUA 4AJ8A 1OHOA 3GYKA 1LOXA 2A2SA 2L1SA 2M72A 4JRRA 1S3CA 2FA4A 2W9QA 1PSQA 1B2ZA 3J7Yb 1SYRA 4FCZA 5FWGA 1GRXA 2AADA 2C10A 2NVLA 2VOCA 5IPHA 1RN7A 1TRWA 5ECKB 1O7MB 3U5RE 3NM7A 4FYCA 3WT2A 4IELA 5CLKA 3Q18A 5BIRA 1SK1A 3BIRA 2RCDA 1I2EA 1K3LA 3M8NA 4HJ2A 2YPMA 5B8AA 2L6CA 1W2ZA 3V92A 1GULA 2L4QA 3DGOA 2GVPA 3DD3A 1RJOA 2CG1A 2NPBA 3KP9A 4N0VA 1MWRA 2YJ7A 3D5IA 3AMOA 3UBLA 4HKVB 3ZRDA 2AB6A 3B4PA 3QCPA 5F05A 1M0UA 1RCLA 2F5MA 4GLTA 1FW1A 3NV0B 3CMA3 2O85A 2KF3A 2IYJA 1VF3A 4BL7A 2O87A 2X8CA 2JZRA 1FOHA 4J8TA 2L57A 2IFQB 2ALBA 3L0RA 1A90A 1I0XA 2H0IA 4N30A 1WQLB 1QK8A 4H3UA 2CA8A 2DC5A 4LA1A 2H8LA 3H1NA 19GSA 2P0XA 2F9SA 1I70A 2RFRA 3QRDA 1BUJA 5AI1A 4NHFA 1TU5A 5IMVA 1QJGA 1UUVB 3KXOA 1GSYA 4KDUA 2OOVC 1X5EA 3EPTA 2A4VA 3TGZA 2M7OA 1VF2A 1BSBA 3LQ7A 2R5GA 4Q53A 1FO5A 3KMOA 3IHGA 4FMAA 2KP1A 4PEJA 1B3SA 3KZTA 2VCVA 3HVVA 2JSYA 3BBYA 3QR6A 5A4VA 1M9GA 2IPAA 5JPPA 1UGIA 2CX4A 3HD5A 4HVNA 4MMZB 3GL3A 3PYJA 1JNQA 1N2AA 3I43A 5G2ZA 5IMCA 3NX0A 3V99A 1M9BA 1ZX2A 4QL7A 4MEIA 2YV7A 4PUAA 2JSZA 3Q19A 4FR9A 4D73B 3OW22 3GIXA 2W9PA 4LGQA 2F86B 1NJI4 1GOVA 3JUNA 5D93A 1FOVA 4FH8A 4CHSA 3KCHA 1ULIB 1O8XA 1AV4A 5B6MA 3QAGA 3APSA 1PQNA 5J3RA 4BL2A 1K734 3LZAA 3DGLA 1AR0A 1W4NA 2YP6A 5J9BA 3BU4A 1OE7A 4X4JA 1RK4A 3FGYA 1K3YA 1B20A 14GSA 3ERWA 1SL0B 4ZIJA 3BLZA 1X1YA 1X1WA 2DMMA 1W6YA 1W89A 5AEUB 2XFSA 3VI7A 2XSHB 3KD0A 3NZNA 3SLUA 1K0DA 2H72A 4OCFA 2B3SA 1OGXA 1T5YA 3V1WA 4EV5A 1FAAA 1RN1A 3E0UA 1CYVA 4TW5A 1F6MC 3P2AA 2HMKB 2Z76A 3D4AA 1XWBA 2ML6A 1BNJA 2CX0A 1QFNA 2FWGA 3BJ5A 2P09A 1BSEA 4K7OA 1C7HA 4FIWA 3UL3A 3G713 5B7CA 1Z6NA 3BOAA 11GSA 4HEA2 2F98A 4IKHA 2PPTA 5G1LA 3X3YA 1VQM3 5KOXA 4HI7A 1W4VA 4RI7A 2AHEA 2XC2A 4Z2RA 2VIMA 1B2SA 5IENA 3UVTA 4BA7A 1FGMA 3PR8A 4X43A 1BU4A 5FT3A 5DREA 2PN8A 2OKAA 4PTSA 5ELAA 2R4IA 2UUGC 2JZSA 4R4KA 2PERA 1GLPA 1ON4A 1ZL9A 3S9FA 2CC3A 2DBCA 3GSPA 3RGAA 3FG4A 3QD9A 4I2UA 2IMJA 2RNTA 4OK0A 1SPUA 4ZB8A 4L0WA 2WFCA 5AIVA 3HIIA 2KF6A 4O02B 2DKHA 3H4KA 1G6WA 5G1KA 2GSRA 1DMNA 5ECOB 1SJZA 4AF2A 5GAND 3JUMA 5D9VA 8CHOA 2WJUA 1PU4A 3LTDA 2I9HA 2WOFA 3EWLA 2BIRA 1WPIA 1ACVA 2ZCTA 1WWJA 2F99A 4ZBDA 3TCOA 1BNRA 3CME3 1TI1A 4MPGA 3WMDA 2ZHXB 3DXOA 3F40A 3DGMA 5HFGA 3G6E3 4EC6A 5IEOA 4KT3B 3GL5A 1SENA 1YEPA 4HM8B 1DETA 3D79A 1MWSA 2YCDA 1Q814 5ECMB 5IG0A 3HI7A 3R3EA 5AN1A 1IT8A 2SARA 2ZDJA 5ECHB 1ERTA 2DMLA 1UCKA 4POKA 4OCEA 4K9ZA 5LD0A 2CFKA 1VF4A 3EHCA 3IK9A 3LMLA 1WE0A 1IVWA 2E0QA 1WTHA 3EC9A 1OCVA 2QGUA 1EWXA 1GS3A 1LQGC 1IQYA 5ENUA 5GSSA 3AHWA 4L7KA 4I8BA 2LNTA 1IQXA 3M9JA 4FMBA 4OD7A 3Q3FA 2BO9B 1M1K4 1M99A 1WMOA 2OTL3 1GSPA 5DQSA 3ZIVA 4HM2B 1MDIA 2L5LA 1ZZYA 1G02A 4EIPA 1RGEA 2W2CA 1JKGB 3HA9A 4JZQA 1AQVA 5CNWA 2BNGA 1X1XA 3WDGB 3K7CA 3C7MA 1PL1A 2X8HA 4KE3A 4Q5FA 1GLQA 4XDWA 2HMLB 1FVJA 1TXXA 5KP1A 4HSCX 5CO3A 2LYXA 5BU4A 2CWVA 1FG4A 1T8EB 3SVAA 4NPBA 4TR0A 1AC1A 2YJHA 2FGTA 2R4VA 5CRWA 3TJJA 1ROVA 4CPKA 3F4TA 4G1MB 1OYJA 4N11A 4IPBA 5IW9A 1BNEA 3IDVA 4WR4A 4HZ9B 4BL3A 3ZL5A 1A8LA 3DVWA 1FGQA 1SJ6A 5AIHA 2LUSA 1Y6EA 2N5AA 1QMAA 5F06A 2OE3A 5HR3A 1EKMA 4JEDA 3EBTA 3HVXA 4L8OA 1ZYEA 3TOTA 4AJ7A 4NREA 5M19A 1QUWA 2FLSA 2YZUA 5HOHA 4FO5A 2B1KA 2F56A 5CAXA 2CWUA 3ROBA 2XFTA 1B27A 5HQPA 1ZYPA 4RNTA 1JZDA 4PQ1A 1BRSA 3ZMKA 2GT6A 2B5XA 2QKEA 3FR6A 1A67A 1SQWA 5J4UA 4ICYA 3BB9A 1EUIC 4BPYA 1JBTA 4AKZA 2CWTA 4PUFC 3IMAB 4J9AA 1Z3EA 4DKIA 1UUWB 1TOFA 4L5OA 1WOUA 3EMXA 1BEDA 5EY6A 3SOAA 1SJWA 5D81A 3GKKA 2CHCA 2KAAA 1SIIA 1LVNA 5H5SA 3X40A 4KB3A 2K9FA 1FGRA 1CYUA 3CSJA 2F8AA 3TDGA 1OF5B 2MC8A 2CIUA 3F63A 5JBSA 2E7PA 1RGCA 1LOYA 4JF8A 4XDVA 2GSQA 3MSZA 5LC7A 1WMJA 1KNGA 2CFLA 1R5PA 4CY6A 4ML6A 2WRTA 4OFNA 2XPDA 2NBSA 2IY2A 1X5DA 4U13A 3QAVA 3UJMA 4GQFA 4IJ3A 3HK4A 2CAQA 3S29A 3TRQA 2FWFA 1A2KA 2AYTA 12GSA 3PGTA 3DGQA 2GDRA 3GUSA 5F07A 1S3RA 3ZREA 2R37A 1TTZA 2OCTA 1IT7A 3CCR3 4OWYA 1LBKA
chains in the Genus database with same CATH topology
4G0LA 5DQYA 1TW9A 1A8YA 1GUKA 1EZKA 2HZEA 3CXGA 3LG6A 1SD8A 1DBYA 4BWQA 4MJAA 3TOUA 2RM5A 2OA7A 5J41A 2OJLA 2LEGA 1UVZA 2HLSA 4YAPA 4Q5QA 3RAZA 1M2AA 3D4MA 4MK3A 4ZL7A 1GWCA 3TKQA 3TJGA 3F6DA 4QL9A 4EIQA 2RM6A 3CRTA 2AV4A 1F37A 3Q74A 1ST9A 3N9JA 2PGTA 4QQ7A 1GUMA 2KLXA 1V58A 3ZVJD 2C4JA 1B4QA 1GSEA 3P90A 1GL8A 4IVFA 4MPFA 2H0HA 2H1AA 3QMXA 1DE2A 2FCHA 2YOIA 4MZWA 1TJDA 1LU4A 3F3QA 2GGTA 2REMA 4ISDA 4YKGA 3F9UA 1BJXA 3QFAC 3D6IA 4XCSA 2AUVA 3FRCA 3GKNA 4V2NA 4K8MA 1SKRB 3KTLA 4O5UA 2PBJA 4DSQA 2IJYA 1ERUA 3TRXA 20GSA 3VK9A 1TK0B 1A2LA 2FWEA 2CZ3A 3EU4A 4MP4A 1Z9HA 5IMFA 2CT6A 2DKIA 3GRXA 3LJRA 4TOPA 2H75A 3WGEA 2HRNA 1JLWA 5AGYA 3HDCA 1JZRA 3EC3A 1GP1A 4XS4B 2FWHA 4ZBBA 4WBRD 1KTEA 2FUG2 5KEJA 3CSHA 3HJOA 2GSTA 3F8UA 4PXOA 2FHEA 3PPUA 1NSWA 2QSIA 1GH2A 2V1MA 1M2DA 4NV2A 4ACSA 2MMNA 1T1VA 2BJXA 2HE3A 4KAEA 2NTOA 1O7UA 1LJRA 4YKFA 1AAZA 5DJMA 2GQMA 2L4CA 1UN2A 1VGLA 2X4AA 5GSTA 4ILFA 3D21A 5A4UA 3VURA 2YNXA 4XS4A 1BQ7A 3HKRA 2WDUA 2YZHA 4GSSA 1XOBA 1XW9A 4BVXB 1OAZA 5CREA 4CY8A 2F8FA 1GTBA 5DALB 3KMNA 3FHKA 2JADA 4O5RA 4TR1A 4MF6A 2F3MA 1TK5B 4F03A 3TKSA 1YQ1A 6GSTA 4DSSA 4POLA 1OC8A 3GSSA 4X1UA 1EGOA 5ECIB 3KEBA 4PQHA 1X9SB 4V1Ag 3W8JA 2V6OA 2L6DA 1ABAA 2H19A 3DVXA 5ECSA 2DLXA 1A0FA 4KW6A 1Y25A 4G19A 3HZ4A 1V98A 5HR0A 4OFMA 16GSA 4XHMA 4AJ6A 4KNDA 2WULA 4D73A 3IOSA 3KGKA 3ZFLA 1B4PA 5C00A 2MBTA 2CVBA 5H5QA 2XPEA 2D2ZA 3IK7A 4TR4A 2V32A 2GZZA 4P3YB 3CSIA 1U3IA 1OKDA 1UA5A 3BD2A 3EMPA 4FYBA 1T00A 2C8UA 4K6XA 4J2FA 4ECCA 3M0FA 1O85A 3UMAA 1OKTA 2K18A 3GTUB 1AUCA 2C0EA 1H4OA 2IMEA 3GH6A 1WRYA 1PMTA 2IMKA 3O3TA 1JFUA 2R0CA 5JCWA 2A2PA 1SKWB 1ZMAA 3TKPA 4GWRA 3IXRA 2PU9C 3W6GA 3U6VA 3A2WA 2FA8A 5JWQB 5DCGA 3ZMLA 2DIZA 1U87A 4O7HA 4LMWA 5DCHA 1J0FA 3W8SA 5ECRB 1IYHA 2EIRA 3IRAA 3E9JB 4IN0A 2JZTA 2KP2A 4MLYA 2BMXA 4KSMA 2YWOA 3HZ8A 3LWAA 5CRGA 1EV4A 1EGRA 2X49A 1A24A 3M3MA 4TVEA 4TXOB 1VF1A 2RLIA 3FZAA 1B8XA 5CYYA 5J5NA 4AGSA 4ZL9A 4MH3A 4KH7A 4X0XA 1YF1A 4KGIA 3SWLA 4LL1B 1ZCPA 2HSYA 3EE2A 2E2MA 2P5RA 2VCXA 4GTUA 3TJKA 3PINA 4K0NA 2GS3A 17GSA 2O8VB 3GA4A 3FR9A 2EIQA 3GH9A 2IN3A 4RQRA 5IIZA 4IBPA 2IL3A 2PUKC 2MZCA 2WCIA 2MMOA 1NW2A 1PRXA 2H73A 4KDYA 1TK8B 3QAWA 3GX0A 5IMZA 4MZCA 2LTKA 2OACA 4CW9A 3JCML 2TRCP 1EEJA 1V57A 2X64A 2LNSA 3KH7A 2CV4A 1AW9A 2OE0A 5A4WA 2L59A 1EV9A 1BX9A 2FD3A 2LRCA 2DJ3A 3CTGA 1Z5YE 4MDCA 3WT1A 2HFDA 2VCTA 2C0FA 3US3A 2I1UA 3ZIJA 3ZITA 1SK0A 3GX8A 3IC4A 5DBQA 4KX4A 2DJKA 2RUFA 1BAYA 2E2GA 1PN0A 2CZ2A 3I6AA 4ECJA 4TXOA 4Q5NA 3CBUA 1K0OA 4J57E 4IQ1A 2B6MA 1EP7A 1ERVA 3F4SA 1PA3A 1PL2A 4BL7B 3APQA 3HYPA 2UZ8A 2HYXA 4OFTA 4WBJA 1PGTA 1A0RP 1TU7A 1MD4A 2MBSA 3IAS2 3Q6OA 4N10A 4EO3A 4YAVA 4KCAA 3GMFA 4MJEA 2HRKA 3LGCA 2M46A 2LRNA 3OR5A 2IMIA 1T4YA 2C80A 2QA2A 3GURA 3N5OA 2LQOA 2QA1A 3J7Yk 3LXZA 4Z2TA 1TRUA 3LSZA 3RHBA 5KN1A 4DSRA 1YDKA 4XIHA 3GV1A 3K8NA 2QC7A 1T7PB 4KDXA 1Z6MA 2DIYA 3QDNA 1GTIA 4EL1A 3MYDA 3VFIA 4JR6A 2C0GA 3IA1A 3VWVA 2RUEA 4F82A 2EC4A 3A5WA 1QMVA 2HRFA 2N5FA 2GQKA 2H71A 1U3AA 1AQWA 1G7OA 2H1DA 3AY8A 2HSHA 4WETA 3CTFA 1XWAA 4JR4A 3G7IA 4PNGA 3APOA 4HDEA 4MABA 5H5RA 4MF5A 2GLRA 2B1LA 3A2VA 3BCIA 4LLRA 3TUEA 1C72A 3F3RA 1G7EA 1GSDA 3D0ZA 6GSYA 2YWMA 1YF0A 3WGXA 5E59A 1F9MA 1DSBA 1HNAA 3G7YA 3CYNA 2JU5A 4OMVA 1A2JA 4O92A 3FK8A 5HFIA 1CQGA 2R0GA 3C1SA 2DJ2A 3ME7A 4O32A 3FZ4A 3UBKA 1YY7A 1BYEA 1RW1A 4EE0A 1URMA 3DWVA 2ES7A 1FB0A 3DKSA 1R4WA 4K0GA 4MCUA 1XWKA 1ZYNA 1EP8A 1NHYA 2H66A 3G9BA 2LSTA 3HVSA 1Q98A 4IQAA 3H93A 2H01A 3IHQA 3E3EA 1Z7PA 3D22A 1GUHA 3C71A 4E8EA 5IOWA 1NM3A 4KUNA 2GT5A 18GSA 4GSNA 1XFLA 1ZGNA 1X5CA 4G9HA 3C73A 3H79A 3VPQA 4EUYA 2G0FA 5IMDA 1TP9A 3UOMA 4ZB9A 4K2XA 1HNCA 2HT9A 3M1GA 3UARA 2VLTA 2V2GA 4KA0A 4XS1A 5G5FA 4MF7A 4WR5A 4EKZA 3MAKA 5ID2A 1M9AA 1GSFA 1K0NA 5JWRB 1SU9A 2KOKA 4H86A 3WGDA 2L5OA 2DJJA 2VL2A 4IP6A 2B5YA 2YV9A 1KEBA 3BCKA 4DVCA 4K7IA 4G0IA 3TKSE 1T3BA 4RQXA 1ILOA 1I5GA 2VCWA 5EVOA 1O73A 2K8VA 2LJRA 3A5IA 3IAM2 1E2YA 3I9V2 2XHFA 3LFLA 7GSSA 3LORA 4LMVA 4EC0A 1HD2A 2K8SA 2VCZA 2OE1A 4IW9A 3GHAA 3L4NA 2HZFA 5CRHA 2FNOA 4V2LA 2C0DA 1FVKA 2HXKA 3GKMA 5DAKA 1X9MB 4JBBA 2AAWA 4GSTA 1S3DA 5D96A 1OC3A 1DE1A 2LV3A 5JCGA 3KCMA 4F0BA 2OBIA 5KOWA 4GF0A 2VM1A 1EEMA 1BG5A 4G2EA 4POMA 3TKSC 4Q5RA 1G6YA 2C1YA 2VLUA 5B8BA 3MIXA 1GSUA 1Q4JA 2F51A 3IE3A 3FYGA 2H30A 1THOA 5IOXA 3L9VA 5IPGA 3FW2A 1MD3A 2OADA 4EDZA 1XPVA 1A23A 2VL9A 4NAXA 1VRSD 3HY2A 4EVMA 1GSSA 4MZBA 1PN9A 2XBIA 4NHWA 3M9KA 2PWJA 3GFKA 3TKRA 13GSA 2IIYA 2A4HA 1FB6A 4XRAA 1XVQA 6GSUA 2IMFA 3QPMA 2HZEB 4RUVA 4DEJA 4TKYA 2FY6A 4ZB6A 3LXTA 