1V58A

Crystal structure of the reduced protein disulfide bond isomerase dsbg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v58A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v58A02
1A2JA 3QAGA 4POMA 2H76A 3DRNA 3CTFA 4TXVA 2LSTA 3GA4A 2YWIA 1W89A 10GSA 1XZOA 5J9CA 1TI3A 2VLVA 2HLSA 1WJKA 1NHOA 1MD3A 5DQSA 2RUEA 3GFKA 2IMDA 2V6OA 4TW5A 3H4KA 1T4YA 4K9ZA 2TRCP 4WBJA 2O85A 5CYYA 2YNXA 4ZB9A 1FW1A 1GSUA 1S3DA 2CZ2A 1XVQA 1X5EA 1JZOA 2RUFA 4X0XA 4IVFA 5G1LA 1F9MA 2BTOT 1ZCPA 1CQHA 1B9YC 5IIZA 1EOHA 3EMPA 4O92A 5JWRB 1DE2A 3FW2A 1GTAA 3MAKA 5DJMA 3GSSA 1S3CA 3DGQA 1ZL9A 2LV3A 4XS4B 3E9JB 5G2ZA 2QSIA 5CRWA 1EV9A 2B7KA 1JFUA 2R37A 3QFBC 3U5RE 2P5RA 1AW9A 4J56E 5JWOB 3UVHA 1YF1A 4DSQA 5G5FA 4CW9A 4MF6A 2VL9A 4LL1B 2M46A 1Y6EA 3KJYA 1TXXA 2AHEA 2I9HA 5AN1A 2VLTA 2I81A 3A2XA 2J9HA 4NWYA 1RQMA 4H86A 3F3QA 5C04A 3UEMA 1DE1A 2M80A 2QGVA 1GULA 3TDGA 1T4ZA 2LS5A 3US3A 2YWOA 4O7HA 2H6XA 1SD9A 3CSHA 4ML6A 3WYWA 4LMWA 1EP7A 3L78A 2GSTA 3ERFA 3NOFA 5CP1A 3MNGA 3LGCA 4NHZA 4JZQA 3FZAA 2DJ0A 3TKRA 4EO3A 1TI1A 2GTUA 2C4JA 3CRUA 3KMOA 2VCWA 3CSJA 3VLNA 4HJMA 2V32A 4BWQA 4ZB8A 1PD21 3LFLA 1K0CA 1E6BA 1OYJA 3BOAA 3KH7A 2YV7A 2K8VA 2RIIA 2B3SA 4MPFA 4GTUA 4EDZA 2GSSA 4PUFC 19GSA 3IRAA 4YAPA 1V40A 2GT5A 1TKDB 2WJUA 1Z7PA 4XS6A 1TRSA 4I8BA 4NAXA 4XIHA 3VWUA 5J4UA 4YQUA 4WR5A 1U3IA 2IPAA 3RPPA 3M9JA 3FRCA 1R7HA 1BQ7A 4MJBA 3CYNA 5AIVA 3IE3A 1XW6A 3TJGA 5D8IA 4JU5A 2MYGA 4MZCA 4GSTA 2NDOA 4OO5A 4EKZA 4K0GA 2HYXA 2ON7A 1SD8A 2L57A 5DALB 4MJAA 3D4TA 1FOVA 5F06A 3EWLA 2JU5A 2IYJA 1EZKA 1OKDA 3C1RA 3ZIJA 3WT1A 4NHWA 4POLA 3A5WA 3IC4A 3ZMLA 1Q98A 1ZYQB 1ILOA 4V1Ap 2H6ZA 2OE3A 3R2QA 2GQLA 1EOGA 2FA8A 3IV4A 3VPTA 4RI7A 2YANA 3KD0A 4IN0A 2EIRA 3IPZA 2I3YA 3I43A 4K8MA 1ABAA 2XBQA 4EDYA 4GCIA 4MK3A 2NTOA 1V9WA 2VLUA 2FD3A 3FK8A 1I9DA 2LRNA 4IP1A 1V2AA 2H1BA 2GSRA 4HQSA 4WR4A 4E8EA 5FWGA 5F8BA 1T3BA 2YCDA 3BBYA 5F05A 4MPGA 2MZCA 1RK4A 5D9TA 3L9VA 1ML6A 4KA0A 5H5RA 4PUAA 1J0FA 2FHEA 2B5XA 2X8GA 3BCIA 4HS1A 4KCAA 5B6NA 4XS4A 5LCZA 3KH9A 1TW9A 4PNGA 2C3TA 3U6VA 2TRXA 1YJ6A 3HVXA 6GSYA 1GSQA 3J7Yk 3VI5A 4V2LA 2VL3A 2YWMA 2HNLA 5IMCA 3KP8A 3IA1A 3KCMA 3DYRA 5D73A 3GHAA 1PQNA 1DSBA 3A3TA 2DIYA 1TU8A 3TJBA 3TRXA 1PRXA 4IP6A 2HSYA 2H6YA 4KX4A 2IMKA 2B5EA 2KLXA 4PXOA 4I2UA 2VUPA 2F8AA 5ABRA 4KAEA 2GQMA 2LJRA 3QDNA 1ERUA 3D0ZA 3O3TA 3TRQA 1OC9B 3IK7A 2N5BA 1GSSA 2PBJA 3M8NA 3O6TA 1AC1A 5G1KA 4DSRA 5CRHA 2IL3A 5IPGA 5ID2A 3UMAA 5HFGA 2FUG2 4IQ1A 2LEGA 4K6XA 2WCIA 4PNFA 2K9FA 1PKZA 1PA3A 3AY8A 1MD4A 2D2ZA 5HQPA 3HZ4A 4EE0A 3UL3A 1A2LA 13GSA 4JBBA 3CRTA 1SU9A 1W4VA 3HZ8A 3FZ5A 2PVOC 3TOUA 1F2EA 2LUSA 2REMA 1AXDA 3DIEA 3GKXA 4BWSA 1FHEA 2A2SA 4FH8A 2HRFA 2EC4A 2DLXA 1GUMA 3P90A 1G7OA 1QK8A 5KN0A 1K0OA 1U6TA 2N5FA 3D6IA 4MMMA 4TR1B 4AJ6A 2PN8A 4V2MA 6GSUA 2VCXA 1QMVA 4EXJA 3TB2A 2WZ9A 4J57E 1ZZYA 1XXUA 1RW1A 2KHPA 4CHSA 4MLYA 3V1WA 1JLVA 3F3RA 2Z9SA 5A5KA 1GTBA 1K0NA 4ZXGA 5F07A 1F3AA 5DALA 3LYPA 3GH6A 1GTIA 9GSSA 3GRXA 4N10A 2RM6A 5DCHA 3W8SA 2F8FA 5AIXA 4I6XA 3RAZA 3TKQA 1B48A 4IJIA 3N9JA 7GSSA 1QFNA 4KDYA 3HJOA 1AIUA 4LMVA 3GTUB 4NV2A 4FYBA 1TJDA 1G7EA 1UN2A 1JZWA 3KM6A 4XRDA 2TIRA 4XCSA 1XWAA 4E8HA 3F4RA 2CA8A 18GSA 1X0RA 3L4NA 4NPBA 2GT6A 1K3LA 2LKUA 2FWGA 5GAND 6GSXA 1YDKA 2CV4A 4GRFA 4KCEA 4WETA 4RUVA 1GSDA 3HJMA 4MABA 2PGTA 4ZL9A 1GWCA 2P31A 1KTEA 4OFTA 3IOSA 3F8UA 2R2JA 3K8NA 1J08A 3TOTA 2WRTA 2B1LA 1YKCA 3H1NA 5J9BA 3VWVA 2H1GA 3EYTA 2YZUA 1UVZA 1HQOA 3WT2A 3GV1A 3VURA 1FB6A 1XOAA 3GKMA 1AQWA 2LJKA 2AB6A 1XWBA 5DQYA 2IMEA 5KN3A 1Q4JA 2HZEA 4TR0A 5A4UA 1KNGA 2A4VA 1XCCA 2C80A 1O7UA 5HFKA 4F82A 2G2QA 4Q5RA 4WEYA 2NBSA 4ML1A 3HVSA 1QXHA 3RDWA 3ME8A 2DJ3A 3C1SA 4F0CA 1OC8A 1VF2A 4GSSA 1K0BA 3LXZA 2CAQA 5B8AA 2B6MA 2PU9C 1Z6MA 1K0AA 4DEJA 1X9MB 2C1YA 1K0MA 1PN9A 2LJAA 1WRYA 1XPVA 2GDRA 1LJRA 1AAZA 1B9XC 5GAPD 3CTGA 4ACSA 2DMLA 1JZDA 2H1AA 4KUNA 4DSSB 2E7PA 2C3QA 5G30A 1G6YA 2HRNA 2OE1A 4TKYA 1KBNA 4WKWA 2LRTA 3IAM2 4WF5A 6GSWA 2VD0A 3KTLA 1OC9A 1A2MA 2L59A 4HI7A 4JR6A 2DBCA 3M0FA 3QOUA 4FIWA 1XWGA 1GSEA 1XIYA 4HZ4A 1A24A 1Z9HA 3DVXA 5ELGA 3HCZA 4TN8A 4PQHA 1PSQA 2ZNMA 1PMTA 4ECJA 2YWNA 2H0IA 5IOXA 3ZL5A 2YJHA 3G7YA 2H73A 4HJ2A 4N30A 2VM2A 2C8UA 4OO4A 5ECSA 5EPFA 4NMUA 2DJKA 3LWAA 4G19A 1M9BA 1SYRA 2OADA 4EC0A 1EGRA 1XWCA 5LNKe 3UBLA 1T00A 3O76A 2VD1A 3DVWA 3GX0A 3DWVA 2IWTA 2R5GA 2FWFA 2L5LA 2MMNA 3ME7A 4KDXA 2AYTA 4TXOA 1Z5YE 6GSTA 4BA7A 4XS1A 3TJKA 1SJ6A 2H70A 3EU4A 3LQ7A 4ECIA 1H4OA 1KEBA 4TR1A 1Z3EA 3L9UA 1TU7A 3VPQA 3FYGA 2OE0A 16GSA 1XOBA 11GSA 2QKEA 4ID0A 5ENUA 2O87A 2C3NA 3EE2A 1GNWA 5ECLB 5HR3A 4KB3A 3HHVA 3E3EA 1Z7RA 2FY6A 2CAIA 3HY2A 4OCFA 4ZBAA 2YPMA 1I5GA 3WGEA 5IM9A 1A8YA 4AJ8A 4IS0A 1BG5A 4KW6A 4OFNA 1WPIA 3PGTA 1NSWA 2NPBA 2MMZA 3KZQA 2IY2A 5ECIB 5E59A 6GSVA 2CZ3A 4GWRA 5AGYA 3TKSE 2PWJA 1S3AA 4OMVA 1OE8A 2L4QA 4GLTA 4HU7A 1FVKA 4RI6A 3NIVA 1ZOFA 3DXBA 3L0HA 3CXGA 2C0GA 2JACA 3PINA 4JRRA 5LD0A 2VCQA 1JLWA 2IIYA 2XC2A 4XRAA 5CRDA 1MDIA 1HNBA 1YZXA 3WGXA 2IJYA 3FY7A 1R5PA 2RM5A 2NVLA 2X8HA 1WE0A 5DJLA 3QCPA 4IELA 1WWJA 2O7KA 3I69A 3UVTA 3QD9A 1U88A 3ERGA 3IAS2 1J9BA 5ECRB 3ED3A 2EIOA 4NV5A 3LSZA 4HQZA 4PQ1A 3C73A 3GX8A 3W6GA 3QAWA 3TRPA 5CRGA 3F6DA 2VAFA 5HR2A 2PMTA 3P8WA 4DSSA 2P0GA 2DSAA 2XPEA 3F6FA 3VK9A 1GL8A 5F0GA 2BMXA 2WB9A 3D22A 3ZLPA 2VM1A 1BAYA 2V6KA 4HOJA 5DDLA 4L5LA 2AV4A 4N11A 1F6MC 3LORA 2DMMA 1XVWA 1AQVA 3ZREA 2H75A 5D93A 4ECCA 1ERWA 4TR4A 5D9XA 5IOWA 3D21A 1FO5A 2BJXA 2YOIA 5GSSA 5J3RA 3G7JA 4MDCA 1A8LA 1WIKA 3FHKA 2VCZA 1R26A 1Y25A 3F9UA 5EY6A 1GSYA 3HYPA 4ZIJA 4GXZA 3P7XA 4ISDA 4X1UA 3Q19A 3RBTA 1SL0B 4CDOA 4V2NA 2FCHA 1AUCA 4L8EA 3EC3A 2LQOA 4N0ZA 3ZIVA 1GTUA 1WP0A 4K7OA 2XPDA 2KUCA 4ECBA 3CSIA 3UOMA 2HXKA 3ZMKA 3KTBA 4D73B 2HFDA 3KEBA 5JCUA 2MBSA 2MMAA 3GN3A 2H74A 2M72A 3GKNA 2GQKA 3FR6A 2R3XA 2K8SA 2GZZA 2O89A 4FO5A 2YZHA 1O6JA 3FR3A 3Q74A 3A2VA 5DCGA 4N0VA 3FZ9A 3QPMA 2FGXA 2L4CA 5DAKB 1V57A 2G0FA 1N2AA 1XWKA 3TCOA 1SK0A 3EU3A 1HD2A 1NW2A 2DJJA 2HZFA 3N5OA 5IMAA 2ES7A 3TUEA 2X8CA 4TRXA 1OVNA 5IMDA 4G10A 4F9ZA 2HI7A 1HNCA 3CBUA 4K2DA 1NHYA 1TRVA 1NM3A 1UA5A 4KSOA 1GUKA 1ST9A 3G9BA 3MWHA 1IYHA 3LXTA 1VRSD 2F51A 3JCML 2CT6A 4FYCA 2H72A 2B7JA 22GSA 3VWXA 1SKRB 3IK9A 3DEXA 1C72A 2WFCA 2H0HA 5KN2A 5G31A 6GSSA 5B8BA 5ECPB 3C8EA 2DJ1A 14GSA 4O5RA 5ECHB 3BCKA 5DBQA 2I4AA 3H93A 3S9FA 2PERA 4PURA 5HR0A 4JR4A 5JCGA 1QQ2A 2GSQA 5D9WA 4JE1A 2VO4A 4YQVA 2E2MA 4HU9A 2VOCA 3TJJA 3GNJA 1ERVA 1TRUA 3A2WA 1QGVA 4XHMA 4F03A 3DMLA 1EWXA 3F4SA 5D9VA 1V58A 2J23A 1SYXA 1USBA 2IMIA 1SENA 2WDUA 2ZUPA 4MJCA 4GSNA 2LNSA 5KN1A 3GUSA 1SJZA 1ACVA 4HZ2A 4WBRD 4QL7A 4MZBA 2VL2C 5ELAA 2VL2A 1BYEA 5JWQB 1K3YA 2H71A 2OBKA 2OA7A 2YJ7A 4BVXA 5ECKB 1ZMAA 1GUHA 1O73A 2H01A 2P5QA 1HNAA 1TRWA 3Q6OA 2CX4A 1EP8A 2LNTA 1GLPA 2V1MA 3P2AA 2EIQA 5CREA 4ULXA 3H79A 2KOKA 2ALBA 1M99A 5IQYA 2ZCTA 1EV4A 2HE3A 2DJ2A 1K3OA 1X9WB 1AQXA 1M0UA 1YY7A 3TJFA 3F4TA 2MBTA 1TOFA 4K7NA 2CVDA 1LU4A 1T8EB 4K0NA 2CVBA 2LRCA 1JZRA 2O8VB 2B1KA 3APSA 5H5SA 1R5AA 3E0UA 4IJ3A 5H5QA 2GLRA 3FEUA 2FA4A 5GZZB 3ZFLA 4MH2A 3BD2A 1DUGA 3G7IA 3PR8A 3UARA 2C0EA 2C0FA 1ON4A 4ZL7A 1DBYA 1SKSB 1GLQA 2HT9A 3UIWA 1GNEA 3KGKA 4Q5FA 3EURA 3ZZXA 1A0FA 5AISA 2E0QA 5L71A 4D73A 3RHBA 1XFLA 4MP4A 4K1FA 1FG4A 3TGZA 2F9SA 3TKPA 4GQCA 1YQ1A 3GKKA 3ZITA 3GL3A 3FZ4A 1U87A 3QFAC 4MF7A 5FT3A 1EGOA 3IBHA 4L0WA 5DAKA 5A4VA 4I97A 2V41A 2OJLA 4KSMA 5ID2B 1G0TA 4PQIA 2H30A 5CAXA 4DVCA 3ZVJD 3HKRA 2RLIA 3CMIA 1VF4A 1MDJA 2GS3A 3SBCA 1TK8B 3ZRDA 2JADA 4KE3A 4LL4B 1R4WA 1SJIA 4GF0A 3GH9A 1YEXA 5IO0A 5C00A 3RHCA 1THOA 1YKAA 2YP6A 1EEJA 5COHA 1XW9A 5E4WA 2E2GA 3FR9A 2H66A 2IFQB 3MDKA 3C71A 3WGDA 4PGTA 1M9AA 20GSA 2GZPA 1B4QA 3GTUA 1A23A 5EL8A 3MSZA 2CQ9A 4IHUA 4IQAA 5CO3A 4TR3A 3UJ1A 1GRXA 1V98A 2WS2A 2YN1A 3WD6A 2AAWA 2CVKA 2JZTA 5IPHA 3IXRA 3HA9A 5EVOA 4RQRA 3EVIA 4TVEA 1IYIA 2QC7A 4Q5NA 1WMJA 4KGIA 1ERTA 2R4VA 2X64A 2VCTA 3LJRA 3J7Yb 3HD5A 2GVPA 1MTCA 2WULA 3I6AA 4RQXA 1OKTA 5KEJA 5FHIA 3EINA 4I5QA 2ON5A 4L0UA 2IN3A 1F37A 3GIXA 1URMA 4WXTA 1SKWB 1TK5B 3APQA 1WOUA 1SK2A 2LTKA 5D96A 5CNWA 3GSTA 1O81A 5JCWA 3RPNA 1Z6NA 2VCVA 3Q18A 1M7TA 2FWHA 3C7MA 1PKWA 5IMVA 4POKA 1A0RP 1O85A 2K18A 1VF3A 4NXIA 5ECNB 3D5JA 1XBSA 4YH2A 3QMXA 5IO2A 3W8JA 3KP9A 4F0BA 4HEA2 3GURA 1XW5A 3KIJA 3SWLA 3GMFA 3HXSA 5J41A 2V2GA 4J2FA 1E2YA 2OKAA 5B7CA 2AUVA 2GZYA 2HSHA 1T7PB 4IGJA 1TDIA 5INYA 4MH3A 1FVJA 3QR6A 3BJ5A 4EF0A 4I2TA 2N5AA 4LLRA 1B4PA 1T1VA 1X5CA 3IR4A 4AGSA 4K7IA 2HZEB 5GSTA 4IBPA 1PL2A 4F2IA 1SK1A 2F3MA 5ECMB 1M2BA 1ZGNA 4POBA 1OAZA 2JZSA 3LEFA 1GP1A 2R6KA 3FKFA 1PX7A 1SL2B 4ZBDA 1N8JA 1O8XA 3H8QA 1YEPA 2CX3A 5J5NA 2VIMA 17GSA 4TOPA 1K0DA 2IMFA 4Z7XA 5IMZA 2YV9A 1BEDA 5HR1A 4MCUA 1BX9A 1PX6A 4MA9A 1BJXA 4X43A 1OE7A 2H19A 2I1UA 2L6CA 4AF2A 4ZL8A 4YQMA 3D4MA 4LA1A 4V1Ag 1CQGA 4ZILA 1VF1A 3QAVA 4P3YB 2PPTA 2L5OA 1SL1B 3M3MA 4EL1A 3HVVA 3IDVA 3UAPA 4O32A 4AJ7A 1U3AA 4BPYA 5ECQB 4QQ7A 3EMXA 2H0GA 1THXA 1X9SB 3ZVJA 4OD7A 1QUWA 1H75A 3TKSC 5G5EA 1JHBA 3TKSA 2OACA 3LYKA 3KMNA 1LBKA 3I9V2 1TTZA 2DIZA 3HJPA 8GSSA 1VGLA 2H1DA 1MDKA 1FB0A 4KDUA 1F3BA 2JL4A 3ZFBA 3UBKA 3NZNA 1GH2A 1TK0B 4EVMA 5B6MA 1HYUA 4HUAA 2AJQB 4G2EA 4GQFA 3LG6A 3ZYWA 2A2RA 2K6VA 3OR5A 4MF5A 2XBIA 4G9HA 3ZTLA 4Q5QA 2KP1A 3APOA 3M9KA 1B8XA 2PUKC 1G6WA 2IFQA 2FNOA 4BL7A 4IKHA 4YAVA 4TXOB 2JZRA 3DKSA 3GL5A 3M1GA 4MJEA 4MZWA 1X5DA 3VFIA 2B5YA 1O8WA 3DD3A 4EUYA 1GSFA 1PGTA 4IW9A 2H8LA 4JEDA 3F63A 4BVYA 2MMOA 3GYKA 3F0IA 1UC7A 3VWWA 1TP9A 2DC5A 4OFMA 1OC3A 2FWEA 5HFIA 1FAAA 2XHFA 4OWYA 2KP2A 2PVQA 3ERWA 2LQQA 2JSZA 2L6DA 2GGTA 4KNDA 1PL1A 1EEMA 1ZYEA 4OCEA 2C0DA 3IHQA 12GSA 1MEKA 4ZB6A 4WF4A 1M2AA 2JSYA 3PH9A 4L5OA 2X99A 4HDEA 3HDCA 5DVBA 2WGRA 1M2DA 3KXOA 5IMFA 3ISOA 4QL9A 4XTSA 1YF0A 2FLSA 5ECOB 5A4WA 4FYUA 4ZBBA 4ILFA 3VI7A 4KH7A 4PX1A 2OBIA 3L9SA
chains in the Genus database with same CATH superfamily
