1V58A

Crystal structure of the reduced protein disulfide bond isomerase dsbg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
b'ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v58A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v58A02
4NHZA 1EWXA 1N8JA 5GSSA 1XIYA 3TRPA 5LCZA 3RHCA 2LS5A 1IYIA 1T1VA 5IM9A 2GDRA 2H6YA 2B3SA 3ME7A 2WULA 3DD3A 2LSTA 2I4AA 1V57A 3D4TA 13GSA 2GQMA 4J57E 5F0GA 4ILFA 1MD3A 2AB6A 3IHQA 3UMAA 2VCXA 3QAGA 3FRCA 4GLTA 3TKSC 3I9V2 2AJQB 3TCOA 2DJ2A 4DSSB 2PN8A 4IQ1A 2X64A 2H01A 3GSSA 1XWCA 4ULXA 2OACA 4BWSA 3QMXA 3TKSA 1F3BA 5KN2A 1BG5A 1URMA 3GTUB 3TJKA 4XRAA 1AQXA 1W4VA 1M2AA 2C0FA 1OC8A 4GSSA 1U6TA 1GRXA 4V2MA 1KTEA 2H76A 2K8SA 1OE8A 2LNSA 1R5AA 1SKSB 3KMNA 4LA1A 3GKKA 2YV7A 5CYYA 5EY6A 3O76A 2I9HA 4F03A 4HDEA 3W6GA 4BVXA 1X9SB 2CT6A 3GL3A 3FZAA 2CVBA 4FH8A 4TR4A 2IYJA 2GSRA 1YZXA 1RW1A 1JFUA 4JE1A 1ZOFA 4X1UA 3F3RA 4XRDA 1PD21 2M80A 2O87A 5LD0A 1JZWA 5KEJA 2KUCA 3KH7A 5AIVA 2C4JA 5HR0A 3A2XA 2IPAA 4E8EA 2YCDA 4CHSA 5G5FA 2JZTA 5AIXA 4MLYA 1G7EA 2LJRA 5DALB 4EC0A 4P3YB 2H74A 4FYBA 1JLWA 2NDOA 1E2YA 3VI7A 4ZBAA 1NW2A 2YZUA 2H73A 4JR6A 6GSTA 22GSA 3APOA 2HYXA 3FR6A 3RDWA 3FEUA 4BL7A 4HU9A 2XC2A 3HDCA 2PUKC 5FT3A 2IMKA 3FHKA 5A4WA 1PA3A 2MMNA 1X9MB 5ECLB 5B6MA 2LRCA 4AF2A 2DIZA 4N0ZA 2VD1A 2HSHA 3GX0A 1UC7A 2VL9A 2H70A 5ECNB 4TR3A 5ELGA 3LFLA 3ZL5A 2HZFA 5DBQA 3FZ9A 3VI5A 1F2EA 2DC5A 2GQKA 14GSA 1V40A 3EC3A 2FWGA 1TK8B 1QQ2A 1FB6A 3DVWA 4NPBA 3E0UA 1OC3A 4Q5RA 4IP1A 5HFGA 3MSZA 1Q4JA 2L5LA 4H86A 2PBJA 3ZLPA 6GSSA 2C3NA 1TI1A 5E4WA 3TRXA 3C1SA 4MP4A 1MDJA 4N30A 1M7TA 2YJHA 3MDKA 3GX8A 5IMCA 1TJDA 5G1LA 4PURA 4KCAA 4IBPA 5F07A 1HNCA 2NPBA 1K0OA 1EZKA 1X5EA 4K8MA 2V2GA 1K0NA 1FVKA 3CBUA 3PINA 1GSSA 4IGJA 1TU7A 3ERGA 1SYXA 2K9FA 4QL9A 2H0IA 1XXUA 3EMXA 4DEJA 5A5KA 3Q74A 3UEMA 3H1NA 2HRFA 2H19A 3IPZA 4NMUA 3S9FA 2LJKA 2R2JA 3WD6A 3GUSA 3M9KA 4KDYA 4MJCA 3EWLA 3W8SA 2P5RA 3L0HA 2MYGA 1PQNA 2R37A 1OC9B 3FW2A 1B9YC 3DYRA 4QL7A 2I1UA 5F05A 5J9CA 1YEPA 1S3AA 2AYTA 3UOMA 1ERTA 3I69A 1R5PA 3HXSA 5GSTA 3WGEA 2B6MA 4N10A 5CP1A 3IOSA 3ERWA 2ZCTA 2PGTA 1XCCA 1M0UA 2FGXA 2TRCP 3U6VA 3I6AA 1SJIA 1T7PB 3IBHA 4K2DA 3H4KA 2K8VA 1J08A 1TRVA 4IJIA 3DWVA 3EURA 4J2FA 1JHBA 2YNXA 2GVPA 2PU9C 4WETA 5D93A 2ZNMA 4TVEA 4ECIA 3O6TA 1UA5A 4KSOA 5FHIA 1LJRA 4KSMA 3UAPA 2GT5A 4HQSA 2H0GA 20GSA 1PSQA 1FOVA 1Z7RA 3GV1A 4MA9A 2VL2A 3A2VA 1THOA 4K1FA 2LJAA 3KCMA 4JBBA 5IOWA 2EIRA 5CRGA 2V32A 2MMZA 5B7CA 2LNTA 1PN9A 1F3AA 3OR5A 1ON4A 4ZL7A 2VD0A 4ECJA 2OA7A 1EP8A 5CREA 2L59A 4IELA 1G0TA 1TKDB 3PR8A 4KW6A 1YF1A 3DEXA 8GSSA 2KP1A 4KB3A 1XW5A 5CRWA 3FK8A 2R5GA 3QAVA 4YQMA 1JZDA 1FVJA 4EVMA 2IY2A 5D9TA 3EVIA 4AJ7A 3P7XA 1TK0B 2YANA 3D0ZA 4PGTA 1ACVA 1MDIA 1GUHA 3G7JA 4L8EA 1U88A 4JEDA 2H1GA 2P5QA 1YKAA 1XZOA 2HE3A 1WWJA 4XS1A 2VO4A 4V1Ap 1KEBA 2RUFA 3CYNA 3R2QA 3JCML 1XWBA 3ZREA 4YQVA 1A2MA 2LRTA 1YKCA 3GA4A 3HVSA 4NAXA 3VWVA 2AUVA 3APSA 2DIYA 5ECPB 4K6XA 2MBSA 4HI7A 3HKRA 1QMVA 4NWYA 1A0FA 1ZYEA 2LQQA 3DGQA 2G0FA 1ZMAA 1QFNA 3WT2A 4O32A 4MZBA 2VCVA 2V1MA 5IPHA 1ZZYA 3TUEA 3C73A 1SK0A 1OYJA 2REMA 4I6XA 3ZTLA 4LMWA 3LSZA 1HNBA 3P2AA 2LTKA 3D4MA 5HR2A 4PNGA 3QAWA 4ML1A 4FYUA 4K7OA 2B7JA 5IOXA 5ECHB 3DXBA 1GUMA 1A23A 2HI7A 1GUKA 2HNLA 3CMIA 1XWGA 3GL5A 2IWTA 3MWHA 5IO2A 4EE0A 3TDGA 2H1BA 5COHA 1BQ7A 4WBRD 4K0GA 3CSHA 1J0FA 2CA8A 2OADA 2DJ3A 3F4SA 3HCZA 1I9DA 2M46A 1BX9A 1GSEA 4ZBDA 4LL1B 2NTOA 1SD9A 11GSA 5D8IA 2WB9A 2IMIA 1FG4A 1U3IA 2F3MA 1SYRA 3LXTA 1V2AA 3ZIJA 1VRSD 2ON5A 4PXOA 4Q5NA 3FR9A 3DRNA 2N5AA 1Z6NA 4E8HA 1AC1A 2CVKA 3D22A 1S3DA 2FA8A 4NHWA 3HZ8A 4PX1A 4ZILA 3ERFA 4MF5A 2NBSA 5JWRB 3H79A 4F0BA 2A4VA 3VPQA 1SK2A 4L5LA 3KIJA 3QFBC 2WGRA 4Z7XA 1ERWA 3KJYA 4PQIA 5EL8A 4EUYA 2VCWA 5G31A 4D73B 4LMVA 4X0XA 1UN2A 2DLXA 3TJJA 1WP0A 4ZIJA 1T00A 5DDLA 1MD4A 2C0EA 3H93A 1U3AA 2F9SA 3IK7A 3TRQA 2CV4A 2WRTA 4XS4A 1AXDA 5JWQB 2V6KA 5D73A 1OE7A 5ABRA 4RQRA 2PVQA 3CTFA 1A0RP 4I5QA 3EU3A 3HYPA 3TJBA 3GMFA 3BCIA 3VURA 1XPVA 4J56E 2L6DA 2TIRA 5AISA 5IO0A 1GTAA 4AJ8A 4ECCA 2EC4A 1R4WA 2GQLA 4WR4A 5C04A 3L9UA 2WCIA 4YAVA 4MPFA 3F3QA 3TKPA 2J23A 3ZIVA 2HFDA 5J5NA 1PKZA 3KH9A 5GAND 4V2LA 1USBA 4IVFA 4KCEA 4GSTA 4ZB6A 2YN1A 1HQOA 3KM6A 2GLRA 1GLPA 17GSA 2MZCA 2DJKA 4HZ4A 4Q5FA 4FIWA 4POLA 1W89A 5IIZA 1M99A 5HQPA 2HLSA 4PQHA 4POKA 2EIOA 5DVBA 1K0DA 1YDKA 1YEXA 1Z3EA 1CQHA 4MJBA 5DJMA 2KP2A 1Z7PA 4BWQA 2VCQA 4OFNA 4EL1A 1QUWA 3ZVJD 4GQCA 1TW9A 6GSYA 2ALBA 2KOKA 2F8AA 3LGCA 2H30A 4XCSA 2L5OA 3VWWA 2LUSA 1K0CA 3IA1A 4I97A 2YV9A 2FLSA 4IW9A 3LYPA 1BAYA 3E3EA 1T4YA 1JZOA 2E7PA 1G7OA 4IN0A 2K18A 1ABAA 2C0DA 4K7NA 2Z9SA 2GTUA 2FUG2 4MDCA 3WYWA 1M9AA 3FR3A 2IFQA 5F8BA 2LRNA 1K3LA 1PX6A 3HVVA 7GSSA 5CO3A 1G6WA 1X0RA 1WE0A 1TRSA 4RUVA 2PMTA 3QD9A 1V98A 1TK5B 1YF0A 2JL4A 1F9MA 2EIQA 2MMAA 1ZYQB 4RI6A 1TP9A 1GNWA 2A2SA 1B4QA 1RK4A 2ZUPA 2DJJA 3KMOA 1JZRA 4MF6A 3HY2A 5D9VA 3SBCA 1PMTA 5CAXA 5D9WA 1EP7A 1A8YA 1TRUA 3L78A 1EEJA 3FZ5A 5IQYA 1EV9A 2WJUA 3IC4A 2H75A 6GSVA 5IPGA 1AAZA 4YAPA 5AN1A 1XVWA 3EYTA 5E59A 1EOHA 1GSFA 2HRNA 4ZL9A 3NIVA 6GSWA 5GAPD 3GN3A 3M9JA 5KN0A 4EDZA 5ECIB 1EEMA 1GTIA 2WZ9A 3DIEA 5ECKB 5D96A 4XHMA 4CW9A 4XIHA 2L4CA 3DMLA 2JACA 4WF4A 1GNEA 5FWGA 4IQAA 4MMMA 1H75A 4MPGA 2CX4A 3UVHA 1TOFA 3ZZXA 2OBKA 2VOCA 1BEDA 1V58A 4XTSA 4NV5A 2HZEA 1YY7A 1EOGA 4MK3A 5INYA 1WIKA 3ME8A 1PRXA 2MMOA 2GGTA 6GSXA 2C1YA 2JZSA 2RM6A 2OE3A 3TKRA 3V1WA 1I5GA 5A4UA 2H1DA 4HOJA 4TXOA 3CRTA 1GL8A 5EPFA 1OKDA 2P31A 3GYKA 2H66A 5J41A 3GKNA 3DVXA 3H8QA 3F63A 4I2TA 3UL3A 1SL0B 3CTGA 4GXZA 1GSYA 3RHBA 3TOTA 4ZXGA 3LWAA 1GTUA 2FA4A 4KDUA 1GULA 5JCWA 5ECSA 2I3YA 4N0VA 3GIXA 4KDXA 4XS4B 3EINA 4TOPA 1KNGA 3L4NA 4TRXA 3RPPA 4V2NA 1AUCA 1THXA 3HJOA 2B1KA 1GSQA 2C8UA 3EE2A 5ECRB 1OVNA 1B48A 5HR3A 1NM3A 1SJ6A 1SENA 3FZ4A 1KBNA 1ZL9A 2LEGA 4K7IA 3A2WA 4ISDA 1F37A 12GSA 4TW5A 3IRAA 2L6CA 1TU8A 1DE2A 2XPEA 5J9BA 2N5BA 1GTBA 10GSA 3TJGA 2VM1A 3W8JA 3QR6A 5DJLA 4ZB9A 4DSRA 3L9SA 2QKEA 2HXKA 2QSIA 3VFIA 5DCHA 2F8FA 4TN8A 3GKXA 3IAS2 2FHEA 1X5CA 3GURA 4OO4A 3TKQA 3HD5A 2JADA 2YZHA 2YOIA 4O92A 3ZVJA 3AY8A 2B1LA 3LYKA 2DBCA 3C7MA 1TI3A 1Y6EA 2O7KA 1ST9A 3LXZA 4F2IA 2VCZA 4O7HA 5CRHA 2O85A 4OFMA 4YH2A 3LQ7A 3CRUA 2DJ1A 3QFAC 4KE3A 1X9WB 4OFTA 2GZZA 4OCFA 3G9BA 3VWUA 1XW9A 4EKZA 1SK1A 3G7YA 2BTOT 2H71A 3F4TA 5LNKe 5ECQB 2P0GA 3LG6A 19GSA 5JCUA 4IS0A 1TRWA 1R26A 2BMXA 1SKRB 2ON7A 2FWEA 2LQOA 2OBIA 4PNFA 1XW6A 3KP9A 2GZYA 4GCIA 3C1RA 1LBKA 4TKYA 2IFQB 3KTLA 2R4VA 2CQ9A 3F8UA 3K8NA 4OD7A 3M3MA 2V6OA 5ENUA 3F4RA 4PQ1A 1SD8A 1OKTA 3BCKA 4V1Ag 3IAM2 4GWRA 3HVXA 5JCGA 3Q18A 2H1AA 2NVLA 2FWFA 2CAIA 1OAZA 3KXOA 1K3YA 5IMAA 4POMA 1M9BA 4OMVA 2H6ZA 2H8LA 5J3RA 2ES7A 1E6BA 4F82A 2R6KA 1WPIA 4DSQA 3GH9A 2GSSA 1O7UA 3NOFA 1Z5YE 5ECOB 2DJ0A 2RIIA 5DAKA 1GWCA 2IMEA 4HJ2A 2OE0A 4JR4A 2VIMA 2WFCA 4FO5A 5D9XA 3MNGA 3HHVA 9GSSA 2GSTA 1YQ1A 4BA7A 2FY6A 3UBLA 1WMJA 5CNWA 2KLXA 4OCEA 2JZRA 5JWOB 3D21A 3UVTA 3ZYWA 3HA9A 5KN3A 1O73A 2B5EA 3F6FA 6GSUA 1A24A 3P8WA 3ED3A 4MZCA 4POBA 4GF0A 4JRRA 1TDIA 4IP6A 4JU5A 3GFKA 4WXTA 3KP8A 3KZQA 1V9WA 4Q5QA 3TKSE 2HZEB 2KHPA 1GLQA 3BJ5A 4LLRA 3BOAA 4MJAA 3QPMA 2L4QA 1FAAA 3M0FA 1QK8A 3LORA 3P90A 1K0AA 1O8WA 4F0CA 2YWOA 1HNAA 4GQFA 1XFLA 5EVOA 1GSDA 1U87A 2J9HA 2FWHA 4TXOB 4ACSA 1ILOA 3IE3A 4N11A 1VF1A 2X8HA 1G6YA 2R3XA 4TR1A 3TJFA 4GTUA 2QGVA 3VK9A 3IV4A 3FKFA 3LEFA 4GSNA 2B7KA 4PUAA 3F9UA 4RQXA 2LKUA 1A2LA 3D6IA 5H5SA 2XHFA 3C71A 5ID2A 2BJXA 1XOAA 3F6DA 2IL3A 5KN1A 3G7IA 2YWIA 1FHEA 3GKMA 4KX4A 4ZL8A 3GSTA 5AGYA 3M8NA 2WDUA 4G9HA 4FYCA 3CSJA 3FY7A 3UARA 1O8XA 3A5WA 3GRXA 5B8AA 1Z9HA 2PWJA 1B9XC 3GHAA 1SJZA 4KUNA 4IHUA 4WBJA 1IYHA 4KH7A 4BVYA 1HD2A 3SWLA 2B5XA 1ERUA 3Q6OA 4MF7A 3TGZA 2TRXA 3M1GA 2RLIA 3A3TA 3MAKA 3CXGA 3KD0A 2C3QA 1O85A 2IMFA 3I43A 1R7HA 5IMFA 4BPYA 1K0MA 2O89A 3KEBA 1DE1A 5IMZA 4ML6A 3RPNA 4ZBBA 3LJRA 3QDNA 1O81A 1WRYA 1Y25A 5H5RA 2JU5A 1AW9A 2GSQA 2OE1A 1XWKA 3ZFLA 4IKHA 1Z6MA 2PVOC 3ZMKA 3IXRA 3VPTA 1PL1A 2YPMA 1PKWA 1B8XA 5G30A 1EGRA 1K3OA 2XBQA 1B4PA 3KTBA 3D5JA 5G2ZA 4KGIA 4I2UA 3ZRDA 4F9ZA 1EV4A 3VWXA 3E9JB 4MZWA 2CAQA 3ISOA 1VF2A 1SL1B 3ZFBA 4NV2A 2AHEA 2AV4A 2IIYA 5G1KA 4MABA 4ECBA 3N9JA 1XBSA 2FD3A 3WGDA 1C72A 4MH2A 5HFKA 4I8BA 4WF5A 4L0UA 3EMPA 1SL2B 2AAWA 1ML6A 2X8CA 4RI7A 2X99A 4O5RA 3U5RE 4EXJA 4D73A 2FCHA 1DUGA 4ZB8A 1VF3A 5C00A 