3A3TA 3VI5A 2OBKA 2P0GA 3VWUA 1V2AA 4YQVA 4HZ2A 2MYGA 3ED3A 5F8BA 1IYIA 2M80A 5DAKB 2IMDA 4BWSA 2H76A 2VL2C 1V9WA 4L5LA 3GTUA 1R7HA 5C04A 1TKDB 1OVNA 3P8WA 3TJFA 1G0TA 3DIEA 2PMTA 4MJBA 2VL3A 4XS6A 3MDKA 5E4WA 3D5JA 2O89A 3GNJA 4TXVA 2YANA 2R2JA 2VM2A 4JU5A 2I81A 1K0CA 5HFKA 2V6KA 2VLVA 3RHCA 2R0PA 1PX6A 3G7JA 4WF4A 2YWIA 1SL2B 5ECQB 1K0BA 1SYXA 1K3OA 1YKCA 1AQXA 2CVKA 3RDWA 2B7JA 5ECNB 3LYPA 4V1Ap 3WD6A 4WKWA 4E8HA 1M7TA 2HSMA 5BMUA 3HJPA 2H70A 2VD0A 5D8IA 1J08A 1DUGA 2ZNMA 2JL4A 4GQCA 4XTSA 4N0ZA 2VAFA 1USBA 4RI6A 3ZZXA 1TU8A 1PX7A 1J9BA 3L78A 5AIXA 4CDOA 4ZBAA 1JLVA 5CRDA 1XCCA 4ZXGA 2AJQB 3ERGA 1JZOA 3WYWA 1QGVA 4PGTA 4HQSA 3ZVJA 3NIVA 3UAPA 5KN0A 4BVYA 5IQYA 3NOFA 4Z2UA 1GTUA 4PX1A 2H0GA 1GNWA 4TN8A 1R26A 1O6JA 4K7NA 2HNLA 3L0HA 3VLNA 5IO2A 4I5QA 5IO0A 1GTAA 4ECBA 4NV5A 1TRSA 2H6YA 1XIYA 4KSOA 3SBCA 4NHZA 4O5QA 3O6TA 2HI7A 1U6TA 2R6KA 3FKFA 3HXSA 4HJMA 4ZILA 2DJ1A 1PKZA 3KH9A 4F2IA 5DALA 1O8WA 1PD21 3MNGA 1OC9A 5JCUA 5KN2A 1MTCA 4IGJA 4ZL8A 4TR1B 3GKXA 4OO4A 4YH2A 4Z7XA 1B9YC 1WP0A 3UJ1A 4K1FA 1FHEA 4K5SA 1R5AA 2PVOC 5LNKe 1U88A 2C3TA 3R2QA 3KZQA 2WB9A 4PQIA 2CQ9A 1N8JA 5J9CA 2H6XA 1XWCA 5F0GA 1MDKA 2KHPA 3CMIA 10GSA 2LRTA 4V2MA 1AXDA 3LYKA 5A5KA 3GSTA 2G2QA 4NMUA 1SKSB 1ZYQB 3GN3A 3FR3A 1THXA 1WJKA 3FY7A 3HCZA 5ID2B 3ISOA 5GZZB 3HHVA 4USSA 3IBHA 2H6ZA 2I4AA 3EINA 4WEYA 2B7KA 4BVYB 3D4TA 4PURA 5EL8A 2ON7A 5G31A 1TI3A 2DSAA 2TIRA 1YJ6A 5ABRA 4HZ4A 5DJLA 5ECPB 1XW5A 3KJYA 2P5QA 1JHBA 2VO4A 1Z7RA 3C8EA 3QOUA 4I6XA 4EF0A 2MMAA 3MWHA 4NWYA 1S3AA 4HUAA 1X9WB 5ECLB 4MMMA 1QQ2A 3IPZA 3KM6A 4L0UA 3IC8A 5EPFA 1X0RA 2CX3A 1HNBA 2A2RA 1GNEA 3A2XA 1KBNA 2C3NA 2JACA 4IHUA 4MNNA 4J56E 2X99A 2ZUPA 6GSSA 5IM9A 3FZ9A 2H74A 1XOAA 5INYA 2EIOA 1EOGA 4F0CA 2Z9SA 3DYRA 3KTBA 2RIIA 2C3QA 4K2DA 3LEFA 3KIJA 2O7KA 3ME8A 2NDOA 3CRUA 2CAIA 1TRVA 2WS2A 2TRXA 5DVBA 5G5EA 1ZOFA 2GZYA 2BTOT 4ULXA 4BVXA 4GCIA 2YWNA 1T4ZA 2N5BA 4FYUA 4GRFA 4IS0A 1JZWA 4I2TA 2J23A 1YZXA 5KN3A 5HR2A 5LCZA 5AISA 2XBQA 4POBA 4PNFA 5IMAA 5G30A 4MJCA 1SD9A 5COHA 4F9ZA 4MH2A 3RPNA 2LQQA 1XWGA 4L8EA 2FGXA 22GSA 2CVDA 2IWTA 8GSSA 2QGVA 2GTUA 2K6VA 3VPTA 1SK2A 1B48A 3UVHA 1EOHA 3F0IA 3FZ5A 6GSXA 3LW9A 1AIUA 3VWWA 1A2MA 4G0KA 3ZLPA 4HU7A 1XXUA 5BRTA 4HQZA 1SL1B 3DMLA 4DSSB 1E6BA 6GSVA 2LKUA 2V41A 4KCEA 2B5EA 3ZTLA 4IJIA 4TR3A 3PH9A 1PKWA 3IV4A 2LS5A 5ELGA 9GSSA 3TJBA 3O76A 2X8GA 1V40A 4KF9A 3ZYWA 4I97A 1I9DA 4OO5A 4IP1A 1K0MA 2KUCA 4YQMA 1ML6A 1O81A 3H8QA 2H1GA 4HU9A 1F2EA 4TRXA 3KP8A 2ON5A 2H1BA 1MDJA 1K0AA 2YN1A 1SJIA 1MEKA 2VD1A 4JE1A 4ECIA 5JWOB 2R3XA 1QXHA 5HR1A 3L9SA 1F3AA 4HS1A 3TB2A 5D73A 1B9XC 1ERWA 4K5RA 4MA9A 2J9HA 3RBTA 3TRPA 1XZOA 3FMWA 5FHIA 1RQMA 3HJMA 4WXTA 3P7XA 2GQLA 1YKAA 3F6FA 5L71A 2HRAA 4XRDA 1XW6A 5GAPD 6GSWA 3UIWA 3FEUA 3ERFA 1OE8A 2P31A 3EURA 3DRNA 2DJ0A 2WGRA 1UC7A 1M2BA 2VCQA 3EU3A 5D9XA 4ML1A 1TDIA 3QFBC 1NHOA 4EDYA 3IR4A 4G10A 5CP1A 1CQHA 4A5PA 5D9WA 4HOJA 3C1RA 1OC9B 5DDLA 2GSSA 1GSQA 3DXBA 3DEXA 3RPPA 2WZ9A 4ID0A 3ZFBA 3UEMA 3F4RA 1H75A 2I3YA 2LJAA 4NXIA 3L9UA 2PVQA 4WF5A 2VUPA 1WIKA 1YEXA 1XVWA 5B6NA 4LL4B 1F3BA 3EYTA 1XBSA 5D9TA 3VWXA 2IFQA 4YQUA 2GZPA 1HQOA 2LJKA 1HYUA 4GXZA 2MMZA 4EXJA 3EVIA 3I69A 4FQUA 4AJ8A 3GYKA 2A2SA 2M72A 4JRRA 1S3CA 2FA4A 1PSQA 3J7Yb 1SYRA 5FWGA 1GRXA 2NVLA 2VOCA 5IPHA 1TRWA 5ECKB 3U5RE 3WT2A 4FYCA 4IELA 3Q18A 1SK1A 1K3LA 3M8NA 4HJ2A 5B8AA 2YPMA 2L6CA 1GULA 2L4QA 2GVPA 3DD3A 2NPBA 3KP9A 4N0VA 2YJ7A 3UBLA 3ZRDA 2AB6A 3QCPA 5F05A 1M0UA 4GLTA 1FW1A 2O85A 2IYJA 1VF3A 4BL7A 2O87A 2X8CA 2JZRA 1FOHA 2L57A 2IFQB 2ALBA 2H0IA 4N30A 1QK8A 2CA8A 2DC5A 4LA1A 2H8LA 3H1NA 19GSA 2F9SA 5IMVA 3KXOA 1GSYA 4KDUA 1X5EA 3EPTA 2A4VA 3TGZA 1VF2A 3LQ7A 2R5GA 1FO5A 3KMOA 3IHGA 2KP1A 2VCVA 3HVVA 2JSYA 3BBYA 3QR6A 5A4VA 2IPAA 2CX4A 3HD5A 3GL3A 1N2AA 3I43A 5G2ZA 5IMCA 1M9BA 4QL7A 2YV7A 4PUAA 2JSZA 3Q19A 4D73B 3GIXA 5D93A 1FOVA 4FH8A 4CHSA 1O8XA 5B6MA 3QAGA 3APSA 1PQNA 5J3RA 2YP6A 5J9BA 1OE7A 4X4JA 1RK4A 1K3YA 14GSA 3ERWA 1SL0B 4ZIJA 2DMMA 1W89A 3VI7A 3KD0A 3NZNA 1K0DA 2H72A 4OCFA 2B3SA 3V1WA 1FAAA 3E0UA 4TW5A 1F6MC 3P2AA 1QFNA 1XWBA 2FWGA 3BJ5A 4K7OA 4FIWA 3UL3A 5B7CA 1Z6NA 3BOAA 11GSA 4HEA2 4IKHA 2PPTA 5G1LA 5KOXA 4HI7A 1W4VA 4RI7A 2AHEA 2XC2A 4Z2RA 2VIMA 3UVTA 4BA7A 3PR8A 4X43A 5FT3A 2PN8A 2OKAA 4PTSA 5ELAA 2JZSA 2PERA 1GLPA 1ON4A 1ZL9A 3S9FA 2DBCA 3QD9A 4I2UA 4ZB8A 4L0WA 2WFCA 5AIVA 2DKHA 3H4KA 1G6WA 5G1KA 2GSRA 5ECOB 1SJZA 4AF2A 5GAND 5D9VA 2WJUA 2I9HA 3EWLA 1WPIA 1ACVA 2ZCTA 1WWJA 4ZBDA 3TCOA 4MPGA 1TI1A 5HFGA 3GL5A 1SENA 1YEPA 5ECMB 2YCDA 3R3EA 5AN1A 5ECHB 1ERTA 2DMLA 4POKA 4OCEA 4K9ZA 5LD0A 1VF4A 3IK9A 1WE0A 2E0QA 1EWXA 5GSSA 5ENUA 4I8BA 2LNTA 3M9JA 4OD7A 1M99A 5DQSA 3ZIVA 1MDIA 2L5LA 1ZZYA 4EIPA 3HA9A 4JZQA 1AQVA 5CNWA 3C7MA 1PL1A 2X8HA 4KE3A 4Q5FA 1GLQA 1FVJA 1TXXA 5CO3A 1FG4A 1T8EB 4NPBA 4TR0A 1AC1A 2YJHA 2R4VA 3TJJA 5CRWA 3F4TA 1OYJA 4N11A 3IDVA 4WR4A 3ZL5A 1A8LA 3DVWA 1SJ6A 2LUSA 1Y6EA 2N5AA 5F06A 2OE3A 5HR3A 4JEDA 3HVXA 1ZYEA 3TOTA 4AJ7A 1QUWA 2FLSA 2YZUA 4FO5A 2B1KA 5CAXA 5HQPA 1ZYPA 1JZDA 4PQ1A 3ZMKA 2GT6A 2B5XA 2QKEA 3FR6A 5J4UA 4ICYA 4BPYA 4PUFC 1Z3EA 1TOFA 4L5OA 1WOUA 3EMXA 1BEDA 5EY6A 3GKKA 5H5SA 4KB3A 2K9FA 3CSJA 2F8AA 3TDGA 3F63A 2E7PA 2GSQA 3MSZA 1WMJA 1KNGA 1R5PA 4CY6A 4ML6A 2WRTA 4OFNA 2XPDA 2NBSA 2IY2A 1X5DA 3QAVA 4GQFA 4IJ3A 2CAQA 3TRQA 2FWFA 2AYTA 3PGTA 12GSA 3DGQA 2GDRA 3GUSA 5F07A 3ZREA 2R37A 1TTZA 4OWYA 1LBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQY A;  1TW9 A;  1A8Y A;  1GUK A;  1EZK A;  2HZE A;  3CXG A;  3LG6 A;  1SD8 A;  1DBY A;  4BWQ A;  4MJA A;  3TOU A;  2RM5 A;  2OA7 A;  5J41 A;  2OJL A;  2LEG A;  1UVZ A;  2HLS A;  4YAP A;  4Q5Q A;  3RAZ A;  1M2A A;  3D4M A;  4MK3 A;  4ZL7 A;  1GWC A;  3TKQ A;  3TJG A;  3F6D A;  4QL9 A;  2RM6 A;  3CRT A;  2AV4 A;  1F37 A;  3Q74 A;  1ST9 A;  3N9J A;  2PGT A;  4QQ7 A;  1GUM A;  2KLX A;  1V58 A;  3ZVJ D;  2C4J A;  1B4Q A;  1GSE A;  3P90 A;  1GL8 A;  4IVF A;  4MPF A;  2H0H A;  2H1A A;  3QMX A;  1DE2 A;  2FCH A;  2YOI A;  4MZW A;  1TJD A;  1LU4 A;  3F3Q A;  2GGT A;  2REM A;  4ISD A;  3F9U A;  1BJX A;  3QFA C;  3D6I A;  4XCS A;  2AUV A;  3FRC A;  3GKN A;  4V2N A;  4K8M A;  1SKR B;  3KTL A;  2PBJ A;  4DSQ A;  2IJY A;  1ERU A;  3TRX A;  20GS A;  3VK9 A;  1TK0 B;  1A2L A;  2FWE A;  2CZ3 A;  3EU4 A;  4MP4 A;  1Z9H A;  5IMF A;  2CT6 A;  3GRX A;  3LJR A;  4TOP A;  2H75 A;  3WGE A;  2HRN A;  1JLW A;  5AGY A;  3HDC A;  1JZR A;  3EC3 A;  1GP1 A;  4XS4 B;  2FWH A;  4ZBB A;  4WBR D;  1KTE A;  2FUG 2;  5KEJ A;  3CSH A;  3HJO A;  2GST A;  3F8U A;  4PXO A;  2FHE A;  1NSW A;  2QSI A;  1GH2 A;  2V1M A;  1M2D A;  4NV2 A;  4ACS A;  2MMN A;  1T1V A;  2BJX A;  2HE3 A;  4KAE A;  2NTO A;  1O7U A;  1LJR A;  1AAZ A;  5DJM A;  2GQM A;  2L4C A;  1UN2 A;  1VGL A;  5GST A;  4ILF A;  3D21 A;  5A4U A;  3VUR A;  2YNX A;  4XS4 A;  1BQ7 A;  3HKR A;  2WDU A;  2YZH A;  4GSS A;  1XOB A;  1XW9 A;  1OAZ A;  5CRE A;  2F8F A;  1GTB A;  5DAL B;  3KMN A;  3FHK A;  2JAD A;  4O5R A;  4TR1 A;  4MF6 A;  2F3M A;  1TK5 B;  4F03 A;  3TKS A;  1YQ1 A;  6GST A;  4DSS A;  4POL A;  1OC8 A;  3GSS A;  4X1U A;  1EGO A;  5ECI B;  3KEB A;  4PQH A;  1X9S B;  4V1A g;  3W8J A;  2V6O A;  2L6D A;  1ABA A;  2H19 A;  3DVX A;  5ECS A;  2DLX A;  1A0F A;  4KW6 A;  1Y25 A;  4G19 A;  3HZ4 A;  1V98 A;  5HR0 A;  4OFM A;  16GS A;  4XHM A;  4AJ6 A;  4KND A;  2WUL A;  4D73 A;  3IOS A;  3KGK A;  3ZFL A;  1B4P A;  5C00 A;  2MBT A;  2CVB A;  5H5Q A;  2XPE A;  2D2Z A;  3IK7 A;  4TR4 A;  2V32 A;  2GZZ A;  4P3Y B;  3CSI A;  1U3I A;  1OKD A;  1UA5 A;  3BD2 A;  3EMP A;  4FYB A;  1T00 A;  2C8U A;  4K6X A;  4J2F A;  4ECC A;  3M0F A;  1O85 A;  3UMA A;  1OKT A;  2K18 A;  3GTU B;  1AUC A;  2C0E A;  1H4O A;  2IME A;  3GH6 A;  1WRY A;  1PMT A;  2IMK A;  3O3T A;  1JFU A;  5JCW A;  1SKW B;  1ZMA A;  3TKP A;  4GWR A;  3IXR A;  2PU9 C;  3W6G A;  3U6V A;  3A2W A;  2FA8 A;  5JWQ B;  5DCG A;  3ZML A;  2DIZ A;  1U87 A;  4O7H A;  4LMW A;  5DCH A;  1J0F A;  3W8S A;  5ECR B;  1IYH A;  2EIR A;  3IRA A;  3E9J B;  4IN0 A;  2JZT A;  2KP2 A;  4MLY A;  2BMX A;  4KSM A;  2YWO A;  3HZ8 A;  3LWA A;  5CRG A;  1EV4 A;  1EGR A;  1A24 A;  3M3M A;  4TVE A;  4TXO B;  1VF1 A;  2RLI A;  3FZA A;  1B8X A;  5CYY A;  5J5N A;  4AGS A;  4ZL9 A;  4MH3 A;  4KH7 A;  4X0X A;  1YF1 A;  4KGI A;  3SWL A;  4LL1 B;  1ZCP A;  2HSY A;  3EE2 A;  2E2M A;  2P5R A;  2VCX A;  4GTU A;  3TJK A;  3PIN A;  4K0N A;  2GS3 A;  17GS A;  2O8V B;  3GA4 A;  3FR9 A;  2EIQ A;  3GH9 