3MG2A 4X2HA 4YKGA 2K3DA 2KF5A 3F8HA 1A2JA 3G6E3 3QAGA 4POMA 2H76A 3BNCA 3DRNA 1IVWA 4U13A 3CTFA 4MEIA 3NM2A 4TXVA 2LSTA 3N54B 3GA4A 1US1A 2YWIA 1W89A 5I97A 1XZOA 10GSA 5J9CA 1TI3A 3UL6A 3KE7A 3NQZA 2J8XB 2VLVA 2XEPA 1N8R4 2HLSA 4DKIA 1MWUA 1WJKA 1NHOA 1MD3A 5DQSA 2RUEA 1GOVA 1BNEA 3GFKA 1GD3A 2IMDA 1U8CB 4EYCA 1CQSA 2V6OA 1QAFA 4TW5A 3DH2A 3H4KA 1T4YA 4K9ZA 2TRCP 1S5AA 1Z1SA 4WBJA 2O85A 4WWUC 5CYYA 2YNXA 4ZB9A 1FW1A 1GSUA 1S3DA 2CG1A 2CZ2A 3VGNA 5KP3A 4USSA 1XVQA 1X5EA 1JZOA 1ASKA 2RUFA 4X0XA 2LYXA 3HZPA 4IVFA 3DGYA 5G1LA 1F9MA 2BTOT 1L5GB 1ZCPA 1CQHA 3G0KA 5EVHA 1MGWA 1B9YC 5IIZA 4OVMA 4FCMA 1EOHA 3EMPA 1RN1A 4O92A 1R4YA 5JWRB 1GYBA 1DE2A 2IMJA 3FW2A 1ZX2A 1O7HB 4LMIA 1GTAA 1K41A 3MAKA 5DJMA 3GSSA 3X3ZA 4HZ9B 1S3CA 3ALAA 3DGQA 1ZL9A 2LV3A 3D9RA 4XS4B 3E9JB 5G2ZA 2QSIA 5CRWA 1UCIA 1EV9A 2B7KA 1JFUA 3J7Yd 2R37A 3QFBC 1RDSA 3U5RE 2P5RA 1AW9A 4J56E 5JWOB 3KN4A 3UVHA 1YF1A 4DSQA 3OXAA 5G5FA 1WMPA 1VQ83 1HKXA 4CW9A 1D6ZA 2W03A 4MF6A 2VL9A 1OH0A 4LL1B 1JNQA 2UZ8A 2M46A 3CPOA 1IVUA 1Y6EA 3KJYA 1TXXA 2AHEA 2I9HA 3ER7A 5AN1A 3SXXA 2VLTA 2R4IA 2I81A 3A2XA 5AYRB 2J9HA 4NWYA 4XDVA 1RQMA 6STDA 4H86A 3F3QA 1QAKA 2CW9A 1LNIA 1JB5A 5C04A 3GZXB 1VQQA 4KVHA 3UEMA 4WYKA 1DE1A 2M80A 2QGVA 1GULA 1TIJA 3TDGA 2GXFA 1T4ZA 2LS5A 3US3A 1ZS7A 2Z7AA 1YVBI 3CCQ3 2YWOA 4O7HA 2H6XA 1SD9A 3CSHA 1ISKA 4ML6A 2RFRA 4LMWA 3WYWA 1EP7A 3L78A 4EBGA 2GSTA 3ERFA 5BMUA 3NOFA 5CP1A 3MNGA 2HMOB 3LGCA 2ZL8A 4NHZA 3JVCA 3S27A 3SYUA 4JZQA 4N6UA 3FZAA 2DJ0A 1JB2A 3B4OA 3TKRA 4N3VA 3RNTA 4EO3A 1TI1A 5IG5A 2GTUA 2C4JA 3NX0A 3CRUA 3KMOA 1ZO2A 4O5UA 2VCWA 3DXOA 3CSJA 3PZWA 3VLNA 2CFKA 2IA7A 3NQYA 4HJMA 2V32A 4BWQA 1I70A 4ZB8A 1I3FA 1QVF2 1PD21 3LFLA 1K0CA 1E6BA 3D3LA 1OYJA 3N8BA 3BOAA 4X4JA 3NV0A 2DKIA 3G713 3KH7A 3HIIA 1RKYA 2YV7A 2K8VA 3GAXA 2B3SA 2RIIA 4PTSA 4MPFA 4GTUA 4EDZA 2GSSA 4PUFC 19GSA 3F9SA 3IRAA 4YAPA 4WFOA 3Q90A 4N6LA 1V40A 2GT5A 5AIIA 1TKDB 2WJUA 1Z7PA 3FSDA 4LZIA 4XS6A 3A5IA 1TRSA 4I8BA 1MGRA 1UGHI 4NAXA 1JKGB 4XIHA 3VWUA 4XDWA 5CF1A 5J4UA 4YQUA 4WR5A 1U3IA 2IPAA 1IVVA 3RPPA 3M9JA 3FRCA 1R7HA 3FG3A 1E97A 1EUIC 1BQ7A 4MJBA 3CYNA 5AIVA 3IE3A 1XW6A 1WMOA 5BU4A 3TJGA 5D8IA 1SARA 4JU5A 2MYGA 1IYYA 4MZCA 4BTXA 3F7SA 4GSTA 2NDOA 4OO5A 4X2OA 4EKZA 3URPA 4K0GA 2HYXA 3HOHA 2D42A 2ON7A 3SLUA 1ZYPA 2OOVC 1SD8A 2L57A 5DALB 2OOVA 4MJAA 3T8NA 4O2HA 3D4TA 1FOHA 4XB5A 1VQ43 3NXJA 4EV5A 1FOVA 5F06A 3EWLA 2JU5A 3D79A 2IYJA 1W6YA 1EZKA 1OKDA 2XR8B 3C1RA 3ZIJA 1G02A 3G8ZA 5AIGA 3WT1A 3HVNA 4NHWA 1GS3A 5BXQA 3LH4A 4POLA 3A5WA 3IC4A 1DMMA 3ZMLA 3DGOA 1Q98A 4BTWA 1ZYQB 3OWSA 1ILOA 4V1Ap 4HKVB 3AHWA 2H6ZA 2OE3A 3R2QA 1U5OA 2GEYA 2M7OA 1BNRA 4N6MA 2GQLA 1B3SA 3MIXA 4HM5B 1VZZA 1EOGA 4J9AA 2FA8A 2LQVA 3STDA 3IV4A 3VPTA 4CCVA 4RI7A 2YANA 2PZVA 3KD0A 4IN0A 2BHMA 3OW22 1UGIA 3FCSB 2EIRA 3IPZA 2I3YA 3I43A 4K8MA 1ABAA 3K5TA 2XBQA 4CY8A 4EDYA 4GCIA 3CQFA 4MK3A 2NTOA 1V9WA 4G0KA 2VLUA 2FD3A 4L8OA 3FK8A 1I9DA 2LRNA 4IP1A 1QMAA 3EQQB 1V2AA 2H1BA 2XF3A 1VQ73 4EIPA 2GSRA 3WA2X 4HQSA 4WR4A 4E8EA 1Q40B 1UI8A 1W01A 5FWGA 5F8BA 1T3BA 2YCDA 3BBYA 1BRJA 5F05A 4MPGA 3DUKA 1NB5I 2MZCA 1RK4A 1M904 5D9TA 3L9VA 1ML6A 3EBTA 4KFFA 2IUJA 4KA0A 5H5RA 4PUAA 1J0FA 5AI1A 2FHEA 1RCKA 2B5XA 2X8GA 3BCIA 4HS1A 4KCAA 4L7KA 2CFLA 5AIFA 1M3JA 5B6NA 4XS4A 1VQ93 5LCZA 3KH9A 1TUHA 2F5MA 1TW9A 1RLSA 2JQ5A 2C3TA 4PNGA 1LXEA 3U6VA 3KFQC 5ELJA 2TRXA 1YJ6A 3HVXA 4K1UA 1RN4A 4BVXB 6GSYA 1GSQA 1GOUA 3J7Yk 3X3XA 3FMWA 3VI5A 3CCM3 5AYSC 4V2LA 2VL3A 2YWMA 2HNLA 5IMCA 3KP8A 1TRQA 5IG0A 3IA1A 3KCMA 3DYRA 5D73A 4MJDA 3GHAA 1N8QA 1PQNA 4HM0B 1DSBA 3A3TA 5IG3A 2C11A 2DIYA 1TU8A 3X41A 3TJBA 2O9UX 3TRXA 1PRXA 4IP6A 2HSYA 3IPTA 3JUNA 2H6YA 4KX4A 2RSXA 2IMKA 2B1XB 2B5EA 7STDA 2DKHA 2KLXA 4PXOA 5IERA 1IT7A 1D6YA 4I2UA 2VUPA 2F8AA 5ABRA 4KAEA 2GQMA 2LJRA 3QDNA 1ERUA 4L8PA 3D0ZA 3O3TA 3TRQA 1OC9B 1BNFA 1HZ1A 5EQLA 3IK7A 2N5BA 1GSSA 2PBJA 4KT3B 3M8NA 3O6TA 2OWPA 1CH0A 3X3YA 1AC1A 2BIRA 5G1KA 4DSRA 2HMLB 5CRHA 2IL3A 5IPGA 5ID2A 3UMAA 1JJ22 5HFGA 2FUG2 4IQ1A 3A5EA 4AKZA 2LEGA 4K6XA 2WCIA 4K61A 4PNFA 2CWVA 2K9FA 6RNTA 1PKZA 1MWTA 1PA3A 3AY8A 1MD4A 4HM4B 2D2ZA 5HQPA 2K0MA 2KF4A 3HZ4A 1X1WA 4EE0A 3UL3A 3B7CA 1A2LA 2UGIA 13GSA 4JBBA 3CRTA 1SU9A 1W4VA 1RGKA 3EC9A 3HZ8A 3FZ5A 1I2EA 2PVOC 4LYLB 3TOUA 1F2EA 1YJ93 2LUSA 1TTOA 2REMA 4XBTA 1AXDA 1X1XA 3DIEA 3GKXA 4BWSA 1FHEA 3K63A 2A2SA 3NBJA 4R80A 1JV2B 3CCS3 1OF5B 2V1LA 4FH8A 2HRFA 1IQXA 2OQEA 2EC4A 2DLXA 1GUMA 3P90A 2B24B 1G7OA 2BU4A 2W56A 3E99A 3MYDA 1B2SA 4EV2A 1N9JA 1QK8A 5KN0A 1K0OA 1U6TA 2N5FA 3D6IA 4MMMA 4TR1B 4AJ6A 2PN8A 4V2MA 6GSUA 1BIRA 2Y74A 3MWZA 1QMVA 2VCXA 4EXJA 3TB2A 2WZ9A 4J57E 1ZZYA 3EJVA 1XXUA 2W9QA 1RW1A 1X1YA 4CPKA 2KHPA 4CHSA 5JPPA 1UUVB 4G0IA 4MLYA 2W0QA 3V1WA 1JLVA 3F3RA 2Z9SA 3ZG5A 5A5KA 1DETA 2HMJB 1GTBA 2GSPA 1K0NA 1S3RA 4ZXGA 1VQN3 5F07A 1F3AA 1ULIB 5DALA 3LYPA 1RGEA 4HVNA 3GH6A 3HK4A 1GTIA 9GSSA 1RGCA 3GRXA 4N10A 1J2BA 1QVG2 2RM6A 1MWRA 1PYLA 5DCHA 1FGMA 3W8SA 1OHPA 1RNTA 2F8FA 2F56A 5AIXA 4I6XA 3RAZA 3TKQA 1B48A 4IJIA 2SBLA 3N9JA 3S5CA 7GSSA 1QFNA 5AIHA 4KFDA 4R9LA 4KDYA 1O7NB 3EN1B 3HJOA 4K2XA 1AIUA 4LMVA 3S28A 1GMRA 3GTUB 4NV2A 3WDGB 1I2GA 4FYBA 5KOXA 1TJDA 1G7EA 1UN2A 1JB4A 1JZWA 3KM6A 4XRDA 2TIRA 4XCSA 1XWAA 4E8HA 3F4RA 2JDIH 4Z2UA 4CJNA 1EA2A 3CXC2 2CA8A 18GSA 1X0RA 3L4NA 4NPBA 4ORLA 1PFOA 2GT6A 1K3LA 2RCDA 2LKUA 5KP4A 3O8YA 2FWGA 5GAND 6GSXA 1Q824 1UCKA 1YDKA 2CV4A 4WP5A 4GRFA 4KCEA 4WETA 4RUVA 3ZFZA 1GSDA 3HJMA 1A90A 2PGTA 4MABA 4ZL9A 3KSED 2BMRB 1GWCA 2OCTA 2P31A 5RNTA 1KTEA 1DE3A 4OFTA 1T2HA 3IOSA 3F8UA 1B20A 2R2JA 2FNQA 3K8NA 2HMMB 1J08A 3TOTA 2WRTA 1HYFA 2B1LA 1YKCA 3HI7A 3EPTA 3DY5A 3MG1A 3H1NA 1LQGC 5J9BA 3VWVA 2H1GA 3EYTA 2YZUA 1UVZA 1CYUA 1HQOA 3WT2A 3GV1A 3VURA 1FB6A 1XOAA 3G16A 1DVCA 3GKMA 1S723 3SVAA 1AQWA 2LJKA 2AB6A 3CPW2 1XWBA 4AEQA 5DQYA 1YIJ3 2IMEA 5KN3A 1Q4JA 2HZEA 1FYSA 4TR0A 5A4UA 1W2B2 1KNGA 2A4VA 3GSPA 3CC23 1XCCA 2C80A 2GU3A 1VQ53 1O7UA 2F98A 5HFKA 4F82A 2G2QA 3F8XA 3WR2A 2R0GA 4Q5RA 3H3HA 4WEYA 3L0RA 2NBSA 4ML1A 7GSPA 1QXHA 2X49A 3HVSA 3RDWA 3ME8A 2DJ3A 3C1SA 4F0CA 1OC8A 1VF2A 1I2FA 1FUTA 5FW5A 4GSSA 1K0BA 3LXZA 3T8UA 3AMOB 3IMAB 2CAQA 4H3UA 5B8AA 4FMAA 2B6MA 2PU9C 1Z6MA 1K0AA 3VF1A 3UL5A 4DEJA 4HOHA 1BRHA 1X9MB 2C1YA 1K0MA 1PN9A 2LJAA 1WRYA 3F7XA 4K5RA 1XPVA 2GDRA 3T0UA 1LJRA 1AAZA 1B9XC 5GAPD 3CTGA 4ACSA 2DMLA 1JZDA 3Q2PA 2H1AA 4MNNA 4KUNA 3H51A 4DSSB 2E7PA 2C3QA 5G30A 1G6YA 1E3RA 2HRNA 2OE1A 4NHFA 4TKYA 1KBNA 1CYVA 2MC8A 4WKWA 1ROAA 1K8A4 5LC7A 3B4PA 1B27A 2LRTA 3IAM2 3JUQA 3JUPA 2XGLA 2W6JH 2BMQB 3F14A 4WF5A 6GSWA 2VD0A 3V98A 1OC9A 3KTLA 1A2MA 2L59A 4HI7A 4JR6A 3V92A 2DBCA 3M0FA 1TFOA 3QOUA 1MNLA 4FIWA 1XWGA 1GSEA 1XIYA 4HZ4A 1A24A 1Z9HA 2OTL3 2QGUA 1M1XB 2CFWA 3DVXA 3HCZA 4TN8A 5ELGA 4PQHA 1PSQA 1I0XA 2ZHXB 2ZNMA 1VQP3 1W00A 8CHOA 1LOXA 1PMTA 5IG4A 4ECJA 2P09A 1DYUA 2YWNA 2H0IA 2CX0A 5IOXA 4MMYB 3ZL5A 1OHOA 2YJHA 4Z2RA 3G7YA 2H73A 4HJ2A 4N30A 3FF2A 3LXUX 2VM2A 2C8UA 4OO4A 5STDA 1GMPA 5ECSA 5EPFA 4Z2TA 4NMUA 2XH9A 2DJKA 3LWAA 4G19A 4AKYA 2X4AA 1M9BA 3BU4A 1SYRA 1Q864 2OADA 4NREA 5DRVA 4EC0A 1EGRA 1XWCA 5LNKe 2K54A 4JF8A 1Q7Y4 5EEOA 1YVSA 1T00A 3O76A 3UBLA 2CKFB 2VD1A 3DVWA 3GX0A 3DWVA 1FUSA 5DREA 1ULJB 3X40A 2IWTA 1YIT3 2R5GA 2FWFA 2L5LA 2MMNA 3ME7A 3ECFA 5G2GA 4KDXA 2AYTA 1I8VA 3KCHA 4TXOA 1Z5YE 4MMZB 6GSTA 4BA7A 4IT7A 4XS1A 3CNMA 3WA3A 3TJKA 1SJ6A 2H70A 3EU4A 1W2ZA 3LQ7A 3LYGA 1LQMB 3LT9A 4ECIA 2R0PA 1H4OA 1KEBA 4TR1A 1Z3EA 1JBRA 3L9UA 3MKIA 1TU7A 3VPQA 3FYGA 2OE0A 3WODG 16GSA 1XOBA 1NB3I 11GSA 2QKEA 4ID0A 5ENUA 1O7WB 2O87A 1FGQA 2C3NA 4TX4A 2KCDA 3EE2A 1GNWA 5ECLB 5HR3A 4KB3A 1SQWA 4HM7B 3HHVA 2F86B 3E3EA 1Z7RA 2FY6A 2CAIA 3HY2A 4HBRA 2XGNA 2HRAA 2CIUA 4OCFA 3EX9A 4ZBAA 3LZAA 2YPMA 3EE1A 1OPYA 1NWWA 1I5GA 2RGQA 3WGEA 5IM9A 5FGOA 1A8YA 2HSMA 4AJ8A 4IS0A 1BG5A 2ML6A 4KW6A 1GY5A 1LVNA 4GL6A 4ZM8A 4OFNA 1Y4KA 2XRXB 4FMBA 1WPIA 2CWUA 3PXMA 1T2IA 3RDEA 4RNTA 3CCJ3 3V99A 4OK0A 3PGTA 1NSWA 2NPBA 4BVYB 2MMZA 1BNJA 3KZQA 2IY2A 4N6NB 5ECIB 5E59A 2CHCA 6GSVA 2CZ3A 1WMNA 4GWRA 5AGYA 1IQ8A 4H61A 2PWJA 3TKSE 1S3AA 4BL2A 4GB5A 4OMVA 5CLKA 1OE8A 2L4QA 4GLTA 1BSDA 3RGAA 4EW5A 4HU7A 2CFDA 2D1WA 2KF6A 1LRAA 1FVKA 4RI6A 1Q7HA 2CFGA 3NIVA 1ZOFA 4ICYA 3DXBA 3L0HA 3CXGA 2C0GA 2JACA 2YFLB 3PINA 4JRFA 4JRRA 5LD0A 5GSPA 2VCQA 1JLWA 3S29A 1TU5A 4N6OB 5AEUB 2IIYA 2XC2A 4RZMA 3NBRA 4XRAA 5CRDA 1MDIA 2QA1A 1TRPA 1BSBA 3CCR3 1HNBA 1YZXA 3WGXA 2IJYA 3FY7A 1R5PA 3QRDA 2RM5A 2IUKA 2NVLA 1XG8A 2X8HA 7RNTA 1WE0A 1OHSA 5DJLA 3QCPA 4IELA 1WWJA 1RHLA 2O7KA 4GSPA 1BSAA 3I69A 3UVTA 3QD9A 1U88A 3ERGA 2YFIB 3AMOA 3IAS2 1J9BA 3CU3A 5ECRB 3ED3A 2EIOA 3WMDA 4NV5A 3LSZA 2RNTA 2CWTA 4HQZA 2ZDJA 4PQ1A 5D83A 1LOWA 3C73A 3GX8A 3W6GA 2E2TA 1JRQA 1IT8A 1VQ63 3QAWA 3TRPA 5CRGA 1FGRA 3F6DA 2VAFA 2KXGA 5HR2A 1BNIA 1IVXA 1Q9EA 2PMTA 3P8WA 2P0GA 4DSSA 2DSAA 2OTJ3 2XPEA 3F6FA 3VK9A 1GL8A 3WOEB 1JN5B 5F0GA 1FGOA 1WTHA 2HMKB 2W9PA 2BMXA 2WB9A 3D22A 3ZLPA 2VM1A 1BAYA 1KSIA 2V6KA 4HOJA 5DDLA 1IV9A 4L5LA 2AV4A 3CC43 5AEWB 1BANA 4N11A 1F6MC 3LORA 2DMMA 1GD4A 1XVWA 1AQVA 3ZREA 1FA3A 3GZYB 4PEJA 2H75A 5D93A 4ECCA 1ERWA 4TR4A 1YI23 3LW9A 5D9XA 5IOWA 3D21A 1FO5A 2BJXA 2YOIA 5GSSA 5J3RA 4KFEA 3G7JA 4MDCA 3PCSA 2WGQA 1EQKA 1NO3A 1A8LA 1SIHA 3AGNA 3QK9A 1I0VA 1WIKA 3FHKA 2WO0A 2VCZA 1R26A 1Y25A 1ZYNA 3NBBA 3F9UA 4O5QA 3SOYA 5EY6A 1GSYA 3HYPA 4ZIJA 4GXZA 3P7XA 4ISDA 1YGWA 1SJWA 1RGFA 4X1UA 1LOYA 3Q19A 3RBTA 1SL0B 1RTUA 4CDOA 2INXA 4V2NA 2STDA 5IENA 2FCHA 1AUCA 4L8EA 3EC3A 5HOHA 2LQOA 4N0ZA 3ZIVA 1GTUA 1WP0A 4K7OA 4WHAA 2XPDA 2KUCA 4ECBA 3DM8A 3CSIA 3UOMA 3N9HA 2HXKA 3ZMKA 3KTBA 4D73B 2HFDA 4K90B 3KEBA 5JCUA 4EIQA 3A76A 2MBSA 2MMAA 3GN3A 1M9GA 5M18A 2H74A 2M72A 3GKNA 3BLZA 1GMQA 2GQKA 5KP1A 3FR6A 1N9EA 2R3XA 1SIIA 2K8SA 2GZZA 3VSYA 2P0XA 2Y73A 2O89A 2CC3A 3D5IA 4FO5A 2YZHA 1A2VA 2KRTA 1O6JA 3LTAA 3FR3A 3Q74A 1PFPA 3A2VA 5DCGA 4N0VA 3FZ9A 3BNDA 3QPMA 1O7PB 2XSHB 3LTDA 3DGNA 2Q07A 2FGXA 1BRNL 2L4CA 1RN7A 1M3IA 1AQZA 4HAAA 5DAKB 1V57A 1KD14 3FG1A 3Q3FA 3BNEA 1KQS2 2G0FA 1N2AA 1XWKA 3TCOA 1SK0A 1JKGA 1N5HA 3EU3A 1HD2A 1NW2A 2DJJA 2HZFA 3N5OA 1MWSA 3S67A 2CG0A 3EHCA 3LTBA 4I4KA 2UX0A 1SPUA 4HM3B 5IMAA 1STDA 2ES7A 2F4YA 3PS8A 3TUEA 4IPBA 3KKGA 2R0CA 2X8CA 3WHOA 4TRXA 4R9KA 1YJW3 1OVNA 2GEXA 5IMDA 1W6CA 4G10A 4F9ZA 1BNSA 4RNYA 2HI7A 3UNLA 1HNCA 2QA2A 3CBUA 4K2DA 2L4VA 4Q53A 1B2ZA 3NV0B 1NHYA 1TRVA 2AADA 5CXOA 1NM3A 1CEWI 1UA5A 4KSOA 1GUKA 1ST9A 3G9BA 3MWHA 4R4KA 1IYHA 1A67A 4J5GA 5IEPA 3LXTA 1O7GB 1VRSD 5CF2A 2F51A 3JCML 4R1KA 2CT6A 4FYCA 3BIRA 2H72A 3FGYA 2B7JA 22GSA 3VWXA 1SKRB 3IK9A 1RCLA 3DEXA 1C72A 4RNZA 2WFCA 1VQO3 3HX8A 2H0HA 5KN2A 4KF9A 5G31A 3B8LA 3OV4A 6GSSA 5B8BA 4G1MB 5ECPB 3OWYA 3C8EA 2WGOA 2DJ1A 1PN0A 14GSA 1RGHA 4O5RA 5ECHB 3K7CA 4STDA 3BCKA 2HOHA 3IHGA 5DBQA 2I4AA 3H93A 3S9FA 2P38A 2PERA 4PURA 5HR0A 2XSOB 4JR4A 5JCGA 2SARA 1B21A 1QQ2A 2GSQA 5D9WA 3BB9A 4HM8B 4JE1A 2VO4A 4YQVA 2E2MA 4HU9A 2VOCA 3TJJA 3GNJA 5IMVA 1FZUA 1ERVA 1TRUA 3A2WA 2I9WA 1LNHA 1QGVA 1YHQ3 4XHMA 4F03A 1Q40A 3DMLA 1EWXA 3F4SA 4MMXB 5D9VA 1V58A 2J23A 3SX1A 1YGEA 1SYXA 1FGTA 1USBA 2IMIA 2KF3A 1SENA 2WDUA 2ZUPA 3NUVA 1A2PA 3M8CA 4MJCA 1F8NA 3D4AA 4GSNA 2LNSA 5KN1A 4QWTA 4O3VA 3K0ZA 3GUSA 3SEDA 1SJZA 1ACVA 4HZ2A 4WBRD 3D5GA 4QL7A 4MZBA 1RMSA 2VL2C 2FGTA 1W4NA 5ELAA 2VL2A 1DMNA 2C4BA 1BYEA 5JWQB 1BVIA 1K3YA 2H71A 2OBKA 3CNXA 1JN5A 2OA7A 2YJ7A 4BVXA 3GRDA 5ECKB 1ZMAA 1GUHA 1O73A 2H01A 2P5QA 1HNAA 1TRWA 5BRTA 3Q6OA 2CX4A 4FQUA 2Z6BA 4BTYA 1EP8A 2LNTA 1GLPA 2BMOB 2V1MA 3P2AA 3NM7A 2EIQA 5CREA 5CK6A 4ULXA 3H79A 3CCV3 2KOKA 2QEX3 2ALBA 1M99A 5IQYA 1YJN3 2ZCTA 1A2KA 1EV4A 2HE3A 2DJ2A 1K3OA 1X9WB 2Z76A 1OACA 1AQXA 1M0UA 1YY7A 3TJFA 4A5PA 3F4TA 2MBTA 1BSEA 1TOFA 4K7NA 2CVDA 1LU4A 1T8EB 4K0NA 3ROBA 1E3VA 2CVBA 1UW1A 2LRCA 1JZRA 2O8VB 4YKFA 2B1KA 3APSA 5H5SA 1R5AA 3E0UA 4IJ3A 5H5QA 2GLRA 1BRKA 3FEUA 1UCLA 2FA4A 5GZZB 3ZFLA 3MPHA 2QIYA 4MH2A 4K1VA 3BD2A 1DUGA 3G7IA 3PR8A 1T5YA 1DVDA 3UARA 2C0EA 2CK3H 2C0FA 1ON4A 4ZL7A 2FXTA 1DBYA 1SKSB 3G4S3 1AV4A 1GLQA 2HT9A 3U97A 3UIWA 1GNEA 3KGKA 4Q5FA 3EURA 3ZZXA 1A0FA 5AISA 4LEHA 4GHOA 2E0QA 5L71A 4D73A 3RHBA 1GY7A 1XFLA 4HM2B 1B2XA 4MP4A 3UJMA 4K1FA 1FG4A 2XFTA 2XFSA 3TGZA 2F9SA 3TKPA 4GQCA 5D82A 4EC6A 1FUWA 1YQ1A 3GKKA 3ZITA 1TFKA 3GL3A 3FZ4A 1PY3A 2WOHA 1U87A 3QFAC 2F99A 4MF7A 5FT3A 3ZG0A 1EGOA 4XBYA 1HU9A 3IBHA 1RSNA 1OF5A 4L0WA 5DAKA 5A4VA 1TP6A 4HZBB 4I97A 3LOYA 1W02A 2V41A 2OJLA 1WNHA 4KSMA 2F5WA 5ID2B 5BVBA 1G0TA 3I553 4PQIA 2H30A 5CAXA 3KSPA 2YX9A 4DVCA 2YFJB 3ZVJD 4KZ1A 3HKRA 2RLIA 3CMIA 1VF4A 1N5PA 1MDJA 2GS3A 3SBCA 1TK8B 3ZRDA 4RBNA 2JADA 4KE3A 4LL4B 3CCL3 5JBSA 4LGQA 1R4WA 1SJIA 4CY6A 4GF0A 3GH9A 4XBXA 1RRHA 2W2CA 1YEXA 3UB1A 5IO0A 1NNVA 5C00A 1THOA 3RHCA 5LC6A 1YKAA 1EEJA 