4DSSA 1GSUA 5IMDA 1MDKA 1FO5A 4KAEA 5ECMB 2V41A 1FB0A 5DAKB 4HUAA 2WS2A 3HZ4A 2DSAA 2MBTA 4HZ2A 2VUPA 2CZ2A 4G10A 5ELAA 3GTUA 1VGLA 1ZCPA 3N5OA 2RUEA 3HJMA 1Q98A 1X5DA 4WEYA 5B8BA 2D2ZA 5B6NA 4L5OA 3ZMLA 1J9BA 1MTCA 1O6JA 2VL2C 1FW1A 1GH2A 2LV3A 2PPTA 2QC7A 1S3CA 2I81A 2VAFA 1NHYA 2DMMA 2PERA 4QQ7A 2VCTA 2CZ3A 4G19A 5J4UA 4G2EA 4TXVA 4LL4B 1VF4A 4MCUA 5DCGA 1CQGA 1PGTA 2G2QA 5F06A 2YWNA 3RAZA 1XWAA 1TXXA 4EF0A 2H6XA 2B5YA 2H72A 1T3BA 3KGKA 3WGXA 2C3TA 1NSWA 1T4ZA 4TR0A 4K0NA 2C0GA 5DALA 1ZGNA 1MEKA 1SU9A 1PL2A 4WKWA 2F51A 4AGSA 4TR1B 1SKWB 2H0HA 1GP1A 1H4OA 5G5EA 3O3TA 4WR5A 1WJKA 2E2GA 3J7Yk 2JSZA 2YWMA 3QOUA 3J7Yb 1BYEA 3US3A 4KA0A 5ID2B 2GT6A 3VLNA 3QCPA 4MJEA 1UVZA 3CSIA 4HS1A 3FYGA 3IK9A 4ID0A 4XS6A 5A4VA 5GZZB 4EO3A 1AQWA 1AQVA 4IJ3A 3TB2A 2CVDA 2M72A 2OKAA 1RQMA 4L0WA 4OO5A 3GH6A 1LU4A 1NHOA 2HT9A 2CX3A 2DMLA 2IJYA 3APQA 2O8VB 2K6VA 2VM2A 2XBIA 18GSA 1M2BA 1A8LA 1N2AA 3Q19A 1A2JA 5CRDA 2JSYA 1F6MC 2X8GA 4AJ6A 1PX7A 4HEA2 1YJ6A 5L71A 2VL3A 2L57A 2FNOA 1QGVA 2A2RA 1K0BA 3IDVA 3UJ1A 5DQSA 1T8EB 3BBYA 5IMVA 1M2DA 4GRFA 4YQUA 1DSBA 2IMDA 3IR4A 1HYUA 3NZNA 1DBYA 3UIWA 2E2MA 1AIUA 2GZPA 4DVCA 5HR1A 3UBKA 2XPDA 4PUFC 4JZQA 2VLVA 3C8EA 4HU7A 4EDYA 4KNDA 4OWYA 1OC9A 3ZITA 3HJPA 3RBTA 2YP6A 4X43A 1EGOA 4NXIA 1XVQA 3WT1A 4K9ZA 2RM5A 5DQYA 3PGTA 4HQZA 5H5QA 3TOUA 2OJLA 2E0QA 3PH9A 1TTZA 3BD2A 1ERVA 1BJXA 2GS3A 2N5FA 1QXHA 3F0IA 4MH3A 3GNJA 3DKSA 2VLUA 2VLTA 4CDOA 2YJ7A 1WOUA 2IN3A 2C80A 3EU4A 1JLVA 5HFIA 2HSYA 1XOBA 16GSA 4HJMA 3L9VA
chains in the Genus database with same CATH superfamily
4R1KA 4NHZA 5LC6A 4X2OA 1EWXA 1DMMA 4J5GA 2W2CA 1N8JA 5GSSA 1XIYA 1RLSA 3TRPA 5LCZA 3RHCA 2LS5A 1IYIA 2OQEC 1T1VA 1JN5A 3SVAA 5IM9A 2GDRA 5HGRA 2H6YA 2B3SA 3ME7A 2WULA 3DD3A 2LSTA 2I4AA 1V57A 3D4TA 13GSA 1W6CA 5D82A 2GQMA 4J57E 5F0GA 4ILFA 1MD3A 2AB6A 2WGOA 1M1K4 3D79A 3OX9A 1AVKA 3IHQA 3SOYA 1PU4A 3QK9A 3UMAA 2VCXA 3QAGA 3FRCA 3CCJ3 3OW22 4GLTA 4HM8B 3TKSC 3I9V2 1V74A 2AJQB 3TCOA 3DGNA 2DJ2A 1YJN3 2PN8A 4IQ1A 4DSSB 1ZS7A 1BRIA 1RSNA 2X64A 3EPTA 4N6MA 2H01A 3GSSA 3DXOA 1E97A 1XWCA 3LOYA 2WOHA 4ULXA 2OACA 4BWSA 3QMXA 3TKSA 1B20A 1RGCA 1IDPA 1F3BA 3KE7A 5KN2A 1BG5A 3EN1B 1URMA 3GTUB 5AEUB 4R9KA 1TFKA 1Q864 3TJKA 4XRAA 4EYCA 2WO0A 1AQXA 1W4VA 1UCIA 1M2AA 2J8XB 2C0FA 1OC8A 4GSSA 5KP3A 1U6TA 1GRXA 1BNRA 4V2MA 1KTEA 2H76A 1WMPA 4EBGA 2UGIA 2K8SA 1OE8A 3BB9A 2LNSA 3ER7A 6RNTA 1B2ZA 1R5AA 1SKSB 3KMNA 4XM4A 5AYRB 4LA1A 3GKKA 2HMMB 2P0XA 1RN4A 4KF9A 2YV7A 1BRGA 5CYYA 3O76A 5EY6A 2I9HA 1OF5A 4F03A 3A5EA 4HDEA 3EF8A 5EVHA 3NBRA 4WP5A 4WYKA 3W6GA 4BVXA 1X9SB 2CT6A 1BOXA 3GL3A 3FZAA 3OWYA 2CVBA 4FH8A 4TR4A 2IYJA 2GSRA 1YZXA 1W2B2 3PZWA 1FUSA 1RW1A 3EN8A 1JFUA 4JE1A 1ZOFA 4X1UA 1RGFA 4I4KA 3F3RA 4XRDA 1STFI 1PD21 2M80A 1RN1A 2O87A 5LD0A 2ZDJA 1OH0A 1JZWA 3NQZA 3S29A 5KEJA 1I3IA 2KUCA 3BNBA 3KH7A 3G16A 5AIVA 2C4JA 3MHEA 3CC43 1HU9A 3FCSB 5HR0A 3A2XA 2IPAA 4IIAA 4E8EA 2YCDA 4CHSA 5G5FA 1FUTA 2JZTA 5AIXA 4N3VA 4MLYA 2P09A 2RBIA 3PCRA 3ZFZA 2LJRA 5DALB 4EC0A 1W2ZA 1G7EA 4P3YB 2H74A 4FYBA 1YJW3 1IVWA 1JLWA 2NDOA 1E2YA 3VI7A 4YKFA 4ZBAA 2XF3A 1ASKA 1NW2A 2YZUA 2H73A 4JR6A 6GSTA 1TRPA 22GSA 3APOA 2HYXA 1B21A 3FR6A 2CFWA 3RDWA 4PTSA 3FEUA 4BIKA 4BL7A 4H61A 4ZM8A 5AI1A 3D5GA 2XC2A 4HU9A 3HDCA 2PUKC 5FT3A 2IMKA 3FHKA 5A4WA 3A5IA 4BL3A 1PA3A 2MMNA 1X9MB 3NX0A 5ECLB 5B6MA 2LRCA 4O5QA 3LTDA 4AF2A 1RGEA 2DIZA 4N0ZA 2VD1A 3SOAA 2HSHA 3GX0A 1UC7A 2VL9A 2H70A 5ECNB 1JBSA 4TR3A 5ELGA 2YFJB 1MWUA 1W6YA 4FMBA 3LFLA 3ZL5A 2HZFA 3SX1A 5DBQA 3FZ9A 1Y4KA 3VI5A 1F2EA 2DC5A 2GQKA 1RDSA 14GSA 1WMNA 4N6LA 4CJNA 1V40A 3EC3A 2FWGA 1TK8B 1QQ2A 1ZGXA 3MSOA 2W6JH 1FB6A 1Q814 1A67A 3DVWA 1U5OA 2XFSA 4NPBA 2OTJ3 4KT3B 3E0UA 1OC3A 4Q5RA 4IP1A 5HFGA 3MSZA 1Q4JA 2L5LA 3G4S3 4HJMA 4H86A 5M19A 2PBJA 3ZLPA 6GSSA 2C3NA 1TI1A 5E4WA 3TRXA 3C1SA 4MP4A 1MDJA 4N30A 1RCKA 1M7TA 4KFEA 1B2MA 2YJHA 2KF3A 3MDKA 3GX8A 5IMCA 1TJDA 5G1LA 4PURA 4KCAA 4HM3B 1GY6A 1WTHA 2SARA 4IBPA 1M904 5F07A 1HNCA 1W02A 2NPBA 1K0OA 3I0YA 1EZKA 1X5EA 4K8MA 2V2GA 1K0NA 1X1YA 1FVKA 5D83A 2HMKB 3CBUA 2IUJA 3RGRA 3PINA 1GSSA 3ZG5A 2YFIB 1OHPA 4IGJA 1TU7A 3ERGA 1SYXA 3GAXA 4FMCA 1HKXA 4J9AA 2K9FA 4CPKA 4QL9A 2H0IA 4J5KA 5BMUA 3GRDA 1XXUA 3EMXA 4DEJA 5A5KA 3Q74A 3UEMA 3H1NA 2HRFA 2H19A 3IPZA 1BRKA 4NMUA 1K9M4 3S9FA 2LJKA 2R2JA 3WD6A 3GUSA 3M9KA 4KDYA 4MJCA 5GSPA 3EWLA 1VQL3 3W8SA 2P5RA 3UB1A 3L0HA 3OV4A 3HX8A 2MYGA 2HMLB 1PQNA 3FLJA 3IMAB 2R37A 2M7OA 3CU3A 4RNZA 1OC9B 3MWZA 3DGMA 3FW2A 1B9YC 2CHCA 3DYRA 4QL7A 2I1UA 5F05A 5J9CA 1TU5A 2XR8B 1YEPA 1S3AA 2AYTA 3UOMA 1ERTA 3I69A 5DRVA 1R5PA 3HXSA 5D81A 5GSTA 3WGEA 3K0ZA 2B6MA 4N10A 5CP1A 3T0UA 3IOSA 3ERWA 2ZCTA 4STDA 2PGTA 1XCCA 1M0UA 2FGXA 2TRCP 3U6VA 3I6AA 1SJIA 1T7PB 2JQ5A 1TUHA 3IBHA 4K2DA 3LYGA 4LMIA 3H4KA 4BTYA 2W04A 1JB4A 1J08A 2K8VA 1TRVA 3DWVA 4IJIA 3EURA 1GD4A 4J2FA 1JHBA 2YNXA 4HBRA 3D3LA 1IV9A 3UL5A 2GVPA 2PU9C 3F8XA 1TIJA 4WETA 5D93A 2ZNMA 1ROVA 4TVEA 3IJEB 4ECIA 2F86B 3O6TA 1UA5A 4KSOA 1LOWA 1JN5B 5FHIA 3DZLA 5HOHA 1LJRA 4KSMA 3UAPA 2GT5A 4HQSA 1KQS2 2H0GA 3V92A 4QWTA 1UUGB 20GSA 1PSQA 1VQ93 1GOVA 1TTOA 1FOVA 1Z7RA 1YHQ3 3GV1A 4MA9A 3CCU3 3O8YA 2Z76A 1BSCA 1UCLA 2VL2A 3A2VA 3LXUX 1THOA 4K1FA 2LJAA 2A15A 3X42A 3KCMA 2FXTA 4JBBA 5IOWA 1X1WA 2EIRA 5CRGA 3G0KA 2V32A 5IW9A 2MMZA 5B7CA 2LNTA 5BRTA 3PCSA 3U97A 1PN9A 3I553 1MGRA 1F3AA 2GU1A 3OR5A 4G0KA 1ON4A 4GL6A 4ZL7A 2VD0A 4ECJA 2OA7A 1EP8A 4X4JA 5CREA 1MWRA 2HMJB 3OWUA 2BIRA 1BUJA 1O7HB 1G0TA 2L59A 4IELA 1TKDB 3KIIA 3PR8A 4KW6A 3VF1A 1YF1A 3DEXA 8GSSA 2KP1A 2KF5A 3F40A 2CH9A 3AMOA 4DKIA 1AVLA 2QGUA 1UGHI 4KB3A 1XW5A 2KRTA 5CRWA 1IT7A 3FK8A 2R5GA 3QAVA 5IG3A 4YQMA 1STDA 1JZDA 3MYTA 1FVJA 1I8VA 4EVMA 2W56A 2IY2A 5D9TA 3EVIA 1BSBA 4AJ7A 2GXFA 3CC73 3P7XA 3HVNA 7GSPA 1RNTA 3UJMA 1TK0B 1OF5B 3KZTA 2YANA 3D0ZA 3WODG 4PGTA 1ACVA 1MDIA 1GUHA 4EXRA 3G7JA 2XH9A 4L8EA 3MIXA 3FGYA 4BVXB 1U88A 3BNDA 4JEDA 2H1GA 2P5QA 1OGXA 1YKAA 1FW7A 4CDLA 1XZOA 2HE3A 1WWJA 4XS1A 7STDA 2VO4A 4V1Ap 1KWIA 2P05A 1KEBA 3LT9A 4FMDA 4KFDA 4LGQA 2RUFA 3CYNA 3R2QA 3JCML 1XWBA 3ZREA 1L5GB 4FCJA 1BRHA 4YQVA 2F4YA 1A2MA 3WOFB 2V1LA 2LRTA 1YKCA 3GA4A 3HVSA 4NAXA 3VWVA 2AUVA 3APSA 2DIYA 5ECPB 3CMA3 4K6XA 2MBSA 3JUOA 4HI7A 4AKZA 3HKRA 1QMVA 4NWYA 1A0FA 1IVVA 4Z2TA 1ZYEA 2LQQA 2FGTA 3DGQA 2G0FA 1ZMAA 1QFNA 1ZYPA 3WT2A 3CNMA 4O32A 4L8OA 3CQFA 4MZBA 3FSDA 5IG0A 4K5SA 1RRHA 1D6ZA 2VCVA 2V1MA 5IPHA 1ZZYA 3TUEA 3C73A 4BL7B 1SK0A 1OYJA 3KN4A 2REMA 4I6XA 6STDA 3ZTLA 4LMWA 1QAFA 3LSZA 1HNBA 3P2AA 2E2VA 2LTKA 3D4MA 5HR2A 1JJ22 1GYBA 4MMXB 4PNGA 3QAWA 4ML1A 4FYUA 4O02B 4K7OA 2B7JA 5IOXA 5ECHB 4WHAA 3DXBA 3CCL3 7RNTA 1GUMA 4NREA 2IUKA 3QRDA 1A23A 2HI7A 1GUKA 2HNLA 3CMIA 2QA43 3Q3FA 4HOHA 1XWGA 3GL5A 3GZBA 1Q42A 2IWTA 1AQZA 3GSPA 3MWHA 5IO2A 4EE0A 1YIJ3 2OTL3 1W7CA 3TDGA 2Q07A 2H1BA 4HZ9B 5COHA 1BQ7A 2BMOB 4WBRD 2QIYA 2AADA 4K0GA 3CSHA 1J0FA 2CA8A 2OADA 1W4NA 2DJ3A 3F4SA 3HCZA 2C4BA 4MMYB 1I9DA 4N6NB 2M46A 1BX9A 1JRQA 4X2HA 2QEX3 1PFPA 1GSEA 1BNEA 4ZBDA 4LL1B 2A2PA 2NTOA 3WA3A 1SD9A 1BSAA 11GSA 5D8IA 1O7PB 1RGGA 1BNSA 4LYLB 4O3VA 2WB9A 5M1AA 3CCM3 2K54A 4HM5B 1FG4A 1U3IA 2F3MA 1SYRA 2IMIA 3LXTA 1MWSA 1BNIA 1Z1SA 3NXJA 1V2AA 3ZIJA 1US1A 1VRSD 1MGWA 3FF2A 2ON5A 4PXOA 4Q5NA 1QJGA 2OWPA 3FR9A 3DRNA 2N5AA 1Z6NA 1R4YA 3DGOA 4G0LA 4E8HA 1AC1A 4KZ1A 2CVKA 3D22A 1S3DA 2FA8A 4NHWA 1N9EA 3HZ8A 4PX1A 4ZILA 3ERFA 4MF5A 1JNQA 4LZIA 2NBSA 5JWRB 3H79A 1I0XA 1ZYNA 3EX9A 4F0BA 5JBSA 2A4VA 5AIFA 3V99A 4R9LA 4G1MB 3VPQA 3CME3 1SK2A 4L5LA 1AV4A 3KIJA 2CKFB 3QFBC 2WGRA 4Z7XA 2OQEA 2UX0A 1ERWA 3KJYA 4PQIA 5EL8A 4EUYA 2VCWA 5G31A 4D73B 4LMVA 4X0XA 3SLUA 1UN2A 2DLXA 4K2XA 2SBLA 3TJJA 1WP0A 4ZIJA 1T00A 5DDLA 2CX0A 4EIPA 1MD4A 2C0EA 3H93A 1Q40A 4EV5A 1U3AA 2F9SA 3IK7A 3TRQA 1W6GA 2CV4A 2WRTA 4XS4A 1AXDA 5JWQB 2V6KA 2BMQB 3EC9A 5D73A 1OE7A 5ABRA 4RQRA 5EQLA 2PVQA 3CTFA 2BO9B 1A0RP 4I5QA 3EU3A 3HYPA 3TJBA 3GMFA 3BCIA 1IQXA 4A5PA 3VURA 1LOVA 1IT8A 1XPVA 4J56E 2L6DA 2TIRA 1MOLA 3MKIA 5AISA 1SJWA 2HMOB 5IO0A 1GTAA 2R0PA 4AJ8A 4ECCA 2EC4A 3JUPA 5CF2A 1R4WA 2GQLA 4WR4A 5C04A 3L9UA 2WCIA 4YAVA 1KD14 4MPFA 3F3QA 2KF6A 3TKPA 2BMRB 2J23A 3ZIVA 2HFDA 5J5NA 2E2UA 1PKZA 1WNHA 2XGNA 3KH9A 5GAND 9RNTA 4V2LA 3WOEB 1USBA 4IVFA 3UNLA 4GSTA 4KCEA 4ZB6A 3BNEA 2YN1A 1HQOA 2XSOB 3U1WA 3KM6A 2GLRA 1BRSA 2HRAA 5IG4A 1RCLA 