A;  2IN3 A;  4RQR A;  5IIZ A;  4IBP A;  2IL3 A;  2PUK C;  2MZC A;  2WCI A;  2MMO A;  1NW2 A;  1PRX A;  2H73 A;  4KDY A;  1TK8 B;  3QAW A;  3GX0 A;  5IMZ A;  4MZC A;  2LTK A;  2OAC A;  4CW9 A;  3JCM L;  2TRC P;  1EEJ A;  1V57 A;  2X64 A;  2LNS A;  3KH7 A;  2CV4 A;  1AW9 A;  2OE0 A;  5A4W A;  2L59 A;  1EV9 A;  1BX9 A;  2FD3 A;  2LRC A;  2DJ3 A;  3CTG A;  1Z5Y E;  4MDC A;  3WT1 A;  2HFD A;  2VCT A;  2C0F A;  3US3 A;  2I1U A;  3ZIT A;  3ZIJ A;  1SK0 A;  3GX8 A;  3IC4 A;  5DBQ A;  4KX4 A;  2DJK A;  2RUF A;  1BAY A;  2E2G A;  2CZ2 A;  3I6A A;  4ECJ A;  4TXO A;  4Q5N A;  3CBU A;  1K0O A;  4J57 E;  4IQ1 A;  2B6M A;  1EP7 A;  1ERV A;  3F4S A;  1PA3 A;  1PL2 A;  3APQ A;  3HYP A;  4OFT A;  2HYX A;  4WBJ A;  1PGT A;  1A0R P;  1TU7 A;  1MD4 A;  2MBS A;  3IAS 2;  3Q6O A;  4N10 A;  4EO3 A;  4YAV A;  4KCA A;  3GMF A;  4MJE A;  3LGC A;  2M46 A;  2LRN A;  3OR5 A;  2IMI A;  1T4Y A;  2C80 A;  3GUR A;  3N5O A;  2LQO A;  3J7Y k;  3LXZ A;  1TRU A;  3LSZ A;  3RHB A;  5KN1 A;  4DSR A;  1YDK A;  4XIH A;  3GV1 A;  3K8N A;  2QC7 A;  1T7P B;  4KDX A;  1Z6M A;  2DIY A;  3QDN A;  1GTI A;  4EL1 A;  3VFI A;  4JR6 A;  2C0G A;  3IA1 A;  3VWV A;  2RUE A;  4F82 A;  2EC4 A;  3A5W A;  1QMV A;  2HRF A;  2N5F A;  2GQK A;  2H71 A;  1U3A A;  1AQW A;  1G7O A;  2H1D A;  3AY8 A;  2HSH A;  4WET A;  3CTF A;  1XWA A;  4JR4 A;  3G7I A;  4PNG A;  3APO A;  4HDE A;  4MAB A;  5H5R A;  4MF5 A;  2GLR A;  2B1L A;  3A2V A;  3BCI A;  4LLR A;  3TUE A;  1C72 A;  3F3R A;  1G7E A;  1GSD A;  3D0Z A;  6GSY A;  2YWM A;  1YF0 A;  3WGX A;  5E59 A;  1F9M A;  1DSB A;  1HNA A;  3G7Y A;  3CYN A;  2JU5 A;  4OMV A;  1A2J A;  4O92 A;  3FK8 A;  5HFI A;  1CQG A;  3C1S A;  2DJ2 A;  3ME7 A;  4O32 A;  3FZ4 A;  3UBK A;  1YY7 A;  1BYE A;  1RW1 A;  4EE0 A;  1URM A;  3DWV A;  2ES7 A;  1FB0 A;  3DKS A;  1R4W A;  4K0G A;  4MCU A;  1XWK A;  1EP8 A;  1NHY A;  2H66 A;  3G9B A;  2LST A;  3HVS A;  1Q98 A;  4IQA A;  3H93 A;  2H01 A;  3IHQ A;  3E3E A;  1Z7P A;  3D22 A;  1GUH A;  3C71 A;  4E8E A;  5IOW A;  1NM3 A;  4KUN A;  2GT5 A;  18GS A;  4GSN A;  1XFL A;  1ZGN A;  1X5C A;  4G9H A;  3C73 A;  3H79 A;  3VPQ A;  4EUY A;  2G0F A;  5IMD A;  1TP9 A;  3UOM A;  4ZB9 A;  1HNC A;  2HT9 A;  3M1G A;  3UAR A;  2VLT A;  2V2G A;  4KA0 A;  4XS1 A;  5G5F A;  4MF7 A;  4WR5 A;  4EKZ A;  3MAK A;  5ID2 A;  1M9A A;  1GSF A;  1K0N A;  5JWR B;  1SU9 A;  2KOK A;  4H86 A;  3WGD A;  2L5O A;  2DJJ A;  2VL2 A;  4IP6 A;  2B5Y A;  2YV9 A;  1KEB A;  3BCK A;  4DVC A;  4K7I A;  3TKS E;  1T3B A;  4RQX A;  1ILO A;  1I5G A;  2VCW A;  5EVO A;  1O73 A;  2K8V A;  2LJR A;  3IAM 2;  1E2Y A;  3I9V 2;  2XHF A;  3LFL A;  7GSS A;  3LOR A;  4LMV A;  4EC0 A;  1HD2 A;  2K8S A;  2VCZ A;  2OE1 A;  4IW9 A;  3GHA A;  3L4N A;  2HZF A;  5CRH A;  2FNO A;  4V2L A;  2C0D A;  1FVK A;  2HXK A;  3GKM A;  5DAK A;  1X9M B;  4JBB A;  2AAW A;  4GST A;  1S3D A;  5D96 A;  1OC3 A;  1DE1 A;  2LV3 A;  5JCG A;  3KCM A;  4F0B A;  2OBI A;  4GF0 A;  2VM1 A;  1EEM A;  1BG5 A;  4G2E A;  4POM A;  3TKS C;  4Q5R A;  1G6Y A;  2C1Y A;  2VLU A;  5B8B A;  1GSU A;  1Q4J A;  2F51 A;  3IE3 A;  3FYG A;  2H30 A;  1THO A;  5IOX A;  3L9V A;  5IPG A;  3FW2 A;  1MD3 A;  2OAD A;  4EDZ A;  1XPV A;  1A23 A;  2VL9 A;  4NAX A;  1VRS D;  3HY2 A;  4EVM A;  1GSS A;  4MZB A;  1PN9 A;  2XBI A;  4NHW A;  3M9K A;  2PWJ A;  3GFK A;  3TKR A;  13GS A;  2IIY A;  1FB6 A;  4XRA A;  1XVQ A;  6GSU A;  2IMF A;  3QPM A;  2HZE B;  4RUV A;  4DEJ A;  4TKY A;  2FY6 A;  4ZB6 A;  3LXT A;  3A3T A;  3VI5 A;  2OBK A;  2P0G A;  3VWU A;  1V2A A;  4YQV A;  4HZ2 A;  2MYG A;  3ED3 A;  5F8B A;  1IYI A;  2M80 A;  5DAK B;  2IMD A;  4BWS A;  2H76 A;  2VL2 C;  1V9W A;  4L5L A;  3GTU A;  1R7H A;  5C04 A;  1TKD B;  1OVN A;  3P8W A;  3TJF A;  1G0T A;  3DIE A;  2PMT A;  4MJB A;  2VL3 A;  4XS6 A;  3MDK A;  5E4W A;  3D5J A;  2O89 A;  3GNJ A;  4TXV A;  2YAN A;  2R2J A;  2VM2 A;  4JU5 A;  2I81 A;  1K0C A;  5HFK A;  2V6K A;  2VLV A;  3RHC A;  1PX6 A;  3G7J A;  4WF4 A;  2YWI A;  1SL2 B;  5ECQ B;  1K0B A;  1SYX A;  1K3O A;  1YKC A;  1AQX A;  2CVK A;  3RDW A;  2B7J A;  5ECN B;  3LYP A;  4V1A p;  3WD6 A;  4WKW A;  4E8H A;  1M7T A;  3HJP A;  2H70 A;  2VD0 A;  5D8I A;  1J08 A;  1DUG A;  2ZNM A;  2JL4 A;  4GQC A;  4XTS A;  4N0Z A;  2VAF A;  1USB A;  4RI6 A;  3ZZX A;  1TU8 A;  1PX7 A;  1J9B A;  3L78 A;  5AIX A;  4CDO A;  4ZBA A;  1JLV A;  5CRD A;  1XCC A;  4ZXG A;  2AJQ B;  3ERG A;  1JZO A;  3WYW A;  1QGV A;  4PGT A;  4HQS A;  3ZVJ A;  3NIV A;  3UAP A;  5KN0 A;  4BVY A;  5IQY A;  3NOF A;  1GTU A;  4PX1 A;  2H0G A;  1GNW A;  4TN8 A;  1R26 A;  1O6J A;  4K7N A;  2HNL A;  3L0H A;  3VLN A;  5IO2 A;  4I5Q A;  5IO0 A;  1GTA A;  4ECB A;  4NV5 A;  1TRS A;  2H6Y A;  1XIY A;  4KSO A;  3SBC A;  4NHZ A;  3O6T A;  2HI7 A;  1U6T A;  2R6K A;  3FKF A;  3HXS A;  4HJM A;  4ZIL A;  2DJ1 A;  1PKZ A;  3KH9 A;  4F2I A;  5DAL A;  1O8W A;  1PD2 1;  3MNG A;  1OC9 A;  5JCU A;  5KN2 A;  1MTC A;  4IGJ A;  4ZL8 A;  4TR1 B;  3GKX A;  4OO4 A;  4YH2 A;  4Z7X A;  1B9Y C;  1WP0 A;  3UJ1 A;  4K1F A;  1FHE A;  1R5A A;  2PVO C;  5LNK e;  1U88 A;  2C3T A;  3R2Q A;  3KZQ A;  2WB9 A;  4PQI A;  2CQ9 A;  1N8J A;  5J9C A;  2H6X A;  1XWC A;  5F0G A;  1MDK A;  2KHP A;  3CMI A;  10GS A;  2LRT A;  4V2M A;  1AXD A;  3LYK A;  5A5K A;  3GST A;  2G2Q A;  4NMU A;  1SKS B;  1ZYQ B;  3GN3 A;  3FR3 A;  1THX A;  1WJK A;  3FY7 A;  3HCZ A;  5ID2 B;  3ISO A;  5GZZ B;  3HHV A;  3IBH A;  2H6Z A;  2I4A A;  3EIN A;  4WEY A;  2B7K A;  3D4T A;  4PUR A;  5EL8 A;  2ON7 A;  5G31 A;  1TI3 A;  2DSA A;  2TIR A;  1YJ6 A;  5ABR A;  4HZ4 A;  5DJL A;  5ECP B;  1XW5 A;  3KJY A;  2P5Q A;  1JHB A;  2VO4 A;  1Z7R A;  3C8E A;  3QOU A;  4I6X A;  4EF0 A;  2MMA A;  3MWH A;  4NWY A;  1S3A A;  4HUA A;  1X9W B;  5ECL B;  4MMM A;  1QQ2 A;  3IPZ A;  3KM6 A;  4L0U A;  5EPF A;  1X0R A;  2CX3 A;  1HNB A;  2A2R A;  1GNE A;  3A2X A;  1KBN A;  2C3N A;  2JAC A;  4IHU A;  4J56 E;  2X99 A;  2ZUP A;  6GSS A;  5IM9 A;  3FZ9 A;  2H74 A;  1XOA A;  5INY A;  2EIO A;  1EOG A;  4F0C A;  2Z9S A;  3DYR A;  3KTB A;  2RII A;  2C3Q A;  4K2D A;  3LEF A;  3KIJ A;  2O7K A;  3ME8 A;  2NDO A;  3CRU A;  2CAI A;  1TRV A;  2WS2 A;  2TRX A;  5DVB A;  5G5E A;  1ZOF A;  2GZY A;  2BTO T;  4ULX A;  4BVX A;  4GCI A;  2YWN A;  1T4Z A;  2N5B A;  4FYU A;  4GRF A;  4IS0 A;  1JZW A;  4I2T A;  2J23 A;  1YZX A;  5KN3 A;  5HR2 A;  5LCZ A;  5AIS A;  2XBQ A;  4POB A;  4PNF A;  5IMA A;  5G30 A;  4MJC A;  1SD9 A;  5COH A;  4F9Z A;  4MH2 A;  3RPN A;  2LQQ A;  1XWG A;  4L8E A;  2FGX A;  22GS A;  2CVD A;  2IWT A;  8GSS A;  2QGV A;  2GTU A;  2K6V A;  3VPT A;  1SK2 A;  1B48 A;  3UVH A;  1EOH A;  3F0I A;  3FZ5 A;  6GSX A;  1AIU A;  3VWW A;  1A2M A;  3ZLP A;  4HU7 A;  1XXU A;  4HQZ A;  1SL1 B;  3DML A;  4DSS B;  1E6B A;  6GSV A;  2LKU A;  2V41 A;  4KCE A;  2B5E A;  3ZTL A;  4IJI A;  4TR3 A;  3PH9 A;  1PKW A;  3IV4 A;  2LS5 A;  5ELG A;  9GSS A;  3TJB A;  3O76 A;  2X8G A;  1V40 A;  3ZYW A;  4I97 A;  1I9D A;  4OO5 A;  4IP1 A;  1K0M A;  2KUC A;  4YQM A;  1ML6 A;  1O81 A;  3H8Q A;  2H1G A;  4HU9 A;  1F2E A;  4TRX A;  3KP8 A;  2ON5 A;  2H1B A;  1MDJ A;  1K0A A;  2YN1 A;  1SJI A;  1MEK A;  2VD1 A;  4JE1 A;  4ECI A;  5JWO B;  2R3X A;  1QXH A;  5HR1 A;  3L9S A;  1F3A A;  4HS1 A;  3TB2 A;  5D73 A;  1B9X C;  1ERW A;  4MA9 A;  2J9H A;  3RBT A;  3TRP A;  1XZO A;  5FHI A;  1RQM A;  3HJM A;  4WXT A;  3P7X A;  2GQL A;  1YKA A;  3F6F A;  5L71 A;  4XRD A;  1XW6 A;  5GAP D;  6GSW A;  3UIW A;  3FEU A;  3ERF A;  1OE8 A;  2P31 A;  3EUR A;  3DRN A;  2DJ0 A;  2WGR A;  1UC7 A;  1M2B A;  2VCQ A;  3EU3 A;  5D9X A;  4ML1 A;  1TDI A;  3QFB C;  1NHO A;  4EDY A;  3IR4 A;  4G10 A;  5CP1 A;  1CQH A;  5D9W A;  4HOJ A;  3C1R A;  1OC9 B;  5DDL A;  2GSS A;  1GSQ A;  3DXB A;  3DEX A;  3RPP A;  2WZ9 A;  4ID0 A;  3ZFB A;  3UEM A;  3F4R A;  1H75 A;  2I3Y A;  2LJA A;  4NXI A;  3L9U A;  2PVQ A;  4WF5 A;  2VUP A;  1WIK A;  1YEX A;  1XVW A;  5B6N A;  4LL4 B;  1F3B A;  3EYT A;  1XBS A;  5D9T A;  3VWX A;  2IFQ A;  4YQU A;  2GZP A;  1HQO A;  2LJK A;  1HYU A;  4GXZ A;  2MMZ A;  4EXJ A;  3EVI A;  3I69 A;  4AJ8 A;  3GYK A;  2A2S A;  2M72 A;  4JRR A;  1S3C A;  2FA4 A;  1PSQ A;  3J7Y b;  1SYR A;  5FWG A;  1GRX A;  2NVL A;  2VOC A;  5IPH A;  1TRW A;  5ECK B;  3U5R E;  3WT2 A;  4FYC A;  4IEL A;  3Q18 A;  1SK1 A;  1K3L A;  3M8N A;  4HJ2 A;  5B8A A;  2YPM A;  2L6C A;  1GUL A;  2L4Q A;  2GVP A;  3DD3 A;  2NPB