2YP6A 5COHA 1XW9A 1FW7A 1QJGA 1RGGA 2E2GA 5E4WA 3FR9A 1IQYA 3PYJA 2H66A 2IFQB 3MDKA 4FMCA 3C71A 3DGMA 1UUGB 1BU4A 3WGDA 4BL7B 3U1WA 4PGTA 1UCJA 1B2MA 1M9AA 20GSA 1OGZA 1IK3A 1LOVA 2W56B 2GZPA 1B4QA 3GTUA 1RNBA 1K9M4 3AHSA 3DZLA 3EF8A 1A23A 2P0MA 5EL8A 3MSZA 2CQ9A 4IHUA 1OUNA 4IQAA 5CO3A 4TR3A 3UJ1A 1GRXA 2Z77A 1V98A 2WS2A 2YN1A 3WD6A 2AAWA 2CVKA 5IW9A 4BU4A 2JZTA 3IXRA 5IPHA 3KIIA 2BNGA 3HA9A 5EVOA 3F40A 4RQRA 3LT8A 3EVIA 4TVEA 5HGRA 1IYIA 2QC7A 1B2UA 4Q5NA 1WMJA 3K9MC 4KGIA 1ERTA 3FZWA 2R4VA 2X64A 2VCTA 1AVKA 3LJRA 3J7Yb 3MSOA 3HD5A 4IIAA 2RBIA 2GVPA 1MTCA 2WULA 3I6AA 4RQXA 1BAOA 2A15A 1OKTA 5KEJA 5FHIA 3EINA 4I5QA 2ON5A 1YNVX 1K28A 4L0UA 1BSCA 2L1SA 2IN3A 5D81A 1F37A 3GIXA 1URMA 4WXTA 1SKWB 1TK5B 3APQA 1WOUA 1SK2A 2LTKA 5D96A 5CNWA 3GSTA 5M19A 1O81A 5JCWA 3RPNA 1NU3A 1Z6NA 4HYZA 2VCVA 3CMA3 3Q18A 1M7TA 2FWHA 1W6GA 3FH1A 1OCVA 3EN8A 1PKWA 3C7MA 3R3EA 1A0RP 1O85A 2K18A 1VF3A 4POKA 4NXIA 1KWIA 5ECNB 3D5JA 3DMCA 1I3IA 1XBSA 4YH2A 3QMXA 1VQM3 5IO2A 2O3OA 1V74A 3W8JA 3KP9A 3FF0A 4F0BA 4HEA2 3Q1CA 1GY6A 3GURA 1XW5A 3KIJA 3SWLA 3GMFA 2A2PA 3HXSA 5J41A 1OGXA 2V2GA 4J2FA 1E2YA 3I563 2OKAA 5B7CA 3JUMA 2P05A 2AUVA 2GZYA 1UDII 2QA43 1M1K4 2PNCA 2HSHA 1T7PB 4IGJA 1TDIA 5INYA 4MH3A 1FVJA 1BOXA 3QR6A 1BRGA 1O7MB 1BUQA 3BJ5A 4EF0A 3I0YA 4I2TA 2GBWB 2N5AA 1W5ZA 4LLRA 1B4PA 1DMQA 3CCE3 1T1VA 1X5CA 3IR4A 4AGSA 4K7IA 3GZRA 2HZEB 5GSTA 4IBPA 3FKAA 1PL2A 4HM6B 4O02B 4F2IA 3NHXA 3OX9A 1SK1A 2F3MA 2HRKA 5ECMB 3LTCA 1M2BA 1ZGNA 4POBA 1OAZA 2JZSA 3LEFA 1GP1A 2R6KA 3FKFA 1BGSA 5IEOA 2BT3A 1PX7A 1SL2B 1PU4A 4ZBDA 5ELUA 1N8JA 1O8XA 4FR9A 3H8QA 1YEPA 2CX3A 2BO9B 3OWUA 5J5NA 2VIMA 1NDOB 17GSA 4TOPA 1K0DA 2IMFA 4Z7XA 1JBSA 4K5SA 4LSOA 5IMZA 2YV9A 1BEDA 5HR1A 4MCUA 1BX9A 1PX6A 4MA9A 1UUWB 4N6TA 1BJXA 1C54A 4X43A 4J8TA 1OE7A 2H19A 2I1UA 2L6CA 5JPUA 1C7HA 3DGLA 4AF2A 4ZL8A 4YQMA 3D4MA 1EG9B 1D6UA 2C10A 1AVLA 4LA1A 4V1Ag 1CQGA 3SOAA 1WQLB 5M1AA 2KAAA 4ZILA 1VF1A 3CC73 3QAVA 4P3YB 2PPTA 2L5OA 1SL1B 3M3MA 5TGNA 4EL1A 3HVVA 3IDVA 3AGOA 4O32A 3UAPA 1BNGA 4AJ7A 1U3AA 1Q814 4BPYA 5ECQB 4QQ7A 2A4HA 3GWRA 3EMXA 2H0GA 1THXA 1X9SB 3ZVJA 4OD7A 3PCRA 1QUWA 1H75A 1BRSA 3TKSC 5G5EA 1UI7A 3RGRA 3CME3 1JHBA 3TKSA 2OACA 3LYKA 5KOWA 4WYKB 1AY7A 2CH9A 3CD63 1K734 3IJEB 1LBKA 1TTZA 3I9V2 3KMNA 1IDPA 3JUOA 2DIZA 1IV7A 3HJPA 8GSSA 4BL3A 1IU7A 1VGLA 4HJLB 2H1DA 1MDKA 1FB0A 4KDUA 1R4CA 1F3BA 2JL4A 4FCJA 3X42A 3CCU3 1BUJA 2E2VA 3ZFBA 1MOLA 3UBKA 3PGBA 3NZNA 1GH2A 1TK0B 4HM1B 1ROVA 2ZA4A 4EVMA 1RGLA 2MF7A 2WOFA 5B6MA 4HSCX 1HYUA 3MHEA 4HUAA 2AJQB 3BNBA 1RRLA 2HMNB 4G2EA 4FMDA 4GQFA 3LG6A 3ZYWA 2A2RA 4OUQA 2K6VA 3OR5A 3MG3A 4MF5A 2XBIA 2R41A 4G9HA 3ZTLA 9RNTA 4Q5QA 2KP1A 3APOA 3M9KA 2CX1A 1B8XA 1X1UA 4BIRA 2PUKC 1G6WA 2IFQA 2ML5A 2OQEC 2FNOA 4FCZA 4BL7A 4IKHA 1RGAA 2GBXB 4YAVA 3HIGA 3MYTA 1VQK3 1QALA 1NJI4 1EKMA 4TXOB 2JZRA 3DKSA 3GL5A 3M1GA 4MJEA 4MZWA 1KC84 1X5DA 2GU1A 3VFIA 2B5YA 1O8WA 4G0LA 3DD3A 4EUYA 1GSFA 1PGTA 3PPUA 4IW9A 1GSPA 2H8LA 3GZBA 4JEDA 3F63A 4BVYA 3IC8A 2MMOA 3GYKA 4EXRA 3F0IA 1ZGXA 1UC7A 1TP9A 3VWWA 4BIKA 2DC5A 5IF6A 4OFMA 1OC3A 2FWEA 2E2UA 5HFIA 3EB8A 1FAAA 2XHFA 4OWYA 2KP2A 2PVQA 3ERWA 4J5KA 2LQQA 2JSZA 2L6DA 5A0OB 2GGTA 4KNDA 2W04A 1PL1A 1EEMA 1ZYEA 4OCEA 4N6V0 2C0DA 3IHQA 1BRIA 12GSA 1MEKA 3EBYA 4ZB6A 5BIRA 2UUGC 1JBTA 4WF4A 1M2AA 1VQL3 1Q42A 2JSYA 3PH9A 4CDLA 4L5OA 3FG4A 2X99A 4HDEA 1RJOA 3HDCA 5DVBA 2WGRA 1W7CA 1M2DA 3KXOA 5IMFA 3ISOA 4QL9A 4XTSA 2AAEA 1YF0A 2FLSA 5ECOB 5A4WA 1STFI 1AR0A 1G96A 4FYUA 4ZBBA 4ILFA 8RNTA 4O8SA 1GOYA 6GSPA 4KH7A 4PX1A 3VI7A 3KZTA 2OBIA 3WOFB 3LMLA 3FLJA 4XM4A 3L9SA
chains in the Genus database with same CATH topology
4YKGA 1A2JA 3QAGA 4POMA 2H76A 3DRNA 3CTFA 4TXVA 2LSTA 3GA4A 2YWIA 1W89A 10GSA 1XZOA 5J9CA 1TI3A 2VLVA 2HLSA 1WJKA 1NHOA 1MD3A 5DQSA 2RUEA 3GFKA 2IMDA 2V6OA 4TW5A 3H4KA 1T4YA 4K9ZA 2TRCP 4WBJA 2O85A 5CYYA 2YNXA 4ZB9A 1FW1A 1GSUA 1S3DA 2CZ2A 4USSA 1XVQA 1X5EA 1JZOA 2RUFA 4X0XA 4IVFA 5G1LA 1F9MA 2BTOT 1ZCPA 1CQHA 1B9YC 5IIZA 1EOHA 3EMPA 4O92A 5JWRB 1DE2A 3FW2A 1GTAA 3MAKA 5DJMA 3GSSA 1S3CA 3DGQA 1ZL9A 2LV3A 4XS4B 3E9JB 5G2ZA 2QSIA 5CRWA 1EV9A 2B7KA 1JFUA 2R37A 3QFBC 3U5RE 2P5RA 1AW9A 4J56E 5JWOB 3UVHA 1YF1A 4DSQA 5G5FA 4CW9A 4MF6A 2VL9A 4LL1B 2UZ8A 2M46A 1Y6EA 3KJYA 1TXXA 2AHEA 2I9HA 5AN1A 2VLTA 2I81A 3A2XA 2J9HA 4NWYA 1RQMA 4H86A 3F3QA 5C04A 3UEMA 1DE1A 2M80A 2QGVA 1GULA 3TDGA 1T4ZA 2LS5A 3US3A 2YWOA 4O7HA 2H6XA 1SD9A 3CSHA 4ML6A 3WYWA 4LMWA 1EP7A 3L78A 2GSTA 3ERFA 5BMUA 3NOFA 5CP1A 3MNGA 3LGCA 4NHZA 4JZQA 3FZAA 2DJ0A 3TKRA 4EO3A 1TI1A 2GTUA 2C4JA 3CRUA 3KMOA 4O5UA 2VCWA 3CSJA 3VLNA 4HJMA 2V32A 4BWQA 4ZB8A 1PD21 3LFLA 1K0CA 1E6BA 1OYJA 3BOAA 4X4JA 2DKIA 3KH7A 2YV7A 2K8VA 2RIIA 2B3SA 4PTSA 4MPFA 4GTUA 4EDZA 2GSSA 4PUFC 19GSA 3IRAA 4YAPA 1V40A 2GT5A 1TKDB 2WJUA 1Z7PA 4XS6A 3A5IA 1TRSA 4I8BA 4NAXA 4XIHA 3VWUA 5J4UA 4YQUA 4WR5A 1U3IA 2IPAA 3RPPA 3M9JA 3FRCA 1R7HA 1BQ7A 4MJBA 3CYNA 5AIVA 3IE3A 1XW6A 3TJGA 5D8IA 4JU5A 2MYGA 4MZCA 4GSTA 2NDOA 4OO5A 4EKZA 4K0GA 2HYXA 2ON7A 1ZYPA 1SD8A 2L57A 5DALB 4MJAA 3D4TA 1FOHA 1FOVA 5F06A 3EWLA 2JU5A 2IYJA 1EZKA 1OKDA 3C1RA 3ZIJA 3WT1A 4NHWA 4POLA 3A5WA 3IC4A 3ZMLA 1Q98A 1ZYQB 1ILOA 4V1Ap 2H6ZA 2OE3A 3R2QA 2GQLA 3MIXA 1EOGA 2FA8A 3IV4A 3VPTA 4RI7A 2YANA 3KD0A 4IN0A 2EIRA 3IPZA 2I3YA 3I43A 4K8MA 1ABAA 2XBQA 4CY8A 4EDYA 4GCIA 4MK3A 2NTOA 1V9WA 4G0KA 2VLUA 2FD3A 3FK8A 1I9DA 2LRNA 4IP1A 1V2AA 2H1BA 4EIPA 2GSRA 4HQSA 4WR4A 4E8EA 5FWGA 5F8BA 1T3BA 2YCDA 3BBYA 5F05A 4MPGA 2MZCA 1RK4A 5D9TA 3L9VA 1ML6A 4KA0A 5H5RA 4PUAA 1J0FA 2FHEA 2B5XA 2X8GA 3BCIA 4HS1A 4KCAA 5B6NA 4XS4A 5LCZA 3KH9A 1TW9A 4PNGA 2C3TA 3U6VA 2TRXA 1YJ6A 3HVXA 4BVXB 6GSYA 1GSQA 3J7Yk 3FMWA 3VI5A 4V2LA 2VL3A 2YWMA 2HNLA 5IMCA 3KP8A 3IA1A 3KCMA 3DYRA 5D73A 3GHAA 1PQNA 1DSBA 3A3TA 2DIYA 1TU8A 3TJBA 3TRXA 1PRXA 4IP6A 2HSYA 2H6YA 4KX4A 2IMKA 2B5EA 2DKHA 2KLXA 4PXOA 4I2UA 2VUPA 2F8AA 5ABRA 4KAEA 2GQMA 2LJRA 3QDNA 1ERUA 3D0ZA 3O3TA 3TRQA 1OC9B 3IK7A 2N5BA 1GSSA 2PBJA 3M8NA 3O6TA 1AC1A 5G1KA 4DSRA 5CRHA 2IL3A 5IPGA 5ID2A 3UMAA 5HFGA 2FUG2 4IQ1A 2LEGA 4K6XA 2WCIA 4PNFA 2K9FA 1PKZA 1PA3A 3AY8A 1MD4A 2D2ZA 5HQPA 3HZ4A 4EE0A 3UL3A 1A2LA 13GSA 4JBBA 3CRTA 1SU9A 1W4VA 3HZ8A 3FZ5A 2PVOC 3TOUA 1F2EA 2LUSA 2REMA 1AXDA 3DIEA 3GKXA 4BWSA 1FHEA 2A2SA 4FH8A 2HRFA 2EC4A 2DLXA 1GUMA 3P90A 1G7OA 3MYDA 1QK8A 5KN0A 1K0OA 1U6TA 2N5FA 3D6IA 4MMMA 4TR1B 4AJ6A 2PN8A 4V2MA 6GSUA 2VCXA 1QMVA 4EXJA 3TB2A 2WZ9A 4J57E 1ZZYA 1XXUA 1RW1A 2KHPA 4CHSA 4G0IA 4MLYA 3V1WA 1JLVA 3F3RA 2Z9SA 5A5KA 1GTBA 1K0NA 4ZXGA 5F07A 1F3AA 5DALA 3LYPA 3GH6A 1GTIA 9GSSA 3GRXA 4N10A 2RM6A 5DCHA 3W8SA 2F8FA 5AIXA 4I6XA 3RAZA 3TKQA 1B48A 4IJIA 3N9JA 7GSSA 1QFNA 4KDYA 3HJOA 4K2XA 1AIUA 4LMVA 3GTUB 4NV2A 4FYBA 5KOXA 1TJDA 1G7EA 1UN2A 1JZWA 3KM6A 4XRDA 2TIRA 4XCSA 1XWAA 4E8HA 3F4RA 4Z2UA 2CA8A 18GSA 1X0RA 3L4NA 4NPBA 2GT6A 1K3LA 2LKUA 2FWGA 5GAND 6GSXA 1YDKA 2CV4A 4GRFA 4KCEA 4WETA 4RUVA 1GSDA 3HJMA 4MABA 2PGTA 4ZL9A 1GWCA 2P31A 1KTEA 4OFTA 3IOSA 3F8UA 2R2JA 3K8NA 1J08A 3TOTA 2WRTA 2B1LA 1YKCA 3EPTA 3H1NA 5J9BA 3VWVA 2H1GA 3EYTA 2YZUA 1UVZA 1HQOA 3WT2A 3GV1A 3VURA 1FB6A 1XOAA 3GKMA 1AQWA 2LJKA 2AB6A 1XWBA 5DQYA 2IMEA 5KN3A 1Q4JA 2HZEA 4TR0A 5A4UA 1KNGA 2A4VA 1XCCA 2C80A 1O7UA 5HFKA 4F82A 2G2QA 2R0GA 4Q5RA 4WEYA 2NBSA 4ML1A 2X49A 1QXHA 3HVSA 3RDWA 3ME8A 2DJ3A 3C1SA 4F0CA 1OC8A 1VF2A 4GSSA 1K0BA 3LXZA 2CAQA 5B8AA 2B6MA 2PU9C 1Z6MA 1K0AA 4DEJA 1X9MB 2C1YA 1K0MA 1PN9A 2LJAA 1WRYA 4K5RA 1XPVA 2GDRA 1LJRA 1AAZA 1B9XC 5GAPD 3CTGA 4ACSA 2DMLA 1JZDA 2H1AA 4MNNA 4KUNA 4DSSB 2E7PA 2C3QA 5G30A 1G6YA 2HRNA 2OE1A 4TKYA 1KBNA 4WKWA 2LRTA 3IAM2 4WF5A 6GSWA 2VD0A 3KTLA 1OC9A 1A2MA 2L59A 4HI7A 4JR6A 2DBCA 3M0FA 3QOUA 4FIWA 1XWGA 1GSEA 1XIYA 4HZ4A 1A24A 1Z9HA 3DVXA 3HCZA 4TN8A 5ELGA 4PQHA 1PSQA 2ZNMA 1PMTA 4ECJA 2YWNA 2H0IA 5IOXA 3ZL5A 2YJHA 4Z2RA 3G7YA 2H73A 4HJ2A 4N30A 2VM2A 2C8UA 4OO4A 5ECSA 5EPFA 4Z2TA 4NMUA 2DJKA 3LWAA 4G19A 2X4AA 1M9BA 1SYRA 2OADA 4EC0A 1EGRA 1XWCA 5LNKe 3UBLA 1T00A 3O76A 2VD1A 3DVWA 3GX0A 3DWVA 2IWTA 2R5GA 2FWFA 2L5LA 2MMNA 3ME7A 4KDXA 2AYTA 4TXOA 1Z5YE 6GSTA 4BA7A 4XS1A 3TJKA 1SJ6A 2H70A 3EU4A 3LQ7A 4ECIA 2R0PA 1H4OA 1KEBA 4TR1A 1Z3EA 3L9UA 1TU7A 3VPQA 3FYGA 2OE0A 16GSA 1XOBA 11GSA 2QKEA 4ID0A 5ENUA 2O87A 2C3NA 3EE2A 1GNWA 5ECLB 5HR3A 4KB3A 3HHVA 3E3EA 1Z7RA 2FY6A 2CAIA 3HY2A 2HRAA 4OCFA 4ZBAA 2YPMA 1I5GA 3WGEA 5IM9A 1A8YA 2HSMA 4AJ8A 4IS0A 1BG5A 4KW6A 4OFNA 1WPIA 3PGTA 1NSWA 2NPBA 4BVYB 2MMZA 3KZQA 2IY2A 5ECIB 5E59A 6GSVA 2CZ3A 4GWRA 5AGYA 3TKSE 2PWJA 1S3AA 4OMVA 1OE8A 2L4QA 4GLTA 4HU7A 1FVKA 4RI6A 3NIVA 1ZOFA 4ICYA 3DXBA 3L0HA 3CXGA 2C0GA 2JACA 3PINA 4JRRA 5LD0A 2VCQA 1JLWA 2IIYA 2XC2A 4XRAA 5CRDA 1MDIA 2QA1A 1HNBA 1YZXA 3WGXA 2IJYA 3FY7A 1R5PA 2RM5A 2NVLA 2X8HA 1WE0A 5DJLA 3QCPA 4IELA 1WWJA 2O7KA 3I69A 3UVTA 3QD9A 1U88A 3ERGA 3IAS2 1J9BA 5ECRB 3ED3A 2EIOA 4NV5A 3LSZA 4HQZA 4PQ1A 3C73A 3GX8A 3W6GA 3QAWA 3TRPA 5CRGA 3F6DA 2VAFA 5HR2A 2PMTA 3P8WA 4DSSA 2P0GA 2DSAA 2XPEA 3F6FA 3VK9A 1GL8A 5F0GA 2BMXA 2WB9A 3D22A 3ZLPA 2VM1A 1BAYA 2V6KA 4HOJA 5DDLA 4L5LA 2AV4A 4N11A 1F6MC 3LORA 2DMMA 1XVWA 1AQVA 3ZREA 2H75A 5D93A 4ECCA 1ERWA 4TR4A 3LW9A 5D9XA 5IOWA 3D21A 1FO5A 2BJXA 2YOIA 5GSSA 5J3RA 3G7JA 4MDCA 1A8LA 1WIKA 3FHKA 2VCZA 1R26A 1Y25A 1ZYNA 3F9UA 4O5QA 5EY6A 1GSYA 3HYPA 4ZIJA 4GXZA 3P7XA 4ISDA 4X1UA 3Q19A 3RBTA 1SL0B 4CDOA 4V2NA 2FCHA 1AUCA 4L8EA 3EC3A 2LQOA 4N0ZA 3ZIVA 1GTUA 1WP0A 4K7OA 2XPDA 2KUCA 4ECBA 3CSIA 3UOMA 2HXKA 3ZMKA 3KTBA 4D73B 2HFDA 3KEBA 5JCUA 4EIQA 2MBSA 2MMAA 3GN3A 2H74A 2M72A 3GKNA 2GQKA 3FR6A 2R3XA 2K8SA 2GZZA 2O89A 4FO5A 2YZHA 1O6JA 3FR3A 3Q74A 3A2VA 5DCGA 4N0VA 3FZ9A 3QPMA 2FGXA 2L4CA 5DAKB 1V57A 2G0FA 1N2AA 1XWKA 3TCOA 1SK0A 3EU3A 1HD2A 1NW2A 2DJJA 2HZFA 3N5OA 5IMAA 2ES7A 3TUEA 2R0CA 2X8CA 4TRXA 1OVNA 5IMDA 4G10A 4F9ZA 2HI7A 1HNCA 2QA2A 3CBUA 4K2DA 1NHYA 1TRVA 1NM3A 1UA5A 4KSOA 1GUKA 1ST9A 3G9BA 3MWHA 1IYHA 3LXTA 1VRSD 2F51A 3JCML 2CT6A 4FYCA 2H72A 2B7JA 22GSA 3VWXA 1SKRB 3IK9A 3DEXA 1C72A 2WFCA 2H0HA 5KN2A 4KF9A 5G31A 6GSSA 5B8BA 5ECPB 3C8EA 2DJ1A 1PN0A 14GSA 4O5RA 5ECHB 3BCKA 3IHGA 5DBQA 2I4AA 3H93A 3S9FA 2PERA 4PURA 5HR0A 4JR4A 5JCGA 1QQ2A 2GSQA 5D9WA 4JE1A 2VO4A 4YQVA 2E2MA 4HU9A 2VOCA 3TJJA 3GNJA 1ERVA 1TRUA 3A2WA 1QGVA 4XHMA 4F03A 3DMLA 1EWXA 3F4SA 5D9VA 1V58A 2J23A 1SYXA 1USBA 2IMIA 1SENA 2WDUA 2ZUPA 4MJCA 4GSNA 2LNSA 5KN1A 3GUSA 1SJZA 1ACVA 4HZ2A 4WBRD 4QL7A 4MZBA 2VL2C 5ELAA 2VL2A 1BYEA 5JWQB 1K3YA 2H71A 2OBKA 2OA7A 2YJ7A 4BVXA 5ECKB 1ZMAA 1GUHA 1O73A 2H01A 2P5QA 1HNAA 1TRWA 5BRTA 3Q6OA 2CX4A 4FQUA 1EP8A 2LNTA 1GLPA 2V1MA 3P2AA 2EIQA 5CREA 4ULXA 3H79A 2KOKA 2ALBA 1M99A 5IQYA 2ZCTA 1EV4A 2HE3A 2DJ2A 1K3OA 1X9WB 1AQXA 1M0UA 1YY7A 3TJFA 4A5PA 3F4TA 2MBTA 1TOFA 4K7NA 2CVDA 1LU4A 1T8EB 4K0NA 2CVBA 2LRCA 1JZRA 2O8VB 4YKFA 2B1KA 3APSA 5H5SA 1R5AA 3E0UA 4IJ3A 5H5QA 2GLRA 3FEUA 2FA4A 5GZZB 3ZFLA 4MH2A 3BD2A 1DUGA 3G7IA 3PR8A 3UARA 2C0EA 2C0FA 1ON4A 4ZL7A 1DBYA 1SKSB 1GLQA 2HT9A 3UIWA 1GNEA 3KGKA 4Q5FA 3EURA 3ZZXA 1A0FA 5AISA 2E0QA 5L71A 4D73A 3RHBA 1XFLA 4MP4A 4K1FA 1FG4A 3TGZA 2F9SA 3TKPA 4GQCA 1YQ1A 3GKKA 3ZITA 3GL3A 3FZ4A 1U87A 3QFAC 4MF7A 5FT3A 1EGOA 3IBHA 4L0WA 5DAKA 5A4VA 4I97A 2V41A 2OJLA 4KSMA 5ID2B 1G0TA 4PQIA 2H30A 5CAXA 4DVCA 3ZVJD 3HKRA 2RLIA 3CMIA 1VF4A 1MDJA 2GS3A 3SBCA 1TK8B 3ZRDA 2JADA 4KE3A 4LL4B 