1GLPA 1T2HA 17GSA 1IVXA 2Y74A 2MZCA 1RGAA 3CCS3 3LTAA 2RFRA 1GMQA 1K28A 3IPTA 3N8BA 4H3UA 2DJKA 4HZ4A 4Q5FA 4FIWA 4POLA 1W89A 5IIZA 4XB5A 3H51A 1M99A 5HQPA 3DMCA 2HLSA 4IPBA 4PQHA 5BVBA 2EIOA 4POKA 3RDEA 3NV0A 1BNJA 5DVBA 4Z2RA 2XGLA 1K0DA 1YDKA 1YEXA 3EBYA 1Z3EA 1CQHA 3AMOB 4MJBA 2XEPA 5DJMA 2KP2A 5IERA 1Z7PA 1RRLA 1Q824 4BWQA 3MYDA 4YKGA 2VCQA 2W56B 4OFNA 4EL1A 1QUWA 3ZVJD 1DETA 4GQCA 1TW9A 2BNGA 6GSYA 1VQ83 1QVF2 2YFLB 2ALBA 2KOKA 2F8AA 4KVHA 3LGCA 2B1XB 2H30A 4XCSA 2RSXA 4XBYA 2L5OA 4HKVB 3HIGA 2QA2A 5IENA 3VWWA 2LUSA 3AGOA 1K0CA 3IA1A 2D42A 4CY6A 4I97A 5AIIA 2YV9A 1PYLA 4GSPA 4HJLB 1FZUA 2FLSA 4IW9A 4HAAA 5KOWA 1YVBI 3LYPA 1BAYA 4MEIA 3E3EA 1T4YA 1JZOA 3G8ZA 2E7PA 1G7OA 4IN0A 2K18A 1ABAA 1CYUA 2C0DA 4K7NA 2Z9SA 2GTUA 2FUG2 4MDCA 3WYWA 4MNNA 1M9AA 3FR3A 2IFQA 2CFDA 1O7NB 3KKGA 2LRNA 5F8BA 4OUQA 1JKGA 3F7SA 3S28A 1K3LA 1PX6A 3HVVA 2INXA 1YVSA 1A2VA 1B2SA 7GSSA 5CO3A 1G6WA 3ROBA 1X0RA 1WE0A 4FCZA 1TRSA 2RCDA 4RUVA 3AHWA 2PMTA 3QD9A 1V98A 2UUGC 1TK5B 2CW9A 1YF0A 2JL4A 1F9MA 2EIQA 2MMAA 3PYJA 1ZYQB 4RI6A 1O7MB 1TP9A 1GNWA 3GZXB 5STDA 3F14A 3LH4A 1B2UA 1Q9EA 3K5TA 2A2SA 2WGQA 4WFOA 1NWWA 1B4QA 1LNHA 1RK4A 2ZUPA 2DJJA 4K5RA 3KMOA 1JZRA 1S3RA 4MF6A 3HY2A 5D9VA 1GY5A 3MG3A 3SBCA 3NBJA 1PMTA 1B2XA 5CAXA 2WOFA 1LXEA 2CWVA 1DE3A 5D9WA 4R4KA 3PPUA 1PN0A 1EP7A 4ICYA 1A8YA 1TRUA 3L78A 1EEJA 3FZ5A 5IQYA 2CG1A 1EV9A 1GMPA 3DGYA 3EQQB 2WJUA 1BU4A 3IC4A 2H75A 1BGSA 6GSVA 2OOVC 5IPGA 1S723 1AAZA 3K9MC 4YAPA 5AN1A 3X3ZA 1XVWA 3EYTA 1KC84 5E59A 1EOHA 1FGRA 3T8UA 3FH1A 1GSFA 2HRNA 2ML5A 2Z7AA 4ZL9A 3NIVA 6GSWA 5GAPD 2C11A 1EKMA 2CX1A 3GN3A 2AAEA 3M9JA 5KN0A 4EDZA 5ECIB 2L1SA 1HYFA 1EEMA 1SIHA 1GTIA 2WZ9A 1E3VA 3DIEA 5ECKB 1OGZA 5D96A 4XHMA 4CW9A 1SARA 4XIHA 2L4CA 3DMLA 1A2KA 4N6UA 2JACA 4WF4A 1GSPA 1GNEA 2RNTA 5FWGA 4IQAA 4MMMA 1H75A 4MPGA 2CX4A 3UVHA 2QA1A 2C10A 1TOFA 4L7KA 2OBKA 3ZZXA 2VOCA 4O8SA 1BEDA 1V58A 4XTSA 1JV2B 4NV5A 3IHGA 5IEPA 4JRFA 2HZEA 1RKYA 1YIT3 1YY7A 1FGMA 3SEDA 1EOGA 4MK3A 1OHOA 5INYA 1O7GB 1BSEA 1WIKA 3ME8A 1DVDA 1PRXA 2MMOA 2GGTA 4Q53A 4HM6B 5DREA 6GSXA 1BNFA 4HM1B 2C1YA 1RGKA 3A76A 3B4OA 2JZSA 2RM6A 2OE3A 1G02A 3TKRA 2F56A 3V1WA 1I5GA 5A4UA 1ZX2A 5AIHA 3FG4A 3EBTA 3WR2A 3HIIA 2H1DA 1M1XB 2GEXA 3KFQC 4HOJA 4TXOA 4XDWA 3CRTA 1GL8A 2CFKA 1OKDA 1G96A 2P31A 3GYKA 5EPFA 2H66A 5J41A 3GKNA 3DVXA 2W0QA 3H8QA 3G713 3F63A 4I2TA 4MJDA 1DVCA 1LQMB 3UL3A 1TFOA 1SL0B 3CTGA 4GXZA 3KSED 1GSYA 3RHBA 3TOTA 4ZXGA 1VQ53 1YJ93 1Q40B 3LWAA 1GTUA 2FA4A 4KDUA 1GULA 4NHFA 5JCWA 5ECSA 2I3YA 4N0VA 3WA2X 3GIXA 3I563 4KDXA 4XS4B 3EINA 4TOPA 1KNGA 3L4NA 4TRXA 4K61A 3RPPA 4V2NA 1Q7HA 3FG1A 1J2BA 1AUCA 1THXA 3WMDA 3HJOA 2B1KA 1UDII 1GSQA 3HZPA 5KOXA 2C8UA 3EE2A 5ECRB 1OVNA 1B48A 5HR3A 4HM2B 1FYSA 1R4CA 1NM3A 3BIRA 1SJ6A 1SENA 3FZ4A 3AHSA 1FOHA 1KBNA 2HMNB 1FA3A 1ZL9A 1BANA 5IG5A 4HSCX 2LEGA 3D5IA 4K7IA 3A2WA 1VQ43 4ISDA 1F37A 12GSA 4TW5A 1UCJA 2CIUA 3IRAA 1RNBA 2L6CA 4FCMA 1LOYA 2F98A 1TU8A 1DE2A 2XPEA 5J9BA 2N5BA 1MNLA 1GTBA 10GSA 3TJGA 2VM1A 1UGIA 3W8JA 2JDIH 4WYKB 3QR6A 4K1VA 1PFOA 1AY7A 5DJLA 2Y73A 4ZB9A 2HOHA 4DSRA 3X3XA 3L9SA 2QKEA 2HXKA 2QSIA 3VFIA 1UCKA 1RGHA 2CFLA 3CC23 2O9UX 5DCHA 4EW5A 2F8FA 4TN8A 3GKXA 1BRJA 3S27A 4RBNA 3NQYA 3IAS2 3JUQA 2I9WA 3STDA 2FHEA 1X5CA 3GURA 1LQGC 2FNQA 4OO4A 3TKQA 2GBXB 3HD5A 2JADA 2YZHA 2YOIA 4O92A 3ZVJA 1KSIA 3AY8A 3J7Yd 2B1LA 3LYKA 2DBCA 3C7MA 1TI3A 1NU3A 1Y6EA 2O7KA 1ST9A 3LXZA 4F2IA 2VCZA 4O7HA 5CRHA 2O85A 3MG2A 4OFMA 4YH2A 3LQ7A 4FMAA 3CRUA 3DM8A 3X41A 2DJ1A 3QFAC 4KE3A 1ISKA 1X9WB 1VQO3 4OFTA 2GZZA 4OCFA 2CG0A 5AIGA 3G9BA 3VWUA 1XW9A 4EKZA 1NDOB 3OWSA 1SK1A 3G7YA 2BTOT 1NB3I 2DKIA 1RJOA 2H71A 3F4TA 5LNKe 5ECQB 2P0GA 3LG6A 4BL2A 19GSA 5IEOA 5JCUA 4CCVA 4FR9A 4IS0A 1N9JA 1EG9B 1VQ63 1VQN3 5LC7A 1TRWA 1R26A 2BMXA 1IVUA 1SKRB 2ON7A 2FWEA 2CC3A 1UUVB 3ALAA 2LQOA 2OBIA 4PNFA 2GBWB 1XW6A 1BSDA 3FG3A 2GZYA 3KP9A 3NHXA 2XSHB 4GCIA 3C1RA 1LBKA 4TKYA 5IF6A 2IFQB 3KTLA 2R4VA 2CQ9A 2RGQA 3F8UA 1JKGB 3K8NA 4OD7A 3M3MA 2V6OA 1EQKA 5ENUA 2R4IA 3F4RA 1RHLA 5FGOA 4PQ1A 3LTBA 3K7CA 1SD8A 1OKTA 4EC6A 3BCKA 4V1Ag 3IAM2 4GWRA 3HVXA 5JCGA 3Q18A 2H1AA 2NVLA 3B4PA 2CAIA 1OAZA 2FWFA 5A0OB 3KXOA 1K3YA 3M8CA 5IMAA 4POMA 1M9BA 4OMVA 2H6ZA 3ECFA 5CF1A 2H8LA 3LTCA 4KFFA 5CK6A 1N5HA 5J3RA 3WHOA 3F8HA 2ES7A 1E6BA 4F82A 2R6KA 1WPIA 4DSQA 1C7HA 3LMLA 3GH9A 2GSSA 1O7UA 1DMNA 3NOFA 1F8NA 1Z5YE 3S67A 5ECOB 3JUNA 2DJ0A 2RIIA 1ULIB 2XRXB 3RNTA 5DAKA 1GWCA 3EHCA 1Q7Y4 1BUQA 2IMEA 4HJ2A 2OE0A 4JR4A 2VIMA 1FGOA 2WFCA 4FO5A 2W9PA 1LRAA 5D9XA 3MNGA 3HHVA 9GSSA 2GSTA 3CCR3 3JUMA 1YQ1A 3D9RA 4BA7A 2FY6A 3UBLA 4Z2UA 3EB8A 1M9GA 1WMJA 5CNWA 2KLXA 1TRQA 1VQK3 4OCEA 2JZRA 1BVIA 5JWOB 3D21A 3UVTA 4N6V0 3ZYWA 1FGTA 3HA9A 5KN3A 1O73A 2B5EA 3F6FA 2MC8A 1BIRA 1RGLA 6GSUA 1A24A 3P8WA 3ED3A 1OCVA 4HVNA 4MZCA 4POBA 4EV2A 4GF0A 4JRRA 1TDIA 3BNCA 4IP6A 4JU5A 3GFKA 4WXTA 3KP8A 3KZQA 3VGNA 5BIRA 1V9WA 6GSPA 1FUWA 1E3RA 3X3YA 4Q5QA 2CFGA 4OVMA 2MF7A 1CH0A 3TKSE 1UW1A 2KXGA 2OCTA 5I97A 2HZEB 2KHPA 1GLQA 1S5AA 3BJ5A 4LLRA 3BOAA 4MJAA 2E2TA 3QPMA 2Z6BA 2L4QA 1UI8A 1FAAA 3M0FA 1QK8A 1LVNA 1JBRA 3LORA 1GOUA 3HK4A 3P90A 1K0AA 1O8WA 4F0CA 2YWOA 3PS8A 1PY3A 1HNAA 4GQFA 1XFLA 5M18A 5EVOA 1GSDA 1U87A 2J9HA 1CYVA 4GHOA 2FWHA 3BU4A 1NO3A 3L0RA 4TXOB 1I2FA 2W03A 2K3DA 4ACSA 1ILOA 1IK3A 4J8TA 3IE3A 2KCDA 3F9SA 4N11A 1VF1A 1WQLB 3CXC2 2X8HA 4XDVA 1G6YA 2R3XA 2ZHXB 4TR1A 3TJFA 1A90A 4GTUA 3UL6A 8CHOA 2QGVA 3VK9A 1GD3A 4TX4A 2GSPA 5KP4A 3IV4A 3FKFA 2R0GA 1C54A 3LEFA 4GSNA 2B7KA 4HM7B 4PUAA 1O7WB 5RNTA 3F9UA 2L4VA 3OXAA 4RQXA 2LKUA 1BAOA 3HOHA 1A2LA 5G2GA 3RGAA 3D6IA 5H5SA 3F7XA 2XHFA 3C71A 3SXXA 4EIQA 4K1UA 5ID2A 2BJXA 3D4AA 1LNIA 1XOAA 3F6DA 2IL3A 1QVG2 1W00A 1EUIC 5KN1A 2BU4A 3B8LA 3G7IA 2YWIA 1UI7A 1FHEA 3GKMA 1N8R4 4K90B 4KX4A 4ZL8A 3GSTA 5AGYA 3M8NA 8RNTA 2WDUA 4G9HA 4FYCA 1OUNA 3CSJA 3Q1CA 4N6OB 3FY7A 1O8XA 3UARA 2CK3H 3A5WA 3GRXA 2CWTA 5B8AA 1Z9HA 2PWJA 1B9XC 3GHAA 1SJZA 4KUNA 4RZMA 4IHUA 4WBJA 1IYHA 2DKHA 1I2EA 4KH7A 4BVYA 1HD2A 2GEYA 4HM4B 4ORLA 5TGNA 3SWLA 1GS3A 2B5XA 1ERUA 3Q6OA 4MF7A 3TGZA 1ZO2A 3MPHA 2TRXA 3EE1A 3M1GA 3AGNA 2RLIA 4AEQA 3A3TA 3VSYA 3MAKA 3CXGA 3KD0A 4MMZB 2C3QA 1O85A 1B27A 2IMFA 3FZWA 3I43A 1W5ZA 1R7HA 2XFTA 2ZL8A 2PZVA 1K734 5IMFA 4BPYA 1K0MA 2O89A 1N8QA 3KEBA 1DE1A 5IMZA 4ML6A 1RTUA 3RPNA 1OHSA 1NNVA 2F5MA 4ZBBA 1NJI4 1XG8A 3LJRA 3QDNA 2F99A 1O81A 1WRYA 3CCE3 4JF8A 1Y25A 2JU5A 1LOXA 1AW9A 5H5RA 2GSQA 2R0CA 2OE1A 3B7CA 1DYUA 1XWKA 3ZFLA 4IKHA 5JPUA 3NM2A 3WDGB 1Z6MA 2PVOC 3ZMKA 3IXRA 1M3JA 3VPTA 1PL1A 2YPMA 1PKWA 1B8XA 5G30A 1EGRA 1K3OA 2XBQA 2X4AA 1I0VA 2O3OA 1IYYA 3GZYB 3LT8A 1JBTA 1K41A 3S5CA 3FF0A 1B4PA 3D5JA 3KTBA 5G2ZA 4KGIA 4I2UA 3ZRDA 4F9ZA 1K8A4 3CD63 1EV4A 3VWXA 3E9JB 4MZWA 2CAQA 3ISOA 1VF2A 1SL1B 3SYUA 3ZFBA 4NV2A 2AHEA 2AV4A 3IC8A 2IIYA 3GWRA 5G1KA 3NBBA 4MABA 2UZ8A 2OOVA 4ECBA 3N9JA 1XBSA 2FD3A 3WGDA 3K63A 1C72A 1WMOA 3KCHA 4LSOA 4MH2A 5HFKA 1VZZA 4I8BA 4WF5A 4L0UA 3CNXA 3EMPA 2LYXA 2R41A 1SL2B 2AAWA 1ML6A 4O2HA 5EEOA 2X8CA 1D6YA 4RI7A 2X99A 4O5RA 3X40A 1JB2A 3U5RE 4EXJA 4D73A 2F5WA 2ZA4A 5ELUA 3HI7A 2FCHA 5AEWB 1DUGA 4ZB8A 3G6E3 1VF3A 5CLKA 5C00A 4DSSA 1GSUA 5IMDA 2IA7A 1BRNL 1MDKA 1FO5A 4KAEA 5ECMB 1QAKA 1I3FA 3JVCA 1RMSA 2V41A 1FB0A 5DAKB 2P0MA 4HUAA 3Q90A 2WS2A 3HZ4A 2DSAA 4BTWA 2MBTA 4HM0B 4HZ2A 2VUPA 2CZ2A 2BHMA 1OPYA 1JB5A 4G10A 5ELAA 4RNTA 1YNVX 3GTUA 1AR0A 1VGLA 2CWUA 1ZCPA 3N5OA 2RUEA 3HJMA 1Q98A 1X5DA 3BLZA 4WEYA 5B8BA 2D2ZA 5B6NA 5ELJA 4L5OA 3ZMLA 3NM7A 1J9BA 1MTCA 3DUKA 3Q2PA 1O6JA 2VL2C 1FW1A 1T2IA 1GH2A 2LV3A 2PPTA 2QC7A 1TP6A 1S3CA 4L8PA 2I81A 1SIIA 2VAFA 2HRKA 1NHYA 2DMMA 2BT3A 2A4HA 2PERA 4QQ7A 2VCTA 3GZRA 2CZ3A 2GU3A 4G19A 5J4UA 4G2EA 1ROAA 4TXVA 3E99A 4LL4B 1GMRA 1VF4A 4MCUA 1HZ1A 5DCGA 1CQGA 1PGTA 2G2QA 5F06A 4AKYA 3ZG0A 2YWNA 3RAZA 1XWAA 3N9HA 1TXXA 3CPOA 1FGQA 4EF0A 2H6XA 2B5YA 2H72A 1B3SA 1IQYA 1VQ73 3PXMA 4OK0A 1M3IA 4XBTA 1T3BA 1T5YA 3KGKA 3WGXA 2C3TA 3NUVA 4WWUC 1NSWA 1T4ZA 1IU7A 2STDA 4TR0A 4FQUA 1YGWA 3DY5A 5CXOA 4K0NA 2C0GA 4BIRA 5AYSC 5DALA 1YGEA 1ZGNA 1MEKA 2K0MA 1SU9A 2W9QA 1PL2A 4HYZA 4WKWA 2F51A 4AGSA 4TR1B 1SKWB 3DGLA 1D6UA 2H0HA 1GP1A 1H4OA 3LW9A 5JPPA 5G5EA 3URPA 3O3TA 4WR5A 1WJKA 2E2GA 3J7Yk 2JSZA 3FKAA 4LEHA 2YWMA 3QOUA 4R80A 3J7Yb 1GY7A 1BYEA 3T8NA 2LQVA 3US3A 4KA0A 1I70A 4N6TA 5ID2B 3EJVA 