A;  3KP9 A;  4N0V A;  2YJ7 A;  3UBL A;  3ZRD A;  2AB6 A;  3QCP A;  5F05 A;  1M0U A;  4GLT A;  1FW1 A;  2O85 A;  2IYJ A;  1VF3 A;  4BL7 A;  2O87 A;  2X8C A;  2JZR A;  2L57 A;  2IFQ B;  2ALB A;  2H0I A;  4N30 A;  1QK8 A;  2CA8 A;  2DC5 A;  4LA1 A;  2H8L A;  3H1N A;  19GS A;  2F9S A;  5IMV A;  3KXO A;  1GSY A;  4KDU A;  1X5E A;  2A4V A;  3TGZ A;  1VF2 A;  3LQ7 A;  2R5G A;  1FO5 A;  3KMO A;  2KP1 A;  2VCV A;  3HVV A;  2JSY A;  3BBY A;  3QR6 A;  5A4V A;  2IPA A;  2CX4 A;  3HD5 A;  3GL3 A;  1N2A A;  3I43 A;  5G2Z A;  5IMC A;  1M9B A;  4QL7 A;  2YV7 A;  4PUA A;  2JSZ A;  3Q19 A;  4D73 B;  3GIX A;  5D93 A;  1FOV A;  4FH8 A;  4CHS A;  1O8X A;  5B6M A;  3QAG A;  3APS A;  1PQN A;  5J3R A;  2YP6 A;  5J9B A;  1OE7 A;  1RK4 A;  1K3Y A;  14GS A;  3ERW A;  1SL0 B;  4ZIJ A;  2DMM A;  1W89 A;  3VI7 A;  3KD0 A;  3NZN A;  1K0D A;  2H72 A;  4OCF A;  2B3S A;  3V1W A;  1FAA A;  3E0U A;  4TW5 A;  1F6M C;  3P2A A;  1QFN A;  1XWB A;  2FWG A;  3BJ5 A;  4K7O A;  4FIW A;  3UL3 A;  5B7C A;  1Z6N A;  3BOA A;  11GS A;  4HEA 2;  4IKH A;  2PPT A;  5G1L A;  4HI7 A;  1W4V A;  4RI7 A;  2AHE A;  2XC2 A;  2VIM A;  3UVT A;  4BA7 A;  3PR8 A;  4X43 A;  5FT3 A;  2PN8 A;  2OKA A;  5ELA A;  2JZS A;  2PER A;  1GLP A;  1ON4 A;  1ZL9 A;  3S9F A;  2DBC A;  3QD9 A;  4I2U A;  4ZB8 A;  4L0W A;  2WFC A;  5AIV A;  3H4K A;  1G6W A;  5G1K A;  2GSR A;  5ECO B;  1SJZ A;  4AF2 A;  5GAN D;  5D9V A;  2WJU A;  2I9H A;  3EWL A;  1WPI A;  1ACV A;  2ZCT A;  1WWJ A;  4ZBD A;  3TCO A;  4MPG A;  1TI1 A;  5HFG A;  3GL5 A;  1SEN A;  1YEP A;  5ECM B;  2YCD A;  5AN1 A;  5ECH B;  1ERT A;  2DML A;  4POK A;  4OCE A;  4K9Z A;  5LD0 A;  1VF4 A;  3IK9 A;  1WE0 A;  2E0Q A;  1EWX A;  5GSS A;  5ENU A;  4I8B A;  2LNT A;  3M9J A;  4OD7 A;  1M99 A;  5DQS A;  3ZIV A;  1MDI A;  2L5L A;  1ZZY A;  3HA9 A;  4JZQ A;  1AQV A;  5CNW A;  3C7M A;  1PL1 A;  2X8H A;  4KE3 A;  4Q5F A;  1GLQ A;  1FVJ A;  1TXX A;  5CO3 A;  1FG4 A;  1T8E B;  4NPB A;  4TR0 A;  1AC1 A;  2YJH A;  2R4V A;  3TJJ A;  5CRW A;  3F4T A;  1OYJ A;  4N11 A;  3IDV A;  4WR4 A;  3ZL5 A;  1A8L A;  3DVW A;  1SJ6 A;  2LUS A;  1Y6E A;  2N5A A;  5F06 A;  2OE3 A;  5HR3 A;  4JED A;  3HVX A;  1ZYE A;  3TOT A;  4AJ7 A;  1QUW A;  2FLS A;  2YZU A;  4FO5 A;  2B1K A;  5CAX A;  5HQP A;  1JZD A;  4PQ1 A;  3ZMK A;  2GT6 A;  2B5X A;  2QKE A;  3FR6 A;  5J4U A;  4BPY A;  4PUF C;  1Z3E A;  1TOF A;  4L5O A;  1WOU A;  3EMX A;  1BED A;  5EY6 A;  3GKK A;  5H5S A;  4KB3 A;  2K9F A;  3CSJ A;  2F8A A;  3TDG A;  3F63 A;  2E7P A;  2GSQ A;  3MSZ A;  1WMJ A;  1KNG A;  1R5P A;  4ML6 A;  2WRT A;  4OFN A;  2XPD A;  2NBS A;  2IY2 A;  1X5D A;  3QAV A;  4GQF A;  4IJ3 A;  2CAQ A;  3TRQ A;  2FWF A;  2AYT A;  3PGT A;  12GS A;  3DGQ A;  2GDR A;  3GUS A;  5F07 A;  3ZRE A;  2R37 A;  1TTZ A;  4OWY A;  1LBK A; 
#chains in the Genus database with same CATH topology
 4G0L A;  5DQY A;  1TW9 A;  3CC2 3;  1A8Y A;  1GUK A;  1EZK A;  3MYT A;  2HZE A;  3CXG A;  3LG6 A;  1SD8 A;  4GL6 A;  1DBY A;  4BWQ A;  4MJA A;  2Y73 A;  3TOU A;  2JQ5 A;  4KFD A;  2RM5 A;  5IF6 A;  1GMP A;  2OA7 A;  5J41 A;  4N6N B;  2OJL A;  4CJN A;  4CDL A;  2LEG A;  5CK6 A;  1M1X B;  1RMS A;  1UVZ A;  2HLS A;  4YAP A;  4Q5Q A;  3IJE B;  1M2A A;  3D4M A;  3RAZ A;  3CNX A;  1I2F A;  1EA2 A;  4MK3 A;  4ZL7 A;  1GWC A;  3TKQ A;  3TJG A;  3LTB A;  3F6D A;  4QL9 A;  4EIQ A;  2RM6 A;  3CRT A;  2AV4 A;  3WHO A;  1F37 A;  3KKG A;  3Q74 A;  1ST9 A;  3N9J A;  2XGL A;  4N6V 0;  2PGT A;  4QQ7 A;  1QAK A;  1GUM A;  2A15 A;  1V58 A;  2KLX A;  3ZVJ D;  2C4J A;  1B4Q A;  1GSE A;  3P90 A;  2XSO B;  3F7X A;  1GL8 A;  4IVF A;  1A2P A;  4MPF A;  5BVB A;  2H0H A;  2H1A A;  2BMO B;  3QMX A;  1DE2 A;  2FCH A;  2YOI A;  4MZW A;  1TJD A;  1LU4 A;  1VQQ A;  4RBN A;  3F3Q A;  4OVM A;  2V1L A;  2GGT A;  3G4S 3;  2REM A;  4ISD A;  4YKG A;  4ORL A;  3F9U A;  2D1W A;  9RNT A;  1BJX A;  1RGG A;  1GOU A;  3QFA C;  3D6I A;  4XCS A;  2AUV A;  3FRC A;  3GKN A;  4V2N A;  1Q40 A;  4K8M A;  1SKR B;  3KTL A;  4O5U A;  2PBJ A;  4DSQ A;  1CEW I;  1YVS A;  3F7S A;  2IJY A;  1ERU A;  3TRX A;  1SAR A;  20GS A;  1Q86 4;  3VK9 A;  1TK0 B;  1A2L A;  2FWE A;  1RDS A;  2CZ3 A;  3EU4 A;  4MP4 A;  1Z9H A;  5IMF A;  2C11 A;  2CT6 A;  2DKI A;  3GRX A;  3LJR A;  4TOP A;  2CFW A;  2H75 A;  3WGE A;  2HRN A;  1JLW A;  5AGY A;  3HDC A;  4GHO A;  1JZR A;  1GYB A;  1RTU A;  3EC3 A;  1GP1 A;  3D5G A;  4N6T A;  5CXO A;  4XS4 B;  2RSX A;  2YX9 A;  2FWH A;  4ZBB A;  4WBR D;  1KTE A;  2FUG 2;  3F8H A;  5KEJ A;  3CSH A;  3NM2 A;  1RGL A;  3HJO A;  3JVC A;  2GST A;  3F8U A;  2PNC A;  4PXO A;  2FHE A;  3PPU A;  3ZG5 A;  1NSW A;  1IVU A;  3DUK A;  2QSI A;  1GH2 A;  2V1M A;  3OWU A;  5D82 A;  1M2D A;  3E99 A;  4O2H A;  1BRG A;  4NV2 A;  2ZA4 A;  1IV9 A;  1DMQ A;  4L8P A;  4ACS A;  2MMN A;  4HZB B;  5AYR B;  1T1V A;  2BJX A;  2HE3 A;  4KAE A;  4HM1 B;  2NTO A;  1M3J A;  1O7U A;  1LJR A;  1ISK A;  3PXM A;  1V74 A;  4YKF A;  5M18 A;  1AVL A;  4HAA A;  1AAZ A;  3G0K A;  5DJM A;  2GQM A;  1PYL A;  5I97 A;  2L4C A;  4N6O B;  1UN2 A;  3DGY A;  1VGL A;  2X4A A;  1HKX A;  3DH2 A;  5GST A;  4ILF A;  3D21 A;  5A4U A;  3VUR A;  2YNX A;  4XS4 A;  1BQ7 A;  3HKR A;  2WDU A;  5D83 A;  2YZH A;  2CH9 A;  4LEH A;  4GSS A;  3EBY A;  1XOB A;  1XW9 A;  4BVX B;  1OAZ A;  1RHL A;  5CRE A;  4HM6 B;  1K28 A;  4CY8 A;  2F8F A;  1GTB A;  1KD1 4;  5DAL B;  3KMN A;  4MMX B;  2JAD A;  1YJ9 3;  3FHK A;  4O5R A;  2YFI B;  4TR1 A;  4MF6 A;  3K5T A;  3CD6 3;  2F3M A;  1VQP 3;  1TK5 B;  1TFO A;  4F03 A;  3TKS A;  3UL5 A;  3VGN A;  2HMM B;  1YQ1 A;  6GST A;  2F4Y A;  4DSS A;  4POL A;  1OC8 A;  3BND A;  3WA2 X;  3GSS A;  4X1U A;  1EGO A;  2GSP A;  3BNB A;  5ECI B;  1I2G A;  3KEB A;  1EQK A;  4PQH A;  1X9S B;  3CCM 3;  4V1A g;  3W8J A;  2V6O A;  2L6D A;  1ABA A;  4O3V A;  2H19 A;  1YNV X;  3DVX A;  5ECS A;  2DLX A;  5GSP A;  1BNS A;  1A0F A;  3PCS A;  5IG4 A;  4KW6 A;  1Y25 A;  1STD A;  5IG3 A;  1QVG 2;  4G19 A;  1FYS A;  3T8N A;  3FLJ A;  3HZ4 A;  1V98 A;  1D6U A;  1VQO 3;  1FW7 A;  5HR0 A;  1HYF A;  4OFM A;  16GS A;  4XHM A;  4AJ6 A;  4KND A;  2WUL A;  4D73 A;  3IOS A;  3KGK A;  3ZFL A;  1B4P A;  1J2B A;  3KFQ C;  4OUQ A;  5C00 A;  1YJN 3;  2MBT A;  3KSP A;  1BVI A;  2CVB A;  5H5Q A;  3CCE 3;  2XPE A;  2HMN B;  2D2Z A;  3IK7 A;  1ASK A;  4GSP A;  4TR4 A;  1NWW A;  2V32 A;  2GZZ A;  1JRQ A;  4P3Y B;  3CSI A;  3CCQ 3;  1NB5 I;  1U3I A;  1OKD A;  1UA5 A;  3BD2 A;  3EMP A;  4FYB A;  1T00 A;  4WHA A;  1K9M 4;  2C8U A;  4K6X A;  2CG0 A;  4J2F A;  4ECC A;  3M0F A;  1O85 A;  3UMA A;  3RDE A;  1OKT A;  2K18 A;  1AUC A;  3GTU B;  3G8Z A;  2C0E A;  1H4O A;  1YI2 3;  4HM5 B;  2IME A;  3GH6 A;  5EQL A;  1WRY A;  1PMT A;  2IMK A;  3O3T A;  1JFU A;  2R0C A;  5JCW A;  2A2P A;  1SKW B;  1Q9E A;  1BRI A;  1ZMA A;  3TKP A;  4GWR A;  3KII A;  1W7C A;  3IXR A;  2PU9 C;  2W03 A;  3W6G A;  3U6V A;  3A2W A;  2FA8 A;  3ALA A;  3EF8 A;  2OOV A;  5JWQ B;  5DCG A;  5AYS C;  4RNY A;  3ZML A;  3SXX A;  2DIZ A;  1OF5 A;  1U87 A;  4O7H A;  2CW9 A;  4LMW A;  5DCH A;  1J0F A;  3CQF A;  3W8S A;  5ECR B;  1IYH A;  2EIR A;  5AEW B;  3IRA A;  3U1W A;  4H61 A;  1DVC A;  1RGH A;  3E9J B;  2B24 B;  1Z1S A;  4N3V A;  4IN0 A;  3WR2 A;  2JZT A;  3NQZ A;  2KP2 A;  1VQ6 3;  4MLY A;  2BMX A;  4KSM A;  2YWO A;  3HZ8 A;  3LWA A;  5CRG A;  1EV4 A;  1EGR A;  2X49 A;  1A24 A;  3M3M A;  4KZ1 A;  3CPW 2;  2YFJ B;  3SED A;  3CCU 3;  4TVE A;  4TXO B;  1UI7 A;  1VF1 A;  1TIJ A;  2RLI A;  3FZA A;  1B8X A;  2HMO B;  3URP A;  5CYY A;  5IER A;  3STD A;  5J5N A;  4AGS A;  4ZL9 A;  2Z6B A;  4MH3 A;  2RBI A;  5STD A;  4KH7 A;  1BAO A;  4BTY A;  4X0X A;  1GMQ A;  1YF1 A;  4KGI A;  2FXT A;  4FCJ A;  3SWL A;  3HOH A;  1JN5 A;  2W56 A;  4LL1 B;  1MWT A;  1ZCP A;  1JBS A;  5HGR A;  3LTC A;  2HSY A;  3EE2 A;  2E2M A;  2P5R A;  2VCX A;  2KCD A;  4GTU A;  3TJK A;  3DY5 A;  3PIN A;  4K0N A;  3OV4 A;  2GS3 A;  17GS A;  2O8V B;  3GA4 A;  3CU3 A;  3X42 A;  3FR9 A;  4WP5 A;  2EIQ A;  1HU9 A;  3GH9 A;  2IN3 A;  4RQR A;  4EV2 A;  5IIZ A;  4IBP A;  2IL3 A;  2PUK C;  4GB5 A;  2MZC A;  2WCI A;  1LRA A;  2MMO A;  1NW2 A;  1PRX A;  2H73 A;  4KDY A;  1TK8 B;  3QAW A;  5AII A;  1Q7H A;  2IUK A;  2Z77 A;  3GX0 A;  2INX A;  3DZL A;  5IMZ A;  4XBX A;  4MZC A;  1F8N A;  2LTK A;  3SOY A;  2OAC A;  4CW9 A;  1IV7 A;  3JCM L;  2TRC P;  1EEJ A;  3GRD A;  1V57 A;  2Q07 A;  2ZL8 A;  2LNS A;  