1R4WA 1SJIA 4CY6A 4GF0A 3GH9A 1YEXA 5IO0A 5C00A 3RHCA 1THOA 1YKAA 2YP6A 1EEJA 5COHA 1XW9A 5E4WA 2E2GA 3FR9A 2H66A 2IFQB 3MDKA 3C71A 4BL7B 3WGDA 4PGTA 1M9AA 20GSA 2GZPA 1B4QA 3GTUA 1A23A 5EL8A 3MSZA 2CQ9A 4IHUA 4IQAA 5CO3A 4TR3A 3UJ1A 1GRXA 1V98A 2WS2A 2YN1A 3WD6A 2AAWA 2CVKA 2JZTA 5IPHA 3IXRA 3HA9A 5EVOA 4RQRA 3EVIA 4TVEA 1IYIA 2QC7A 4Q5NA 1WMJA 4KGIA 1ERTA 2R4VA 2X64A 2VCTA 3LJRA 3J7Yb 3HD5A 2GVPA 1MTCA 2WULA 3I6AA 4RQXA 1OKTA 5KEJA 5FHIA 3EINA 4I5QA 2ON5A 4L0UA 2IN3A 1F37A 3GIXA 1URMA 4WXTA 1SKWB 1TK5B 3APQA 1WOUA 1SK2A 2LTKA 5D96A 5CNWA 3GSTA 1O81A 5JCWA 3RPNA 1Z6NA 2VCVA 3Q18A 1M7TA 2FWHA 3C7MA 1PKWA 3R3EA 5IMVA 4POKA 1A0RP 1O85A 2K18A 1VF3A 4NXIA 5ECNB 3D5JA 1XBSA 4YH2A 3QMXA 5IO2A 3W8JA 3KP9A 4F0BA 4HEA2 3GURA 1XW5A 3KIJA 3SWLA 3GMFA 2A2PA 3HXSA 5J41A 2V2GA 4J2FA 1E2YA 2OKAA 5B7CA 2AUVA 2GZYA 2HSHA 1T7PB 4IGJA 1TDIA 5INYA 4MH3A 1FVJA 3QR6A 3BJ5A 4EF0A 4I2TA 2N5AA 4LLRA 1B4PA 1T1VA 1X5CA 3IR4A 4AGSA 4K7IA 2HZEB 5GSTA 4IBPA 1PL2A 4F2IA 2HRKA 1SK1A 2F3MA 5ECMB 1M2BA 1ZGNA 4POBA 1OAZA 2JZSA 3LEFA 1GP1A 2R6KA 3FKFA 1PX7A 1SL2B 4ZBDA 1N8JA 1O8XA 3H8QA 1YEPA 2CX3A 5J5NA 2VIMA 17GSA 4TOPA 1K0DA 2IMFA 4Z7XA 4K5SA 5IMZA 2YV9A 1BEDA 5HR1A 4MCUA 1BX9A 1PX6A 4MA9A 1BJXA 4X43A 1OE7A 2H19A 2I1UA 2L6CA 4AF2A 4ZL8A 4YQMA 3D4MA 4LA1A 4V1Ag 1CQGA 4ZILA 1VF1A 3QAVA 4P3YB 2PPTA 2L5OA 1SL1B 3M3MA 4EL1A 3HVVA 3IDVA 3UAPA 4O32A 4AJ7A 1U3AA 4BPYA 5ECQB 4QQ7A 2A4HA 3EMXA 2H0GA 1THXA 1X9SB 3ZVJA 4OD7A 1QUWA 1H75A 3TKSC 5G5EA 1JHBA 3TKSA 2OACA 3LYKA 5KOWA 3KMNA 1LBKA 3I9V2 1TTZA 2DIZA 3HJPA 8GSSA 1VGLA 2H1DA 1MDKA 1FB0A 4KDUA 1F3BA 2JL4A 3ZFBA 3UBKA 3NZNA 1GH2A 1TK0B 4EVMA 5B6MA 1HYUA 4HUAA 2AJQB 4G2EA 4GQFA 3LG6A 3ZYWA 2A2RA 2K6VA 3OR5A 4MF5A 2XBIA 4G9HA 3ZTLA 4Q5QA 2KP1A 3APOA 3M9KA 1B8XA 2PUKC 1G6WA 2IFQA 2FNOA 4BL7A 4IKHA 4YAVA 4TXOB 2JZRA 3DKSA 3GL5A 3M1GA 4MJEA 4MZWA 1X5DA 3VFIA 2B5YA 1O8WA 4G0LA 3DD3A 4EUYA 1GSFA 1PGTA 3PPUA 4IW9A 2H8LA 4JEDA 3F63A 4BVYA 3IC8A 2MMOA 3GYKA 3F0IA 1UC7A 3VWWA 1TP9A 2DC5A 4OFMA 1OC3A 2FWEA 5HFIA 1FAAA 2XHFA 4OWYA 2KP2A 2PVQA 3ERWA 2LQQA 2JSZA 2L6DA 2GGTA 4KNDA 1PL1A 1EEMA 1ZYEA 4OCEA 2C0DA 3IHQA 12GSA 1MEKA 4ZB6A 4WF4A 1M2AA 2JSYA 3PH9A 4L5OA 2X99A 4HDEA 3HDCA 5DVBA 2WGRA 1M2DA 3KXOA 5IMFA 3ISOA 4QL9A 4XTSA 1YF0A 2FLSA 5ECOB 5A4WA 4FYUA 4ZBBA 4ILFA 3VI7A 4KH7A 4PX1A 2OBIA 3L9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2J A;  3QAG A;  4POM A;  2H76 A;  3DRN A;  3CTF A;  4TXV A;  2LST A;  3GA4 A;  2YWI A;  1W89 A;  10GS A;  1XZO A;  5J9C A;  1TI3 A;  2VLV A;  2HLS A;  1WJK A;  1NHO A;  1MD3 A;  5DQS A;  2RUE A;  3GFK A;  2IMD A;  2V6O A;  4TW5 A;  3H4K A;  1T4Y A;  4K9Z A;  2TRC P;  4WBJ A;  2O85 A;  5CYY A;  2YNX A;  4ZB9 A;  1FW1 A;  1GSU A;  1S3D A;  2CZ2 A;  1XVQ A;  1X5E A;  1JZO A;  2RUF A;  4X0X A;  4IVF A;  5G1L A;  1F9M A;  2BTO T;  1ZCP A;  1CQH A;  1B9Y C;  5IIZ A;  1EOH A;  3EMP A;  4O92 A;  5JWR B;  1DE2 A;  3FW2 A;  1GTA A;  3MAK A;  5DJM A;  3GSS A;  1S3C A;  3DGQ A;  1ZL9 A;  2LV3 A;  4XS4 B;  3E9J B;  5G2Z A;  2QSI A;  5CRW A;  1EV9 A;  2B7K A;  1JFU A;  2R37 A;  3QFB C;  3U5R E;  2P5R A;  1AW9 A;  4J56 E;  5JWO B;  3UVH A;  1YF1 A;  4DSQ A;  5G5F A;  4CW9 A;  4MF6 A;  2VL9 A;  4LL1 B;  2M46 A;  1Y6E A;  3KJY A;  1TXX A;  2AHE A;  2I9H A;  5AN1 A;  2VLT A;  2I81 A;  3A2X A;  2J9H A;  4NWY A;  1RQM A;  4H86 A;  3F3Q A;  5C04 A;  3UEM A;  1DE1 A;  2M80 A;  2QGV A;  1GUL A;  3TDG A;  1T4Z A;  2LS5 A;  3US3 A;  2YWO A;  4O7H A;  2H6X A;  1SD9 A;  3CSH A;  4ML6 A;  3WYW A;  4LMW A;  1EP7 A;  3L78 A;  2GST A;  3ERF A;  3NOF A;  5CP1 A;  3MNG A;  3LGC A;  4NHZ A;  4JZQ A;  3FZA A;  2DJ0 A;  3TKR A;  4EO3 A;  1TI1 A;  2GTU A;  2C4J A;  3CRU A;  3KMO A;  2VCW A;  3CSJ A;  3VLN A;  4HJM A;  2V32 A;  4BWQ A;  4ZB8 A;  1PD2 1;  3LFL A;  1K0C A;  1E6B A;  1OYJ A;  3BOA A;  3KH7 A;  2YV7 A;  2K8V A;  2RII A;  2B3S A;  4MPF A;  4GTU A;  4EDZ A;  2GSS A;  4PUF C;  19GS A;  3IRA A;  4YAP A;  1V40 A;  2GT5 A;  1TKD B;  2WJU A;  1Z7P A;  4XS6 A;  1TRS A;  4I8B A;  4NAX A;  4XIH A;  3VWU A;  5J4U A;  4YQU A;  4WR5 A;  1U3I A;  2IPA A;  3RPP A;  3M9J A;  3FRC A;  1R7H A;  1BQ7 A;  4MJB A;  3CYN A;  5AIV A;  3IE3 A;  1XW6 A;  3TJG A;  5D8I A;  4JU5 A;  2MYG A;  4MZC A;  4GST A;  2NDO A;  4OO5 A;  4EKZ A;  4K0G A;  2HYX A;  2ON7 A;  1SD8 A;  2L57 A;  5DAL B;  4MJA A;  3D4T A;  1FOV A;  5F06 A;  3EWL A;  2JU5 A;  2IYJ A;  1EZK A;  1OKD A;  3C1R A;  3ZIJ A;  3WT1 A;  4NHW A;  4POL A;  3A5W A;  3IC4 A;  3ZML A;  1Q98 A;  1ZYQ B;  1ILO A;  4V1A p;  2H6Z A;  2OE3 A;  3R2Q A;  2GQL A;  1EOG A;  2FA8 A;  3IV4 A;  3VPT A;  4RI7 A;  2YAN A;  3KD0 A;  4IN0 A;  2EIR A;  3IPZ A;  2I3Y A;  3I43 A;  4K8M A;  1ABA A;  2XBQ A;  4EDY A;  4GCI A;  4MK3 A;  2NTO A;  1V9W A;  2VLU A;  2FD3 A;  3FK8 A;  1I9D A;  2LRN A;  4IP1 A;  1V2A A;  2H1B A;  2GSR A;  4HQS A;  4WR4 A;  4E8E A;  5FWG A;  5F8B A;  1T3B A;  2YCD A;  3BBY A;  5F05 A;  4MPG A;  2MZC A;  1RK4 A;  5D9T A;  3L9V A;  1ML6 A;  4KA0 A;  5H5R A;  4PUA A;  1J0F A;  2FHE A;  2B5X A;  2X8G A;  3BCI A;  4HS1 A;  4KCA A;  5B6N A;  4XS4 A;  5LCZ A;  3KH9 A;  1TW9 A;  4PNG A;  2C3T A;  3U6V A;  2TRX A;  1YJ6 A;  3HVX A;  6GSY A;  1GSQ A;  3J7Y k;  3VI5 A;  4V2L A;  2VL3 A;  2YWM A;  2HNL A;  5IMC A;  3KP8 A;  3IA1 A;  3KCM A;  3DYR A;  5D73 A;  3GHA A;  1PQN A;  1DSB A;  3A3T A;  2DIY A;  1TU8 A;  3TJB A;  3TRX A;  1PRX A;  4IP6 A;  2HSY A;  2H6Y A;  4KX4 A;  2IMK A;  2B5E A;  2KLX A;  4PXO A;  4I2U A;  2VUP A;  2F8A A;  5ABR A;  4KAE A;  2GQM A;  2LJR A;  3QDN A;  1ERU A;  3D0Z A;  3O3T A;  3TRQ A;  1OC9 B;  3IK7 A;  2N5B A;  1GSS A;  2PBJ A;  3M8N A;  3O6T A;  1AC1 A;  5G1K A;  4DSR A;  5CRH A;  2IL3 A;  5IPG A;  5ID2 A;  3UMA A;  5HFG A;  2FUG 2;  4IQ1 A;  2LEG A;  4K6X A;  2WCI A;  4PNF A;  2K9F A;  1PKZ A;  1PA3 A;  3AY8 A;  1MD4 A;  2D2Z A;  5HQP A;  3HZ4 A;  4EE0 A;  3UL3 A;  1A2L A;  13GS A;  4JBB A;  3CRT A;  1SU9 A;  1W4V A;  3HZ8 A;  3FZ5 A;  2PVO C;  3TOU A;  1F2E A;  2LUS A;  2REM A;  1AXD A;  3DIE A;  3GKX A;  4BWS A;  1FHE A;  2A2S A;  4FH8 A;  2HRF A;  2EC4 A;  2DLX A;  1GUM A;  3P90 A;  1G7O A;  1QK8 A;  5KN0 A;  1K0O A;  1U6T A;  2N5F A;  3D6I A;  4MMM A;  4TR1 B;  4AJ6 A;  2PN8 A;  4V2M A;  6GSU A;  2VCX A;  1QMV A;  4EXJ A;  3TB2 A;  2WZ9 A;  4J57 E;  1ZZY A;  1XXU A;  1RW1 A;  2KHP A;  4CHS A;  4MLY A;  3V1W A;  1JLV A;  3F3R A;  2Z9S A;  5A5K A;  1GTB A;  1K0N A;  4ZXG A;  5F07 A;  1F3A A;  5DAL A;  3LYP A;  3GH6 A;  1GTI A;  9GSS A;  3GRX A;  4N10 A;  2RM6 A;  5DCH A;  3W8S A;  2F8F A;  5AIX A;  4I6X A;  3RAZ A;  3TKQ A;  1B48 A;  4IJI A;  3N9J A;  7GSS A;  1QFN A;  4KDY A;  3HJO A;  1AIU A;  4LMV A;  3GTU B;  4NV2 A;  4FYB A;  1TJD A;  1G7E A;  1UN2 A;  1JZW A;  3KM6 A;  4XRD A;  2TIR A;  4XCS A;  1XWA A;  4E8H A;  3F4R A;  2CA8 A;  18GS A;  1X0R A;  3L4N A;  4NPB A;  2GT6 A;  1K3L A;  2LKU A;  2FWG A;  5GAN D;  6GSX A;  1YDK A;  2CV4 A;  4GRF A;  4KCE A;  4WET A;  4RUV A;  1GSD A;  3HJM A;  4MAB A;  2PGT A;  4ZL9 A;  1GWC A;  2P31 A;  1KTE A;  4OFT A;  3IOS A;  3F8U A;  2R2J A;  3K8N A;  1J08 A;  3TOT A;  2WRT A;  2B1L A;  1YKC A;  3H1N A;  5J9B A;  3VWV A;  2H1G A;  3EYT A;  2YZU A;  1UVZ A;  1HQO A;  3WT2 A;  3GV1 A;  3VUR A;  1FB6 A;  1XOA A;  3GKM A;  1AQW A;  2LJK A;  2AB6 A;  1XWB A;  5DQY A;  2IME A;  5KN3 A;  1Q4J A;  2HZE A;  4TR0 A;  5A4U A;  1KNG A;  2A4V A;  1XCC A;  2C80 A;  1O7U A;  5HFK A;  4F82 A;  2G2Q A;  4Q5R A;  4WEY A;  2NBS A;  4ML1 A;  3HVS A;  1QXH A;  3RDW A;  3ME8 A;  2DJ3 A;  3C1S A;  4F0C A;  1OC8 A;  1VF2 A;  4GSS A;  1K0B A;  3LXZ A;  2CAQ A;  5B8A A;  2B6M A;  2PU9 C;  1Z6M A;  1K0A A;  4DEJ A;  1X9M B;  2C1Y A;  1K0M A;  1PN9 A;  2LJA A;  1WRY A;  1XPV A;  2GDR A;  1LJR A;  1AAZ A;  1B9X C;  5GAP D;  3CTG A;  4ACS A;  2DML A;  1JZD A;  2H1A A;  4KUN A;  4DSS B;  2E7P A;  2C3Q A;  5G30 A;  1G6Y A;  2HRN A;  2OE1 A;  4TKY A;  1KBN A;  4WKW A;  2LRT A;  3IAM 2;  4WF5 A;  6GSW A;  2VD0 A;  3KTL A;  1OC9 A;  1A2M A;  2L59 A;  4HI7 A;  4JR6 A;  2DBC A;  3M0F A;  3QOU A;  4FIW A;  1XWG A;  1GSE A;  1XIY A;  4HZ4 A;  1A24 A;  1Z9H A;  3DVX A;  5ELG A;  3HCZ A;  4TN8 A;  4PQH A;  1PSQ A;  2ZNM A;  1PMT A;  4ECJ A;  2YWN A;  2H0I A;  5IOX A;  3ZL5 A;  2YJH A;  3G7Y A;  2H73 A;  4HJ2 A;  4N30 A;  2VM2 A;  2C8U A;  4OO4 A;  5ECS A;  5EPF A;  4NMU A;  2DJK A;  3LWA A;  4G19 A;  1M9B A;  1SYR A;  2OAD A;  4EC0 A;  1EGR A;  1XWC A;  5LNK e;  3UBL A;  1T00 A;  3O76 A;  2VD1 A;  3DVW A;  3GX0 A;  3DWV A;  2IWT A;  2R5G A;  2FWF A;  2L5L A;  2MMN A;  3ME7 A;  4KDX A;  2AYT A;  4TXO A;  1Z5Y E;  6GST A;  4BA7 A;  4XS1 A;  3TJK A;  1SJ6 A;  2H70 A;  3EU4 A;  3LQ7 A;  4ECI A;  1H4O A;  1KEB A;  4TR1 A;  1Z3E A;  3L9U A;  1TU7 A;  3VPQ A;  3FYG A;  2OE0 A;  16GS A;  1XOB A;  11GS A;  2QKE A;  4ID0 A;  5ENU A;  2O87 A;  2C3N A;  3EE2 A;  1GNW A;  5ECL B;  5HR3 A;  4KB3 A;  3HHV A;  3E3E A;  1Z7R A;  2FY6 A;  2CAI A;  3HY2 A;  4OCF A;  4ZBA A;  2YPM A;  1I5G A;  3WGE A;  5IM9 A;  1A8Y A;  4AJ8 A;  4IS0 A;  1BG5 A;  4KW6 A;  4OFN A;  1WPI A;  3PGT A;  1NSW A;  2NPB A;  2MMZ A;  3KZQ A;  2IY2 A;  5ECI B;  5E59 A;  6GSV A;  2CZ3 A;  4GWR A;  5AGY A;  3TKS E;  2PWJ A;  1S3A A;  4OMV A;  1OE8 A;  2L4Q A;  4GLT A;  4HU7 A;  1FVK A;  4RI6 A;  3NIV A;  1ZOF A;  3DXB A;  3L0H A;  3CXG A;  2C0G A;  2JAC A;  3PIN A;  4JRR A;  5LD0 A;  2VCQ A;  1JLW A;  2IIY A;  2XC2 A;  4XRA A;  5CRD A;  1MDI A;  1HNB A;  1YZX A;  3WGX A;  2IJY A;  3FY7 A;  1R5P A;  2RM5 A;  2NVL A;  2X8H A;  1WE0 A;  5DJL A;  3QCP A;  4IEL A;  1WWJ A;  2O7K A;  3I69 A;  3UVT A;  3QD9 A;  1U88 A;  3ERG A;  3IAS 2;  1J9B A;  5ECR B;  3ED3 A;  2EIO A;  4NV5 A;  3LSZ A;  4HQZ A;  4PQ1 A;  3C73 A;  3GX8 A;  3W6G A;  3QAW A;  3TRP A;  5CRG A;  3F6D A;  2VAF A;  5HR2 A;  2PMT A;  3P8W A;  4DSS A;  2P0G A;  2DSA A;  2XPE A;  3F6F A;  3VK9 A;  1GL8 A;  5F0G A;  2BMX A;  2WB9 A;  3D22 A;  3ZLP A;  2VM1 A;  1BAY A;  2V6K A;  4HOJ A;  5DDL A;  4L5L A;  2AV4 A;  4N11 A;  1F6M C;  3LOR A;  2DMM A;  1XVW A;  1AQV A;  3ZRE A;  2H75 A;  5D93 A;  4ECC A;  1ERW A;  4TR4 A;  5D9X A;  5IOW A;  3D21 A;  1FO5 A;  2BJX A;  2YOI A;  5GSS A;  5J3R A;  3G7J A;  4MDC A;  1A8L A;  1WIK A;  3FHK A;  2VCZ A;  1R26 A;  1Y25 A;  3F9U A;  5EY6 A;  1GSY A;  3HYP A;  4ZIJ A;  4GXZ A;  3P7X A;  4ISD A;  4X1U A;  3Q19 A;  3RBT A;  1SL0 B;  4CDO A;  4V2N A;  2FCH A;  1AUC A;  4L8E A;  3EC3 A;  2LQO A;  4N0Z A;  3ZIV A;  1GTU A;  1WP0 A;  4K7O A;  2XPD A;  2KUC A;  4ECB A;  3CSI A;  3UOM A;  2HXK A;  3ZMK A;  3KTB A;  4D73 B;  2HFD A;  3KEB A;  5JCU A;  2MBS A;  2MMA A;  3GN3 A;  2H74 A;  2M72 A;  3GKN A;  2GQK A;  3FR6 A;  2R3X A;  2K8S A;  2GZZ A;  2O89 A;  4FO5 A;  2YZH A;  1O6J A;  3FR3 A;  3Q74 A;  3A2V A;  5DCG A;  4N0V A;  3FZ9 A;  3QPM A;  2FGX A;  2L4C A;  5DAK B;  1V57 A;  2G0F A;  1N2A A;  1XWK A;  3TCO A;  1SK0 A;  3EU3 A;  1HD2 A;  1NW2 A;  2DJJ A;  2HZF A;  3N5O A;  5IMA A;  2ES7 A;  3TUE A;  2X8C A;  4TRX A;  1OVN A;  5IMD A;  4G10 A;  4F9Z A;  2HI7 A;  1HNC A;  3CBU A;  4K2D A;  1NHY A;  1TRV A;  1NM3 A;  1UA5 A;  4KSO A;  1GUK A;  1ST9 A;  3G9B A;  