3NV0B 3PGBA 4BTXA 2GT6A 3VLNA 1W01A 1YI23 4GB5A 1VQM3 3QCPA 4RNYA 4MJEA 1UVZA 1X1XA 3CSIA 1X1UA 3CPW2 4HS1A 3FYGA 3IK9A 4ID0A 4XS6A 5A4VA 1A2PA 5GZZB 4U13A 3CCV3 4EO3A 1AQWA 1AQVA 4IJ3A 3TB2A 2CVDA 2IMJA 2M72A 2D1WA 1RQMA 2OKAA 4L0WA 1QALA 2Z77A 5BU4A 3KSPA 4OO5A 3GH6A 5BXQA 1LU4A 1NHOA 2HT9A 2CX3A 1CQSA 2DMLA 2IJYA 3APQA 4USSA 4BVYB 4IT7A 4PEJA 2O8VB 2K6VA 2VM2A 3V98A 2XBIA 18GSA 1M2BA 1A8LA 1N2AA 3Q19A 1VQQA 1A2JA 5FW5A 5CRDA 2JSYA 1F6MC 1GOYA 3R3EA 2X8GA 3N54B 4AJ6A 2P38A 1PX7A 4XBXA 4HEA2 1YJ6A 5L71A 2VL3A 1ULJB 2L57A 2FNOA 4HZBB 1QGVA 4O5UA 2A2RA 2KAAA 1K0BA 3IDVA 3UJ1A 5DQSA 1T8EB 3BBYA 4G0IA 1BNGA 5IMVA 4BU4A 1M2DA 4GRFA 4YQUA 1N5PA 1DSBA 2IMDA 3IR4A 1HYUA 3NZNA 1DBYA 3UIWA 3DH2A 2PNCA 2E2MA 1AIUA 2GZPA 4DVCA 5HR1A 3UBKA 2XPDA 1U8CB 3H3HA 4PUFC 4JZQA 1SQWA 2HSMA 2VLVA 3C8EA 4HU7A 4EDYA 4KNDA 4OWYA 1OACA 1VQP3 1OC9A 3ZITA 3HJPA 3RBTA 2YP6A 4X43A 1EGOA 4NXIA 1IQ8A 1XVQA 3WT1A 3LZAA 4K9ZA 3FMWA 2RM5A 1EA2A 5DQYA 3PGTA 4HQZA 5H5QA 2B24B 3TOUA 3CCQ3 2OJLA 1RN7A 2E0QA 4CY8A 3PH9A 1TTZA 3BD2A 1ERVA 1BJXA 2GS3A 2N5FA 1I2GA 1QXHA 1SPUA 1DMQA 2ML6A 3F0IA 1IV7A 2KF4A 2YX9A 4MH3A 3GNJA 1QMAA 3DKSA 1CEWI 2VLTA 3MG1A 2VLUA 5KP1A 2X49A 2YJ7A 4CDOA 1MWTA 1WOUA 2IN3A 2C80A 1NB5I 3EU4A 1JLVA 5HFIA 2HSYA 1XOBA 16GSA 1UUWB 3L9VA
chains in the Genus database with same CATH topology
4NHZA 1EWXA 1N8JA 5GSSA 1XIYA 3TRPA 5LCZA 3RHCA 2LS5A 1IYIA 1T1VA 5IM9A 2GDRA 2H6YA 2B3SA 3ME7A 2WULA 3DD3A 2LSTA 2I4AA 1V57A 3D4TA 13GSA 2GQMA 4J57E 5F0GA 4ILFA 1MD3A 2AB6A 3IHQA 3UMAA 2VCXA 3QAGA 3FRCA 4GLTA 3TKSC 3I9V2 2AJQB 3TCOA 2DJ2A 4DSSB 2PN8A 4IQ1A 2X64A 3EPTA 2H01A 3GSSA 1XWCA 4ULXA 2OACA 4BWSA 3QMXA 3TKSA 1F3BA 5KN2A 1BG5A 1URMA 3GTUB 3TJKA 4XRAA 1AQXA 1W4VA 1M2AA 2C0FA 1OC8A 4GSSA 1U6TA 1GRXA 4V2MA 1KTEA 2H76A 2K8SA 1OE8A 2LNSA 1R5AA 1SKSB 3KMNA 4LA1A 3GKKA 4KF9A 2YV7A 5CYYA 5EY6A 3O76A 2I9HA 4F03A 4HDEA 3W6GA 4BVXA 1X9SB 2CT6A 3GL3A 3FZAA 2CVBA 4FH8A 4TR4A 2IYJA 2GSRA 1YZXA 1RW1A 1JFUA 4JE1A 1ZOFA 4X1UA 3F3RA 4XRDA 1PD21 2M80A 2O87A 5LD0A 1JZWA 5KEJA 2KUCA 3KH7A 5AIVA 2C4JA 5HR0A 3A2XA 2IPAA 4E8EA 2YCDA 4CHSA 5G5FA 2JZTA 5AIXA 4MLYA 1G7EA 2LJRA 5DALB 4EC0A 4P3YB 2H74A 4FYBA 1JLWA 2NDOA 1E2YA 3VI7A 4YKFA 4ZBAA 1NW2A 2YZUA 2H73A 4JR6A 6GSTA 22GSA 3APOA 2HYXA 3FR6A 3RDWA 4PTSA 3FEUA 4BL7A 4HU9A 2XC2A 3HDCA 2PUKC 5FT3A 2IMKA 3FHKA 5A4WA 3A5IA 1PA3A 2MMNA 1X9MB 5ECLB 5B6MA 2LRCA 4O5QA 4AF2A 2DIZA 4N0ZA 2VD1A 2HSHA 3GX0A 1UC7A 2VL9A 2H70A 5ECNB 4TR3A 5ELGA 3LFLA 3ZL5A 2HZFA 5DBQA 3FZ9A 3VI5A 1F2EA 2DC5A 2GQKA 14GSA 1V40A 3EC3A 2FWGA 1TK8B 1QQ2A 1FB6A 3DVWA 4NPBA 3E0UA 1OC3A 4Q5RA 4IP1A 5HFGA 3MSZA 1Q4JA 2L5LA 4H86A 2PBJA 3ZLPA 6GSSA 2C3NA 1TI1A 5E4WA 3TRXA 3C1SA 4MP4A 1MDJA 4N30A 1M7TA 2YJHA 3MDKA 3GX8A 5IMCA 1TJDA 5G1LA 4PURA 4KCAA 4IBPA 5F07A 1HNCA 2NPBA 1K0OA 1EZKA 1X5EA 4K8MA 2V2GA 1K0NA 1FVKA 3CBUA 3PINA 1GSSA 4IGJA 1TU7A 3ERGA 1SYXA 2K9FA 4QL9A 2H0IA 5BMUA 1XXUA 3EMXA 4DEJA 5A5KA 3Q74A 3UEMA 3H1NA 2HRFA 2H19A 3IPZA 4NMUA 3S9FA 2LJKA 2R2JA 3WD6A 3GUSA 3M9KA 4KDYA 4MJCA 3EWLA 3W8SA 2P5RA 3L0HA 2MYGA 1PQNA 2R37A 1OC9B 3FW2A 1B9YC 3DYRA 4QL7A 2I1UA 5F05A 5J9CA 1YEPA 1S3AA 2AYTA 3UOMA 1ERTA 3I69A 1R5PA 3HXSA 5GSTA 3WGEA 2B6MA 4N10A 5CP1A 3IOSA 3ERWA 2ZCTA 2PGTA 1XCCA 1M0UA 2FGXA 2TRCP 3U6VA 3I6AA 1SJIA 1T7PB 3IBHA 4K2DA 3H4KA 2K8VA 1J08A 1TRVA 4IJIA 3DWVA 3EURA 4J2FA 1JHBA 2YNXA 2GVPA 2PU9C 4WETA 5D93A 2ZNMA 4TVEA 4ECIA 3O6TA 1UA5A 4KSOA 5FHIA 1LJRA 4KSMA 3UAPA 2GT5A 4HQSA 2H0GA 20GSA 1PSQA 1FOVA 1Z7RA 3GV1A 4MA9A 2VL2A 3A2VA 1THOA 4K1FA 2LJAA 3KCMA 4JBBA 5IOWA 2EIRA 5CRGA 2V32A 2MMZA 5B7CA 2LNTA 5BRTA 1PN9A 1F3AA 3OR5A 4G0KA 1ON4A 4ZL7A 2VD0A 4ECJA 2OA7A 1EP8A 4X4JA 5CREA 2L59A 4IELA 1G0TA 1TKDB 3PR8A 4KW6A 1YF1A 3DEXA 8GSSA 2KP1A 4KB3A 1XW5A 5CRWA 3FK8A 2R5GA 3QAVA 4YQMA 1JZDA 1FVJA 4EVMA 2IY2A 5D9TA 3EVIA 4AJ7A 3P7XA 1TK0B 2YANA 3D0ZA 4PGTA 1ACVA 1MDIA 1GUHA 3G7JA 4L8EA 3MIXA 4BVXB 1U88A 4JEDA 2H1GA 2P5QA 1YKAA 1XZOA 2HE3A 1WWJA 4XS1A 2VO4A 4V1Ap 1KEBA 2RUFA 3CYNA 3R2QA 3JCML 1XWBA 3ZREA 4YQVA 1A2MA 2LRTA 1YKCA 3GA4A 3HVSA 4NAXA 3VWVA 2AUVA 3APSA 2DIYA 5ECPB 4K6XA 2MBSA 4HI7A 3HKRA 1QMVA 4NWYA 1A0FA 4Z2TA 1ZYEA 2LQQA 3DGQA 2G0FA 1ZMAA 1QFNA 1ZYPA 3WT2A 4O32A 4MZBA 4K5SA 2VCVA 2V1MA 5IPHA 1ZZYA 3TUEA 3C73A 4BL7B 1SK0A 1OYJA 2REMA 4I6XA 3ZTLA 4LMWA 3LSZA 1HNBA 3P2AA 2LTKA 3D4MA 5HR2A 4PNGA 3QAWA 4ML1A 4FYUA 4K7OA 2B7JA 5IOXA 5ECHB 3DXBA 1GUMA 1A23A 2HI7A 1GUKA 2HNLA 3CMIA 1XWGA 3GL5A 2IWTA 3MWHA 5IO2A 4EE0A 3TDGA 2H1BA 5COHA 1BQ7A 4WBRD 4K0GA 3CSHA 1J0FA 2CA8A 2OADA 2DJ3A 3F4SA 3HCZA 1I9DA 2M46A 1BX9A 1GSEA 4ZBDA 4LL1B 2A2PA 2NTOA 1SD9A 11GSA 5D8IA 2WB9A 2IMIA 1FG4A 1U3IA 2F3MA 1SYRA 3LXTA 1V2AA 3ZIJA 1VRSD 2ON5A 4PXOA 4Q5NA 3FR9A 3DRNA 2N5AA 1Z6NA 4G0LA 4E8HA 1AC1A 2CVKA 3D22A 1S3DA 2FA8A 4NHWA 3HZ8A 4PX1A 4ZILA 3ERFA 4MF5A 2NBSA 5JWRB 3H79A 1ZYNA 4F0BA 2A4VA 3VPQA 1SK2A 4L5LA 3KIJA 3QFBC 2WGRA 4Z7XA 1ERWA 3KJYA 4PQIA 5EL8A 4EUYA 2VCWA 5G31A 4D73B 4LMVA 4X0XA 1UN2A 2DLXA 4K2XA 3TJJA 1WP0A 4ZIJA 1T00A 5DDLA 4EIPA 1MD4A 2C0EA 3H93A 1U3AA 2F9SA 3IK7A 3TRQA 2CV4A 2WRTA 4XS4A 1AXDA 5JWQB 2V6KA 5D73A 1OE7A 5ABRA 4RQRA 2PVQA 3CTFA 1A0RP 4I5QA 3EU3A 3HYPA 3TJBA 3GMFA 3BCIA 4A5PA 3VURA 1XPVA 4J56E 2L6DA 2TIRA 5AISA 5IO0A 1GTAA 2R0PA 4AJ8A 4ECCA 2EC4A 1R4WA 2GQLA 4WR4A 5C04A 3L9UA 2WCIA 4YAVA 4MPFA 3F3QA 3TKPA 2J23A 3ZIVA 2HFDA 5J5NA 1PKZA 3KH9A 5GAND 4V2LA 1USBA 4IVFA 4KCEA 4GSTA 4ZB6A 2YN1A 1HQOA 3KM6A 2GLRA 2HRAA 1GLPA 17GSA 2MZCA 2DJKA 4HZ4A 4Q5FA 4FIWA 4POLA 1W89A 5IIZA 1M99A 5HQPA 2HLSA 4PQHA 4POKA 2EIOA 5DVBA 4Z2RA 1K0DA 1YDKA 1YEXA 1Z3EA 1CQHA 4MJBA 5DJMA 2KP2A 1Z7PA 4BWQA 3MYDA 4YKGA 2VCQA 4OFNA 4EL1A 1QUWA 3ZVJD 4GQCA 1TW9A 6GSYA 2ALBA 2KOKA 2F8AA 3LGCA 2H30A 4XCSA 2L5OA 2QA2A 3VWWA 2LUSA 1K0CA 3IA1A 4CY6A 4I97A 2YV9A 2FLSA 4IW9A 5KOWA 3LYPA 1BAYA 3E3EA 1T4YA 1JZOA 2E7PA 1G7OA 4IN0A 2K18A 1ABAA 2C0DA 4K7NA 2Z9SA 2GTUA 2FUG2 4MDCA 3WYWA 4MNNA 1M9AA 3FR3A 2IFQA 5F8BA 2LRNA 1K3LA 1PX6A 3HVVA 7GSSA 5CO3A 1G6WA 1X0RA 1WE0A 1TRSA 4RUVA 2PMTA 3QD9A 1V98A 1TK5B 1YF0A 2JL4A 1F9MA 2EIQA 2MMAA 1ZYQB 4RI6A 1TP9A 1GNWA 2A2SA 1B4QA 1RK4A 2ZUPA 2DJJA 4K5RA 3KMOA 1JZRA 4MF6A 3HY2A 5D9VA 3SBCA 1PMTA 5CAXA 5D9WA 3PPUA 1PN0A 1EP7A 4ICYA 1A8YA 1TRUA 3L78A 1EEJA 3FZ5A 5IQYA 1EV9A 2WJUA 3IC4A 2H75A 6GSVA 5IPGA 1AAZA 4YAPA 5AN1A 1XVWA 3EYTA 5E59A 1EOHA 1GSFA 2HRNA 4ZL9A 3NIVA 6GSWA 5GAPD 3GN3A 3M9JA 5KN0A 4EDZA 5ECIB 1EEMA 1GTIA 2WZ9A 3DIEA 5ECKB 5D96A 4XHMA 4CW9A 4XIHA 2L4CA 3DMLA 2JACA 4WF4A 1GNEA 5FWGA 4IQAA 4MMMA 1H75A 4MPGA 2CX4A 3UVHA 2QA1A 1TOFA 3ZZXA 2OBKA 2VOCA 1BEDA 1V58A 4XTSA 4NV5A 3IHGA 2HZEA 1YY7A 1EOGA 4MK3A 5INYA 1WIKA 3ME8A 1PRXA 2MMOA 2GGTA 6GSXA 2C1YA 2JZSA 2RM6A 2OE3A 3TKRA 3V1WA 1I5GA 5A4UA 2H1DA 4HOJA 4TXOA 3CRTA 1GL8A 5EPFA 1OKDA 2P31A 3GYKA 2H66A 5J41A 3GKNA 3DVXA 3H8QA 3F63A 4I2TA 3UL3A 1SL0B 3CTGA 4GXZA 1GSYA 3RHBA 3TOTA 4ZXGA 3LWAA 1GTUA 2FA4A 4KDUA 1GULA 5JCWA 5ECSA 2I3YA 4N0VA 3GIXA 4KDXA 4XS4B 3EINA 4TOPA 1KNGA 3L4NA 4TRXA 3RPPA 4V2NA 1AUCA 1THXA 3HJOA 2B1KA 1GSQA 5KOXA 2C8UA 3EE2A 5ECRB 1OVNA 1B48A 5HR3A 1NM3A 1SJ6A 1SENA 3FZ4A 1FOHA 1KBNA 1ZL9A 2LEGA 4K7IA 3A2WA 4ISDA 1F37A 12GSA 4TW5A 3IRAA 2L6CA 1TU8A 1DE2A 2XPEA 5J9BA 2N5BA 1GTBA 10GSA 3TJGA 2VM1A 3W8JA 3QR6A 5DJLA 4ZB9A 4DSRA 3L9SA 2QKEA 2HXKA 2QSIA 3VFIA 5DCHA 2F8FA 4TN8A 3GKXA 3IAS2 2FHEA 1X5CA 3GURA 4OO4A 3TKQA 3HD5A 2JADA 2YZHA 2YOIA 4O92A 3ZVJA 3AY8A 2B1LA 3LYKA 2DBCA 3C7MA 1TI3A 1Y6EA 2O7KA 1ST9A 3LXZA 4F2IA 2VCZA 4O7HA 5CRHA 2O85A 4OFMA 4YH2A 3LQ7A 3CRUA 2DJ1A 3QFAC 4KE3A 1X9WB 4OFTA 2GZZA 4OCFA 3G9BA 3VWUA 1XW9A 4EKZA 1SK1A 3G7YA 2BTOT 2DKIA 2H71A 3F4TA 5LNKe 5ECQB 2P0GA 3LG6A 19GSA 5JCUA 4IS0A 1TRWA 1R26A 2BMXA 1SKRB 2ON7A 2FWEA 2LQOA 2OBIA 4PNFA 1XW6A 3KP9A 2GZYA 4GCIA 3C1RA 1LBKA 4TKYA 2IFQB 3KTLA 2R4VA 2CQ9A 3F8UA 3K8NA 4OD7A 3M3MA 2V6OA 5ENUA 3F4RA 4PQ1A 1SD8A 1OKTA 3BCKA 4V1Ag 3IAM2 4GWRA 3HVXA 5JCGA 3Q18A 2H1AA 2NVLA 2FWFA 2CAIA 1OAZA 3KXOA 1K3YA 5IMAA 4POMA 1M9BA 4OMVA 2H6ZA 2H8LA 5J3RA 2ES7A 1E6BA 4F82A 2R6KA 1WPIA 4DSQA 3GH9A 2GSSA 1O7UA 3NOFA 1Z5YE 5ECOB 2DJ0A 2RIIA 5DAKA 1GWCA 2IMEA 4HJ2A 2OE0A 4JR4A 2VIMA 2WFCA 4FO5A 5D9XA 3MNGA 3HHVA 9GSSA 2GSTA 1YQ1A 4BA7A 2FY6A 3UBLA 4Z2UA 1WMJA 5CNWA 2KLXA 4OCEA 2JZRA 5JWOB 3D21A 3UVTA 3ZYWA 3HA9A 5KN3A 1O73A 