2CV4 A;  2X64 A;  3KH7 A;  4R9K A;  5EEO A;  1AW9 A;  2OE0 A;  5A4W A;  2L59 A;  6GSP A;  2Z7A A;  5EVH A;  1EV9 A;  1BX9 A;  2FD3 A;  3PZW A;  2LRC A;  3DM8 A;  3KN4 A;  2DJ3 A;  3CTG A;  4HM4 B;  3FF0 A;  1Z5Y E;  3NHX A;  4MDC A;  3WT1 A;  1GMR A;  2HFD A;  2VCT A;  4MMY B;  2BU4 A;  2C0F A;  3US3 A;  2QIY A;  2I1U A;  3ZIJ A;  3ZIT A;  1SK0 A;  4K1U A;  1MOL A;  3GX8 A;  5ELJ A;  3T8U A;  3IC4 A;  5DBQ A;  1TP6 A;  4KX4 A;  3LT8 A;  2DJK A;  2RUF A;  1BAY A;  2E2G A;  1PN0 A;  3K9M C;  2CZ2 A;  3I6A A;  1VQK 3;  4ECJ A;  4TXO A;  4Q5N A;  3CBU A;  1K0O A;  2GBW B;  1WMP A;  4J57 E;  1MGR A;  4IQ1 A;  2P0M A;  2B6M A;  1EP7 A;  1ERV A;  4JRF A;  3F4S A;  1EG9 B;  1PA3 A;  1PL2 A;  4BL7 B;  3APQ A;  8RNT A;  3HYP A;  1BUQ A;  1Q42 A;  2HYX A;  2UZ8 A;  4OFT A;  4WBJ A;  1NDO B;  3NUV A;  1PGT A;  1A0R P;  2OQE C;  1TU7 A;  1MD4 A;  2MBS A;  3IAS 2;  3Q6O A;  4N10 A;  4EO3 A;  4YAV A;  4KCA A;  3S27 A;  3GMF A;  4MJE A;  1W6C A;  2HRK A;  3LH4 A;  4QWT A;  1N9E A;  1UDI I;  3LGC A;  2M46 A;  1UCJ A;  1YHQ 3;  1W5Z A;  2LRN A;  1BRJ A;  4J5G A;  1FUS A;  3OR5 A;  2IMI A;  2LQV A;  1BNI A;  1T4Y A;  2C80 A;  2QA2 A;  3GUR A;  3N5O A;  1RRH A;  1OGZ A;  2LQO A;  2QA1 A;  3J7Y k;  3LXZ A;  2K0M A;  4Z2T A;  1TRU A;  3LSZ A;  3RHB A;  3EN8 A;  5KN1 A;  4DSR A;  1YDK A;  4XIH A;  3GV1 A;  2UX0 A;  1BIR A;  1JB5 A;  3K8N A;  2QC7 A;  1YJW 3;  4KDX A;  1T7P B;  1GY5 A;  2WO0 A;  1Z6M A;  2DIY A;  3QDN A;  4O8S A;  1GTI A;  4EL1 A;  3MYD A;  3FG1 A;  1FUW A;  3VFI A;  4JR6 A;  4BIR A;  2C0G A;  1NNV A;  1XG8 A;  3IA1 A;  3VWV A;  2RUE A;  1W02 A;  1UW1 A;  4LZI A;  4F82 A;  4HM3 B;  2EC4 A;  2IA7 A;  3A5W A;  3X3Z A;  1QMV A;  2HRF A;  2N5F A;  2GQK A;  2H71 A;  1U3A A;  1AQW A;  1G7O A;  2H1D A;  3AY8 A;  2HSH A;  4WET A;  3CTF A;  1XWA A;  2K3D A;  4JR4 A;  2XH9 A;  3G7I A;  4PNG A;  3APO A;  4HDE A;  1D6Y A;  1E3R A;  4MAB A;  1LOV A;  5H5R A;  4BTX A;  4MF5 A;  2GLR A;  2B1L A;  3A2V A;  4XM4 A;  1OPY A;  3BCI A;  4LMI A;  3NBR A;  4LLR A;  3TUE A;  1C72 A;  3F3R A;  2XF3 A;  1G7E A;  1GSD A;  3D0Z A;  6GSY A;  2YWM A;  1YF0 A;  4R80 A;  3WGX A;  5E59 A;  3EX9 A;  1F9M A;  1DSB A;  1HNA A;  3G7Y A;  3OXA A;  3CYN A;  4KVH A;  1S5A A;  2WGQ A;  2JU5 A;  4OMV A;  1A2J A;  1KWI A;  4J5K A;  1K8A 4;  3FK8 A;  4O92 A;  3MHE A;  5HFI A;  3NV0 A;  1CQG A;  2R0G A;  3C1S A;  1FZU A;  2DJ2 A;  3I55 3;  3ME7 A;  4O32 A;  1AQZ A;  3FZ4 A;  3UBK A;  1YY7 A;  1BYE A;  1RW1 A;  1BRN L;  2XR8 B;  4EE0 A;  1URM A;  3DWV A;  2ES7 A;  1FB0 A;  3DKS A;  2WOH A;  1R4W A;  4K0G A;  4MCU A;  1Q40 B;  1XWK A;  1ZYN A;  1EP8 A;  1NHY A;  3FSD A;  1QVF 2;  2H66 A;  3G9B A;  2LST A;  1JV2 B;  2P38 A;  1D6Z A;  1RNB A;  3HVS A;  1Q98 A;  4IQA A;  1IVX A;  3H93 A;  2H01 A;  3IHQ A;  3E3E A;  4EXR A;  1Z7P A;  3D22 A;  3A76 A;  1GUH A;  3C71 A;  4E8E A;  5IOW A;  1NM3 A;  6RNT A;  3CXC 2;  4KUN A;  3N8B A;  1IK3 A;  2GT5 A;  3UNL A;  18GS A;  4GSN A;  3EQQ B;  1XFL A;  1B2X A;  3GZX B;  1ZGN A;  1X5C A;  3O8Y A;  4G9H A;  3C73 A;  3H79 A;  2W6J H;  3N9H A;  4CCV A;  3VPQ A;  1E3V A;  2HMJ B;  3FCS B;  2G0F A;  1TP9 A;  5IMD A;  3UOM A;  4EUY A;  4ZB9 A;  1TFK A;  4K2X A;  1HNC A;  2HT9 A;  3M1G A;  3UAR A;  5DRV A;  2VLT A;  2V2G A;  4KA0 A;  4XS1 A;  5G5F A;  3WOF B;  1VZZ A;  4MF7 A;  3EB8 A;  4WR5 A;  4EKZ A;  3Q1C A;  3MAK A;  5ID2 A;  2AAE A;  3F9S A;  1M9A A;  1Q7Y 4;  1GSF A;  1K0N A;  5JWR B;  4AEQ A;  1SU9 A;  2KOK A;  4H86 A;  3WGD A;  1RNT A;  3RNT A;  2DJJ A;  2L5O A;  2VL2 A;  3AHS A;  4BU4 A;  2BMQ B;  3HX8 A;  4IP6 A;  2B5Y A;  2YV9 A;  1KEB A;  3BCK A;  4DVC A;  4K7I A;  1ZS7 A;  1O7W B;  2FNQ A;  1GD4 A;  4FMD A;  4G0I A;  3TKS E;  1T3B A;  4HM7 B;  4RQX A;  5FGO A;  5IEP A;  1ILO A;  1I5G A;  2VCW A;  2W0Q A;  1BNF A;  5EVO A;  1O73 A;  2K8V A;  2LJR A;  3A5I A;  3IAM 2;  1E2Y A;  3I9V 2;  2XHF A;  3LFL A;  1MNL A;  1YGW A;  3SYU A;  7GSS A;  1UGH I;  3LOR A;  4LMV A;  1VQ5 3;  4EC0 A;  1HD2 A;  1NU3 A;  2K8S A;  2VCZ A;  1IU7 A;  2OE1 A;  4IW9 A;  3GHA A;  3L4N A;  2HZF A;  5CRH A;  3MWZ A;  2FNO A;  4V2L A;  2C0D A;  4WYK A;  6STD A;  3NQY A;  1PFP A;  1FVK A;  2HXK A;  1IQ8 A;  3GKM A;  5DAK A;  1X9M B;  1ULJ B;  4JBB A;  2AAW A;  3EJV A;  4K61 A;  4GST A;  1S3D A;  5D96 A;  3G16 A;  4N6U A;  1OC3 A;  1DE1 A;  2LV3 A;  5JCG A;  4EYC A;  3KCM A;  1YIT 3;  4F0B A;  2R41 A;  2OTJ 3;  2OBI A;  4GF0 A;  5KOW A;  2VM1 A;  1K41 A;  5BXQ A;  1KSI A;  2CKF B;  2E2T A;  1EEM A;  1BG5 A;  1N5H A;  4G2E A;  2XEP A;  1RSN A;  4POM A;  1IDP A;  3TKS C;  4Q5R A;  1ROA A;  1G6Y A;  2C1Y A;  2VLU A;  5B8B A;  3AGO A;  1RGF A;  3MIX A;  1GSU A;  3ECF A;  1Q4J A;  2F51 A;  3ER7 A;  3IE3 A;  3FYG A;  2H30 A;  1U8C B;  2I9W A;  1THO A;  5IOX A;  1WMN A;  3L9V A;  5IPG A;  3FW2 A;  1MD3 A;  3LYG A;  5LC6 A;  2OAD A;  4EDZ A;  1XPV A;  1A23 A;  2VL9 A;  3CPO A;  3F14 A;  2GXF A;  4IIA A;  3OX9 A;  4NAX A;  1VRS D;  3HY2 A;  4EVM A;  1GSS A;  4MZB A;  1PN9 A;  2CFG A;  2XBI A;  4NHW A;  3M9K A;  1GY7 A;  2PWJ A;  2XRX B;  3GFK A;  3TKR A;  13GS A;  3GZR A;  2IIY A;  1LNH A;  2A4H A;  1FB6 A;  4XRA A;  3NXJ A;  3NBB A;  1XVQ A;  1I3F A;  6GSU A;  1OUN A;  2IMF A;  3QPM A;  3CCJ 3;  2HZE B;  4RUV A;  4DEJ A;  4TKY A;  1BRH A;  5AIG A;  2FY6 A;  4ZB6 A;  3PCR A;  3LXT A;  1MWU A;  3A3T A;  3VI5 A;  1BRK A;  2OBK A;  2P0G A;  3VWU A;  1V2A A;  4YQV A;  4HZ2 A;  2J8X B;  2MYG A;  3ED3 A;  5F8B A;  1IYI A;  1N9J A;  2M80 A;  5DAK B;  1G96 A;  2IMD A;  3KE7 A;  4BWS A;  1JB4 A;  2H76 A;  1RN4 A;  2SBL A;  2VL2 C;  1JKG A;  1V9W A;  4L5L A;  3GTU A;  1R7H A;  5C04 A;  2O3O A;  1TKD B;  1OVN A;  3P8W A;  1RLS A;  3TJF A;  1G0T A;  3DIE A;  2PMT A;  4MJB A;  2VL3 A;  4XS6 A;  3VF1 A;  3MDK A;  5E4W A;  3D5J A;  3F8X A;  1JB2 A;  2O89 A;  1S72 3;  3GNJ A;  4TXV A;  2YAN A;  1WNH A;  1R4C A;  3B4O A;  2R2J A;  2VM2 A;  3CNM A;  4JU5 A;  3X41 A;  2I81 A;  1K0C A;  3EE1 A;  4STD A;  1ZO2 A;  2V6K A;  2VLV A;  5HFK A;  3RHC A;  1BNG A;  1A2V A;  1VQ8 3;  4RNZ A;  1N8R 4;  2R0P A;  1PX6 A;  3G7J A;  3KSE D;  1FGO A;  5RNT A;  4WF4 A;  1E97 A;  2UGI A;  2GU3 A;  2KRT A;  5TGN A;  2YWI A;  1SL2 B;  5ECQ B;  1K0B A;  1SYX A;  1K3O A;  1YKC A;  1AQX A;  1M90 4;  1BSD A;  2CVK A;  2CX1 A;  5FW5 A;  3RDW A;  5IG5 A;  2B7J A;  3MKI A;  5ECN B;  3LYP A;  4V1A p;  3WD6 A;  5CF2 A;  4WKW A;  4E8H A;  1M7T A;  3HIG A;  2E2V A;  3U97 A;  2HSM A;  5BMU A;  3HJP A;  2H70 A;  2VD0 A;  4EW5 A;  1RKY A;  5D8I A;  1J08 A;  5G2G A;  1RCK A;  4FMC A;  1DUG A;  2ZNM A;  4BIK A;  4R1K A;  3BNE A;  2JL4 A;  3B7C A;  4GQC A;  1IYY A;  1I3I A;  4FCM A;  4XTS A;  4N0Z A;  2VAF A;  1USB A;  3MSO A;  1VQ4 3;  3JUO A;  4RI6 A;  2BT3 A;  3ZZX A;  3IPT A;  1TU8 A;  1PX7 A;  1J9B A;  3L78 A;  5AIX A;  3GZY B;  2Y74 A;  4ZM8 A;  4CDO A;  4ZBA A;  1UI8 A;  1JLV A;  5CRD A;  1XCC A;  4ZXG A;  2AJQ B;  3ERG A;  1UCI A;  1JZO A;  2QEX 3;  3WYW A;  1QGV A;  4PGT A;  4HQS A;  1LOW A;  3ZVJ A;  1LNI A;  1Q82 4;  3NIV A;  3UAP A;  5KN0 A;  4BVY A;  5IQY A;  3NOF A;  4Z2U A;  1GTU A;  4PX1 A;  2H0G A;  1GNW A;  4TN8 A;  1R26 A;  1Y4K A;  1O6J A;  4K7N A;  1OHS A;  2HNL A;  3L0H A;  3VLN A;  5IO2 A;  4I5Q A;  5IO0 A;  1GTA A;  4ECB A;  3QK9 A;  4NV5 A;  1TRQ A;  3Q2P A;  3ZG0 A;  1TRS A;  2H6Y A;  3LTA A;  1XIY A;  4KSO A;  3SBC A;  1M3I A;  2B1X B;  4NHZ A;  4X2H A;  4O5Q A;  3X3X A;  3O6T A;  5JPU A;  2HI7 A;  4TX4 A;  1TTO A;  1VQ9 3;  1U6T A;  1N5P A;  2R6K A;  3FKF A;  2OWP A;  3HXS A;  5KP3 A;  4HJM A;  2DJ1 A;  4ZIL A;  3LXU X;  3CC7 3;  1I8V A;  1PKZ A;  3KH9 A;  4F2I A;  5DAL A;  1O8W A;  1PD2 1;  3MNG A;  4K1V A;  1OC9 A;  5JCU A;  5KN2 A;  1MTC A;  4IGJ A;  4ZL8 A;  4TR1 B;  7GSP A;  2K54 A;  3GKX A;  4OO4 A;  2KF5 A;  4YH2 A;  4Z7X A;  1B9Y C;  1WP0 A;  3UJ1 A;  4K1F A;  1FHE A;  4K5S A;  1R5A A;  1BOX A;  2PVO C;  1BGS A;  5LNK e;  1U88 A;  2C3T A;  3R2Q A;  3KZQ A;  2WB9 A;  1DMM A;  3PS8 A;  4PQI A;  2CQ9 A;  1N8J A;  1GD3 A;  5J9C A;  2H6X A;  1STF I;  1UCL A;  1XWC A;  3FF2 A;  5F0G A;  1MDK A;  2KHP A;  3CMI A;  4N6M A;  10GS A;  2LRT A;  4V2M A;  1AXD A;  3LYK A;  5A5K A;  3GST A;  2G2Q A;  3I0Y A;  2CFD A;  4NMU A;  1SKS B;  1ZYQ B;  3GN3 A;  3FR3 A;  1US1 A;  1THX A;  1WJK A;  3FY7 A;  1NB3 I;  3A5E A;  2XGN A;  3HCZ A;  5ID2 B;  3J7Y d;  3ISO A;  