3MWH A;  1IYH A;  3LXT A;  1VRS D;  2F51 A;  3JCM L;  2CT6 A;  4FYC A;  2H72 A;  2B7J A;  22GS A;  3VWX A;  1SKR B;  3IK9 A;  3DEX A;  1C72 A;  2WFC A;  2H0H A;  5KN2 A;  5G31 A;  6GSS A;  5B8B A;  5ECP B;  3C8E A;  2DJ1 A;  14GS A;  4O5R A;  5ECH B;  3BCK A;  5DBQ A;  2I4A A;  3H93 A;  3S9F A;  2PER A;  4PUR A;  5HR0 A;  4JR4 A;  5JCG A;  1QQ2 A;  2GSQ A;  5D9W A;  4JE1 A;  2VO4 A;  4YQV A;  2E2M A;  4HU9 A;  2VOC A;  3TJJ A;  3GNJ A;  1ERV A;  1TRU A;  3A2W A;  1QGV A;  4XHM A;  4F03 A;  3DML A;  1EWX A;  3F4S A;  5D9V A;  1V58 A;  2J23 A;  1SYX A;  1USB A;  2IMI A;  1SEN A;  2WDU A;  2ZUP A;  4MJC A;  4GSN A;  2LNS A;  5KN1 A;  3GUS A;  1SJZ A;  1ACV A;  4HZ2 A;  4WBR D;  4QL7 A;  4MZB A;  2VL2 C;  5ELA A;  2VL2 A;  1BYE A;  5JWQ B;  1K3Y A;  2H71 A;  2OBK A;  2OA7 A;  2YJ7 A;  4BVX A;  5ECK B;  1ZMA A;  1GUH A;  1O73 A;  2H01 A;  2P5Q A;  1HNA A;  1TRW A;  3Q6O A;  2CX4 A;  1EP8 A;  2LNT A;  1GLP A;  2V1M A;  3P2A A;  2EIQ A;  5CRE A;  4ULX A;  3H79 A;  2KOK A;  2ALB A;  1M99 A;  5IQY A;  2ZCT A;  1EV4 A;  2HE3 A;  2DJ2 A;  1K3O A;  1X9W B;  1AQX A;  1M0U A;  1YY7 A;  3TJF A;  3F4T A;  2MBT A;  1TOF A;  4K7N A;  2CVD A;  1LU4 A;  1T8E B;  4K0N A;  2CVB A;  2LRC A;  1JZR A;  2O8V B;  2B1K A;  3APS A;  5H5S A;  1R5A A;  3E0U A;  4IJ3 A;  5H5Q A;  2GLR A;  3FEU A;  2FA4 A;  5GZZ B;  3ZFL A;  4MH2 A;  3BD2 A;  1DUG A;  3G7I A;  3PR8 A;  3UAR A;  2C0E A;  2C0F A;  1ON4 A;  4ZL7 A;  1DBY A;  1SKS B;  1GLQ A;  2HT9 A;  3UIW A;  1GNE A;  3KGK A;  4Q5F A;  3EUR A;  3ZZX A;  1A0F A;  5AIS A;  2E0Q A;  5L71 A;  4D73 A;  3RHB A;  1XFL A;  4MP4 A;  4K1F A;  1FG4 A;  3TGZ A;  2F9S A;  3TKP A;  4GQC A;  1YQ1 A;  3GKK A;  3ZIT A;  3GL3 A;  3FZ4 A;  1U87 A;  3QFA C;  4MF7 A;  5FT3 A;  1EGO A;  3IBH A;  4L0W A;  5DAK A;  5A4V A;  4I97 A;  2V41 A;  2OJL A;  4KSM A;  5ID2 B;  1G0T A;  4PQI A;  2H30 A;  5CAX A;  4DVC A;  3ZVJ D;  3HKR A;  2RLI A;  3CMI A;  1VF4 A;  1MDJ A;  2GS3 A;  3SBC A;  1TK8 B;  3ZRD A;  2JAD A;  4KE3 A;  4LL4 B;  1R4W A;  1SJI A;  4GF0 A;  3GH9 A;  1YEX A;  5IO0 A;  5C00 A;  3RHC A;  1THO A;  1YKA A;  2YP6 A;  1EEJ A;  5COH A;  1XW9 A;  5E4W A;  2E2G A;  3FR9 A;  2H66 A;  2IFQ B;  3MDK A;  3C71 A;  3WGD A;  4PGT A;  1M9A A;  20GS A;  2GZP A;  1B4Q A;  3GTU A;  1A23 A;  5EL8 A;  3MSZ A;  2CQ9 A;  4IHU A;  4IQA A;  5CO3 A;  4TR3 A;  3UJ1 A;  1GRX A;  1V98 A;  2WS2 A;  2YN1 A;  3WD6 A;  2AAW A;  2CVK A;  2JZT A;  5IPH A;  3IXR A;  3HA9 A;  5EVO A;  4RQR A;  3EVI A;  4TVE A;  1IYI A;  2QC7 A;  4Q5N A;  1WMJ A;  4KGI A;  1ERT A;  2R4V A;  2X64 A;  2VCT A;  3LJR A;  3J7Y b;  3HD5 A;  2GVP A;  1MTC A;  2WUL A;  3I6A A;  4RQX A;  1OKT A;  5KEJ A;  5FHI A;  3EIN A;  4I5Q A;  2ON5 A;  4L0U A;  2IN3 A;  1F37 A;  3GIX A;  1URM A;  4WXT A;  1SKW B;  1TK5 B;  3APQ A;  1WOU A;  1SK2 A;  2LTK A;  5D96 A;  5CNW A;  3GST A;  1O81 A;  5JCW A;  3RPN A;  1Z6N A;  2VCV A;  3Q18 A;  1M7T A;  2FWH A;  3C7M A;  1PKW A;  5IMV A;  4POK A;  1A0R P;  1O85 A;  2K18 A;  1VF3 A;  4NXI A;  5ECN B;  3D5J A;  1XBS A;  4YH2 A;  3QMX A;  5IO2 A;  3W8J A;  3KP9 A;  4F0B A;  4HEA 2;  3GUR A;  1XW5 A;  3KIJ A;  3SWL A;  3GMF A;  3HXS A;  5J41 A;  2V2G A;  4J2F A;  1E2Y A;  2OKA A;  5B7C A;  2AUV A;  2GZY A;  2HSH A;  1T7P B;  4IGJ A;  1TDI A;  5INY A;  4MH3 A;  1FVJ A;  3QR6 A;  3BJ5 A;  4EF0 A;  4I2T A;  2N5A A;  4LLR A;  1B4P A;  1T1V A;  1X5C A;  3IR4 A;  4AGS A;  4K7I A;  2HZE B;  5GST A;  4IBP A;  1PL2 A;  4F2I A;  1SK1 A;  2F3M A;  5ECM B;  1M2B A;  1ZGN A;  4POB A;  1OAZ A;  2JZS A;  3LEF A;  1GP1 A;  2R6K A;  3FKF A;  1PX7 A;  1SL2 B;  4ZBD A;  1N8J A;  1O8X A;  3H8Q A;  1YEP A;  2CX3 A;  5J5N A;  2VIM A;  17GS A;  4TOP A;  1K0D A;  2IMF A;  4Z7X A;  5IMZ A;  2YV9 A;  1BED A;  5HR1 A;  4MCU A;  1BX9 A;  1PX6 A;  4MA9 A;  1BJX A;  4X43 A;  1OE7 A;  2H19 A;  2I1U A;  2L6C A;  4AF2 A;  4ZL8 A;  4YQM A;  3D4M A;  4LA1 A;  4V1A g;  1CQG A;  4ZIL A;  1VF1 A;  3QAV A;  4P3Y B;  2PPT A;  2L5O A;  1SL1 B;  3M3M A;  4EL1 A;  3HVV A;  3IDV A;  3UAP A;  4O32 A;  4AJ7 A;  1U3A A;  4BPY A;  5ECQ B;  4QQ7 A;  3EMX A;  2H0G A;  1THX A;  1X9S B;  3ZVJ A;  4OD7 A;  1QUW A;  1H75 A;  3TKS C;  5G5E A;  1JHB A;  3TKS A;  2OAC A;  3LYK A;  3KMN A;  1LBK A;  3I9V 2;  1TTZ A;  2DIZ A;  3HJP A;  8GSS A;  1VGL A;  2H1D A;  1MDK A;  1FB0 A;  4KDU A;  1F3B A;  2JL4 A;  3ZFB A;  3UBK A;  3NZN A;  1GH2 A;  1TK0 B;  4EVM A;  5B6M A;  1HYU A;  4HUA A;  2AJQ B;  4G2E A;  4GQF A;  3LG6 A;  3ZYW A;  2A2R A;  2K6V A;  3OR5 A;  4MF5 A;  2XBI A;  4G9H A;  3ZTL A;  4Q5Q A;  2KP1 A;  3APO A;  3M9K A;  1B8X A;  2PUK C;  1G6W A;  2IFQ A;  2FNO A;  4BL7 A;  4IKH A;  4YAV A;  4TXO B;  2JZR A;  3DKS A;  3GL5 A;  3M1G A;  4MJE A;  4MZW A;  1X5D A;  3VFI A;  2B5Y A;  1O8W A;  3DD3 A;  4EUY A;  1GSF A;  1PGT A;  4IW9 A;  2H8L A;  4JED A;  3F63 A;  4BVY A;  2MMO A;  3GYK A;  3F0I A;  1UC7 A;  3VWW A;  1TP9 A;  2DC5 A;  4OFM A;  1OC3 A;  2FWE A;  5HFI A;  1FAA A;  2XHF A;  4OWY A;  2KP2 A;  2PVQ A;  3ERW A;  2LQQ A;  2JSZ A;  2L6D A;  2GGT A;  4KND A;  1PL1 A;  1EEM A;  1ZYE A;  4OCE A;  2C0D A;  3IHQ A;  12GS A;  1MEK A;  4ZB6 A;  4WF4 A;  1M2A A;  2JSY A;  3PH9 A;  4L5O A;  2X99 A;  4HDE A;  3HDC A;  5DVB A;  2WGR A;  1M2D A;  3KXO A;  5IMF A;  3ISO A;  4QL9 A;  4XTS A;  1YF0 A;  2FLS A;  5ECO B;  5A4W A;  4FYU A;  4ZBB A;  4ILF A;  3VI7 A;  4KH7 A;  4PX1 A;  2OBI A;  3L9S A; 
#chains in the Genus database with same CATH topology
 3MG2 A;  4X2H A;  4YKG A;  2K3D A;  2KF5 A;  3F8H A;  1A2J A;  3G6E 3;  3QAG A;  4POM A;  2H76 A;  3BNC A;  3DRN A;  1IVW A;  4U13 A;  3CTF A;  4MEI A;  3NM2 A;  4TXV A;  2LST A;  3N54 B;  3GA4 A;  1US1 A;  2YWI A;  1W89 A;  5I97 A;  1XZO A;  10GS A;  5J9C A;  1TI3 A;  3UL6 A;  3KE7 A;  3NQZ A;  2J8X B;  2VLV A;  2XEP A;  1N8R 4;  2HLS A;  4DKI A;  1MWU A;  1WJK A;  1NHO A;  1MD3 A;  5DQS A;  2RUE A;  1GOV A;  1BNE A;  3GFK A;  1GD3 A;  2IMD A;  1U8C B;  4EYC A;  1CQS A;  2V6O A;  1QAF A;  4TW5 A;  3DH2 A;  3H4K A;  1T4Y A;  4K9Z A;  2TRC P;  1S5A A;  1Z1S A;  4WBJ A;  2O85 A;  4WWU C;  5CYY A;  2YNX A;  4ZB9 A;  1FW1 A;  1GSU A;  1S3D A;  2CG1 A;  2CZ2 A;  3VGN A;  5KP3 A;  4USS A;  1XVQ A;  1X5E A;  1JZO A;  1ASK A;  2RUF A;  4X0X A;  2LYX A;  3HZP A;  4IVF A;  3DGY A;  5G1L A;  1F9M A;  2BTO T;  1L5G B;  1ZCP A;  1CQH A;  3G0K A;  5EVH A;  1MGW A;  1B9Y C;  5IIZ A;  4OVM A;  4FCM A;  1EOH A;  3EMP A;  1RN1 A;  4O92 A;  1R4Y A;  5JWR B;  1GYB A;  1DE2 A;  2IMJ A;  3FW2 A;  1ZX2 A;  1O7H B;  4LMI A;  1GTA A;  1K41 A;  3MAK A;  5DJM A;  3GSS A;  3X3Z A;  4HZ9 B;  1S3C A;  3ALA A;  3DGQ A;  1ZL9 A;  2LV3 A;  3D9R A;  4XS4 B;  3E9J B;  5G2Z A;  2QSI A;  5CRW A;  1UCI A;  1EV9 A;  2B7K A;  1JFU A;  3J7Y d;  2R37 A;  3QFB C;  1RDS A;  3U5R E;  2P5R A;  1AW9 A;  4J56 E;  5JWO B;  3KN4 A;  3UVH A;  1YF1 A;  4DSQ A;  3OXA A;  5G5F A;  1WMP A;  1VQ8 3;  1HKX A;  4CW9 A;  1D6Z A;  2W03 A;  4MF6 A;  2VL9 A;  1OH0 A;  4LL1 B;  1JNQ A;  2UZ8 A;  2M46 A;  3CPO A;  1IVU A;  1Y6E A;  3KJY A;  1TXX A;  2AHE A;  2I9H A;  3ER7 A;  5AN1 A;  3SXX A;  2VLT A;  2R4I A;  2I81 A;  3A2X A;  5AYR B;  2J9H A;  4NWY A;  4XDV A;  1RQM A;  6STD A;  4H86 A;  3F3Q A;  1QAK A;  2CW9 A;  1LNI A;  1JB5 A;  5C04 A;  3GZX B;  1VQQ A;  4KVH A;  3UEM A;  4WYK A;  1DE1 A;  2M80 A;  2QGV A;  1GUL A;  1TIJ A;  3TDG A;  2GXF A;  1T4Z A;  2LS5 A;  3US3 A;  1ZS7 A;  2Z7A A;  1YVB I;  3CCQ 3;  2YWO A;  4O7H A;  2H6X A;  1SD9 A;  3CSH A;  1ISK A;  4ML6 A;  2RFR A;  4LMW A;  3WYW A;  1EP7 A;  3L78 A;  4EBG A;  2GST A;  3ERF A;  5BMU A;  3NOF A;  5CP1 A;  3MNG A;  2HMO B;  3LGC A;  2ZL8 A;  4NHZ A;  3JVC A;  3S27 A;  3SYU A;  4JZQ A;  4N6U A;  3FZA A;  2DJ0 A;  1JB2 A;  3B4O A;  3TKR A;  4N3V A;  3RNT A;  4EO3 A;  1TI1 A;  5IG5 A;  2GTU A;  2C4J A;  3NX0 A;  3CRU A;  3KMO A;  1ZO2 A;  4O5U A;  2VCW A;  3DXO A;  3CSJ A;  3PZW A;  3VLN A;  2CFK A;  2IA7 A;  3NQY A;  4HJM A;  2V32 A;  4BWQ A;  1I70 A;  4ZB8 A;  1I3F A;  1QVF 2;  1PD2 1;  3LFL A;  1K0C A;  1E6B A;  3D3L A;  1OYJ A;  3N8B A;  3BOA A;  4X4J A;  3NV0 A;  2DKI A;  3G71 3;  3KH7 A;  3HII A;  1RKY A;  2YV7 A;  2K8V A;  3GAX A;  2B3S A;  2RII A;  4PTS A;  4MPF A;  4GTU A;  4EDZ A;  2GSS A;  4PUF C;  19GS A;  3F9S A;  3IRA A;  4YAP A;  4WFO A;  3Q90 A;  4N6L A;  1V40 A;  2GT5 A;  5AII A;  1TKD B;  2WJU A;  1Z7P A;  3FSD A;  4LZI A;  4XS6 A;  3A5I A;  1TRS A;  4I8B A;  1MGR A;  1UGH I;  4NAX A;  1JKG B;  4XIH A;  3VWU A;  4XDW A;  5CF1 A;  5J4U A;  4YQU A;  4WR5 A;  1U3I A;  2IPA A;  1IVV A;  3RPP A;  3M9J A;  3FRC A;  1R7H A;  3FG3 A;  1E97 A;  1EUI C;  1BQ7 A;  4MJB A;  3CYN A;  5AIV A;  3IE3 A;  1XW6 A;  1WMO A;  5BU4 A;  3TJG A;  5D8I A;  1SAR A;  4JU5 A;  2MYG A;  1IYY A;  4MZC A;  4BTX A;  3F7S A;  4GST A;  2NDO A;  4OO5 A;  4X2O A;  4EKZ A;  3URP A;  4K0G A;  2HYX A;  3HOH A;  2D42 A;  2ON7 A;  3SLU A;  1ZYP A;  2OOV C;  1SD8 A;  2L57 A;  5DAL B;  2OOV A;  4MJA A;  3T8N A;  4O2H A;  3D4T A;  1FOH A;  4XB5 A;  1VQ4 3;  3NXJ A;  4EV5 A;  1FOV A;  5F06 A;  3EWL A;  2JU5 A;  3D79 A;  2IYJ A;  1W6Y A;  1EZK A;  1OKD A;  2XR8 B;  3C1R A;  3ZIJ A;  1G02 A;  3G8Z A;  5AIG A;  3WT1 A;  3HVN A;  4NHW A;  1GS3 A;  5BXQ A;  3LH4 A;  4POL A;  3A5W A;  3IC4 A;  1DMM A;  3ZML A;  3DGO A;  1Q98 A;  4BTW A;  1ZYQ B;  3OWS A;  1ILO A;  4V1A p;  4HKV B;  3AHW A;  2H6Z A;  2OE3 A;  3R2Q A;  1U5O A;  2GEY A;  2M7O A;  1BNR A;  4N6M A;  2GQL A;  1B3S A;  3MIX A;  4HM5 B;  1VZZ A;  1EOG A;  4J9A A;  2FA8 A;  2LQV A;  3STD A;  3IV4 A;  3VPT A;  4CCV A;  4RI7 A;  2YAN A;  2PZV A;  3KD0 A;  4IN0 A;  2BHM A;  3OW2 2;  1UGI A;  3FCS B;  2EIR A;  3IPZ A;  2I3Y A;  3I43 A;  4K8M A;  1ABA A;  3K5T A;  2XBQ A;  4CY8 A;  4EDY A;  4GCI A;  3CQF A;  4MK3 A;  2NTO A;  1V9W A;  4G0K A;  2VLU A;  2FD3 A;  4L8O A;  3FK8 A;  1I9D A;  2LRN A;  4IP1 A;  1QMA A;  3EQQ B;  1V2A A;  2H1B A;  2XF3 A;  1VQ7 3;  4EIP A;  2GSR A;  3WA2 X;  4HQS A;  4WR4 A;  4E8E A;  1Q40 B;  1UI8 A;  1W01 A;  5FWG A;  5F8B A;  1T3B A;  2YCD A;  3BBY A;  1BRJ A;  5F05 A;  4MPG A;  3DUK A;  1NB5 I;  2MZC A;  1RK4 A;  1M90 4;  5D9T A;  3L9V A;  1ML6 A;  3EBT A;  4KFF A;  2IUJ A;  4KA0 A;  5H5R A;  4PUA A;  1J0F A;  5AI1 A;  2FHE A;  1RCK A;  2B5X A;  2X8G A;  3BCI A;  4HS1 A;  4KCA A;  4L7K A;  2CFL A;  5AIF A;  1M3J A;  5B6N A;  4XS4 A;  1VQ9 3;  5LCZ A;  3KH9 A;  1TUH A;  2F5M A;  1TW9 A;  1RLS A;  2JQ5 A;  2C3T A;  4PNG A;  1LXE A;  3U6V A;  3KFQ C;  5ELJ A;  2TRX A;  1YJ6 A;  3HVX A;  4K1U A;  1RN4 A;  4BVX B;  6GSY A;  1GSQ A;  1GOU A;  3J7Y k;  3X3X A;  3FMW A;  3VI5 A;  3CCM 3;  5AYS C;  4V2L A;  2VL3 A;  2YWM A;  2HNL A;  5IMC A;  3KP8 A;  1TRQ A;  5IG0 A;  3IA1 A;  3KCM A;  3DYR A;  5D73 A;  4MJD A;  3GHA A;  1N8Q A;  1PQN A;  4HM0 B;  1DSB A;  3A3T A;  5IG3 A;  2C11 A;  2DIY A;  1TU8 A;  3X41 A;  3TJB A;  2O9U X;  3TRX A;  1PRX A;  4IP6 A;  2HSY A;  3IPT A;  3JUN A;  2H6Y A;  4KX4 A;  2RSX A;  2IMK A;  2B1X B;  2B5E A;  7STD A;  2DKH A;  2KLX A;  4PXO A;  5IER A;  1IT7 A;  1D6Y A;  4I2U A;  2VUP A;  2F8A A;  5ABR A;  4KAE A;  2GQM A;  2LJR A;  3QDN A;  