2B5EA 3F6FA 6GSUA 1A24A 3P8WA 3ED3A 4MZCA 4POBA 4GF0A 4JRRA 1TDIA 4IP6A 4JU5A 3GFKA 4WXTA 3KP8A 3KZQA 1V9WA 4Q5QA 3TKSE 2HZEB 2KHPA 1GLQA 3BJ5A 4LLRA 3BOAA 4MJAA 3QPMA 2L4QA 1FAAA 3M0FA 1QK8A 3LORA 3P90A 1K0AA 1O8WA 4F0CA 2YWOA 1HNAA 4GQFA 1XFLA 5EVOA 1GSDA 1U87A 2J9HA 2FWHA 4TXOB 4ACSA 1ILOA 3IE3A 4N11A 1VF1A 2X8HA 1G6YA 2R3XA 4TR1A 3TJFA 4GTUA 2QGVA 3VK9A 3IV4A 3FKFA 2R0GA 3LEFA 4GSNA 2B7KA 4PUAA 3F9UA 4RQXA 2LKUA 1A2LA 3D6IA 5H5SA 2XHFA 3C71A 4EIQA 5ID2A 2BJXA 1XOAA 3F6DA 2IL3A 5KN1A 3G7IA 2YWIA 1FHEA 3GKMA 4KX4A 4ZL8A 3GSTA 5AGYA 3M8NA 2WDUA 4G9HA 4FYCA 3CSJA 3FY7A 3UARA 1O8XA 3A5WA 3GRXA 5B8AA 1Z9HA 2PWJA 1B9XC 3GHAA 1SJZA 4KUNA 4IHUA 4WBJA 1IYHA 2DKHA 4KH7A 4BVYA 1HD2A 3SWLA 2B5XA 1ERUA 3Q6OA 4MF7A 3TGZA 2TRXA 3M1GA 2RLIA 3A3TA 3MAKA 3CXGA 3KD0A 2C3QA 1O85A 2IMFA 3I43A 1R7HA 5IMFA 4BPYA 1K0MA 2O89A 3KEBA 1DE1A 5IMZA 4ML6A 3RPNA 4ZBBA 3LJRA 3QDNA 1O81A 1WRYA 1Y25A 5H5RA 2JU5A 1AW9A 2GSQA 2R0CA 2OE1A 1XWKA 3ZFLA 4IKHA 1Z6MA 2PVOC 3ZMKA 3IXRA 3VPTA 1PL1A 2YPMA 1PKWA 1B8XA 5G30A 1EGRA 1K3OA 2XBQA 2X4AA 1B4PA 3KTBA 3D5JA 5G2ZA 4KGIA 4I2UA 3ZRDA 4F9ZA 1EV4A 3VWXA 3E9JB 4MZWA 2CAQA 3ISOA 1VF2A 1SL1B 3ZFBA 4NV2A 2AHEA 2AV4A 3IC8A 2IIYA 5G1KA 4MABA 2UZ8A 4ECBA 3N9JA 1XBSA 2FD3A 3WGDA 1C72A 4MH2A 5HFKA 4I8BA 4WF5A 4L0UA 3EMPA 1SL2B 2AAWA 1ML6A 2X8CA 4RI7A 2X99A 4O5RA 3U5RE 4EXJA 4D73A 2FCHA 1DUGA 4ZB8A 1VF3A 5C00A 4DSSA 1GSUA 5IMDA 1MDKA 1FO5A 4KAEA 5ECMB 2V41A 1FB0A 5DAKB 4HUAA 2WS2A 3HZ4A 2DSAA 2MBTA 4HZ2A 2VUPA 2CZ2A 4G10A 5ELAA 3GTUA 1VGLA 1ZCPA 3N5OA 2RUEA 3HJMA 1Q98A 1X5DA 4WEYA 5B8BA 2D2ZA 5B6NA 4L5OA 3ZMLA 1J9BA 1MTCA 1O6JA 2VL2C 1FW1A 1GH2A 2LV3A 2PPTA 2QC7A 1S3CA 2I81A 2VAFA 2HRKA 1NHYA 2DMMA 2A4HA 2PERA 4QQ7A 2VCTA 2CZ3A 4G19A 5J4UA 4G2EA 4TXVA 4LL4B 1VF4A 4MCUA 5DCGA 1CQGA 1PGTA 2G2QA 5F06A 2YWNA 3RAZA 1XWAA 1TXXA 4EF0A 2H6XA 2B5YA 2H72A 1T3BA 3KGKA 3WGXA 2C3TA 1NSWA 1T4ZA 4TR0A 4FQUA 4K0NA 2C0GA 5DALA 1ZGNA 1MEKA 1SU9A 1PL2A 4WKWA 2F51A 4AGSA 4TR1B 1SKWB 2H0HA 1GP1A 1H4OA 3LW9A 5G5EA 3O3TA 4WR5A 1WJKA 2E2GA 3J7Yk 2JSZA 2YWMA 3QOUA 3J7Yb 1BYEA 3US3A 4KA0A 5ID2B 2GT6A 3VLNA 3QCPA 4MJEA 1UVZA 3CSIA 4HS1A 3FYGA 3IK9A 4ID0A 4XS6A 5A4VA 5GZZB 4EO3A 1AQWA 1AQVA 4IJ3A 3TB2A 2CVDA 2M72A 2OKAA 1RQMA 4L0WA 4OO5A 3GH6A 1LU4A 1NHOA 2HT9A 2CX3A 2DMLA 2IJYA 3APQA 4USSA 4BVYB 2O8VB 2K6VA 2VM2A 2XBIA 18GSA 1M2BA 1A8LA 1N2AA 3Q19A 1A2JA 5CRDA 2JSYA 1F6MC 3R3EA 2X8GA 4AJ6A 1PX7A 4HEA2 1YJ6A 5L71A 2VL3A 2L57A 2FNOA 1QGVA 4O5UA 2A2RA 1K0BA 3IDVA 3UJ1A 5DQSA 1T8EB 3BBYA 4G0IA 5IMVA 1M2DA 4GRFA 4YQUA 1DSBA 2IMDA 3IR4A 1HYUA 3NZNA 1DBYA 3UIWA 2E2MA 1AIUA 2GZPA 4DVCA 5HR1A 3UBKA 2XPDA 4PUFC 4JZQA 2HSMA 2VLVA 3C8EA 4HU7A 4EDYA 4KNDA 4OWYA 1OC9A 3ZITA 3HJPA 3RBTA 2YP6A 4X43A 1EGOA 4NXIA 1XVQA 3WT1A 4K9ZA 3FMWA 2RM5A 5DQYA 3PGTA 4HQZA 5H5QA 3TOUA 2OJLA 2E0QA 4CY8A 3PH9A 1TTZA 3BD2A 1ERVA 1BJXA 2GS3A 2N5FA 1QXHA 3F0IA 4MH3A 3GNJA 3DKSA 2VLUA 2VLTA 2X49A 4CDOA 2YJ7A 1WOUA 2IN3A 2C80A 3EU4A 1JLVA 5HFIA 2HSYA 1XOBA 16GSA 4HJMA 3L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHZ A;  1EWX A;  1N8J A;  5GSS A;  1XIY A;  3TRP A;  5LCZ A;  3RHC A;  2LS5 A;  1IYI A;  1T1V A;  5IM9 A;  2GDR A;  2H6Y A;  2B3S A;  3ME7 A;  2WUL A;  3DD3 A;  2LST A;  2I4A A;  1V57 A;  3D4T A;  13GS A;  2GQM A;  4J57 E;  5F0G A;  4ILF A;  1MD3 A;  2AB6 A;  3IHQ A;  3UMA A;  2VCX A;  3QAG A;  3FRC A;  4GLT A;  3TKS C;  3I9V 2;  2AJQ B;  3TCO A;  2DJ2 A;  4DSS B;  2PN8 A;  4IQ1 A;  2X64 A;  2H01 A;  3GSS A;  1XWC A;  4ULX A;  2OAC A;  4BWS A;  3QMX A;  3TKS A;  1F3B A;  5KN2 A;  1BG5 A;  1URM A;  3GTU B;  3TJK A;  4XRA A;  1AQX A;  1W4V A;  1M2A A;  2C0F A;  1OC8 A;  4GSS A;  1U6T A;  1GRX A;  4V2M A;  1KTE A;  2H76 A;  2K8S A;  1OE8 A;  2LNS A;  1R5A A;  1SKS B;  3KMN A;  4LA1 A;  3GKK A;  2YV7 A;  5CYY A;  5EY6 A;  3O76 A;  2I9H A;  4F03 A;  4HDE A;  3W6G A;  4BVX A;  1X9S B;  2CT6 A;  3GL3 A;  3FZA A;  2CVB A;  4FH8 A;  4TR4 A;  2IYJ A;  2GSR A;  1YZX A;  1RW1 A;  1JFU A;  4JE1 A;  1ZOF A;  4X1U A;  3F3R A;  4XRD A;  1PD2 1;  2M80 A;  2O87 A;  5LD0 A;  1JZW A;  5KEJ A;  2KUC A;  3KH7 A;  5AIV A;  2C4J A;  5HR0 A;  3A2X A;  2IPA A;  4E8E A;  2YCD A;  4CHS A;  5G5F A;  2JZT A;  5AIX A;  4MLY A;  1G7E A;  2LJR A;  5DAL B;  4EC0 A;  4P3Y B;  2H74 A;  4FYB A;  1JLW A;  2NDO A;  1E2Y A;  3VI7 A;  4ZBA A;  1NW2 A;  2YZU A;  2H73 A;  4JR6 A;  6GST A;  22GS A;  3APO A;  2HYX A;  3FR6 A;  3RDW A;  3FEU A;  4BL7 A;  4HU9 A;  2XC2 A;  3HDC A;  2PUK C;  5FT3 A;  2IMK A;  3FHK A;  5A4W A;  1PA3 A;  2MMN A;  1X9M B;  5ECL B;  5B6M A;  2LRC A;  4AF2 A;  2DIZ A;  4N0Z A;  2VD1 A;  2HSH A;  3GX0 A;  1UC7 A;  2VL9 A;  2H70 A;  5ECN B;  4TR3 A;  5ELG A;  3LFL A;  3ZL5 A;  2HZF A;  5DBQ A;  3FZ9 A;  3VI5 A;  1F2E A;  2DC5 A;  2GQK A;  14GS A;  1V40 A;  3EC3 A;  2FWG A;  1TK8 B;  1QQ2 A;  1FB6 A;  3DVW A;  4NPB A;  3E0U A;  1OC3 A;  4Q5R A;  4IP1 A;  5HFG A;  3MSZ A;  1Q4J A;  2L5L A;  4H86 A;  2PBJ A;  3ZLP A;  6GSS A;  2C3N A;  1TI1 A;  5E4W A;  3TRX A;  3C1S A;  4MP4 A;  1MDJ A;  4N30 A;  1M7T A;  2YJH A;  3MDK A;  3GX8 A;  5IMC A;  1TJD A;  5G1L A;  4PUR A;  4KCA A;  4IBP A;  5F07 A;  1HNC A;  2NPB A;  1K0O A;  1EZK A;  1X5E A;  4K8M A;  2V2G A;  1K0N A;  1FVK A;  3CBU A;  3PIN A;  1GSS A;  4IGJ A;  1TU7 A;  3ERG A;  1SYX A;  2K9F A;  4QL9 A;  2H0I A;  1XXU A;  3EMX A;  4DEJ A;  5A5K A;  3Q74 A;  3UEM A;  3H1N A;  2HRF A;  2H19 A;  3IPZ A;  4NMU A;  3S9F A;  2LJK A;  2R2J A;  3WD6 A;  3GUS A;  3M9K A;  4KDY A;  4MJC A;  3EWL A;  3W8S A;  2P5R A;  3L0H A;  2MYG A;  1PQN A;  2R37 A;  1OC9 B;  3FW2 A;  1B9Y C;  3DYR A;  4QL7 A;  2I1U A;  5F05 A;  5J9C A;  1YEP A;  1S3A A;  2AYT A;  3UOM A;  1ERT A;  3I69 A;  1R5P A;  3HXS A;  5GST A;  3WGE A;  2B6M A;  4N10 A;  5CP1 A;  3IOS A;  3ERW A;  2ZCT A;  2PGT A;  1XCC A;  1M0U A;  2FGX A;  2TRC P;  3U6V A;  3I6A A;  1SJI A;  1T7P B;  3IBH A;  4K2D A;  3H4K A;  2K8V A;  1J08 A;  1TRV A;  4IJI A;  3DWV A;  3EUR A;  4J2F A;  1JHB A;  2YNX A;  2GVP A;  2PU9 C;  4WET A;  5D93 A;  2ZNM A;  4TVE A;  4ECI A;  3O6T A;  1UA5 A;  4KSO A;  5FHI A;  1LJR A;  4KSM A;  3UAP A;  2GT5 A;  4HQS A;  2H0G A;  20GS A;  1PSQ A;  1FOV A;  1Z7R A;  3GV1 A;  4MA9 A;  2VL2 A;  3A2V A;  1THO A;  4K1F A;  2LJA A;  3KCM A;  4JBB A;  5IOW A;  2EIR A;  5CRG A;  2V32 A;  2MMZ A;  5B7C A;  2LNT A;  1PN9 A;  1F3A A;  3OR5 A;  1ON4 A;  4ZL7 A;  2VD0 A;  4ECJ A;  2OA7 A;  1EP8 A;  5CRE A;  2L59 A;  4IEL A;  1G0T A;  1TKD B;  3PR8 A;  4KW6 A;  1YF1 A;  3DEX A;  8GSS A;  2KP1 A;  4KB3 A;  1XW5 A;  5CRW A;  3FK8 A;  2R5G A;  3QAV A;  4YQM A;  1JZD A;  1FVJ A;  4EVM A;  2IY2 A;  5D9T A;  3EVI A;  4AJ7 A;  3P7X A;  1TK0 B;  2YAN A;  3D0Z A;  4PGT A;  1ACV A;  1MDI A;  1GUH A;  3G7J A;  4L8E A;  1U88 A;  4JED A;  2H1G A;  2P5Q A;  1YKA A;  1XZO A;  2HE3 A;  1WWJ A;  4XS1 A;  2VO4 A;  4V1A p;  1KEB A;  2RUF A;  3CYN A;  3R2Q A;  3JCM L;  1XWB A;  3ZRE A;  4YQV A;  1A2M A;  2LRT A;  1YKC A;  3GA4 A;  3HVS A;  4NAX A;  3VWV A;  2AUV A;  3APS A;  2DIY A;  5ECP B;  4K6X A;  2MBS A;  4HI7 A;  3HKR A;  1QMV A;  4NWY A;  1A0F A;  1ZYE A;  2LQQ A;  3DGQ A;  2G0F A;  1ZMA A;  1QFN A;  3WT2 A;  4O32 A;  4MZB A;  2VCV A;  2V1M A;  5IPH A;  1ZZY A;  3TUE A;  3C73 A;  1SK0 A;  1OYJ A;  2REM A;  4I6X A;  3ZTL A;  4LMW A;  3LSZ A;  1HNB A;  3P2A A;  2LTK A;  3D4M A;  5HR2 A;  4PNG A;  3QAW A;  4ML1 A;  4FYU A;  4K7O A;  2B7J A;  5IOX A;  5ECH B;  3DXB A;  1GUM A;  1A23 A;  2HI7 A;  1GUK A;  2HNL A;  3CMI A;  1XWG A;  3GL5 A;  2IWT A;  3MWH A;  5IO2 A;  4EE0 A;  3TDG A;  2H1B A;  5COH A;  1BQ7 A;  4WBR D;  4K0G A;  3CSH A;  1J0F A;  2CA8 A;  2OAD A;  2DJ3 A;  3F4S A;  3HCZ A;  1I9D A;  2M46 A;  1BX9 A;  1GSE A;  4ZBD A;  4LL1 B;  2NTO A;  1SD9 A;  11GS A;  5D8I A;  2WB9 A;  2IMI A;  1FG4 A;  1U3I A;  2F3M A;  1SYR A;  3LXT A;  1V2A A;  3ZIJ A;  1VRS D;  2ON5 A;  4PXO A;  4Q5N A;  3FR9 A;  3DRN A;  2N5A A;  1Z6N A;  4E8H A;  1AC1 A;  2CVK A;  3D22 A;  1S3D A;  2FA8 A;  4NHW A;  3HZ8 A;  4PX1 A;  4ZIL A;  3ERF A;  4MF5 A;  2NBS A;  5JWR B;  3H79 A;  4F0B A;  2A4V A;  3VPQ A;  1SK2 A;  4L5L A;  3KIJ A;  3QFB C;  2WGR A;  4Z7X A;  1ERW A;  3KJY A;  4PQI A;  5EL8 A;  4EUY A;  2VCW A;  5G31 A;  