3HZP A;  1OHP A;  1W2B 2;  5GZZ B;  3D9R A;  3HHV A;  1BSC A;  3M8C A;  3IBH A;  4USS A;  1OH0 A;  2H6Z A;  2I4A A;  4WWU C;  3EIN A;  4WEY A;  2B7K A;  4BVY B;  3D4T A;  1OAC A;  5CF1 A;  4PUR A;  5EL8 A;  2ON7 A;  3AGN A;  4XBY A;  5G31 A;  1TI3 A;  2BMR B;  2DSA A;  2TIR A;  1IVV A;  1TRP A;  1YJ6 A;  1VQL 3;  5ABR A;  3GWR A;  4HZ4 A;  5DJL A;  4X2O A;  1KC8 4;  5ECP B;  4HBR A;  1XW5 A;  3KJY A;  2P5Q A;  1JHB A;  3PGB A;  2VO4 A;  4HM0 B;  1Z7R A;  4KFF A;  3C8E A;  3QOU A;  4I6X A;  4EF0 A;  3V98 A;  1O7G B;  4WFO A;  2MMA A;  3VSY A;  2MF7 A;  3MWH A;  4NWY A;  1S3A A;  4HUA A;  2W04 A;  1X9W B;  5ECL B;  1GOY A;  1T2H A;  2E2U A;  3DGN A;  3H3H A;  4MMM A;  1QQ2 A;  3IPZ A;  2O9U X;  3KM6 A;  4L0U A;  2QA4 3;  3IC8 A;  1U5O A;  5EPF A;  2D42 A;  3K63 A;  1CQS A;  1KQS 2;  1X0R A;  2CX3 A;  1HNB A;  1FA3 A;  1CH0 A;  3UL6 A;  2A2R A;  3CC4 3;  1GNE A;  3A2X A;  2HOH A;  1KBN A;  2C3N A;  3T0U A;  2WGO A;  1W00 A;  2JAC A;  4IHU A;  4MNN A;  4J56 E;  2X99 A;  2ZUP A;  6GSS A;  2JDI H;  5IM9 A;  3FG3 A;  3SX1 A;  4HOH A;  3FZ9 A;  3CCS 3;  2F5W A;  1QAF A;  2H74 A;  1XOA A;  5INY A;  2EIO A;  1EOG A;  1AVK A;  4F0C A;  2Z9S A;  4HYZ A;  3DYR A;  3KTB A;  2RII A;  2C3Q A;  4K2D A;  1VQ7 3;  3LEF A;  1B2M A;  3KIJ A;  2O7K A;  3ME8 A;  2NDO A;  3CRU A;  2CAI A;  2P05 A;  1TRV A;  2WS2 A;  2TRX A;  5DVB A;  2CK3 H;  2KF4 A;  5G5E A;  3BNC A;  3LOY A;  1ZOF A;  2GZY A;  1LQM B;  4MJD A;  4BTW A;  3HVN A;  2BTO T;  4ULX A;  1ZGX A;  1LXE A;  4BVX A;  4GCI A;  2YWN A;  1T4Z A;  1JN5 B;  2W56 B;  2GEX A;  2N5B A;  2GU1 A;  4FYU A;  4GRF A;  4R9L A;  3OWY A;  7STD A;  1JBR A;  4IS0 A;  1VQN 3;  1JZW A;  4I2T A;  2J23 A;  4K90 B;  1YZX A;  5KN3 A;  5HR2 A;  5LCZ A;  5AIS A;  2XBQ A;  4POB A;  4PNF A;  5IMA A;  5G30 A;  4MJC A;  1SD9 A;  5COH A;  2KXG A;  4F9Z A;  1N8Q A;  4MH2 A;  3GAX A;  1B21 A;  3RPN A;  3NBJ A;  2RGQ A;  3MG3 A;  2LQQ A;  1XWG A;  4L8E A;  2FGX A;  3WOE B;  22GS A;  2CVD A;  5A0O B;  1L5G B;  3S5C A;  1C54 A;  2IWT A;  8GSS A;  1B2U A;  2QGV A;  2GTU A;  1TUH A;  2K6V A;  1SK2 A;  3S67 A;  3VPT A;  1B48 A;  5AIF A;  1T2I A;  3UVH A;  1EOH A;  3F0I A;  3FZ5 A;  6GSX A;  1X1U A;  1AIU A;  3LW9 A;  3VWW A;  2BHM A;  1A2M A;  3CCV 3;  4G0K A;  3ZLP A;  1AY7 A;  1XXU A;  2C4B A;  4HU7 A;  3CCL 3;  5BRT A;  1BSA A;  4RZM A;  4HQZ A;  4XB5 A;  1SL1 B;  3DML A;  1O7P B;  4DSS B;  1E6B A;  1W01 A;  6GSV A;  1RGK A;  2LKU A;  2V41 A;  4KCE A;  1DYU A;  3B8L A;  1JJ2 2;  2B5E A;  5M1A A;  3ZTL A;  4IJI A;  3GZB A;  4TR3 A;  3WOD G;  1NO3 A;  3PH9 A;  1PKW A;  4I4K A;  3IV4 A;  2LS5 A;  5ELG A;  9GSS A;  1SIH A;  3TJB A;  3MG2 A;  1DVD A;  3O76 A;  3FKA A;  2GBX B;  2X8G A;  1V40 A;  4KF9 A;  3ZYW A;  4I97 A;  3K0Z A;  1I9D A;  4OO5 A;  3LT9 A;  4IP1 A;  4LSO A;  3FH1 A;  1K0M A;  1RRL A;  4IT7 A;  2KUC A;  4YQM A;  3H51 A;  1ML6 A;  1O81 A;  1BAN A;  3I56 3;  3H8Q A;  2H1G A;  4HU9 A;  1F2E A;  3KP8 A;  4TRX A;  2ON5 A;  3OWS A;  4WYK B;  2H1B A;  3N54 B;  1MDJ A;  2PZV A;  1K0A A;  2YN1 A;  1HZ1 A;  1MEK A;  1SJI A;  2VD1 A;  2ML5 A;  4JE1 A;  4ECI A;  5JWO B;  2R3X A;  1QXH A;  5HR1 A;  3L9S A;  1F3A A;  1QAL A;  4HS1 A;  3TB2 A;  1UUG B;  5D73 A;  1B9X C;  1ERW A;  4KFE A;  3DMC A;  4K5R A;  3ZFZ A;  7RNT A;  4MA9 A;  2J9H A;  3RBT A;  3TRP A;  1XZO A;  3FMW A;  5FHI A;  4LYL B;  3JUP A;  1PFO A;  1RQM A;  2L4V A;  3HJM A;  3MG1 A;  4WXT A;  3P7X A;  2GQL A;  1YKA A;  3F6F A;  5L71 A;  2HRA A;  1R4Y A;  4XRD A;  1XW6 A;  5GAP D;  6GSW A;  4HJL B;  3UIW A;  3FEU A;  3ERF A;  5ELU A;  1YIJ 3;  5KP4 A;  1OE8 A;  2P31 A;  3EUR A;  3Q90 A;  1YVB I;  3S28 A;  3DRN A;  2DJ0 A;  2WGR A;  1UC7 A;  1M2B A;  3FZW A;  2VCQ A;  3EU3 A;  5D9X A;  4ML1 A;  1DE3 A;  1MGW A;  1TDI A;  1RGA A;  3QFB C;  2GEY A;  1NHO A;  4EDY A;  3IR4 A;  4G10 A;  5CP1 A;  1CQH A;  3WA3 A;  4A5P A;  5D9W A;  3C1R A;  4HOJ A;  1OC9 B;  5DDL A;  2GSS A;  1GSQ A;  3DXB A;  3DEX A;  1PY3 A;  3AMO B;  2WZ9 A;  3D3L A;  4AKY A;  3RGR A;  4ID0 A;  3RPP A;  3MPH A;  3ZFB A;  1O7N B;  1W6G A;  3UEM A;  3EN1 B;  3F4R A;  1H75 A;  2I3Y A;  2LJA A;  4NXI A;  3L9U A;  2PVQ A;  1YGE A;  4WF5 A;  2VUP A;  1FGT A;  1WIK A;  1YEX A;  2IUJ A;  1XVW A;  5B6N A;  1O7H B;  4XBT A;  4LL4 B;  1F3B A;  3EYT A;  2STD A;  1XBS A;  5D9T A;  2OQE A;  3VWX A;  1I0V A;  2IFQ A;  1FUT A;  3JUQ A;  1GY6 A;  2YFL B;  4EBG A;  4N6L A;  4YQU A;  2GZP A;  1HQO A;  2LJK A;  1HYU A;  4GXZ A;  2MMZ A;  4EXJ A;  3UB1 A;  3EVI A;  3I69 A;  4FQU A;  4AJ8 A;  1OHO A;  3GYK A;  1LOX A;  2A2S A;  2L1S A;  2M72 A;  4JRR A;  1S3C A;  2FA4 A;  2W9Q A;  1PSQ A;  1B2Z A;  3J7Y b;  1SYR A;  4FCZ A;  5FWG A;  1GRX A;  2AAD A;  2C10 A;  2NVL A;  2VOC A;  5IPH A;  1RN7 A;  1TRW A;  5ECK B;  1O7M B;  3U5R E;  3NM7 A;  4FYC A;  3WT2 A;  4IEL A;  5CLK A;  3Q18 A;  5BIR A;  1SK1 A;  3BIR A;  2RCD A;  1I2E A;  1K3L A;  3M8N A;  4HJ2 A;  2YPM A;  5B8A A;  2L6C A;  1W2Z A;  3V92 A;  1GUL A;  2L4Q A;  3DGO A;  2GVP A;  3DD3 A;  1RJO A;  2CG1 A;  2NPB A;  3KP9 A;  4N0V A;  1MWR A;  2YJ7 A;  3D5I A;  3AMO A;  3UBL A;  4HKV B;  3ZRD A;  2AB6 A;  3B4P A;  3QCP A;  5F05 A;  1M0U A;  1RCL A;  2F5M A;  4GLT A;  1FW1 A;  3NV0 B;  3CMA 3;  2O85 A;  2KF3 A;  2IYJ A;  1VF3 A;  4BL7 A;  2O87 A;  2X8C A;  2JZR A;  1FOH A;  4J8T A;  2L57 A;  2IFQ B;  2ALB A;  3L0R A;  1A90 A;  1I0X A;  2H0I A;  4N30 A;  1WQL B;  1QK8 A;  4H3U A;  2CA8 A;  2DC5 A;  4LA1 A;  2H8L A;  3H1N A;  19GS A;  2P0X A;  2F9S A;  1I70 A;  2RFR A;  3QRD A;  1BUJ A;  5AI1 A;  4NHF A;  1TU5 A;  5IMV A;  1QJG A;  1UUV B;  3KXO A;  1GSY A;  4KDU A;  2OOV C;  1X5E A;  3EPT A;  2A4V A;  3TGZ A;  2M7O A;  1VF2 A;  1BSB A;  3LQ7 A;  2R5G A;  4Q53 A;  1FO5 A;  3KMO A;  3IHG A;  4FMA A;  2KP1 A;  4PEJ A;  1B3S A;  3KZT A;  2VCV A;  3HVV A;  2JSY A;  3BBY A;  3QR6 A;  5A4V A;  1M9G A;  2IPA A;  5JPP A;  1UGI A;  2CX4 A;  3HD5 A;  4HVN A;  4MMZ B;  3GL3 A;  3PYJ A;  1JNQ A;  1N2A A;  3I43 A;  5G2Z A;  5IMC A;  3NX0 A;  3V99 A;  1M9B A;  1ZX2 A;  4QL7 A;  4MEI A;  2YV7 A;  4PUA A;  2JSZ A;  3Q19 A;  4FR9 A;  4D73 B;  3OW2 2;  3GIX A;  2W9P A;  4LGQ A;  2F86 B;  1NJI 4;  1GOV A;  3JUN A;  5D93 A;  1FOV A;  4FH8 A;  4CHS A;  3KCH A;  1ULI B;  1O8X A;  1AV4 A;  5B6M A;  3QAG A;  3APS A;  1PQN A;  5J3R A;  4BL2 A;  1K73 4;  3LZA A;  3DGL A;  1AR0 A;  1W4N A;  2YP6 A;  5J9B A;  3BU4 A;  1OE7 A;  4X4J A;  1RK4 A;  3FGY A;  1K3Y A;  1B20 A;  14GS A;  3ERW A;  1SL0 B;  4ZIJ A;  3BLZ A;  1X1Y A;  1X1W A;  2DMM A;  1W6Y A;  1W89 A;  5AEU B;  2XFS A;  3VI7 A;  2XSH B;  3KD0 A;  3NZN A;  3SLU A;  1K0D A;  2H72 A;  4OCF A;  2B3S A;  1OGX A;  1T5Y A;  3V1W A;  4EV5 A;  1FAA A;  1RN1 A;  3E0U A;  1CYV A;  4TW5 A;  1F6M C;  3P2A A;  2HMK B;  2Z76 A;  3D4A A;  1XWB A;  2ML6 A;  1BNJ A;  2CX0 A;  1QFN A;  2FWG A;  3BJ5 A;  2P09 A;  1BSE A;  4K7O A;  1C7H A;  4FIW A;  3UL3 A;  3G71 3;  5B7C A;  1Z6N A;  3BOA A;  11GS A;  4HEA 2;  2F98 A;  4IKH A;  2PPT A;  5G1L A;  3X3Y A;  1VQM 3;  5KOX A;  4HI7 A;  1W4V A;  4RI7 A;  2AHE A;  2XC2 A;  4Z2R A;  2VIM A;  1B2S A;  5IEN A;  3UVT A;  4BA7 A;  1FGM A;  3PR8 A;  4X43 A;  1BU4 A;  5FT3 A;  5DRE A;  2PN8 A;  2OKA A;  4PTS A;  5ELA A;  2R4I A;  2UUG C;  2JZS A;  4R4K A;  2PER A;  1GLP A;  1ON4 A;  1ZL9 A;  3S9F A;  2CC3 A;  2DBC A;  3GSP A;  3RGA A;  3FG4 A;  3QD9 A;  4I2U A;  2IMJ A;  2RNT A;  4OK0 A;  1SPU A;  4ZB8 A;  4L0W A;  2WFC A;  5AIV A;  3HII A;  2KF6 A;  4O02 B;  2DKH A;  3H4K A;  1G6W A;  5G1K A;  2GSR A;  1DMN A;  5ECO B;  1SJZ A;  4AF2 A;  5GAN D;  3JUM A;  5D9V A;  8CHO A;  2WJU A;  1PU4 A;  3LTD A;  2I9H A;  2WOF A;  3EWL A;  2BIR A;  1WPI A;  1ACV A;  2ZCT A;  1WWJ A;  2F99 A;  4ZBD A;  3TCO A;  1BNR A;  3CME 3;  1TI1 A;  4MPG A;  3WMD A;  2ZHX B;  3DXO A;  3F40 A;  3DGM A;  5HFG A;  3G6E 3;  4EC6 A;  5IEO A;  4KT3 B;  3GL5 A;  1SEN A;  1YEP A;  4HM8 B;  1DET A;  3D79 A;  1MWS A;  2YCD A;  1Q81 4;  5ECM B;  5IG0 A;  3HI7 A;  3R3E A;  5AN1 A;  1IT8 A;  2SAR A;  2ZDJ A;  5ECH B;  1ERT A;  2DML A;  1UCK A;  4POK A;  4OCE A;  4K9Z A;  5LD0 A;  2CFK A;  1VF4 A;  3EHC A;  3IK9 A;  3LML A;  1WE0 A;  1IVW A;  2E0Q A;  1WTH A;  3EC9 A;  1OCV A;  2QGU A;  1EWX A;  1GS3 A;  1LQG C;  1IQY A;  5ENU A;  5GSS A;  3AHW A;  4L7K A;  4I8B A;  2LNT A;  1IQX A;  3M9J A;  4FMB A;  4OD7 A;  3Q3F A;  