1ERU A;  4L8P A;  3D0Z A;  3O3T A;  3TRQ A;  1OC9 B;  1BNF A;  1HZ1 A;  5EQL A;  3IK7 A;  2N5B A;  1GSS A;  2PBJ A;  4KT3 B;  3M8N A;  3O6T A;  2OWP A;  1CH0 A;  3X3Y A;  1AC1 A;  2BIR A;  5G1K A;  4DSR A;  2HML B;  5CRH A;  2IL3 A;  5IPG A;  5ID2 A;  3UMA A;  1JJ2 2;  5HFG A;  2FUG 2;  4IQ1 A;  3A5E A;  4AKZ A;  2LEG A;  4K6X A;  2WCI A;  4K61 A;  4PNF A;  2CWV A;  2K9F A;  6RNT A;  1PKZ A;  1MWT A;  1PA3 A;  3AY8 A;  1MD4 A;  4HM4 B;  2D2Z A;  5HQP A;  2K0M A;  2KF4 A;  3HZ4 A;  1X1W A;  4EE0 A;  3UL3 A;  3B7C A;  1A2L A;  2UGI A;  13GS A;  4JBB A;  3CRT A;  1SU9 A;  1W4V A;  1RGK A;  3EC9 A;  3HZ8 A;  3FZ5 A;  1I2E A;  2PVO C;  4LYL B;  3TOU A;  1F2E A;  1YJ9 3;  2LUS A;  1TTO A;  2REM A;  4XBT A;  1AXD A;  1X1X A;  3DIE A;  3GKX A;  4BWS A;  1FHE A;  3K63 A;  2A2S A;  3NBJ A;  4R80 A;  1JV2 B;  3CCS 3;  1OF5 B;  2V1L A;  4FH8 A;  2HRF A;  1IQX A;  2OQE A;  2EC4 A;  2DLX A;  1GUM A;  3P90 A;  2B24 B;  1G7O A;  2BU4 A;  2W56 A;  3E99 A;  3MYD A;  1B2S A;  4EV2 A;  1N9J A;  1QK8 A;  5KN0 A;  1K0O A;  1U6T A;  2N5F A;  3D6I A;  4MMM A;  4TR1 B;  4AJ6 A;  2PN8 A;  4V2M A;  6GSU A;  1BIR A;  2Y74 A;  3MWZ A;  1QMV A;  2VCX A;  4EXJ A;  3TB2 A;  2WZ9 A;  4J57 E;  1ZZY A;  3EJV A;  1XXU A;  2W9Q A;  1RW1 A;  1X1Y A;  4CPK A;  2KHP A;  4CHS A;  5JPP A;  1UUV B;  4G0I A;  4MLY A;  2W0Q A;  3V1W A;  1JLV A;  3F3R A;  2Z9S A;  3ZG5 A;  5A5K A;  1DET A;  2HMJ B;  1GTB A;  2GSP A;  1K0N A;  1S3R A;  4ZXG A;  1VQN 3;  5F07 A;  1F3A A;  1ULI B;  5DAL A;  3LYP A;  1RGE A;  4HVN A;  3GH6 A;  3HK4 A;  1GTI A;  9GSS A;  1RGC A;  3GRX A;  4N10 A;  1J2B A;  1QVG 2;  2RM6 A;  1MWR A;  1PYL A;  5DCH A;  1FGM A;  3W8S A;  1OHP A;  1RNT A;  2F8F A;  2F56 A;  5AIX A;  4I6X A;  3RAZ A;  3TKQ A;  1B48 A;  4IJI A;  2SBL A;  3N9J A;  3S5C A;  7GSS A;  1QFN A;  5AIH A;  4KFD A;  4R9L A;  4KDY A;  1O7N B;  3EN1 B;  3HJO A;  4K2X A;  1AIU A;  4LMV A;  3S28 A;  1GMR A;  3GTU B;  4NV2 A;  3WDG B;  1I2G A;  4FYB A;  5KOX A;  1TJD A;  1G7E A;  1UN2 A;  1JB4 A;  1JZW A;  3KM6 A;  4XRD A;  2TIR A;  4XCS A;  1XWA A;  4E8H A;  3F4R A;  2JDI H;  4Z2U A;  4CJN A;  1EA2 A;  3CXC 2;  2CA8 A;  18GS A;  1X0R A;  3L4N A;  4NPB A;  4ORL A;  1PFO A;  2GT6 A;  1K3L A;  2RCD A;  2LKU A;  5KP4 A;  3O8Y A;  2FWG A;  5GAN D;  6GSX A;  1Q82 4;  1UCK A;  1YDK A;  2CV4 A;  4WP5 A;  4GRF A;  4KCE A;  4WET A;  4RUV A;  3ZFZ A;  1GSD A;  3HJM A;  1A90 A;  2PGT A;  4MAB A;  4ZL9 A;  3KSE D;  2BMR B;  1GWC A;  2OCT A;  2P31 A;  5RNT A;  1KTE A;  1DE3 A;  4OFT A;  1T2H A;  3IOS A;  3F8U A;  1B20 A;  2R2J A;  2FNQ A;  3K8N A;  2HMM B;  1J08 A;  3TOT A;  2WRT A;  1HYF A;  2B1L A;  1YKC A;  3HI7 A;  3EPT A;  3DY5 A;  3MG1 A;  3H1N A;  1LQG C;  5J9B A;  3VWV A;  2H1G A;  3EYT A;  2YZU A;  1UVZ A;  1CYU A;  1HQO A;  3WT2 A;  3GV1 A;  3VUR A;  1FB6 A;  1XOA A;  3G16 A;  1DVC A;  3GKM A;  1S72 3;  3SVA A;  1AQW A;  2LJK A;  2AB6 A;  3CPW 2;  1XWB A;  4AEQ A;  5DQY A;  1YIJ 3;  2IME A;  5KN3 A;  1Q4J A;  2HZE A;  1FYS A;  4TR0 A;  5A4U A;  1W2B 2;  1KNG A;  2A4V A;  3GSP A;  3CC2 3;  1XCC A;  2C80 A;  2GU3 A;  1VQ5 3;  1O7U A;  2F98 A;  5HFK A;  4F82 A;  2G2Q A;  3F8X A;  3WR2 A;  2R0G A;  4Q5R A;  3H3H A;  4WEY A;  3L0R A;  2NBS A;  4ML1 A;  7GSP A;  1QXH A;  2X49 A;  3HVS A;  3RDW A;  3ME8 A;  2DJ3 A;  3C1S A;  4F0C A;  1OC8 A;  1VF2 A;  1I2F A;  1FUT A;  5FW5 A;  4GSS A;  1K0B A;  3LXZ A;  3T8U A;  3AMO B;  3IMA B;  2CAQ A;  4H3U A;  5B8A A;  4FMA A;  2B6M A;  2PU9 C;  1Z6M A;  1K0A A;  3VF1 A;  3UL5 A;  4DEJ A;  4HOH A;  1BRH A;  1X9M B;  2C1Y A;  1K0M A;  1PN9 A;  2LJA A;  1WRY A;  3F7X A;  4K5R A;  1XPV A;  2GDR A;  3T0U A;  1LJR A;  1AAZ A;  1B9X C;  5GAP D;  3CTG A;  4ACS A;  2DML A;  1JZD A;  3Q2P A;  2H1A A;  4MNN A;  4KUN A;  3H51 A;  4DSS B;  2E7P A;  2C3Q A;  5G30 A;  1G6Y A;  1E3R A;  2HRN A;  2OE1 A;  4NHF A;  4TKY A;  1KBN A;  1CYV A;  2MC8 A;  4WKW A;  1ROA A;  1K8A 4;  5LC7 A;  3B4P A;  1B27 A;  2LRT A;  3IAM 2;  3JUQ A;  3JUP A;  2XGL A;  2W6J H;  2BMQ B;  3F14 A;  4WF5 A;  6GSW A;  2VD0 A;  3V98 A;  1OC9 A;  3KTL A;  1A2M A;  2L59 A;  4HI7 A;  4JR6 A;  3V92 A;  2DBC A;  3M0F A;  1TFO A;  3QOU A;  1MNL A;  4FIW A;  1XWG A;  1GSE A;  1XIY A;  4HZ4 A;  1A24 A;  1Z9H A;  2OTL 3;  2QGU A;  1M1X B;  2CFW A;  3DVX A;  3HCZ A;  4TN8 A;  5ELG A;  4PQH A;  1PSQ A;  1I0X A;  2ZHX B;  2ZNM A;  1VQP 3;  1W00 A;  8CHO A;  1LOX A;  1PMT A;  5IG4 A;  4ECJ A;  2P09 A;  1DYU A;  2YWN A;  2H0I A;  2CX0 A;  5IOX A;  4MMY B;  3ZL5 A;  1OHO A;  2YJH A;  4Z2R A;  3G7Y A;  2H73 A;  4HJ2 A;  4N30 A;  3FF2 A;  3LXU X;  2VM2 A;  2C8U A;  4OO4 A;  5STD A;  1GMP A;  5ECS A;  5EPF A;  4Z2T A;  4NMU A;  2XH9 A;  2DJK A;  3LWA A;  4G19 A;  4AKY A;  2X4A A;  1M9B A;  3BU4 A;  1SYR A;  1Q86 4;  2OAD A;  4NRE A;  5DRV A;  4EC0 A;  1EGR A;  1XWC A;  5LNK e;  2K54 A;  4JF8 A;  1Q7Y 4;  5EEO A;  1YVS A;  1T00 A;  3O76 A;  3UBL A;  2CKF B;  2VD1 A;  3DVW A;  3GX0 A;  3DWV A;  1FUS A;  5DRE A;  1ULJ B;  3X40 A;  2IWT A;  1YIT 3;  2R5G A;  2FWF A;  2L5L A;  2MMN A;  3ME7 A;  3ECF A;  5G2G A;  4KDX A;  2AYT A;  1I8V A;  3KCH A;  4TXO A;  1Z5Y E;  4MMZ B;  6GST A;  4BA7 A;  4IT7 A;  4XS1 A;  3CNM A;  3WA3 A;  3TJK A;  1SJ6 A;  2H70 A;  3EU4 A;  1W2Z A;  3LQ7 A;  3LYG A;  1LQM B;  3LT9 A;  4ECI A;  2R0P A;  1H4O A;  1KEB A;  4TR1 A;  1Z3E A;  1JBR A;  3L9U A;  3MKI A;  1TU7 A;  3VPQ A;  3FYG A;  2OE0 A;  3WOD G;  16GS A;  1XOB A;  1NB3 I;  11GS A;  2QKE A;  4ID0 A;  5ENU A;  1O7W B;  2O87 A;  1FGQ A;  2C3N A;  4TX4 A;  2KCD A;  3EE2 A;  1GNW A;  5ECL B;  5HR3 A;  4KB3 A;  1SQW A;  4HM7 B;  3HHV A;  2F86 B;  3E3E A;  1Z7R A;  2FY6 A;  2CAI A;  3HY2 A;  4HBR A;  2XGN A;  2HRA A;  2CIU A;  4OCF A;  3EX9 A;  4ZBA A;  3LZA A;  2YPM A;  3EE1 A;  1OPY A;  1NWW A;  1I5G A;  2RGQ A;  3WGE A;  5IM9 A;  5FGO A;  1A8Y A;  2HSM A;  4AJ8 A;  4IS0 A;  1BG5 A;  2ML6 A;  4KW6 A;  1GY5 A;  1LVN A;  4GL6 A;  4ZM8 A;  4OFN A;  1Y4K A;  2XRX B;  4FMB A;  1WPI A;  2CWU A;  3PXM A;  1T2I A;  3RDE A;  4RNT A;  3CCJ 3;  3V99 A;  4OK0 A;  3PGT A;  1NSW A;  2NPB A;  4BVY B;  2MMZ A;  1BNJ A;  3KZQ A;  2IY2 A;  4N6N B;  5ECI B;  5E59 A;  2CHC A;  6GSV A;  2CZ3 A;  1WMN A;  4GWR A;  5AGY A;  1IQ8 A;  4H61 A;  2PWJ A;  3TKS E;  1S3A A;  4BL2 A;  4GB5 A;  4OMV A;  5CLK A;  1OE8 A;  2L4Q A;  4GLT A;  1BSD A;  3RGA A;  4EW5 A;  4HU7 A;  2CFD A;  2D1W A;  2KF6 A;  1LRA A;  1FVK A;  4RI6 A;  1Q7H A;  2CFG A;  3NIV A;  1ZOF A;  4ICY A;  3DXB A;  3L0H A;  3CXG A;  2C0G A;  2JAC A;  2YFL B;  3PIN A;  4JRF A;  4JRR A;  5LD0 A;  5GSP A;  2VCQ A;  1JLW A;  3S29 A;  1TU5 A;  4N6O B;  5AEU B;  2IIY A;  2XC2 A;  4RZM A;  3NBR A;  4XRA A;  5CRD A;  1MDI A;  2QA1 A;  1TRP A;  1BSB A;  3CCR 3;  1HNB A;  1YZX A;  3WGX A;  2IJY A;  3FY7 A;  1R5P A;  3QRD A;  2RM5 A;  2IUK A;  2NVL A;  1XG8 A;  2X8H A;  7RNT A;  1WE0 A;  1OHS A;  5DJL A;  3QCP A;  4IEL A;  1WWJ A;  1RHL A;  2O7K A;  4GSP A;  1BSA A;  3I69 A;  3UVT A;  3QD9 A;  1U88 A;  3ERG A;  2YFI B;  3AMO A;  3IAS 2;  1J9B A;  3CU3 A;  5ECR B;  3ED3 A;  2EIO A;  3WMD A;  4NV5 A;  3LSZ A;  2RNT A;  2CWT A;  4HQZ A;  2ZDJ A;  4PQ1 A;  5D83 A;  1LOW A;  3C73 A;  3GX8 A;  3W6G A;  2E2T A;  1JRQ A;  1IT8 A;  1VQ6 3;  3QAW A;  3TRP A;  5CRG A;  1FGR A;  3F6D A;  2VAF A;  2KXG A;  5HR2 A;  1BNI A;  1IVX A;  1Q9E A;  2PMT A;  3P8W A;  2P0G A;  4DSS A;  2DSA A;  2OTJ 3;  2XPE A;  3F6F A;  3VK9 A;  1GL8 A;  3WOE B;  1JN5 B;  5F0G A;  1FGO A;  1WTH A;  2HMK B;  2W9P A;  2BMX A;  2WB9 A;  3D22 A;  3ZLP A;  2VM1 A;  1BAY A;  1KSI A;  2V6K A;  4HOJ A;  5DDL A;  1IV9 A;  4L5L A;  2AV4 A;  3CC4 3;  5AEW B;  1BAN A;  4N11 A;  1F6M C;  3LOR A;  2DMM A;  1GD4 A;  1XVW A;  1AQV A;  3ZRE A;  1FA3 A;  3GZY B;  4PEJ A;  2H75 A;  5D93 A;  4ECC A;  1ERW A;  4TR4 A;  1YI2 3;  3LW9 A;  5D9X A;  5IOW A;  3D21 A;  1FO5 A;  2BJX A;  2YOI A;  5GSS A;  5J3R A;  4KFE A;  3G7J A;  4MDC A;  3PCS A;  2WGQ A;  1EQK A;  1NO3 A;  1A8L A;  1SIH A;  3AGN A;  3QK9 A;  1I0V A;  1WIK A;  3FHK A;  2WO0 A;  2VCZ A;  1R26 A;  1Y25 A;  1ZYN A;  3NBB A;  3F9U A;  4O5Q A;  3SOY A;  5EY6 A;  1GSY A;  3HYP A;  4ZIJ A;  4GXZ A;  3P7X A;  4ISD A;  1YGW A;  1SJW A;  1RGF A;  4X1U A;  1LOY A;  3Q19 A;  3RBT A;  1SL0 B;  1RTU A;  4CDO A;  2INX A;  4V2N A;  2STD A;  5IEN A;  2FCH A;  1AUC A;  4L8E A;  3EC3 A;  5HOH A;  2LQO A;  4N0Z A;  3ZIV A;  1GTU A;  1WP0 A;  4K7O A;  4WHA A;  2XPD A;  2KUC A;  4ECB A;  3DM8 A;  3CSI A;  3UOM A;  3N9H A;  2HXK A;  3ZMK A;  3KTB A;  4D73 B;  2HFD A;  4K90 B;  3KEB A;  5JCU A;  4EIQ A;  3A76 A;  2MBS A;  2MMA A;  3GN3 A;  1M9G A;  5M18 A;  2H74 A;  2M72 A;  3GKN A;  3BLZ A;  1GMQ A;  2GQK A;  5KP1 A;  3FR6 A;  1N9E A;  2R3X A;  1SII A;  2K8S A;  2GZZ A;  3VSY A;  2P0X A;  2Y73 A;  2O89 A;  2CC3 A;  3D5I A;  4FO5 A;  2YZH A;  1A2V A;  2KRT A;  1O6J A;  3LTA A;  3FR3 A;  3Q74 A;  1PFP A;  3A2V A;  5DCG A;  4N0V A;  3FZ9 A;  3BND A;  3QPM A;  1O7P B;  2XSH B;  3LTD A;  3DGN A;  2Q07 A;  2FGX A;  1BRN L;  2L4C A;  1RN7 A;  1M3I A;  1AQZ A;  4HAA A;  5DAK B;  1V57 A;  1KD1 4;  3FG1 A;  3Q3F A;  3BNE A;  1KQS 2;  2G0F A;  1N2A A;  1XWK A;  3TCO A;  1SK0 A;  1JKG A;  1N5H A;  3EU3 A;  1HD2 A;  1NW2 A;  2DJJ A;  2HZF A;  3N5O A;  1MWS A;  3S67 A;  2CG0 A;  3EHC A;  3LTB A;  4I4K A;  2UX0 A;  1SPU A;  4HM3 B;  5IMA A;  1STD A;  2ES7 A;  2F4Y A;  3PS8 A;  3TUE A;  4IPB A;  3KKG A;  2R0C A;  2X8C A;  3WHO A;  4TRX A;  4R9K A;  1YJW 3;  1OVN A;  2GEX A;  5IMD A;  1W6C A;  4G10 A;  4F9Z A;  1BNS A;  4RNY A;  2HI7 A;  3UNL A;  1HNC A;  2QA2 A;  3CBU A;  4K2D A;  2L4V A;  4Q53 A;  1B2Z A;  3NV0 B;  1NHY A;  1TRV A;  2AAD A;  5CXO A;  1NM3 A;  1CEW I;  1UA5 A;  4KSO A;  1GUK A;  1ST9 A;  3G9B A;  3MWH A;  4R4K A;  1IYH A;  1A67 A;  4J5G A;  5IEP A;  3LXT A;  1O7G B;  1VRS D;  5CF2 A;  2F51 A;  3JCM L;  4R1K A;  2CT6 A;  4FYC A;  3BIR A;  2H72 A;  3FGY A;  2B7J A;  22GS A;  3VWX A;  1SKR B;  3IK9 A;  1RCL A;  3DEX A;  1C72 A;  4RNZ A;  2WFC A;  1VQO 3;  3HX8 A;  2H0H A;  5KN2 A;  4KF9 A;  5G31 A;  3B8L A;  3OV4 A;  6GSS A;  5B8B A;  4G1M B;  5ECP B;  3OWY A;  3C8E A;  2WGO A;  2DJ1 A;  1PN0 A;  14GS A;  1RGH A;  4O5R A;  5ECH B;  3K7C A;  4STD A;  3BCK A;  2HOH A;  3IHG A;  5DBQ A;  2I4A A;  3H93 A;  3S9F A;  2P38 A;  2PER A;  4PUR A;  5HR0 A;  2XSO B;  4JR4 A;  5JCG A;  2SAR A;  1B21 A;  1QQ2 A;  2GSQ A;  5D9W A;  3BB9 A;  4HM8 B;  4JE1 A;  2VO4 A;  4YQV A;  2E2M A;  4HU9 A;  2VOC A;  3TJJ A;  3GNJ A;  5IMV A;  1FZU A;  1ERV A;  1TRU A;  3A2W A;  2I9W A;  1LNH A;  1QGV A;  1YHQ 3;  4XHM A;  4F03 A;  1Q40 A;  3DML A;  1EWX A;  3F4S A;  4MMX B;  5D9V A;  1V58 A;  2J23 A;  3SX1 A;  1YGE A;  1SYX A;  1FGT A;  1USB A;  2IMI A;  2KF3 A;  1SEN A;  2WDU A;  2ZUP A;  3NUV A;  1A2P A;  3M8C A;  4MJC A;  1F8N A;  3D4A A;  4GSN A;  2LNS A;  5KN1 A;  4QWT A;  4O3V A;  3K0Z A;  3GUS A;  3SED A;  1SJZ A;  1ACV A;  4HZ2 A;  4WBR D;  3D5G A;  4QL7 A;  4MZB A;  1RMS A;  2VL2 C;  2FGT A;  1W4N A;  5ELA A;  2VL2 A;  1DMN A;  2C4B A;  1BYE A;  5JWQ B;  1BVI A;  1K3Y A;  2H71 A;  2OBK A;  3CNX A;  1JN5 A;  