4D73 B;  4LMV A;  4X0X A;  1UN2 A;  2DLX A;  3TJJ A;  1WP0 A;  4ZIJ A;  1T00 A;  5DDL A;  1MD4 A;  2C0E A;  3H93 A;  1U3A A;  2F9S A;  3IK7 A;  3TRQ A;  2CV4 A;  2WRT A;  4XS4 A;  1AXD A;  5JWQ B;  2V6K A;  5D73 A;  1OE7 A;  5ABR A;  4RQR A;  2PVQ A;  3CTF A;  1A0R P;  4I5Q A;  3EU3 A;  3HYP A;  3TJB A;  3GMF A;  3BCI A;  3VUR A;  1XPV A;  4J56 E;  2L6D A;  2TIR A;  5AIS A;  5IO0 A;  1GTA A;  4AJ8 A;  4ECC A;  2EC4 A;  1R4W A;  2GQL A;  4WR4 A;  5C04 A;  3L9U A;  2WCI A;  4YAV A;  4MPF A;  3F3Q A;  3TKP A;  2J23 A;  3ZIV A;  2HFD A;  5J5N A;  1PKZ A;  3KH9 A;  5GAN D;  4V2L A;  1USB A;  4IVF A;  4KCE A;  4GST A;  4ZB6 A;  2YN1 A;  1HQO A;  3KM6 A;  2GLR A;  1GLP A;  17GS A;  2MZC A;  2DJK A;  4HZ4 A;  4Q5F A;  4FIW A;  4POL A;  1W89 A;  5IIZ A;  1M99 A;  5HQP A;  2HLS A;  4PQH A;  4POK A;  2EIO A;  5DVB A;  1K0D A;  1YDK A;  1YEX A;  1Z3E A;  1CQH A;  4MJB A;  5DJM A;  2KP2 A;  1Z7P A;  4BWQ A;  2VCQ A;  4OFN A;  4EL1 A;  1QUW A;  3ZVJ D;  4GQC A;  1TW9 A;  6GSY A;  2ALB A;  2KOK A;  2F8A A;  3LGC A;  2H30 A;  4XCS A;  2L5O A;  3VWW A;  2LUS A;  1K0C A;  3IA1 A;  4I97 A;  2YV9 A;  2FLS A;  4IW9 A;  3LYP A;  1BAY A;  3E3E A;  1T4Y A;  1JZO A;  2E7P A;  1G7O A;  4IN0 A;  2K18 A;  1ABA A;  2C0D A;  4K7N A;  2Z9S A;  2GTU A;  2FUG 2;  4MDC A;  3WYW A;  1M9A A;  3FR3 A;  2IFQ A;  5F8B A;  2LRN A;  1K3L A;  1PX6 A;  3HVV A;  7GSS A;  5CO3 A;  1G6W A;  1X0R A;  1WE0 A;  1TRS A;  4RUV A;  2PMT A;  3QD9 A;  1V98 A;  1TK5 B;  1YF0 A;  2JL4 A;  1F9M A;  2EIQ A;  2MMA A;  1ZYQ B;  4RI6 A;  1TP9 A;  1GNW A;  2A2S A;  1B4Q A;  1RK4 A;  2ZUP A;  2DJJ A;  3KMO A;  1JZR A;  4MF6 A;  3HY2 A;  5D9V A;  3SBC A;  1PMT A;  5CAX A;  5D9W A;  1EP7 A;  1A8Y A;  1TRU A;  3L78 A;  1EEJ A;  3FZ5 A;  5IQY A;  1EV9 A;  2WJU A;  3IC4 A;  2H75 A;  6GSV A;  5IPG A;  1AAZ A;  4YAP A;  5AN1 A;  1XVW A;  3EYT A;  5E59 A;  1EOH A;  1GSF A;  2HRN A;  4ZL9 A;  3NIV A;  6GSW A;  5GAP D;  3GN3 A;  3M9J A;  5KN0 A;  4EDZ A;  5ECI B;  1EEM A;  1GTI A;  2WZ9 A;  3DIE A;  5ECK B;  5D96 A;  4XHM A;  4CW9 A;  4XIH A;  2L4C A;  3DML A;  2JAC A;  4WF4 A;  1GNE A;  5FWG A;  4IQA A;  4MMM A;  1H75 A;  4MPG A;  2CX4 A;  3UVH A;  1TOF A;  3ZZX A;  2OBK A;  2VOC A;  1BED A;  1V58 A;  4XTS A;  4NV5 A;  2HZE A;  1YY7 A;  1EOG A;  4MK3 A;  5INY A;  1WIK A;  3ME8 A;  1PRX A;  2MMO A;  2GGT A;  6GSX A;  2C1Y A;  2JZS A;  2RM6 A;  2OE3 A;  3TKR A;  3V1W A;  1I5G A;  5A4U A;  2H1D A;  4HOJ A;  4TXO A;  3CRT A;  1GL8 A;  5EPF A;  1OKD A;  2P31 A;  3GYK A;  2H66 A;  5J41 A;  3GKN A;  3DVX A;  3H8Q A;  3F63 A;  4I2T A;  3UL3 A;  1SL0 B;  3CTG A;  4GXZ A;  1GSY A;  3RHB A;  3TOT A;  4ZXG A;  3LWA A;  1GTU A;  2FA4 A;  4KDU A;  1GUL A;  5JCW A;  5ECS A;  2I3Y A;  4N0V A;  3GIX A;  4KDX A;  4XS4 B;  3EIN A;  4TOP A;  1KNG A;  3L4N A;  4TRX A;  3RPP A;  4V2N A;  1AUC A;  1THX A;  3HJO A;  2B1K A;  1GSQ A;  2C8U A;  3EE2 A;  5ECR B;  1OVN A;  1B48 A;  5HR3 A;  1NM3 A;  1SJ6 A;  1SEN A;  3FZ4 A;  1KBN A;  1ZL9 A;  2LEG A;  4K7I A;  3A2W A;  4ISD A;  1F37 A;  12GS A;  4TW5 A;  3IRA A;  2L6C A;  1TU8 A;  1DE2 A;  2XPE A;  5J9B A;  2N5B A;  1GTB A;  10GS A;  3TJG A;  2VM1 A;  3W8J A;  3QR6 A;  5DJL A;  4ZB9 A;  4DSR A;  3L9S A;  2QKE A;  2HXK A;  2QSI A;  3VFI A;  5DCH A;  2F8F A;  4TN8 A;  3GKX A;  3IAS 2;  2FHE A;  1X5C A;  3GUR A;  4OO4 A;  3TKQ A;  3HD5 A;  2JAD A;  2YZH A;  2YOI A;  4O92 A;  3ZVJ A;  3AY8 A;  2B1L A;  3LYK A;  2DBC A;  3C7M A;  1TI3 A;  1Y6E A;  2O7K A;  1ST9 A;  3LXZ A;  4F2I A;  2VCZ A;  4O7H A;  5CRH A;  2O85 A;  4OFM A;  4YH2 A;  3LQ7 A;  3CRU A;  2DJ1 A;  3QFA C;  4KE3 A;  1X9W B;  4OFT A;  2GZZ A;  4OCF A;  3G9B A;  3VWU A;  1XW9 A;  4EKZ A;  1SK1 A;  3G7Y A;  2BTO T;  2H71 A;  3F4T A;  5LNK e;  5ECQ B;  2P0G A;  3LG6 A;  19GS A;  5JCU A;  4IS0 A;  1TRW A;  1R26 A;  2BMX A;  1SKR B;  2ON7 A;  2FWE A;  2LQO A;  2OBI A;  4PNF A;  1XW6 A;  3KP9 A;  2GZY A;  4GCI A;  3C1R A;  1LBK A;  4TKY A;  2IFQ B;  3KTL A;  2R4V A;  2CQ9 A;  3F8U A;  3K8N A;  4OD7 A;  3M3M A;  2V6O A;  5ENU A;  3F4R A;  4PQ1 A;  1SD8 A;  1OKT A;  3BCK A;  4V1A g;  3IAM 2;  4GWR A;  3HVX A;  5JCG A;  3Q18 A;  2H1A A;  2NVL A;  2FWF A;  2CAI A;  1OAZ A;  3KXO A;  1K3Y A;  5IMA A;  4POM A;  1M9B A;  4OMV A;  2H6Z A;  2H8L A;  5J3R A;  2ES7 A;  1E6B A;  4F82 A;  2R6K A;  1WPI A;  4DSQ A;  3GH9 A;  2GSS A;  1O7U A;  3NOF A;  1Z5Y E;  5ECO B;  2DJ0 A;  2RII A;  5DAK A;  1GWC A;  2IME A;  4HJ2 A;  2OE0 A;  4JR4 A;  2VIM A;  2WFC A;  4FO5 A;  5D9X A;  3MNG A;  3HHV A;  9GSS A;  2GST A;  1YQ1 A;  4BA7 A;  2FY6 A;  3UBL A;  1WMJ A;  5CNW A;  2KLX A;  4OCE A;  2JZR A;  5JWO B;  3D21 A;  3UVT A;  3ZYW A;  3HA9 A;  5KN3 A;  1O73 A;  2B5E A;  3F6F A;  6GSU A;  1A24 A;  3P8W A;  3ED3 A;  4MZC A;  4POB A;  4GF0 A;  4JRR A;  1TDI A;  4IP6 A;  4JU5 A;  3GFK A;  4WXT A;  3KP8 A;  3KZQ A;  1V9W A;  4Q5Q A;  3TKS E;  2HZE B;  2KHP A;  1GLQ A;  3BJ5 A;  4LLR A;  3BOA A;  4MJA A;  3QPM A;  2L4Q A;  1FAA A;  3M0F A;  1QK8 A;  3LOR A;  3P90 A;  1K0A A;  1O8W A;  4F0C A;  2YWO A;  1HNA A;  4GQF A;  1XFL A;  5EVO A;  1GSD A;  1U87 A;  2J9H A;  2FWH A;  4TXO B;  4ACS A;  1ILO A;  3IE3 A;  4N11 A;  1VF1 A;  2X8H A;  1G6Y A;  2R3X A;  4TR1 A;  3TJF A;  4GTU A;  2QGV A;  3VK9 A;  3IV4 A;  3FKF A;  3LEF A;  4GSN A;  2B7K A;  4PUA A;  3F9U A;  4RQX A;  2LKU A;  1A2L A;  3D6I A;  5H5S A;  2XHF A;  3C71 A;  5ID2 A;  2BJX A;  1XOA A;  3F6D A;  2IL3 A;  5KN1 A;  3G7I A;  2YWI A;  1FHE A;  3GKM A;  4KX4 A;  4ZL8 A;  3GST A;  5AGY A;  3M8N A;  2WDU A;  4G9H A;  4FYC A;  3CSJ A;  3FY7 A;  3UAR A;  1O8X A;  3A5W A;  3GRX A;  5B8A A;  1Z9H A;  2PWJ A;  1B9X C;  3GHA A;  1SJZ A;  4KUN A;  4IHU A;  4WBJ A;  1IYH A;  4KH7 A;  4BVY A;  1HD2 A;  3SWL A;  2B5X A;  1ERU A;  3Q6O A;  4MF7 A;  3TGZ A;  2TRX A;  3M1G A;  2RLI A;  3A3T A;  3MAK A;  3CXG A;  3KD0 A;  2C3Q A;  1O85 A;  2IMF A;  3I43 A;  1R7H A;  5IMF A;  4BPY A;  1K0M A;  2O89 A;  3KEB A;  1DE1 A;  5IMZ A;  4ML6 A;  3RPN A;  4ZBB A;  3LJR A;  3QDN A;  1O81 A;  1WRY A;  1Y25 A;  5H5R A;  2JU5 A;  1AW9 A;  2GSQ A;  2OE1 A;  1XWK A;  3ZFL A;  4IKH A;  1Z6M A;  2PVO C;  3ZMK A;  3IXR A;  3VPT A;  1PL1 A;  2YPM A;  1PKW A;  1B8X A;  5G30 A;  1EGR A;  1K3O A;  2XBQ A;  1B4P A;  3KTB A;  3D5J A;  5G2Z A;  4KGI A;  4I2U A;  3ZRD A;  4F9Z A;  1EV4 A;  3VWX A;  3E9J B;  4MZW A;  2CAQ A;  3ISO A;  1VF2 A;  1SL1 B;  3ZFB A;  4NV2 A;  2AHE A;  2AV4 A;  2IIY A;  5G1K A;  4MAB A;  4ECB A;  3N9J A;  1XBS A;  2FD3 A;  3WGD A;  1C72 A;  4MH2 A;  5HFK A;  4I8B A;  4WF5 A;  4L0U A;  3EMP A;  1SL2 B;  2AAW A;  1ML6 A;  2X8C A;  4RI7 A;  2X99 A;  4O5R A;  3U5R E;  4EXJ A;  4D73 A;  2FCH A;  1DUG A;  4ZB8 A;  1VF3 A;  5C00 A;  4DSS A;  1GSU A;  5IMD A;  1MDK A;  1FO5 A;  4KAE A;  5ECM B;  2V41 A;  1FB0 A;  5DAK B;  4HUA A;  2WS2 A;  3HZ4 A;  2DSA A;  2MBT A;  4HZ2 A;  2VUP A;  2CZ2 A;  4G10 A;  5ELA A;  3GTU A;  1VGL A;  1ZCP A;  3N5O A;  2RUE A;  3HJM A;  1Q98 A;  1X5D A;  4WEY A;  5B8B A;  2D2Z A;  5B6N A;  4L5O A;  3ZML A;  1J9B A;  1MTC A;  1O6J A;  2VL2 C;  1FW1 A;  1GH2 A;  2LV3 A;  2PPT A;  2QC7 A;  1S3C A;  2I81 A;  2VAF A;  1NHY A;  2DMM A;  2PER A;  4QQ7 A;  2VCT A;  2CZ3 A;  4G19 A;  5J4U A;  4G2E A;  4TXV A;  4LL4 B;  1VF4 A;  4MCU A;  5DCG A;  1CQG A;  1PGT A;  2G2Q A;  5F06 A;  2YWN A;  3RAZ A;  1XWA A;  1TXX A;  4EF0 A;  2H6X A;  2B5Y A;  2H72 A;  1T3B A;  3KGK A;  3WGX A;  2C3T A;  1NSW A;  1T4Z A;  4TR0 A;  4K0N A;  2C0G A;  5DAL A;  1ZGN A;  1MEK A;  1SU9 A;  1PL2 A;  4WKW A;  2F51 A;  4AGS A;  4TR1 B;  1SKW B;  2H0H A;  1GP1 A;  1H4O A;  5G5E A;  3O3T A;  4WR5 A;  1WJK A;  2E2G A;  3J7Y k;  2JSZ A;  2YWM A;  3QOU A;  3J7Y b;  1BYE A;  3US3 A;  4KA0 A;  5ID2 B;  2GT6 A;  3VLN A;  3QCP A;  4MJE A;  1UVZ A;  3CSI A;  4HS1 A;  3FYG A;  3IK9 A;  4ID0 A;  4XS6 A;  5A4V A;  5GZZ B;  4EO3 A;  1AQW A;  1AQV A;  4IJ3 A;  3TB2 A;  2CVD A;  2M72 A;  2OKA A;  1RQM A;  4L0W A;  4OO5 A;  3GH6 A;  1LU4 A;  1NHO A;  2HT9 A;  2CX3 A;  2DML A;  2IJY A;  3APQ A;  2O8V B;  2K6V A;  2VM2 A;  2XBI A;  18GS A;  1M2B A;  1A8L A;  1N2A A;  3Q19 A;  1A2J A;  5CRD A;  2JSY A;  1F6M C;  2X8G A;  4AJ6 A;  1PX7 A;  4HEA 2;  1YJ6 A;  5L71 A;  2VL3 A;  2L57 A;  2FNO A;  1QGV A;  2A2R A;  1K0B A;  3IDV A;  3UJ1 A;  5DQS A;  1T8E B;  3BBY A;  5IMV A;  1M2D A;  4GRF A;  4YQU A;  1DSB A;  2IMD A;  3IR4 A;  1HYU A;  3NZN A;  1DBY A;  3UIW A;  2E2M A;  1AIU A;  2GZP A;  4DVC A;  5HR1 A;  3UBK A;  2XPD A;  4PUF C;  4JZQ A;  2VLV A;  3C8E A;  4HU7 A;  4EDY A;  4KND A;  4OWY A;  1OC9 A;  3ZIT A;  3HJP A;  3RBT A;  2YP6 A;  4X43 A;  1EGO A;  4NXI A;  1XVQ A;  3WT1 A;  4K9Z A;  2RM5 A;  5DQY A;  3PGT A;  4HQZ A;  5H5Q A;  3TOU A;  2OJL A;  2E0Q A;  3PH9 A;  1TTZ A;  3BD2 A;  1ERV A;  1BJX A;  2GS3 A;  2N5F A;  1QXH A;  3F0I A;  4MH3 A;  3GNJ A;  3DKS A;  2VLU A;  2VLT A;  4CDO A;  2YJ7 A;  1WOU A;  2IN3 A;  2C80 A;  3EU4 A;  1JLV A;  5HFI A;  2HSY A;  1XOB A;  16GS A;  4HJM A;  3L9V A; 