2BO9 B;  1M1K 4;  1M99 A;  1WMO A;  2OTL 3;  1GSP A;  5DQS A;  3ZIV A;  4HM2 B;  1MDI A;  2L5L A;  1ZZY A;  1G02 A;  4EIP A;  1RGE A;  2W2C A;  1JKG B;  3HA9 A;  4JZQ A;  1AQV A;  5CNW A;  2BNG A;  1X1X A;  3WDG B;  3K7C A;  3C7M A;  1PL1 A;  2X8H A;  4KE3 A;  4Q5F A;  1GLQ A;  4XDW A;  2HML B;  1FVJ A;  1TXX A;  5KP1 A;  4HSC X;  5CO3 A;  2LYX A;  5BU4 A;  2CWV A;  1FG4 A;  1T8E B;  3SVA A;  4NPB A;  4TR0 A;  1AC1 A;  2YJH A;  2FGT A;  2R4V A;  5CRW A;  3TJJ A;  1ROV A;  4CPK A;  3F4T A;  4G1M B;  1OYJ A;  4N11 A;  4IPB A;  5IW9 A;  1BNE A;  3IDV A;  4WR4 A;  4HZ9 B;  4BL3 A;  3ZL5 A;  1A8L A;  3DVW A;  1FGQ A;  1SJ6 A;  5AIH A;  2LUS A;  1Y6E A;  2N5A A;  1QMA A;  5F06 A;  2OE3 A;  5HR3 A;  1EKM A;  4JED A;  3EBT A;  3HVX A;  4L8O A;  1ZYE A;  3TOT A;  4AJ7 A;  4NRE A;  5M19 A;  1QUW A;  2FLS A;  2YZU A;  5HOH A;  4FO5 A;  2B1K A;  2F56 A;  5CAX A;  2CWU A;  3ROB A;  2XFT A;  1B27 A;  5HQP A;  1ZYP A;  4RNT A;  1JZD A;  4PQ1 A;  1BRS A;  3ZMK A;  2GT6 A;  2B5X A;  2QKE A;  3FR6 A;  1A67 A;  1SQW A;  5J4U A;  4ICY A;  3BB9 A;  1EUI C;  4BPY A;  1JBT A;  4AKZ A;  2CWT A;  4PUF C;  3IMA B;  4J9A A;  1Z3E A;  4DKI A;  1UUW B;  1TOF A;  4L5O A;  1WOU A;  3EMX A;  1BED A;  5EY6 A;  3SOA A;  1SJW A;  5D81 A;  3GKK A;  2CHC A;  2KAA A;  1SII A;  1LVN A;  5H5S A;  3X40 A;  4KB3 A;  2K9F A;  1FGR A;  1CYU A;  3CSJ A;  2F8A A;  3TDG A;  1OF5 B;  2MC8 A;  2CIU A;  3F63 A;  5JBS A;  2E7P A;  1RGC A;  1LOY A;  4JF8 A;  4XDV A;  2GSQ A;  3MSZ A;  5LC7 A;  1WMJ A;  1KNG A;  2CFL A;  1R5P A;  4CY6 A;  4ML6 A;  2WRT A;  4OFN A;  2XPD A;  2NBS A;  2IY2 A;  1X5D A;  4U13 A;  3QAV A;  3UJM A;  4GQF A;  4IJ3 A;  3HK4 A;  2CAQ A;  3S29 A;  3TRQ A;  2FWF A;  1A2K A;  2AYT A;  12GS A;  3PGT A;  3DGQ A;  2GDR A;  3GUS A;  5F07 A;  1S3R A;  3ZRE A;  2R37 A;  1TTZ A;  2OCT A;  1IT7 A;  3CCR 3;  4OWY A;  1LBK A; 
#chains in the Genus database with same CATH homology
 4G0L A;  5DQY A;  1TW9 A;  1A8Y A;  1GUK A;  1EZK A;  2HZE A;  3CXG A;  3LG6 A;  1SD8 A;  1DBY A;  4BWQ A;  4MJA A;  3TOU A;  2RM5 A;  2OA7 A;  5J41 A;  2OJL A;  2LEG A;  1UVZ A;  2HLS A;  4YAP A;  4Q5Q A;  3RAZ A;  1M2A A;  3D4M A;  4MK3 A;  4ZL7 A;  1GWC A;  3TKQ A;  3TJG A;  3F6D A;  4QL9 A;  4EIQ A;  2RM6 A;  3CRT A;  2AV4 A;  1F37 A;  3Q74 A;  1ST9 A;  3N9J A;  2PGT A;  4QQ7 A;  1GUM A;  2KLX A;  1V58 A;  3ZVJ D;  2C4J A;  1B4Q A;  1GSE A;  3P90 A;  1GL8 A;  4IVF A;  4MPF A;  2H0H A;  2H1A A;  3QMX A;  1DE2 A;  2FCH A;  2YOI A;  4MZW A;  1TJD A;  1LU4 A;  3F3Q A;  2GGT A;  2REM A;  4ISD A;  4YKG A;  3F9U A;  1BJX A;  3QFA C;  3D6I A;  4XCS A;  2AUV A;  3FRC A;  3GKN A;  4V2N A;  4K8M A;  1SKR B;  3KTL A;  4O5U A;  2PBJ A;  4DSQ A;  2IJY A;  1ERU A;  3TRX A;  20GS A;  3VK9 A;  1TK0 B;  1A2L A;  2FWE A;  2CZ3 A;  3EU4 A;  4MP4 A;  1Z9H A;  5IMF A;  2CT6 A;  2DKI A;  3GRX A;  3LJR A;  4TOP A;  2H75 A;  3WGE A;  2HRN A;  1JLW A;  5AGY A;  3HDC A;  1JZR A;  3EC3 A;  1GP1 A;  4XS4 B;  2FWH A;  4ZBB A;  4WBR D;  1KTE A;  2FUG 2;  5KEJ A;  3CSH A;  3HJO A;  2GST A;  3F8U A;  4PXO A;  2FHE A;  3PPU A;  1NSW A;  2QSI A;  1GH2 A;  2V1M A;  1M2D A;  4NV2 A;  4ACS A;  2MMN A;  1T1V A;  2BJX A;  2HE3 A;  4KAE A;  2NTO A;  1O7U A;  1LJR A;  4YKF A;  1AAZ A;  5DJM A;  2GQM A;  2L4C A;  1UN2 A;  1VGL A;  2X4A A;  5GST A;  4ILF A;  3D21 A;  5A4U A;  3VUR A;  2YNX A;  4XS4 A;  1BQ7 A;  3HKR A;  2WDU A;  2YZH A;  4GSS A;  1XOB A;  1XW9 A;  4BVX B;  1OAZ A;  5CRE A;  4CY8 A;  2F8F A;  1GTB A;  5DAL B;  3KMN A;  3FHK A;  2JAD A;  4O5R A;  4TR1 A;  4MF6 A;  2F3M A;  1TK5 B;  4F03 A;  3TKS A;  1YQ1 A;  6GST A;  4DSS A;  4POL A;  1OC8 A;  3GSS A;  4X1U A;  1EGO A;  5ECI B;  3KEB A;  4PQH A;  1X9S B;  4V1A g;  3W8J A;  2V6O A;  2L6D A;  1ABA A;  2H19 A;  3DVX A;  5ECS A;  2DLX A;  1A0F A;  4KW6 A;  1Y25 A;  4G19 A;  3HZ4 A;  1V98 A;  5HR0 A;  4OFM A;  16GS A;  4XHM A;  4AJ6 A;  4KND A;  2WUL A;  4D73 A;  3IOS A;  3KGK A;  3ZFL A;  1B4P A;  5C00 A;  2MBT A;  2CVB A;  5H5Q A;  2XPE A;  2D2Z A;  3IK7 A;  4TR4 A;  2V32 A;  2GZZ A;  4P3Y B;  3CSI A;  1U3I A;  1OKD A;  1UA5 A;  3BD2 A;  3EMP A;  4FYB A;  1T00 A;  2C8U A;  4K6X A;  4J2F A;  4ECC A;  3M0F A;  1O85 A;  3UMA A;  1OKT A;  2K18 A;  3GTU B;  1AUC A;  2C0E A;  1H4O A;  2IME A;  3GH6 A;  1WRY A;  1PMT A;  2IMK A;  3O3T A;  1JFU A;  2R0C A;  5JCW A;  2A2P A;  1SKW B;  1ZMA A;  3TKP A;  4GWR A;  3IXR A;  2PU9 C;  3W6G A;  3U6V A;  3A2W A;  2FA8 A;  5JWQ B;  5DCG A;  3ZML A;  2DIZ A;  1U87 A;  4O7H A;  4LMW A;  5DCH A;  1J0F A;  3W8S A;  5ECR B;  1IYH A;  2EIR A;  3IRA A;  3E9J B;  4IN0 A;  2JZT A;  2KP2 A;  4MLY A;  2BMX A;  4KSM A;  2YWO A;  3HZ8 A;  3LWA A;  5CRG A;  1EV4 A;  1EGR A;  2X49 A;  1A24 A;  3M3M A;  4TVE A;  4TXO B;  1VF1 A;  2RLI A;  3FZA A;  1B8X A;  5CYY A;  5J5N A;  4AGS A;  4ZL9 A;  4MH3 A;  4KH7 A;  4X0X A;  1YF1 A;  4KGI A;  3SWL A;  4LL1 B;  1ZCP A;  2HSY A;  3EE2 A;  2E2M A;  2P5R A;  2VCX A;  4GTU A;  3TJK A;  3PIN A;  4K0N A;  2GS3 A;  17GS A;  2O8V B;  3GA4 A;  3FR9 A;  2EIQ A;  3GH9 A;  2IN3 A;  4RQR A;  5IIZ A;  4IBP A;  2IL3 A;  2PUK C;  2MZC A;  2WCI A;  2MMO A;  1NW2 A;  1PRX A;  2H73 A;  4KDY A;  1TK8 B;  3QAW A;  3GX0 A;  5IMZ A;  4MZC A;  2LTK A;  2OAC A;  4CW9 A;  3JCM L;  2TRC P;  1EEJ A;  1V57 A;  2X64 A;  2LNS A;  3KH7 A;  2CV4 A;  1AW9 A;  2OE0 A;  5A4W A;  2L59 A;  1EV9 A;  1BX9 A;  2FD3 A;  2LRC A;  2DJ3 A;  3CTG A;  1Z5Y E;  4MDC A;  3WT1 A;  2HFD A;  2VCT A;  2C0F A;  3US3 A;  2I1U A;  3ZIJ A;  3ZIT A;  1SK0 A;  3GX8 A;  3IC4 A;  5DBQ A;  4KX4 A;  2DJK A;  2RUF A;  1BAY A;  2E2G A;  1PN0 A;  2CZ2 A;  3I6A A;  4ECJ A;  4TXO A;  4Q5N A;  3CBU A;  1K0O A;  4J57 E;  4IQ1 A;  2B6M A;  1EP7 A;  1ERV A;  3F4S A;  1PA3 A;  1PL2 A;  4BL7 B;  3APQ A;  3HYP A;  2UZ8 A;  2HYX A;  4OFT A;  4WBJ A;  1PGT A;  1A0R P;  1TU7 A;  1MD4 A;  2MBS A;  3IAS 2;  3Q6O A;  4N10 A;  4EO3 A;  4YAV A;  4KCA A;  3GMF A;  4MJE A;  2HRK A;  3LGC A;  2M46 A;  2LRN A;  3OR5 A;  2IMI A;  1T4Y A;  2C80 A;  2QA2 A;  3GUR A;  3N5O A;  2LQO A;  2QA1 A;  3J7Y k;  3LXZ A;  4Z2T A;  1TRU A;  3LSZ A;  3RHB A;  5KN1 A;  4DSR A;  1YDK A;  4XIH A;  3GV1 A;  3K8N A;  2QC7 A;  1T7P B;  4KDX A;  1Z6M A;  2DIY A;  3QDN A;  1GTI A;  4EL1 A;  3MYD A;  3VFI A;  4JR6 A;  2C0G A;  3IA1 A;  3VWV A;  2RUE A;  4F82 A;  2EC4 A;  3A5W A;  1QMV A;  2HRF A;  2N5F A;  2GQK A;  2H71 A;  1U3A A;  1AQW A;  1G7O A;  2H1D A;  3AY8 A;  2HSH A;  4WET A;  3CTF A;  1XWA A;  4JR4 A;  3G7I A;  4PNG A;  3APO A;  4HDE A;  4MAB A;  5H5R A;  4MF5 A;  2GLR A;  2B1L A;  3A2V A;  3BCI A;  4LLR A;  3TUE A;  1C72 A;  3F3R A;  1G7E A;  1GSD A;  3D0Z A;  6GSY A;  2YWM A;  1YF0 A;  3WGX A;  5E59 A;  1F9M A;  1DSB A;  1HNA A;  3G7Y A;  3CYN A;  2JU5 A;  4OMV A;  1A2J A;  4O92 A;  3FK8 A;  5HFI A;  1CQG A;  2R0G A;  3C1S A;  2DJ2 A;  3ME7 A;  4O32 A;  3FZ4 A;  3UBK A;  1YY7 A;  1BYE A;  1RW1 A;  4EE0 A;  1URM A;  3DWV A;  2ES7 A;  1FB0 A;  3DKS A;  1R4W A;  4K0G A;  4MCU A;  1XWK A;  1ZYN A;  1EP8 A;  1NHY A;  2H66 A;  3G9B A;  2LST A;  3HVS A;  1Q98 A;  4IQA A;  3H93 A;  2H01 A;  3IHQ A;  3E3E A;  1Z7P A;  3D22 A;  1GUH A;  3C71 A;  4E8E A;  5IOW A;  1NM3 A;  4KUN A;  2GT5 A;  18GS A;  4GSN A;  1XFL A;  1ZGN A;  1X5C A;  4G9H A;  3C73 A;  3H79 A;  3VPQ A;  4EUY A;  2G0F A;  5IMD A;  1TP9 A;  3UOM A;  4ZB9 A;  4K2X A;  1HNC A;  2HT9 A;  3M1G A;  3UAR A;  2VLT A;  2V2G A;  4KA0 A;  4XS1 A;  5G5F A;  4MF7 A;  4WR5 A;  4EKZ A;  3MAK A;  5ID2 A;  1M9A A;  1GSF A;  1K0N A;  5JWR B;  1SU9 A;  2KOK A;  4H86 A;  3WGD A;  2L5O A;  2DJJ A;  2VL2 A;  4IP6 A;  2B5Y A;  2YV9 A;  1KEB A;  3BCK A;  4DVC A;  4K7I A;  4G0I A;  3TKS E;  1T3B A;  4RQX A;  1ILO A;  1I5G A;  2VCW A;  5EVO A;  1O73 A;  2K8V A;  2LJR A;  3A5I A;  3IAM 2;  1E2Y A;  3I9V 2;  2XHF A;  3LFL A;  7GSS A;  3LOR A;  4LMV A;  4EC0 A;  1HD2 A;  2K8S A;  2VCZ A;  2OE1 A;  4IW9 A;  3GHA A;  3L4N A;  2HZF A;  5CRH A;  2FNO A;  4V2L A;  2C0D A;  1FVK A;  2HXK A;  3GKM A;  5DAK A;  1X9M B;  4JBB A;  2AAW A;  4GST A;  1S3D A;  5D96 A;  1OC3 A;  1DE1 A;  2LV3 A;  5JCG A;  3KCM A;  4F0B A;  2OBI A;  5KOW A;  4GF0 A;  2VM1 A;  1EEM A;  1BG5 A;  4G2E A;  4POM A;  3TKS C;  4Q5R A;  1G6Y A;  2C1Y A;  2VLU A;  5B8B A;  3MIX A;  1GSU A;  1Q4J A;  2F51 A;  3IE3 A;  3FYG A;  2H30 A;  1THO A;  5IOX A;  3L9V A;  5IPG A;  3FW2 