2OA7 A;  2YJ7 A;  4BVX A;  3GRD A;  5ECK B;  1ZMA A;  1GUH A;  1O73 A;  2H01 A;  2P5Q A;  1HNA A;  1TRW A;  5BRT A;  3Q6O A;  2CX4 A;  4FQU A;  2Z6B A;  4BTY A;  1EP8 A;  2LNT A;  1GLP A;  2BMO B;  2V1M A;  3P2A A;  3NM7 A;  2EIQ A;  5CRE A;  5CK6 A;  4ULX A;  3H79 A;  3CCV 3;  2KOK A;  2QEX 3;  2ALB A;  1M99 A;  5IQY A;  1YJN 3;  2ZCT A;  1A2K A;  1EV4 A;  2HE3 A;  2DJ2 A;  1K3O A;  1X9W B;  2Z76 A;  1OAC A;  1AQX A;  1M0U A;  1YY7 A;  3TJF A;  4A5P A;  3F4T A;  2MBT A;  1BSE A;  1TOF A;  4K7N A;  2CVD A;  1LU4 A;  1T8E B;  4K0N A;  3ROB A;  1E3V A;  2CVB A;  1UW1 A;  2LRC A;  1JZR A;  2O8V B;  4YKF A;  2B1K A;  3APS A;  5H5S A;  1R5A A;  3E0U A;  4IJ3 A;  5H5Q A;  2GLR A;  1BRK A;  3FEU A;  1UCL A;  2FA4 A;  5GZZ B;  3ZFL A;  3MPH A;  2QIY A;  4MH2 A;  4K1V A;  3BD2 A;  1DUG A;  3G7I A;  3PR8 A;  1T5Y A;  1DVD A;  3UAR A;  2C0E A;  2CK3 H;  2C0F A;  1ON4 A;  4ZL7 A;  2FXT A;  1DBY A;  1SKS B;  3G4S 3;  1AV4 A;  1GLQ A;  2HT9 A;  3U97 A;  3UIW A;  1GNE A;  3KGK A;  4Q5F A;  3EUR A;  3ZZX A;  1A0F A;  5AIS A;  4LEH A;  4GHO A;  2E0Q A;  5L71 A;  4D73 A;  3RHB A;  1GY7 A;  1XFL A;  4HM2 B;  1B2X A;  4MP4 A;  3UJM A;  4K1F A;  1FG4 A;  2XFT A;  2XFS A;  3TGZ A;  2F9S A;  3TKP A;  4GQC A;  5D82 A;  4EC6 A;  1FUW A;  1YQ1 A;  3GKK A;  3ZIT A;  1TFK A;  3GL3 A;  3FZ4 A;  1PY3 A;  2WOH A;  1U87 A;  3QFA C;  2F99 A;  4MF7 A;  5FT3 A;  3ZG0 A;  1EGO A;  4XBY A;  1HU9 A;  3IBH A;  1RSN A;  1OF5 A;  4L0W A;  5DAK A;  5A4V A;  1TP6 A;  4HZB B;  4I97 A;  3LOY A;  1W02 A;  2V41 A;  2OJL A;  1WNH A;  4KSM A;  2F5W A;  5ID2 B;  5BVB A;  1G0T A;  3I55 3;  4PQI A;  2H30 A;  5CAX A;  3KSP A;  2YX9 A;  4DVC A;  2YFJ B;  3ZVJ D;  4KZ1 A;  3HKR A;  2RLI A;  3CMI A;  1VF4 A;  1N5P A;  1MDJ A;  2GS3 A;  3SBC A;  1TK8 B;  3ZRD A;  4RBN A;  2JAD A;  4KE3 A;  4LL4 B;  3CCL 3;  5JBS A;  4LGQ A;  1R4W A;  1SJI A;  4CY6 A;  4GF0 A;  3GH9 A;  4XBX A;  1RRH A;  2W2C A;  1YEX A;  3UB1 A;  5IO0 A;  1NNV A;  5C00 A;  1THO A;  3RHC A;  5LC6 A;  1YKA A;  1EEJ A;  2YP6 A;  5COH A;  1XW9 A;  1FW7 A;  1QJG A;  1RGG A;  2E2G A;  5E4W A;  3FR9 A;  1IQY A;  3PYJ A;  2H66 A;  2IFQ B;  3MDK A;  4FMC A;  3C71 A;  3DGM A;  1UUG B;  1BU4 A;  3WGD A;  4BL7 B;  3U1W A;  4PGT A;  1UCJ A;  1B2M A;  1M9A A;  20GS A;  1OGZ A;  1IK3 A;  1LOV A;  2W56 B;  2GZP A;  1B4Q A;  3GTU A;  1RNB A;  1K9M 4;  3AHS A;  3DZL A;  3EF8 A;  1A23 A;  2P0M A;  5EL8 A;  3MSZ A;  2CQ9 A;  4IHU A;  1OUN A;  4IQA A;  5CO3 A;  4TR3 A;  3UJ1 A;  1GRX A;  2Z77 A;  1V98 A;  2WS2 A;  2YN1 A;  3WD6 A;  2AAW A;  2CVK A;  5IW9 A;  4BU4 A;  2JZT A;  3IXR A;  5IPH A;  3KII A;  2BNG A;  3HA9 A;  5EVO A;  3F40 A;  4RQR A;  3LT8 A;  3EVI A;  4TVE A;  5HGR A;  1IYI A;  2QC7 A;  1B2U A;  4Q5N A;  1WMJ A;  3K9M C;  4KGI A;  1ERT A;  3FZW A;  2R4V A;  2X64 A;  2VCT A;  1AVK A;  3LJR A;  3J7Y b;  3MSO A;  3HD5 A;  4IIA A;  2RBI A;  2GVP A;  1MTC A;  2WUL A;  3I6A A;  4RQX A;  1BAO A;  2A15 A;  1OKT A;  5KEJ A;  5FHI A;  3EIN A;  4I5Q A;  2ON5 A;  1YNV X;  1K28 A;  4L0U A;  1BSC A;  2L1S A;  2IN3 A;  5D81 A;  1F37 A;  3GIX A;  1URM A;  4WXT A;  1SKW B;  1TK5 B;  3APQ A;  1WOU A;  1SK2 A;  2LTK A;  5D96 A;  5CNW A;  3GST A;  5M19 A;  1O81 A;  5JCW A;  3RPN A;  1NU3 A;  1Z6N A;  4HYZ A;  2VCV A;  3CMA 3;  3Q18 A;  1M7T A;  2FWH A;  1W6G A;  3FH1 A;  1OCV A;  3EN8 A;  1PKW A;  3C7M A;  3R3E A;  1A0R P;  1O85 A;  2K18 A;  1VF3 A;  4POK A;  4NXI A;  1KWI A;  5ECN B;  3D5J A;  3DMC A;  1I3I A;  1XBS A;  4YH2 A;  3QMX A;  1VQM 3;  5IO2 A;  2O3O A;  1V74 A;  3W8J A;  3KP9 A;  3FF0 A;  4F0B A;  4HEA 2;  3Q1C A;  1GY6 A;  3GUR A;  1XW5 A;  3KIJ A;  3SWL A;  3GMF A;  2A2P A;  3HXS A;  5J41 A;  1OGX A;  2V2G A;  4J2F A;  1E2Y A;  3I56 3;  2OKA A;  5B7C A;  3JUM A;  2P05 A;  2AUV A;  2GZY A;  1UDI I;  2QA4 3;  1M1K 4;  2PNC A;  2HSH A;  1T7P B;  4IGJ A;  1TDI A;  5INY A;  4MH3 A;  1FVJ A;  1BOX A;  3QR6 A;  1BRG A;  1O7M B;  1BUQ A;  3BJ5 A;  4EF0 A;  3I0Y A;  4I2T A;  2GBW B;  2N5A A;  1W5Z A;  4LLR A;  1B4P A;  1DMQ A;  3CCE 3;  1T1V A;  1X5C A;  3IR4 A;  4AGS A;  4K7I A;  3GZR A;  2HZE B;  5GST A;  4IBP A;  3FKA A;  1PL2 A;  4HM6 B;  4O02 B;  4F2I A;  3NHX A;  3OX9 A;  1SK1 A;  2F3M A;  2HRK A;  5ECM B;  3LTC A;  1M2B A;  1ZGN A;  4POB A;  1OAZ A;  2JZS A;  3LEF A;  1GP1 A;  2R6K A;  3FKF A;  1BGS A;  5IEO A;  2BT3 A;  1PX7 A;  1SL2 B;  1PU4 A;  4ZBD A;  5ELU A;  1N8J A;  1O8X A;  4FR9 A;  3H8Q A;  1YEP A;  2CX3 A;  2BO9 B;  3OWU A;  5J5N A;  2VIM A;  1NDO B;  17GS A;  4TOP A;  1K0D A;  2IMF A;  4Z7X A;  1JBS A;  4K5S A;  4LSO A;  5IMZ A;  2YV9 A;  1BED A;  5HR1 A;  4MCU A;  1BX9 A;  1PX6 A;  4MA9 A;  1UUW B;  4N6T A;  1BJX A;  1C54 A;  4X43 A;  4J8T A;  1OE7 A;  2H19 A;  2I1U A;  2L6C A;  5JPU A;  1C7H A;  3DGL A;  4AF2 A;  4ZL8 A;  4YQM A;  3D4M A;  1EG9 B;  1D6U A;  2C10 A;  1AVL A;  4LA1 A;  4V1A g;  1CQG A;  3SOA A;  1WQL B;  5M1A A;  2KAA A;  4ZIL A;  1VF1 A;  3CC7 3;  3QAV A;  4P3Y B;  2PPT A;  2L5O A;  1SL1 B;  3M3M A;  5TGN A;  4EL1 A;  3HVV A;  3IDV A;  3AGO A;  4O32 A;  3UAP A;  1BNG A;  4AJ7 A;  1U3A A;  1Q81 4;  4BPY A;  5ECQ B;  4QQ7 A;  2A4H A;  3GWR A;  3EMX A;  2H0G A;  1THX A;  1X9S B;  3ZVJ A;  4OD7 A;  3PCR A;  1QUW A;  1H75 A;  1BRS A;  3TKS C;  5G5E A;  1UI7 A;  3RGR A;  3CME 3;  1JHB A;  3TKS A;  2OAC A;  3LYK A;  5KOW A;  4WYK B;  1AY7 A;  2CH9 A;  3CD6 3;  1K73 4;  3IJE B;  1LBK A;  1TTZ A;  3I9V 2;  3KMN A;  1IDP A;  3JUO A;  2DIZ A;  1IV7 A;  3HJP A;  8GSS A;  4BL3 A;  1IU7 A;  1VGL A;  4HJL B;  2H1D A;  1MDK A;  1FB0 A;  4KDU A;  1R4C A;  1F3B A;  2JL4 A;  4FCJ A;  3X42 A;  3CCU 3;  1BUJ A;  2E2V A;  3ZFB A;  1MOL A;  3UBK A;  3PGB A;  3NZN A;  1GH2 A;  1TK0 B;  4HM1 B;  1ROV A;  2ZA4 A;  4EVM A;  1RGL A;  2MF7 A;  2WOF A;  5B6M A;  4HSC X;  1HYU A;  3MHE A;  4HUA A;  2AJQ B;  3BNB A;  1RRL A;  2HMN B;  4G2E A;  4FMD A;  4GQF A;  3LG6 A;  3ZYW A;  2A2R A;  4OUQ A;  2K6V A;  3OR5 A;  3MG3 A;  4MF5 A;  2XBI A;  2R41 A;  4G9H A;  3ZTL A;  9RNT A;  4Q5Q A;  2KP1 A;  3APO A;  3M9K A;  2CX1 A;  1B8X A;  1X1U A;  4BIR A;  2PUK C;  1G6W A;  2IFQ A;  2ML5 A;  2OQE C;  2FNO A;  4FCZ A;  4BL7 A;  4IKH A;  1RGA A;  2GBX B;  4YAV A;  3HIG A;  3MYT A;  1VQK 3;  1QAL A;  1NJI 4;  1EKM A;  4TXO B;  2JZR A;  3DKS A;  3GL5 A;  3M1G A;  4MJE A;  4MZW A;  1KC8 4;  1X5D A;  2GU1 A;  3VFI A;  2B5Y A;  1O8W A;  4G0L A;  3DD3 A;  4EUY A;  1GSF A;  1PGT A;  3PPU A;  4IW9 A;  1GSP A;  2H8L A;  3GZB A;  4JED A;  3F63 A;  4BVY A;  3IC8 A;  2MMO A;  3GYK A;  4EXR A;  3F0I A;  1ZGX A;  1UC7 A;  1TP9 A;  3VWW A;  4BIK A;  2DC5 A;  5IF6 A;  4OFM A;  1OC3 A;  2FWE A;  2E2U A;  5HFI A;  3EB8 A;  1FAA A;  2XHF A;  4OWY A;  2KP2 A;  2PVQ A;  3ERW A;  4J5K A;  2LQQ A;  2JSZ A;  2L6D A;  5A0O B;  2GGT A;  4KND A;  2W04 A;  1PL1 A;  1EEM A;  1ZYE A;  4OCE A;  4N6V 0;  2C0D A;  3IHQ A;  1BRI A;  12GS A;  1MEK A;  3EBY A;  4ZB6 A;  5BIR A;  2UUG C;  1JBT A;  4WF4 A;  1M2A A;  1VQL 3;  1Q42 A;  2JSY A;  3PH9 A;  4CDL A;  4L5O A;  3FG4 A;  2X99 A;  4HDE A;  1RJO A;  3HDC A;  5DVB A;  2WGR A;  1W7C A;  1M2D A;  3KXO A;  5IMF A;  3ISO A;  4QL9 A;  4XTS A;  2AAE A;  1YF0 A;  2FLS A;  5ECO B;  5A4W A;  1STF I;  1AR0 A;  1G96 A;  4FYU A;  4ZBB A;  4ILF A;  8RNT A;  4O8S A;  1GOY A;  6GSP A;  4KH7 A;  4PX1 A;  3VI7 A;  3KZT A;  2OBI A;  3WOF B;  3LML A;  3FLJ A;  4XM4 A;  3L9S A; 
#chains in the Genus database with same CATH homology
 4YKG A;  1A2J A;  3QAG A;  4POM A;  2H76 A;  3DRN A;  3CTF A;  4TXV A;  2LST A;  3GA4 A;  2YWI A;  1W89 A;  10GS A;  1XZO A;  5J9C A;  1TI3 A;  2VLV A;  2HLS A;  1WJK A;  1NHO A;  1MD3 A;  5DQS A;  2RUE A;  3GFK A;  2IMD A;  2V6O A;  4TW5 A;  3H4K A;  1T4Y A;  4K9Z A;  2TRC P;  4WBJ A;  2O85 A;  5CYY A;  2YNX A;  4ZB9 A;  1FW1 A;  1GSU A;  1S3D A;  2CZ2 A;  4USS A;  1XVQ A;  1X5E A;  1JZO A;  2RUF A;  4X0X A;  4IVF A;  5G1L A;  1F9M A;  2BTO T;  1ZCP A;  1CQH A;  1B9Y C;  5IIZ A;  1EOH A;  3EMP A;  4O92 A;  5JWR B;  1DE2 A;  3FW2 A;  1GTA A;  3MAK A;  5DJM A;  3GSS A;  1S3C A;  3DGQ A;  1ZL9 A;  2LV3 A;  4XS4 B;  3E9J B;  5G2Z A;  2QSI A;  5CRW A;  1EV9 A;  2B7K A;  1JFU A;  2R37 A;  3QFB C;  3U5R E;  2P5R A;  1AW9 A;  4J56 E;  5JWO B;  3UVH A;  1YF1 A;  4DSQ A;  5G5F A;  4CW9 A;  4MF6 A;  2VL9 A;  4LL1 B;  2UZ8 A;  2M46 A;  1Y6E A;  3KJY A;  1TXX A;  2AHE A;  2I9H A;  5AN1 A;  2VLT A;  2I81 A;  3A2X A;  2J9H A;  4NWY A;  1RQM A;  4H86 A;  3F3Q A;  5C04 A;  3UEM A;  1DE1 A;  2M80 A;  2QGV A;  1GUL A;  3TDG A;  1T4Z A;  2LS5 A;  3US3 A;  2YWO A;  4O7H A;  2H6X A;  1SD9 A;  3CSH A;  4ML6 A;  3WYW A;  4LMW A;  1EP7 A;  3L78 A;  2GST A;  3ERF A;  5BMU A;  3NOF A;  5CP1 A;  3MNG A;  3LGC A;  4NHZ A;  4JZQ A;  3FZA A;  2DJ0 A;  3TKR A;  4EO3 A;  1TI1 A;  2GTU A;  2C4J A;  3CRU A;  3KMO A;  4O5U A;  2VCW A;  3CSJ A;  3VLN A;  4HJM A;  2V32 A;  4BWQ A;  4ZB8 A;  1PD2 1;  3LFL A;  1K0C A;  1E6B A;  1OYJ A;  3BOA A;  4X4J A;  2DKI A;  3KH7 A;  2YV7 A;  2K8V A;  2RII A;  2B3S A;  4PTS A;  4MPF A;  4GTU A;  4EDZ A;  2GSS A;  4PUF C;  19GS A;  3IRA A;  4YAP A;  1V40 A;  2GT5 A;  1TKD B;  2WJU A;  1Z7P A;  4XS6 A;  3A5I A;  1TRS A;  4I8B A;  4NAX A;  4XIH A;  3VWU A;  5J4U A;  4YQU A;  4WR5 A;  1U3I A;  2IPA A;  3RPP A;  3M9J A;  3FRC A;  1R7H A;  1BQ7 A;  4MJB A;  3CYN A;  5AIV A;  3IE3 A;  1XW6 A;  3TJG A;  5D8I A;  4JU5 A;  2MYG A;  4MZC A;  4GST A;  2NDO A;  4OO5 A;  4EKZ A;  4K0G A;  2HYX A;  2ON7 A;  1ZYP A;  1SD8 A;  2L57 A;  5DAL B;  4MJA A;  3D4T A;  1FOH A;  1FOV A;  5F06 A;  3EWL A;  2JU5 A;  2IYJ A;  1EZK A;  1OKD A;  3C1R A;  3ZIJ A;  3WT1 A;  4NHW A;  4POL A;  3A5W A;  3IC4 A;  3ZML A;  1Q98 A;  1ZYQ B;  1ILO A;  4V1A p;  2H6Z A;  2OE3 A;  3R2Q A;  2GQL A;  3MIX A;  1EOG A;  2FA8 A;  3IV4 A;  3VPT A;  4RI7 A;  2YAN A;  3KD0 A;  4IN0 A;  2EIR A;  3IPZ A;  2I3Y A;  3I43 A;  4K8M A;  1ABA A;  2XBQ A;  4CY8 A;  4EDY A;  4GCI A;  4MK3 A;  2NTO A;  1V9W A;  4G0K A;  2VLU A;  2FD3 A;  3FK8 A;  1I9D A;  2LRN A;  4IP1 A;  1V2A A;  2H1B A;  4EIP A;  2GSR A;  4HQS A;  4WR4 A;  4E8E A;  5FWG A;  5F8B A;  1T3B A;  2YCD A;  3BBY A;  5F05 A;  4MPG A;  2MZC A;  1RK4 A;  5D9T A;  3L9V A;  1ML6 A;  4KA0 A;  5H5R A;  4PUA A;  1J0F A;  2FHE A;  2B5X A;  2X8G A;  3BCI A;  4HS1 A;  4KCA A;  5B6N A;  4XS4 A;  5LCZ A;  3KH9 A;  1TW9 A;  4PNG A;  2C3T A;  3U6V A;  2TRX A;  1YJ6 A;  3HVX A;  4BVX B;  6GSY A;  1GSQ A;  3J7Y k;  3FMW A;  3VI5 A;  4V2L A;  2VL3 A;  2YWM A;  2HNL A;  5IMC A;  3KP8 A;  3IA1 A;  3KCM A;  3DYR A;  5D73 A;  3GHA A;  1PQN A;  1DSB A;  3A3T A;  2DIY A;  1TU8 A;  3TJB A;  3TRX A;  1PRX A;  4IP6 A;  2HSY A;  2H6Y A;  4KX4 A;  2IMK A;  2B5E A;  2DKH A;  2KLX A;  4PXO A;  4I2U A;  2VUP A;  2F8A A;  5ABR A;  4KAE A;  2GQM A;  2LJR A;  3QDN A;  1ERU A;  3D0Z A;  3O3T A;  3TRQ A;  1OC9 B;  3IK7 A;  2N5B A;  1GSS A;  2PBJ A;  3M8N A;  3O6T A;  1AC1 A;  5G1K A;  4DSR A;  5CRH A;  2IL3 A;  5IPG A;  5ID2 A;  3UMA A;  5HFG A;  2FUG 2;  4IQ1 A;  2LEG A;  4K6X A;  2WCI A;  4PNF A;  2K9F A;  1PKZ A;  1PA3 A;  3AY8 A;  1MD4 A;  2D2Z A;  5HQP A;  3HZ4 A;  4EE0 A;  3UL3 A;  1A2L