#chains in the Genus database with same CATH topology
 4R1K A;  4NHZ A;  5LC6 A;  4X2O A;  1EWX A;  1DMM A;  4J5G A;  2W2C A;  1N8J A;  5GSS A;  1XIY A;  1RLS A;  3TRP A;  5LCZ A;  3RHC A;  2LS5 A;  1IYI A;  2OQE C;  1T1V A;  1JN5 A;  3SVA A;  5IM9 A;  2GDR A;  5HGR A;  2H6Y A;  2B3S A;  3ME7 A;  2WUL A;  3DD3 A;  2LST A;  2I4A A;  1V57 A;  3D4T A;  13GS A;  1W6C A;  5D82 A;  2GQM A;  4J57 E;  5F0G A;  4ILF A;  1MD3 A;  2AB6 A;  2WGO A;  1M1K 4;  3D79 A;  3OX9 A;  1AVK A;  3IHQ A;  3SOY A;  1PU4 A;  3QK9 A;  3UMA A;  2VCX A;  3QAG A;  3FRC A;  3CCJ 3;  3OW2 2;  4GLT A;  4HM8 B;  3TKS C;  3I9V 2;  1V74 A;  2AJQ B;  3TCO A;  3DGN A;  2DJ2 A;  1YJN 3;  2PN8 A;  4IQ1 A;  4DSS B;  1ZS7 A;  1BRI A;  1RSN A;  2X64 A;  3EPT A;  4N6M A;  2H01 A;  3GSS A;  3DXO A;  1E97 A;  1XWC A;  3LOY A;  2WOH A;  4ULX A;  2OAC A;  4BWS A;  3QMX A;  3TKS A;  1B20 A;  1RGC A;  1IDP A;  1F3B A;  3KE7 A;  5KN2 A;  1BG5 A;  3EN1 B;  1URM A;  3GTU B;  5AEU B;  4R9K A;  1TFK A;  1Q86 4;  3TJK A;  4XRA A;  4EYC A;  2WO0 A;  1AQX A;  1W4V A;  1UCI A;  1M2A A;  2J8X B;  2C0F A;  1OC8 A;  4GSS A;  5KP3 A;  1U6T A;  1GRX A;  1BNR A;  4V2M A;  1KTE A;  2H76 A;  1WMP A;  4EBG A;  2UGI A;  2K8S A;  1OE8 A;  3BB9 A;  2LNS A;  3ER7 A;  6RNT A;  1B2Z A;  1R5A A;  1SKS B;  3KMN A;  4XM4 A;  5AYR B;  4LA1 A;  3GKK A;  2HMM B;  2P0X A;  1RN4 A;  4KF9 A;  2YV7 A;  1BRG A;  5CYY A;  3O76 A;  5EY6 A;  2I9H A;  1OF5 A;  4F03 A;  3A5E A;  4HDE A;  3EF8 A;  5EVH A;  3NBR A;  4WP5 A;  4WYK A;  3W6G A;  4BVX A;  1X9S B;  2CT6 A;  1BOX A;  3GL3 A;  3FZA A;  3OWY A;  2CVB A;  4FH8 A;  4TR4 A;  2IYJ A;  2GSR A;  1YZX A;  1W2B 2;  3PZW A;  1FUS A;  1RW1 A;  3EN8 A;  1JFU A;  4JE1 A;  1ZOF A;  4X1U A;  1RGF A;  4I4K A;  3F3R A;  4XRD A;  1STF I;  1PD2 1;  2M80 A;  1RN1 A;  2O87 A;  5LD0 A;  2ZDJ A;  1OH0 A;  1JZW A;  3NQZ A;  3S29 A;  5KEJ A;  1I3I A;  2KUC A;  3BNB A;  3KH7 A;  3G16 A;  5AIV A;  2C4J A;  3MHE A;  3CC4 3;  1HU9 A;  3FCS B;  5HR0 A;  3A2X A;  2IPA A;  4IIA A;  4E8E A;  2YCD A;  4CHS A;  5G5F A;  1FUT A;  2JZT A;  5AIX A;  4N3V A;  4MLY A;  2P09 A;  2RBI A;  3PCR A;  3ZFZ A;  2LJR A;  5DAL B;  4EC0 A;  1W2Z A;  1G7E A;  4P3Y B;  2H74 A;  4FYB A;  1YJW 3;  1IVW A;  1JLW A;  2NDO A;  1E2Y A;  3VI7 A;  4YKF A;  4ZBA A;  2XF3 A;  1ASK A;  1NW2 A;  2YZU A;  2H73 A;  4JR6 A;  6GST A;  1TRP A;  22GS A;  3APO A;  2HYX A;  1B21 A;  3FR6 A;  2CFW A;  3RDW A;  4PTS A;  3FEU A;  4BIK A;  4BL7 A;  4H61 A;  4ZM8 A;  5AI1 A;  3D5G A;  2XC2 A;  4HU9 A;  3HDC A;  2PUK C;  5FT3 A;  2IMK A;  3FHK A;  5A4W A;  3A5I A;  4BL3 A;  1PA3 A;  2MMN A;  1X9M B;  3NX0 A;  5ECL B;  5B6M A;  2LRC A;  4O5Q A;  3LTD A;  4AF2 A;  1RGE A;  2DIZ A;  4N0Z A;  2VD1 A;  3SOA A;  2HSH A;  3GX0 A;  1UC7 A;  2VL9 A;  2H70 A;  5ECN B;  1JBS A;  4TR3 A;  5ELG A;  2YFJ B;  1MWU A;  1W6Y A;  4FMB A;  3LFL A;  3ZL5 A;  2HZF A;  3SX1 A;  5DBQ A;  3FZ9 A;  1Y4K A;  3VI5 A;  1F2E A;  2DC5 A;  2GQK A;  1RDS A;  14GS A;  1WMN A;  4N6L A;  4CJN A;  1V40 A;  3EC3 A;  2FWG A;  1TK8 B;  1QQ2 A;  1ZGX A;  3MSO A;  2W6J H;  1FB6 A;  1Q81 4;  1A67 A;  3DVW A;  1U5O A;  2XFS A;  4NPB A;  2OTJ 3;  4KT3 B;  3E0U A;  1OC3 A;  4Q5R A;  4IP1 A;  5HFG A;  3MSZ A;  1Q4J A;  2L5L A;  3G4S 3;  4HJM A;  4H86 A;  5M19 A;  2PBJ A;  3ZLP A;  6GSS A;  2C3N A;  1TI1 A;  5E4W A;  3TRX A;  3C1S A;  4MP4 A;  1MDJ A;  4N30 A;  1RCK A;  1M7T A;  4KFE A;  1B2M A;  2YJH A;  2KF3 A;  3MDK A;  3GX8 A;  5IMC A;  1TJD A;  5G1L A;  4PUR A;  4KCA A;  4HM3 B;  1GY6 A;  1WTH A;  2SAR A;  4IBP A;  1M90 4;  5F07 A;  1HNC A;  1W02 A;  2NPB A;  1K0O A;  3I0Y A;  1EZK A;  1X5E A;  4K8M A;  2V2G A;  1K0N A;  1X1Y A;  1FVK A;  5D83 A;  2HMK B;  3CBU A;  2IUJ A;  3RGR A;  3PIN A;  1GSS A;  3ZG5 A;  2YFI B;  1OHP A;  4IGJ A;  1TU7 A;  3ERG A;  1SYX A;  3GAX A;  4FMC A;  1HKX A;  4J9A A;  2K9F A;  4CPK A;  4QL9 A;  2H0I A;  4J5K A;  5BMU A;  3GRD A;  1XXU A;  3EMX A;  4DEJ A;  5A5K A;  3Q74 A;  3UEM A;  3H1N A;  2HRF A;  2H19 A;  3IPZ A;  1BRK A;  4NMU A;  1K9M 4;  3S9F A;  2LJK A;  2R2J A;  3WD6 A;  3GUS A;  3M9K A;  4KDY A;  4MJC A;  5GSP A;  3EWL A;  1VQL 3;  3W8S A;  2P5R A;  3UB1 A;  3L0H A;  3OV4 A;  3HX8 A;  2MYG A;  2HML B;  1PQN A;  3FLJ A;  3IMA B;  2R37 A;  2M7O A;  3CU3 A;  4RNZ A;  1OC9 B;  3MWZ A;  3DGM A;  3FW2 A;  1B9Y C;  2CHC A;  3DYR A;  4QL7 A;  2I1U A;  5F05 A;  5J9C A;  1TU5 A;  2XR8 B;  1YEP A;  1S3A A;  2AYT A;  3UOM A;  1ERT A;  3I69 A;  5DRV A;  1R5P A;  3HXS A;  5D81 A;  5GST A;  3WGE A;  3K0Z A;  2B6M A;  4N10 A;  5CP1 A;  3T0U A;  3IOS A;  3ERW A;  2ZCT A;  4STD A;  2PGT A;  1XCC A;  1M0U A;  2FGX A;  2TRC P;  3U6V A;  3I6A A;  1SJI A;  1T7P B;  2JQ5 A;  1TUH A;  3IBH A;  4K2D A;  3LYG A;  4LMI A;  3H4K A;  4BTY A;  2W04 A;  1JB4 A;  1J08 A;  2K8V A;  1TRV A;  3DWV A;  4IJI A;  3EUR A;  1GD4 A;  4J2F A;  1JHB A;  2YNX A;  4HBR A;  3D3L A;  1IV9 A;  3UL5 A;  2GVP A;  2PU9 C;  3F8X A;  1TIJ A;  4WET A;  5D93 A;  2ZNM A;  1ROV A;  4TVE A;  3IJE B;  4ECI A;  2F86 B;  3O6T A;  1UA5 A;  4KSO A;  1LOW A;  1JN5 B;  5FHI A;  3DZL A;  5HOH A;  1LJR A;  4KSM A;  3UAP A;  2GT5 A;  4HQS A;  1KQS 2;  2H0G A;  3V92 A;  4QWT A;  1UUG B;  20GS A;  1PSQ A;  1VQ9 3;  1GOV A;  1TTO A;  1FOV A;  1Z7R A;  1YHQ 3;  3GV1 A;  4MA9 A;  3CCU 3;  3O8Y A;  2Z76 A;  1BSC A;  1UCL A;  2VL2 A;  3A2V A;  3LXU X;  1THO A;  4K1F A;  2LJA A;  2A15 A;  3X42 A;  3KCM A;  2FXT A;  4JBB A;  5IOW A;  1X1W A;  2EIR A;  5CRG A;  3G0K A;  2V32 A;  5IW9 A;  2MMZ A;  5B7C A;  2LNT A;  5BRT A;  3PCS A;  3U97 A;  1PN9 A;  3I55 3;  1MGR A;  1F3A A;  2GU1 A;  3OR5 A;  4G0K A;  1ON4 A;  4GL6 A;  4ZL7 A;  2VD0 A;  4ECJ A;  2OA7 A;  1EP8 A;  4X4J A;  5CRE A;  1MWR A;  2HMJ B;  3OWU A;  2BIR A;  1BUJ A;  1O7H B;  1G0T A;  2L59 A;  4IEL A;  1TKD B;  3KII A;  3PR8 A;  4KW6 A;  3VF1 A;  1YF1 A;  3DEX A;  8GSS A;  2KP1 A;  2KF5 A;  3F40 A;  2CH9 A;  3AMO A;  4DKI A;  1AVL A;  2QGU A;  1UGH I;  4KB3 A;  1XW5 A;  2KRT A;  5CRW A;  1IT7 A;  3FK8 A;  2R5G A;  3QAV A;  5IG3 A;  4YQM A;  1STD A;  1JZD A;  3MYT A;  1FVJ A;  1I8V A;  4EVM A;  2W56 A;  2IY2 A;  5D9T A;  3EVI A;  1BSB A;  4AJ7 A;  2GXF A;  3CC7 3;  3P7X A;  3HVN A;  7GSP A;  1RNT A;  3UJM A;  1TK0 B;  1OF5 B;  3KZT A;  2YAN A;  3D0Z A;  3WOD G;  4PGT A;  1ACV A;  1MDI A;  1GUH A;  4EXR A;  3G7J A;  2XH9 A;  4L8E A;  3MIX A;  3FGY A;  4BVX B;  1U88 A;  3BND A;  4JED A;  2H1G A;  2P5Q A;  1OGX A;  1YKA A;  1FW7 A;  4CDL A;  1XZO A;  2HE3 A;  1WWJ A;  4XS1 A;  7STD A;  2VO4 A;  4V1A p;  1KWI A;  2P05 A;  1KEB A;  3LT9 A;  4FMD A;  4KFD A;  4LGQ A;  2RUF A;  3CYN A;  3R2Q A;  3JCM L;  1XWB A;  3ZRE A;  1L5G B;  4FCJ A;  1BRH A;  4YQV A;  2F4Y A;  1A2M A;  3WOF B;  2V1L A;  2LRT A;  1YKC A;  3GA4 A;  3HVS A;  4NAX A;  3VWV A;  2AUV A;  3APS A;  2DIY A;  5ECP B;  3CMA 3;  4K6X A;  2MBS A;  3JUO A;  4HI7 A;  4AKZ A;  3HKR A;  1QMV A;  4NWY A;  1A0F A;  1IVV A;  4Z2T A;  1ZYE A;  2LQQ A;  2FGT A;  3DGQ A;  2G0F A;  1ZMA A;  1QFN A;  1ZYP A;  3WT2 A;  3CNM A;  4O32 A;  4L8O A;  3CQF A;  4MZB A;  3FSD A;  5IG0 A;  4K5S A;  1RRH A;  1D6Z A;  2VCV A;  2V1M A;  5IPH A;  1ZZY A;  3TUE A;  3C73 A;  4BL7 B;  1SK0 A;  1OYJ A;  3KN4 A;  2REM A;  4I6X A;  6STD A;  3ZTL A;  4LMW A;  1QAF A;  3LSZ A;  1HNB A;  3P2A A;  2E2V A;  2LTK A;  3D4M A;  5HR2 A;  1JJ2 2;  1GYB A;  