A;  1MD3 A;  2OAD A;  4EDZ A;  1XPV A;  1A23 A;  2VL9 A;  4NAX A;  1VRS D;  3HY2 A;  4EVM A;  1GSS A;  4MZB A;  1PN9 A;  2XBI A;  4NHW A;  3M9K A;  2PWJ A;  3GFK A;  3TKR A;  13GS A;  2IIY A;  2A4H A;  1FB6 A;  4XRA A;  1XVQ A;  6GSU A;  2IMF A;  3QPM A;  2HZE B;  4RUV A;  4DEJ A;  4TKY A;  2FY6 A;  4ZB6 A;  3LXT A;  3A3T A;  3VI5 A;  2OBK A;  2P0G A;  3VWU A;  1V2A A;  4YQV A;  4HZ2 A;  2MYG A;  3ED3 A;  5F8B A;  1IYI A;  2M80 A;  5DAK B;  2IMD A;  4BWS A;  2H76 A;  2VL2 C;  1V9W A;  4L5L A;  3GTU A;  1R7H A;  5C04 A;  1TKD B;  1OVN A;  3P8W A;  3TJF A;  1G0T A;  3DIE A;  2PMT A;  4MJB A;  2VL3 A;  4XS6 A;  3MDK A;  5E4W A;  3D5J A;  2O89 A;  3GNJ A;  4TXV A;  2YAN A;  2R2J A;  2VM2 A;  4JU5 A;  2I81 A;  1K0C A;  5HFK A;  2V6K A;  2VLV A;  3RHC A;  2R0P A;  1PX6 A;  3G7J A;  4WF4 A;  2YWI A;  1SL2 B;  5ECQ B;  1K0B A;  1SYX A;  1K3O A;  1YKC A;  1AQX A;  2CVK A;  3RDW A;  2B7J A;  5ECN B;  3LYP A;  4V1A p;  3WD6 A;  4WKW A;  4E8H A;  1M7T A;  2HSM A;  5BMU A;  3HJP A;  2H70 A;  2VD0 A;  5D8I A;  1J08 A;  1DUG A;  2ZNM A;  2JL4 A;  4GQC A;  4XTS A;  4N0Z A;  2VAF A;  1USB A;  4RI6 A;  3ZZX A;  1TU8 A;  1PX7 A;  1J9B A;  3L78 A;  5AIX A;  4CDO A;  4ZBA A;  1JLV A;  5CRD A;  1XCC A;  4ZXG A;  2AJQ B;  3ERG A;  1JZO A;  3WYW A;  1QGV A;  4PGT A;  4HQS A;  3ZVJ A;  3NIV A;  3UAP A;  5KN0 A;  4BVY A;  5IQY A;  3NOF A;  4Z2U A;  1GTU A;  4PX1 A;  2H0G A;  1GNW A;  4TN8 A;  1R26 A;  1O6J A;  4K7N A;  2HNL A;  3L0H A;  3VLN A;  5IO2 A;  4I5Q A;  5IO0 A;  1GTA A;  4ECB A;  4NV5 A;  1TRS A;  2H6Y A;  1XIY A;  4KSO A;  3SBC A;  4NHZ A;  4O5Q A;  3O6T A;  2HI7 A;  1U6T A;  2R6K A;  3FKF A;  3HXS A;  4HJM A;  4ZIL A;  2DJ1 A;  1PKZ A;  3KH9 A;  4F2I A;  5DAL A;  1O8W A;  1PD2 1;  3MNG A;  1OC9 A;  5JCU A;  5KN2 A;  1MTC A;  4IGJ A;  4ZL8 A;  4TR1 B;  3GKX A;  4OO4 A;  4YH2 A;  4Z7X A;  1B9Y C;  1WP0 A;  3UJ1 A;  4K1F A;  1FHE A;  4K5S A;  1R5A A;  2PVO C;  5LNK e;  1U88 A;  2C3T A;  3R2Q A;  3KZQ A;  2WB9 A;  4PQI A;  2CQ9 A;  1N8J A;  5J9C A;  2H6X A;  1XWC A;  5F0G A;  1MDK A;  2KHP A;  3CMI A;  10GS A;  2LRT A;  4V2M A;  1AXD A;  3LYK A;  5A5K A;  3GST A;  2G2Q A;  4NMU A;  1SKS B;  1ZYQ B;  3GN3 A;  3FR3 A;  1THX A;  1WJK A;  3FY7 A;  3HCZ A;  5ID2 B;  3ISO A;  5GZZ B;  3HHV A;  4USS A;  3IBH A;  2H6Z A;  2I4A A;  3EIN A;  4WEY A;  2B7K A;  4BVY B;  3D4T A;  4PUR A;  5EL8 A;  2ON7 A;  5G31 A;  1TI3 A;  2DSA A;  2TIR A;  1YJ6 A;  5ABR A;  4HZ4 A;  5DJL A;  5ECP B;  1XW5 A;  3KJY A;  2P5Q A;  1JHB A;  2VO4 A;  1Z7R A;  3C8E A;  3QOU A;  4I6X A;  4EF0 A;  2MMA A;  3MWH A;  4NWY A;  1S3A A;  4HUA A;  1X9W B;  5ECL B;  4MMM A;  1QQ2 A;  3IPZ A;  3KM6 A;  4L0U A;  3IC8 A;  5EPF A;  1X0R A;  2CX3 A;  1HNB A;  2A2R A;  1GNE A;  3A2X A;  1KBN A;  2C3N A;  2JAC A;  4IHU A;  4MNN A;  4J56 E;  2X99 A;  2ZUP A;  6GSS A;  5IM9 A;  3FZ9 A;  2H74 A;  1XOA A;  5INY A;  2EIO A;  1EOG A;  4F0C A;  2Z9S A;  3DYR A;  3KTB A;  2RII A;  2C3Q A;  4K2D A;  3LEF A;  3KIJ A;  2O7K A;  3ME8 A;  2NDO A;  3CRU A;  2CAI A;  1TRV A;  2WS2 A;  2TRX A;  5DVB A;  5G5E A;  1ZOF A;  2GZY A;  2BTO T;  4ULX A;  4BVX A;  4GCI A;  2YWN A;  1T4Z A;  2N5B A;  4FYU A;  4GRF A;  4IS0 A;  1JZW A;  4I2T A;  2J23 A;  1YZX A;  5KN3 A;  5HR2 A;  5LCZ A;  5AIS A;  2XBQ A;  4POB A;  4PNF A;  5IMA A;  5G30 A;  4MJC A;  1SD9 A;  5COH A;  4F9Z A;  4MH2 A;  3RPN A;  2LQQ A;  1XWG A;  4L8E A;  2FGX A;  22GS A;  2CVD A;  2IWT A;  8GSS A;  2QGV A;  2GTU A;  2K6V A;  3VPT A;  1SK2 A;  1B48 A;  3UVH A;  1EOH A;  3F0I A;  3FZ5 A;  6GSX A;  3LW9 A;  1AIU A;  3VWW A;  1A2M A;  4G0K A;  3ZLP A;  4HU7 A;  1XXU A;  5BRT A;  4HQZ A;  1SL1 B;  3DML A;  4DSS B;  1E6B A;  6GSV A;  2LKU A;  2V41 A;  4KCE A;  2B5E A;  3ZTL A;  4IJI A;  4TR3 A;  3PH9 A;  1PKW A;  3IV4 A;  2LS5 A;  5ELG A;  9GSS A;  3TJB A;  3O76 A;  2X8G A;  1V40 A;  4KF9 A;  3ZYW A;  4I97 A;  1I9D A;  4OO5 A;  4IP1 A;  1K0M A;  2KUC A;  4YQM A;  1ML6 A;  1O81 A;  3H8Q A;  2H1G A;  4HU9 A;  1F2E A;  4TRX A;  3KP8 A;  2ON5 A;  2H1B A;  1MDJ A;  1K0A A;  2YN1 A;  1SJI A;  1MEK A;  2VD1 A;  4JE1 A;  4ECI A;  5JWO B;  2R3X A;  1QXH A;  5HR1 A;  3L9S A;  1F3A A;  4HS1 A;  3TB2 A;  5D73 A;  1B9X C;  1ERW A;  4K5R A;  4MA9 A;  2J9H A;  3RBT A;  3TRP A;  1XZO A;  3FMW A;  5FHI A;  1RQM A;  3HJM A;  4WXT A;  3P7X A;  2GQL A;  1YKA A;  3F6F A;  5L71 A;  2HRA A;  4XRD A;  1XW6 A;  5GAP D;  6GSW A;  3UIW A;  3FEU A;  3ERF A;  1OE8 A;  2P31 A;  3EUR A;  3DRN A;  2DJ0 A;  2WGR A;  1UC7 A;  1M2B A;  2VCQ A;  3EU3 A;  5D9X A;  4ML1 A;  1TDI A;  3QFB C;  1NHO A;  4EDY A;  3IR4 A;  4G10 A;  5CP1 A;  1CQH A;  4A5P A;  5D9W A;  4HOJ A;  3C1R A;  1OC9 B;  5DDL A;  2GSS A;  1GSQ A;  3DXB A;  3DEX A;  3RPP A;  2WZ9 A;  4ID0 A;  3ZFB A;  3UEM A;  3F4R A;  1H75 A;  2I3Y A;  2LJA A;  4NXI A;  3L9U A;  2PVQ A;  4WF5 A;  2VUP A;  1WIK A;  1YEX A;  1XVW A;  5B6N A;  4LL4 B;  1F3B A;  3EYT A;  1XBS A;  5D9T A;  3VWX A;  2IFQ A;  4YQU A;  2GZP A;  1HQO A;  2LJK A;  1HYU A;  4GXZ A;  2MMZ A;  4EXJ A;  3EVI A;  3I69 A;  4FQU A;  4AJ8 A;  3GYK A;  2A2S A;  2M72 A;  4JRR A;  1S3C A;  2FA4 A;  1PSQ A;  3J7Y b;  1SYR A;  5FWG A;  1GRX A;  2NVL A;  2VOC A;  5IPH A;  1TRW A;  5ECK B;  3U5R E;  3WT2 A;  4FYC A;  4IEL A;  3Q18 A;  1SK1 A;  1K3L A;  3M8N A;  4HJ2 A;  5B8A A;  2YPM A;  2L6C A;  1GUL A;  2L4Q A;  2GVP A;  3DD3 A;  2NPB A;  3KP9 A;  4N0V A;  2YJ7 A;  3UBL A;  3ZRD A;  2AB6 A;  3QCP A;  5F05 A;  1M0U A;  4GLT A;  1FW1 A;  2O85 A;  2IYJ A;  1VF3 A;  4BL7 A;  2O87 A;  2X8C A;  2JZR A;  1FOH A;  2L57 A;  2IFQ B;  2ALB A;  2H0I A;  4N30 A;  1QK8 A;  2CA8 A;  2DC5 A;  4LA1 A;  2H8L A;  3H1N A;  19GS A;  2F9S A;  5IMV A;  3KXO A;  1GSY A;  4KDU A;  1X5E A;  3EPT A;  2A4V A;  3TGZ A;  1VF2 A;  3LQ7 A;  2R5G A;  1FO5 A;  3KMO A;  3IHG A;  2KP1 A;  2VCV A;  3HVV A;  2JSY A;  3BBY A;  3QR6 A;  5A4V A;  2IPA A;  2CX4 A;  3HD5 A;  3GL3 A;  1N2A A;  3I43 A;  5G2Z A;  5IMC A;  1M9B A;  4QL7 A;  2YV7 A;  4PUA A;  2JSZ A;  3Q19 A;  4D73 B;  3GIX A;  5D93 A;  1FOV A;  4FH8 A;  4CHS A;  1O8X A;  5B6M A;  3QAG A;  3APS A;  1PQN A;  5J3R A;  2YP6 A;  5J9B A;  1OE7 A;  4X4J A;  1RK4 A;  1K3Y A;  14GS A;  3ERW A;  1SL0 B;  4ZIJ A;  2DMM A;  1W89 A;  3VI7 A;  3KD0 A;  3NZN A;  1K0D A;  2H72 A;  4OCF A;  2B3S A;  3V1W A;  1FAA A;  3E0U A;  4TW5 A;  1F6M C;  3P2A A;  1QFN A;  1XWB A;  2FWG A;  3BJ5 A;  4K7O A;  4FIW A;  3UL3 A;  5B7C A;  1Z6N A;  3BOA A;  11GS A;  4HEA 2;  4IKH A;  2PPT A;  5G1L A;  5KOX A;  4HI7 A;  1W4V A;  4RI7 A;  2AHE A;  2XC2 A;  4Z2R A;  2VIM A;  3UVT A;  4BA7 A;  3PR8 A;  4X43 A;  5FT3 A;  2PN8 A;  2OKA A;  4PTS A;  5ELA A;  2JZS A;  2PER A;  1GLP A;  1ON4 A;  1ZL9 A;  3S9F A;  2DBC A;  3QD9 A;  4I2U A;  4ZB8 A;  4L0W A;  2WFC A;  5AIV A;  2DKH A;  3H4K A;  1G6W A;  5G1K A;  2GSR A;  5ECO B;  1SJZ A;  4AF2 A;  5GAN D;  5D9V A;  2WJU A;  2I9H A;  3EWL A;  1WPI A;  1ACV A;  2ZCT A;  1WWJ A;  4ZBD A;  3TCO A;  4MPG A;  1TI1 A;  5HFG A;  3GL5 A;  1SEN A;  1YEP A;  5ECM B;  2YCD A;  3R3E A;  5AN1 A;  5ECH B;  1ERT A;  2DML A;  4POK A;  4OCE A;  4K9Z A;  5LD0 A;  1VF4 A;  3IK9 A;  1WE0 A;  2E0Q A;  1EWX A;  5GSS A;  5ENU A;  4I8B A;  2LNT A;  3M9J A;  4OD7 A;  1M99 A;  5DQS A;  3ZIV A;  1MDI A;  2L5L A;  1ZZY A;  4EIP A;  3HA9 A;  4JZQ A;  1AQV A;  5CNW A;  3C7M A;  1PL1 A;  2X8H A;  4KE3 A;  4Q5F A;  1GLQ A;  1FVJ A;  1TXX A;  5CO3 A;  1FG4 A;  1T8E B;  4NPB A;  4TR0 A;  1AC1 A;  2YJH A;  2R4V A;  3TJJ A;  5CRW A;  3F4T A;  1OYJ A;  4N11 A;  3IDV A;  4WR4 A;  3ZL5 A;  1A8L A;  3DVW A;  1SJ6 A;  2LUS A;  1Y6E A;  2N5A A;  5F06 A;  2OE3 A;  5HR3 A;  4JED A;  3HVX A;  1ZYE A;  3TOT A;  4AJ7 A;  1QUW A;  2FLS A;  2YZU A;  4FO5 A;  2B1K A;  5CAX A;  5HQP A;  1ZYP A;  1JZD A;  4PQ1 A;  3ZMK A;  2GT6 A;  2B5X A;  2QKE A;  3FR6 A;  5J4U A;  4ICY A;  4BPY A;  4PUF C;  1Z3E A;  1TOF A;  4L5O A;  1WOU A;  3EMX A;  1BED A;  5EY6 A;  3GKK A;  5H5S A;  4KB3 A;  2K9F A;  3CSJ A;  2F8A A;  3TDG A;  3F63 A;  2E7P A;  2GSQ A;  3MSZ A;  1WMJ A;  1KNG A;  1R5P A;  4CY6 A;  4ML6 A;  2WRT A;  4OFN A;  2XPD A;  2NBS A;  2IY2 A;  1X5D A;  3QAV A;  4GQF A;  4IJ3 A;  2CAQ A;  3TRQ A;  2FWF A;  2AYT A;  3PGT A;  12GS A;  3DGQ A;  2GDR A;  3GUS A;  5F07 A;  3ZRE A;  2R37 A;  1TTZ A;  4OWY A;  1LBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...