A;  13GS A;  4JBB A;  3CRT A;  1SU9 A;  1W4V A;  3HZ8 A;  3FZ5 A;  2PVO C;  3TOU A;  1F2E A;  2LUS A;  2REM A;  1AXD A;  3DIE A;  3GKX A;  4BWS A;  1FHE A;  2A2S A;  4FH8 A;  2HRF A;  2EC4 A;  2DLX A;  1GUM A;  3P90 A;  1G7O A;  3MYD A;  1QK8 A;  5KN0 A;  1K0O A;  1U6T A;  2N5F A;  3D6I A;  4MMM A;  4TR1 B;  4AJ6 A;  2PN8 A;  4V2M A;  6GSU A;  2VCX A;  1QMV A;  4EXJ A;  3TB2 A;  2WZ9 A;  4J57 E;  1ZZY A;  1XXU A;  1RW1 A;  2KHP A;  4CHS A;  4G0I A;  4MLY A;  3V1W A;  1JLV A;  3F3R A;  2Z9S A;  5A5K A;  1GTB A;  1K0N A;  4ZXG A;  5F07 A;  1F3A A;  5DAL A;  3LYP A;  3GH6 A;  1GTI A;  9GSS A;  3GRX A;  4N10 A;  2RM6 A;  5DCH A;  3W8S A;  2F8F A;  5AIX A;  4I6X A;  3RAZ A;  3TKQ A;  1B48 A;  4IJI A;  3N9J A;  7GSS A;  1QFN A;  4KDY A;  3HJO A;  4K2X A;  1AIU A;  4LMV A;  3GTU B;  4NV2 A;  4FYB A;  5KOX A;  1TJD A;  1G7E A;  1UN2 A;  1JZW A;  3KM6 A;  4XRD A;  2TIR A;  4XCS A;  1XWA A;  4E8H A;  3F4R A;  4Z2U A;  2CA8 A;  18GS A;  1X0R A;  3L4N A;  4NPB A;  2GT6 A;  1K3L A;  2LKU A;  2FWG A;  5GAN D;  6GSX A;  1YDK A;  2CV4 A;  4GRF A;  4KCE A;  4WET A;  4RUV A;  1GSD A;  3HJM A;  4MAB A;  2PGT A;  4ZL9 A;  1GWC A;  2P31 A;  1KTE A;  4OFT A;  3IOS A;  3F8U A;  2R2J A;  3K8N A;  1J08 A;  3TOT A;  2WRT A;  2B1L A;  1YKC A;  3EPT A;  3H1N A;  5J9B A;  3VWV A;  2H1G A;  3EYT A;  2YZU A;  1UVZ A;  1HQO A;  3WT2 A;  3GV1 A;  3VUR A;  1FB6 A;  1XOA A;  3GKM A;  1AQW A;  2LJK A;  2AB6 A;  1XWB A;  5DQY A;  2IME A;  5KN3 A;  1Q4J A;  2HZE A;  4TR0 A;  5A4U A;  1KNG A;  2A4V A;  1XCC A;  2C80 A;  1O7U A;  5HFK A;  4F82 A;  2G2Q A;  2R0G A;  4Q5R A;  4WEY A;  2NBS A;  4ML1 A;  2X49 A;  1QXH A;  3HVS A;  3RDW A;  3ME8 A;  2DJ3 A;  3C1S A;  4F0C A;  1OC8 A;  1VF2 A;  4GSS A;  1K0B A;  3LXZ A;  2CAQ A;  5B8A A;  2B6M A;  2PU9 C;  1Z6M A;  1K0A A;  4DEJ A;  1X9M B;  2C1Y A;  1K0M A;  1PN9 A;  2LJA A;  1WRY A;  4K5R A;  1XPV A;  2GDR A;  1LJR A;  1AAZ A;  1B9X C;  5GAP D;  3CTG A;  4ACS A;  2DML A;  1JZD A;  2H1A A;  4MNN A;  4KUN A;  4DSS B;  2E7P A;  2C3Q A;  5G30 A;  1G6Y A;  2HRN A;  2OE1 A;  4TKY A;  1KBN A;  4WKW A;  2LRT A;  3IAM 2;  4WF5 A;  6GSW A;  2VD0 A;  3KTL A;  1OC9 A;  1A2M A;  2L59 A;  4HI7 A;  4JR6 A;  2DBC A;  3M0F A;  3QOU A;  4FIW A;  1XWG A;  1GSE A;  1XIY A;  4HZ4 A;  1A24 A;  1Z9H A;  3DVX A;  3HCZ A;  4TN8 A;  5ELG A;  4PQH A;  1PSQ A;  2ZNM A;  1PMT A;  4ECJ A;  2YWN A;  2H0I A;  5IOX A;  3ZL5 A;  2YJH A;  4Z2R A;  3G7Y A;  2H73 A;  4HJ2 A;  4N30 A;  2VM2 A;  2C8U A;  4OO4 A;  5ECS A;  5EPF A;  4Z2T A;  4NMU A;  2DJK A;  3LWA A;  4G19 A;  2X4A A;  1M9B A;  1SYR A;  2OAD A;  4EC0 A;  1EGR A;  1XWC A;  5LNK e;  3UBL A;  1T00 A;  3O76 A;  2VD1 A;  3DVW A;  3GX0 A;  3DWV A;  2IWT A;  2R5G A;  2FWF A;  2L5L A;  2MMN A;  3ME7 A;  4KDX A;  2AYT A;  4TXO A;  1Z5Y E;  6GST A;  4BA7 A;  4XS1 A;  3TJK A;  1SJ6 A;  2H70 A;  3EU4 A;  3LQ7 A;  4ECI A;  2R0P A;  1H4O A;  1KEB A;  4TR1 A;  1Z3E A;  3L9U A;  1TU7 A;  3VPQ A;  3FYG A;  2OE0 A;  16GS A;  1XOB A;  11GS A;  2QKE A;  4ID0 A;  5ENU A;  2O87 A;  2C3N A;  3EE2 A;  1GNW A;  5ECL B;  5HR3 A;  4KB3 A;  3HHV A;  3E3E A;  1Z7R A;  2FY6 A;  2CAI A;  3HY2 A;  2HRA A;  4OCF A;  4ZBA A;  2YPM A;  1I5G A;  3WGE A;  5IM9 A;  1A8Y A;  2HSM A;  4AJ8 A;  4IS0 A;  1BG5 A;  4KW6 A;  4OFN A;  1WPI A;  3PGT A;  1NSW A;  2NPB A;  4BVY B;  2MMZ A;  3KZQ A;  2IY2 A;  5ECI B;  5E59 A;  6GSV A;  2CZ3 A;  4GWR A;  5AGY A;  3TKS E;  2PWJ A;  1S3A A;  4OMV A;  1OE8 A;  2L4Q A;  4GLT A;  4HU7 A;  1FVK A;  4RI6 A;  3NIV A;  1ZOF A;  4ICY A;  3DXB A;  3L0H A;  3CXG A;  2C0G A;  2JAC A;  3PIN A;  4JRR A;  5LD0 A;  2VCQ A;  1JLW A;  2IIY A;  2XC2 A;  4XRA A;  5CRD A;  1MDI A;  2QA1 A;  1HNB A;  1YZX A;  3WGX A;  2IJY A;  3FY7 A;  1R5P A;  2RM5 A;  2NVL A;  2X8H A;  1WE0 A;  5DJL A;  3QCP A;  4IEL A;  1WWJ A;  2O7K A;  3I69 A;  3UVT A;  3QD9 A;  1U88 A;  3ERG A;  3IAS 2;  1J9B A;  5ECR B;  3ED3 A;  2EIO A;  4NV5 A;  3LSZ A;  4HQZ A;  4PQ1 A;  3C73 A;  3GX8 A;  3W6G A;  3QAW A;  3TRP A;  5CRG A;  3F6D A;  2VAF A;  5HR2 A;  2PMT A;  3P8W A;  4DSS A;  2P0G A;  2DSA A;  2XPE A;  3F6F A;  3VK9 A;  1GL8 A;  5F0G A;  2BMX A;  2WB9 A;  3D22 A;  3ZLP A;  2VM1 A;  1BAY A;  2V6K A;  4HOJ A;  5DDL A;  4L5L A;  2AV4 A;  4N11 A;  1F6M C;  3LOR A;  2DMM A;  1XVW A;  1AQV A;  3ZRE A;  2H75 A;  5D93 A;  4ECC A;  1ERW A;  4TR4 A;  3LW9 A;  5D9X A;  5IOW A;  3D21 A;  1FO5 A;  2BJX A;  2YOI A;  5GSS A;  5J3R A;  3G7J A;  4MDC A;  1A8L A;  1WIK A;  3FHK A;  2VCZ A;  1R26 A;  1Y25 A;  1ZYN A;  3F9U A;  4O5Q A;  5EY6 A;  1GSY A;  3HYP A;  4ZIJ A;  4GXZ A;  3P7X A;  4ISD A;  4X1U A;  3Q19 A;  3RBT A;  1SL0 B;  4CDO A;  4V2N A;  2FCH A;  1AUC A;  4L8E A;  3EC3 A;  2LQO A;  4N0Z A;  3ZIV A;  1GTU A;  1WP0 A;  4K7O A;  2XPD A;  2KUC A;  4ECB A;  3CSI A;  3UOM A;  2HXK A;  3ZMK A;  3KTB A;  4D73 B;  2HFD A;  3KEB A;  5JCU A;  4EIQ A;  2MBS A;  2MMA A;  3GN3 A;  2H74 A;  2M72 A;  3GKN A;  2GQK A;  3FR6 A;  2R3X A;  2K8S A;  2GZZ A;  2O89 A;  4FO5 A;  2YZH A;  1O6J A;  3FR3 A;  3Q74 A;  3A2V A;  5DCG A;  4N0V A;  3FZ9 A;  3QPM A;  2FGX A;  2L4C A;  5DAK B;  1V57 A;  2G0F A;  1N2A A;  1XWK A;  3TCO A;  1SK0 A;  3EU3 A;  1HD2 A;  1NW2 A;  2DJJ A;  2HZF A;  3N5O A;  5IMA A;  2ES7 A;  3TUE A;  2R0C A;  2X8C A;  4TRX A;  1OVN A;  5IMD A;  4G10 A;  4F9Z A;  2HI7 A;  1HNC A;  2QA2 A;  3CBU A;  4K2D A;  1NHY A;  1TRV A;  1NM3 A;  1UA5 A;  4KSO A;  1GUK A;  1ST9 A;  3G9B A;  3MWH A;  1IYH A;  3LXT A;  1VRS D;  2F51 A;  3JCM L;  2CT6 A;  4FYC A;  2H72 A;  2B7J A;  22GS A;  3VWX A;  1SKR B;  3IK9 A;  3DEX A;  1C72 A;  2WFC A;  2H0H A;  5KN2 A;  4KF9 A;  5G31 A;  6GSS A;  5B8B A;  5ECP B;  3C8E A;  2DJ1 A;  1PN0 A;  14GS A;  4O5R A;  5ECH B;  3BCK A;  3IHG A;  5DBQ A;  2I4A A;  3H93 A;  3S9F A;  2PER A;  4PUR A;  5HR0 A;  4JR4 A;  5JCG A;  1QQ2 A;  2GSQ A;  5D9W A;  4JE1 A;  2VO4 A;  4YQV A;  2E2M A;  4HU9 A;  2VOC A;  3TJJ A;  3GNJ A;  1ERV A;  1TRU A;  3A2W A;  1QGV A;  4XHM A;  4F03 A;  3DML A;  1EWX A;  3F4S A;  5D9V A;  1V58 A;  2J23 A;  1SYX A;  1USB A;  2IMI A;  1SEN A;  2WDU A;  2ZUP A;  4MJC A;  4GSN A;  2LNS A;  5KN1 A;  3GUS A;  1SJZ A;  1ACV A;  4HZ2 A;  4WBR D;  4QL7 A;  4MZB A;  2VL2 C;  5ELA A;  2VL2 A;  1BYE A;  5JWQ B;  1K3Y A;  2H71 A;  2OBK A;  2OA7 A;  2YJ7 A;  4BVX A;  5ECK B;  1ZMA A;  1GUH A;  1O73 A;  2H01 A;  2P5Q A;  1HNA A;  1TRW A;  5BRT A;  3Q6O A;  2CX4 A;  4FQU A;  1EP8 A;  2LNT A;  1GLP A;  2V1M A;  3P2A A;  2EIQ A;  5CRE A;  4ULX A;  3H79 A;  2KOK A;  2ALB A;  1M99 A;  5IQY A;  2ZCT A;  1EV4 A;  2HE3 A;  2DJ2 A;  1K3O A;  1X9W B;  1AQX A;  1M0U A;  1YY7 A;  3TJF A;  4A5P A;  3F4T A;  2MBT A;  1TOF A;  4K7N A;  2CVD A;  1LU4 A;  1T8E B;  4K0N A;  2CVB A;  2LRC A;  1JZR A;  2O8V B;  4YKF A;  2B1K A;  3APS A;  5H5S A;  1R5A A;  3E0U A;  4IJ3 A;  5H5Q A;  2GLR A;  3FEU A;  2FA4 A;  5GZZ B;  3ZFL A;  4MH2 A;  3BD2 A;  1DUG A;  3G7I A;  3PR8 A;  3UAR A;  2C0E A;  2C0F A;  1ON4 A;  4ZL7 A;  1DBY A;  1SKS B;  1GLQ A;  2HT9 A;  3UIW A;  1GNE A;  3KGK A;  4Q5F A;  3EUR A;  3ZZX A;  1A0F A;  5AIS A;  2E0Q A;  5L71 A;  4D73 A;  3RHB A;  1XFL A;  4MP4 A;  4K1F A;  1FG4 A;  3TGZ A;  2F9S A;  3TKP A;  4GQC A;  1YQ1 A;  3GKK A;  3ZIT A;  3GL3 A;  3FZ4 A;  1U87 A;  3QFA C;  4MF7 A;  5FT3 A;  1EGO A;  3IBH A;  4L0W A;  5DAK A;  5A4V A;  4I97 A;  2V41 A;  2OJL A;  4KSM A;  5ID2 B;  1G0T A;  4PQI A;  2H30 A;  5CAX A;  4DVC A;  3ZVJ D;  3HKR A;  2RLI A;  3CMI A;  1VF4 A;  1MDJ A;  2GS3 A;  3SBC A;  1TK8 B;  3ZRD A;  2JAD A;  4KE3 A;  4LL4 B;  1R4W A;  1SJI A;  4CY6 A;  4GF0 A;  3GH9 A;  1YEX A;  5IO0 A;  5C00 A;  3RHC A;  1THO A;  1YKA A;  2YP6 A;  1EEJ A;  5COH A;  1XW9 A;  5E4W A;  2E2G A;  3FR9 A;  2H66 A;  2IFQ B;  3MDK A;  3C71 A;  4BL7 B;  3WGD A;  4PGT A;  1M9A A;  20GS A;  2GZP A;  1B4Q A;  3GTU A;  1A23 A;  5EL8 A;  3MSZ A;  2CQ9 A;  4IHU A;  4IQA A;  5CO3 A;  4TR3 A;  3UJ1 A;  1GRX A;  1V98 A;  2WS2 A;  2YN1 A;  3WD6 A;  2AAW A;  2CVK A;  2JZT A;  5IPH A;  3IXR A;  3HA9 A;  5EVO A;  4RQR A;  3EVI A;  4TVE A;  1IYI A;  2QC7 A;  4Q5N A;  1WMJ A;  4KGI A;  1ERT A;  2R4V A;  2X64 A;  2VCT A;  3LJR A;  3J7Y b;  3HD5 A;  2GVP A;  1MTC A;  2WUL A;  3I6A A;  4RQX A;  1OKT A;  5KEJ A;  5FHI A;  3EIN A;  4I5Q A;  2ON5 A;  4L0U A;  2IN3 A;  1F37 A;  3GIX A;  1URM A;  4WXT A;  1SKW B;  1TK5 B;  3APQ A;  1WOU A;  1SK2 A;  2LTK A;  5D96 A;  5CNW A;  3GST A;  1O81 A;  5JCW A;  3RPN A;  1Z6N A;  2VCV A;  3Q18 A;  1M7T A;  2FWH A;  3C7M A;  1PKW A;  3R3E A;  5IMV A;  4POK A;  1A0R P;  1O85 A;  2K18 A;  1VF3 A;  4NXI A;  5ECN B;  3D5J A;  1XBS A;  4YH2 A;  3QMX A;  5IO2 A;  3W8J A;  3KP9 A;  4F0B A;  4HEA 2;  3GUR A;  1XW5 A;  3KIJ A;  3SWL A;  3GMF A;  2A2P A;  3HXS A;  5J41 A;  2V2G A;  4J2F A;  1E2Y A;  2OKA A;  5B7C A;  2AUV A;  2GZY A;  2HSH A;  1T7P B;  4IGJ A;  1TDI A;  5INY A;  4MH3 A;  1FVJ A;  3QR6 A;  3BJ5 A;  4EF0 A;  4I2T A;  2N5A A;  4LLR A;  1B4P A;  1T1V A;  1X5C A;  3IR4 A;  4AGS A;  4K7I A;  2HZE B;  5GST A;  4IBP A;  1PL2 A;  4F2I A;  2HRK A;  1SK1 A;  2F3M A;  5ECM B;  1M2B A;  1ZGN A;  4POB A;  1OAZ A;  2JZS A;  3LEF A;  1GP1 A;  2R6K A;  3FKF A;  1PX7 A;  1SL2 B;  4ZBD A;  1N8J A;  1O8X A;  3H8Q A;  1YEP A;  2CX3 A;  5J5N A;  2VIM A;  17GS A;  4TOP A;  1K0D A;  2IMF A;  4Z7X A;  4K5S A;  5IMZ A;  2YV9 A;  1BED A;  5HR1 A;  4MCU A;  1BX9 A;  1PX6 A;  4MA9 A;  1BJX A;  4X43 A;  1OE7 A;  2H19 A;  2I1U A;  2L6C A;  4AF2 A;  4ZL8 A;  4YQM A;  3D4M A;  4LA1 A;  4V1A g;  1CQG A;  4ZIL A;  1VF1 A;  3QAV A;  4P3Y B;  2PPT A;  2L5O A;  1SL1 B;  3M3M A;  4EL1 A;  3HVV A;  3IDV A;  3UAP A;  4O32 A;  4AJ7 A;  1U3A A;  4BPY A;  5ECQ B;  4QQ7 A;  2A4H A;  3EMX A;  2H0G A;  1THX A;  1X9S B;  3ZVJ A;  4OD7 A;  1QUW A;  1H75 A;  3TKS C;  5G5E A;  1JHB A;  3TKS A;  2OAC A;  3LYK A;  5KOW A;  3KMN A;  1LBK A;  3I9V 2;  1TTZ A;  2DIZ A;  3HJP A;  8GSS A;  1VGL A;  2H1D A;  1MDK A;  1FB0 A;  4KDU A;  1F3B A;  2JL4 A;  3ZFB A;  3UBK A;  3NZN A;  1GH2 A;  1TK0 B;  4EVM A;  5B6M A;  1HYU A;  4HUA A;  2AJQ B;  4G2E A;  4GQF A;  3LG6 A;  3ZYW A;  2A2R A;  2K6V A;  3OR5 A;  4MF5 A;  2XBI A;  4G9H A;  3ZTL A;  4Q5Q A;  2KP1 A;  3APO A;  3M9K A;  1B8X A;  2PUK C;  1G6W A;  2IFQ A;  2FNO A;  4BL7 A;  4IKH A;  4YAV A;  4TXO B;  2JZR A;  3DKS A;  3GL5 A;  3M1G A;  4MJE A;  4MZW A;  1X5D A;  3VFI A;  2B5Y A;  1O8W A;  4G0L A;  3DD3 A;  4EUY A;  1GSF A;  1PGT A;  3PPU A;  4IW9 A;  2H8L A;  4JED A;  3F63 A;  4BVY A;  3IC8 A;  2MMO A;  3GYK A;  3F0I A;  1UC7 A;  3VWW A;  1TP9 A;  2DC5 A;  4OFM A;  1OC3 A;  2FWE A;  5HFI A;  1FAA A;  2XHF A;  4OWY A;  2KP2 A;  2PVQ A;  3ERW A;  2LQQ A;  2JSZ A;  2L6D A;  2GGT A;  4KND A;  1PL1 A;  1EEM A;  1ZYE A;  4OCE A;  2C0D A;  3IHQ A;  12GS A;  1MEK A;  4ZB6 A;  4WF4 A;  1M2A A;  2JSY A;  3PH9 A;  4L5O A;  2X99 A;  4HDE A;  3HDC A;  5DVB A;  2WGR A;  1M2D A;  3KXO A;  5IMF A;  3ISO A;  4QL9 A;  4XTS A;  1YF0 A;  2FLS A;  5ECO B;  5A4W A;  4FYU A;  4ZBB A;  4ILF A;  3VI7 A;  4KH7 A;  4PX1 A;  2OBI A;  3L9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...