4MMX B;  4PNG A;  3QAW A;  4ML1 A;  4FYU A;  4O02 B;  4K7O A;  2B7J A;  5IOX A;  5ECH B;  4WHA A;  3DXB A;  3CCL 3;  7RNT A;  1GUM A;  4NRE A;  2IUK A;  3QRD A;  1A23 A;  2HI7 A;  1GUK A;  2HNL A;  3CMI A;  2QA4 3;  3Q3F A;  4HOH A;  1XWG A;  3GL5 A;  3GZB A;  1Q42 A;  2IWT A;  1AQZ A;  3GSP A;  3MWH A;  5IO2 A;  4EE0 A;  1YIJ 3;  2OTL 3;  1W7C A;  3TDG A;  2Q07 A;  2H1B A;  4HZ9 B;  5COH A;  1BQ7 A;  2BMO B;  4WBR D;  2QIY A;  2AAD A;  4K0G A;  3CSH A;  1J0F A;  2CA8 A;  2OAD A;  1W4N A;  2DJ3 A;  3F4S A;  3HCZ A;  2C4B A;  4MMY B;  1I9D A;  4N6N B;  2M46 A;  1BX9 A;  1JRQ A;  4X2H A;  2QEX 3;  1PFP A;  1GSE A;  1BNE A;  4ZBD A;  4LL1 B;  2A2P A;  2NTO A;  3WA3 A;  1SD9 A;  1BSA A;  11GS A;  5D8I A;  1O7P B;  1RGG A;  1BNS A;  4LYL B;  4O3V A;  2WB9 A;  5M1A A;  3CCM 3;  2K54 A;  4HM5 B;  1FG4 A;  1U3I A;  2F3M A;  1SYR A;  2IMI A;  3LXT A;  1MWS A;  1BNI A;  1Z1S A;  3NXJ A;  1V2A A;  3ZIJ A;  1US1 A;  1VRS D;  1MGW A;  3FF2 A;  2ON5 A;  4PXO A;  4Q5N A;  1QJG A;  2OWP A;  3FR9 A;  3DRN A;  2N5A A;  1Z6N A;  1R4Y A;  3DGO A;  4G0L A;  4E8H A;  1AC1 A;  4KZ1 A;  2CVK A;  3D22 A;  1S3D A;  2FA8 A;  4NHW A;  1N9E A;  3HZ8 A;  4PX1 A;  4ZIL A;  3ERF A;  4MF5 A;  1JNQ A;  4LZI A;  2NBS A;  5JWR B;  3H79 A;  1I0X A;  1ZYN A;  3EX9 A;  4F0B A;  5JBS A;  2A4V A;  5AIF A;  3V99 A;  4R9L A;  4G1M B;  3VPQ A;  3CME 3;  1SK2 A;  4L5L A;  1AV4 A;  3KIJ A;  2CKF B;  3QFB C;  2WGR A;  4Z7X A;  2OQE A;  2UX0 A;  1ERW A;  3KJY A;  4PQI A;  5EL8 A;  4EUY A;  2VCW A;  5G31 A;  4D73 B;  4LMV A;  4X0X A;  3SLU A;  1UN2 A;  2DLX A;  4K2X A;  2SBL A;  3TJJ A;  1WP0 A;  4ZIJ A;  1T00 A;  5DDL A;  2CX0 A;  4EIP A;  1MD4 A;  2C0E A;  3H93 A;  1Q40 A;  4EV5 A;  1U3A A;  2F9S A;  3IK7 A;  3TRQ A;  1W6G A;  2CV4 A;  2WRT A;  4XS4 A;  1AXD A;  5JWQ B;  2V6K A;  2BMQ B;  3EC9 A;  5D73 A;  1OE7 A;  5ABR A;  4RQR A;  5EQL A;  2PVQ A;  3CTF A;  2BO9 B;  1A0R P;  4I5Q A;  3EU3 A;  3HYP A;  3TJB A;  3GMF A;  3BCI A;  1IQX A;  4A5P A;  3VUR A;  1LOV A;  1IT8 A;  1XPV A;  4J56 E;  2L6D A;  2TIR A;  1MOL A;  3MKI A;  5AIS A;  1SJW A;  2HMO B;  5IO0 A;  1GTA A;  2R0P A;  4AJ8 A;  4ECC A;  2EC4 A;  3JUP A;  5CF2 A;  1R4W A;  2GQL A;  4WR4 A;  5C04 A;  3L9U A;  2WCI A;  4YAV A;  1KD1 4;  4MPF A;  3F3Q A;  2KF6 A;  3TKP A;  2BMR B;  2J23 A;  3ZIV A;  2HFD A;  5J5N A;  2E2U A;  1PKZ A;  1WNH A;  2XGN A;  3KH9 A;  5GAN D;  9RNT A;  4V2L A;  3WOE B;  1USB A;  4IVF A;  3UNL A;  4GST A;  4KCE A;  4ZB6 A;  3BNE A;  2YN1 A;  1HQO A;  2XSO B;  3U1W A;  3KM6 A;  2GLR A;  1BRS A;  2HRA A;  5IG4 A;  1RCL A;  1GLP A;  1T2H A;  17GS A;  1IVX A;  2Y74 A;  2MZC A;  1RGA A;  3CCS 3;  3LTA A;  2RFR A;  1GMQ A;  1K28 A;  3IPT A;  3N8B A;  4H3U A;  2DJK A;  4HZ4 A;  4Q5F A;  4FIW A;  4POL A;  1W89 A;  5IIZ A;  4XB5 A;  3H51 A;  1M99 A;  5HQP A;  3DMC A;  2HLS A;  4IPB A;  4PQH A;  5BVB A;  2EIO A;  4POK A;  3RDE A;  3NV0 A;  1BNJ A;  5DVB A;  4Z2R A;  2XGL A;  1K0D A;  1YDK A;  1YEX A;  3EBY A;  1Z3E A;  1CQH A;  3AMO B;  4MJB A;  2XEP A;  5DJM A;  2KP2 A;  5IER A;  1Z7P A;  1RRL A;  1Q82 4;  4BWQ A;  3MYD A;  4YKG A;  2VCQ A;  2W56 B;  4OFN A;  4EL1 A;  1QUW A;  3ZVJ D;  1DET A;  4GQC A;  1TW9 A;  2BNG A;  6GSY A;  1VQ8 3;  1QVF 2;  2YFL B;  2ALB A;  2KOK A;  2F8A A;  4KVH A;  3LGC A;  2B1X B;  2H30 A;  4XCS A;  2RSX A;  4XBY A;  2L5O A;  4HKV B;  3HIG A;  2QA2 A;  5IEN A;  3VWW A;  2LUS A;  3AGO A;  1K0C A;  3IA1 A;  2D42 A;  4CY6 A;  4I97 A;  5AII A;  2YV9 A;  1PYL A;  4GSP A;  4HJL B;  1FZU A;  2FLS A;  4IW9 A;  4HAA A;  5KOW A;  1YVB I;  3LYP A;  1BAY A;  4MEI A;  3E3E A;  1T4Y A;  1JZO A;  3G8Z A;  2E7P A;  1G7O A;  4IN0 A;  2K18 A;  1ABA A;  1CYU A;  2C0D A;  4K7N A;  2Z9S A;  2GTU A;  2FUG 2;  4MDC A;  3WYW A;  4MNN A;  1M9A A;  3FR3 A;  2IFQ A;  2CFD A;  1O7N B;  3KKG A;  2LRN A;  5F8B A;  4OUQ A;  1JKG A;  3F7S A;  3S28 A;  1K3L A;  1PX6 A;  3HVV A;  2INX A;  1YVS A;  1A2V A;  1B2S A;  7GSS A;  5CO3 A;  1G6W A;  3ROB A;  1X0R A;  1WE0 A;  4FCZ A;  1TRS A;  2RCD A;  4RUV A;  3AHW A;  2PMT A;  3QD9 A;  1V98 A;  2UUG C;  1TK5 B;  2CW9 A;  1YF0 A;  2JL4 A;  1F9M A;  2EIQ A;  2MMA A;  3PYJ A;  1ZYQ B;  4RI6 A;  1O7M B;  1TP9 A;  1GNW A;  3GZX B;  5STD A;  3F14 A;  3LH4 A;  1B2U A;  1Q9E A;  3K5T A;  2A2S A;  2WGQ A;  4WFO A;  1NWW A;  1B4Q A;  1LNH A;  1RK4 A;  2ZUP A;  2DJJ A;  4K5R A;  3KMO A;  1JZR A;  1S3R A;  4MF6 A;  3HY2 A;  5D9V A;  1GY5 A;  3MG3 A;  3SBC A;  3NBJ A;  1PMT A;  1B2X A;  5CAX A;  2WOF A;  1LXE A;  2CWV A;  1DE3 A;  5D9W A;  4R4K A;  3PPU A;  1PN0 A;  1EP7 A;  4ICY A;  1A8Y A;  1TRU A;  3L78 A;  1EEJ A;  3FZ5 A;  5IQY A;  2CG1 A;  1EV9 A;  1GMP A;  3DGY A;  3EQQ B;  2WJU A;  1BU4 A;  3IC4 A;  2H75 A;  1BGS A;  6GSV A;  2OOV C;  5IPG A;  1S72 3;  1AAZ A;  3K9M C;  4YAP A;  5AN1 A;  3X3Z A;  1XVW A;  3EYT A;  1KC8 4;  5E59 A;  1EOH A;  1FGR A;  3T8U A;  3FH1 A;  1GSF A;  2HRN A;  2ML5 A;  2Z7A A;  4ZL9 A;  3NIV A;  6GSW A;  5GAP D;  2C11 A;  1EKM A;  2CX1 A;  3GN3 A;  2AAE A;  3M9J A;  5KN0 A;  4EDZ A;  5ECI B;  2L1S A;  1HYF A;  1EEM A;  1SIH A;  1GTI A;  2WZ9 A;  1E3V A;  3DIE A;  5ECK B;  1OGZ A;  5D96 A;  4XHM A;  4CW9 A;  1SAR A;  4XIH A;  2L4C A;  3DML A;  1A2K A;  4N6U A;  2JAC A;  4WF4 A;  1GSP A;  1GNE A;  2RNT A;  5FWG A;  4IQA A;  4MMM A;  1H75 A;  4MPG A;  2CX4 A;  3UVH A;  2QA1 A;  2C10 A;  1TOF A;  4L7K A;  2OBK A;  3ZZX A;  2VOC A;  4O8S A;  1BED A;  1V58 A;  4XTS A;  1JV2 B;  4NV5 A;  3IHG A;  5IEP A;  4JRF A;  2HZE A;  1RKY A;  1YIT 3;  1YY7 A;  1FGM A;  3SED A;  1EOG A;  4MK3 A;  1OHO A;  5INY A;  1O7G B;  1BSE A;  1WIK A;  3ME8 A;  1DVD A;  1PRX A;  2MMO A;  2GGT A;  4Q53 A;  4HM6 B;  5DRE A;  6GSX A;  1BNF A;  4HM1 B;  2C1Y A;  1RGK A;  3A76 A;  3B4O A;  2JZS A;  2RM6 A;  2OE3 A;  1G02 A;  3TKR A;  2F56 A;  3V1W A;  1I5G A;  5A4U A;  1ZX2 A;  5AIH A;  3FG4 A;  3EBT A;  3WR2 A;  3HII A;  2H1D A;  1M1X B;  2GEX A;  3KFQ C;  4HOJ A;  4TXO A;  4XDW A;  3CRT A;  1GL8 A;  2CFK A;  1OKD A;  1G96 A;  2P31 A;  3GYK A;  5EPF A;  2H66 A;  5J41 A;  3GKN A;  3DVX A;  2W0Q A;  3H8Q A;  3G71 3;  3F63 A;  4I2T A;  4MJD A;  1DVC A;  1LQM B;  3UL3 A;  1TFO A;  1SL0 B;  3CTG A;  4GXZ A;  3KSE D;  1GSY A;  3RHB A;  3TOT A;  4ZXG A;  1VQ5 3;  1YJ9 3;  1Q40 B;  3LWA A;  1GTU A;  2FA4 A;  4KDU A;  1GUL A;  4NHF A;  5JCW A;  5ECS A;  2I3Y A;  4N0V A;  3WA2 X;  3GIX A;  3I56 3;  4KDX A;  4XS4 B;  3EIN A;  4TOP A;  1KNG A;  3L4N A;  4TRX A;  4K61 A;  3RPP A;  4V2N A;  1Q7H A;  3FG1 A;  1J2B A;  1AUC A;  1THX A;  3WMD A;  3HJO A;  2B1K A;  1UDI I;  1GSQ A;  3HZP A;  5KOX A;  2C8U A;  3EE2 A;  5ECR B;  1OVN A;  1B48 A;  5HR3 A;  4HM2 B;  1FYS A;  1R4C A;  1NM3 A;  3BIR A;  1SJ6 A;  1SEN A;  3FZ4 A;  3AHS A;  1FOH A;  1KBN A;  2HMN B;  1FA3 A;  1ZL9 A;  1BAN A;  5IG5 A;  4HSC X;  2LEG A;  3D5I A;  4K7I A;  3A2W A;  1VQ4 3;  4ISD A;  1F37 A;  12GS A;  4TW5 A;  1UCJ A;  2CIU A;  3IRA A;  1RNB A;  2L6C A;  4FCM A;  1LOY A;  2F98 A;  1TU8 A;  1DE2 A;  2XPE A;  5J9B A;  2N5B A;  1MNL A;  1GTB A;  10GS A;  3TJG A;  2VM1 A;  1UGI A;  3W8J A;  2JDI H;  4WYK B;  3QR6 A;  4K1V A;  1PFO A;  1AY7 A;  5DJL A;  2Y73 A;  4ZB9 A;  2HOH A;  4DSR A;  3X3X A;  3L9S A;  2QKE A;  2HXK A;  2QSI A;  3VFI A;  1UCK A;  1RGH A;  2CFL A;  3CC2 3;  2O9U X;  5DCH A;  4EW5 A;  2F8F A;  4TN8 A;  3GKX A;  1BRJ A;  3S27 A;  4RBN A;  3NQY A;  3IAS 2;  3JUQ A;  2I9W A;  3STD A;  2FHE A;  1X5C A;  3GUR A;  1LQG C;  2FNQ A;  4OO4 A;  3TKQ A;  2GBX B;  3HD5 A;  2JAD A;  2YZH A;  2YOI A;  4O92 A;  3ZVJ A;  1KSI A;  3AY8 A;  3J7Y d;  2B1L A;  3LYK A;  2DBC A;  3C7M A;  1TI3 A;  1NU3 A;  1Y6E A;  2O7K A;  1ST9 A;  3LXZ A;  4F2I A;  2VCZ A;  4O7H A;  5CRH A;  2O85 A;  3MG2 A;  4OFM A;  4YH2 A;  3LQ7 A;  4FMA A;  3CRU A;  3DM8 A;  3X41 A;  2DJ1 A;  3QFA C;  4KE3 A;  1ISK A;  1X9W B;  1VQO 3;  4OFT A;  2GZZ A;  4OCF A;  2CG0 A;  5AIG A;  3G9B A;  3VWU A;  1XW9 A;  4EKZ A;  1NDO B;  3OWS A;  1SK1 A;  3G7Y A;  2BTO T;  1NB3 I;  2DKI A;  1RJO A;  2H71 A;  3F4T A;  5LNK e;  5ECQ B;  2P0G A;  3LG6 A;  4BL2 A;  19GS A;  5IEO A;  5JCU A;  4CCV A;  4FR9 A;  4IS0 A;  1N9J A;  1EG9 B;  1VQ6 3;  1VQN 3;  5LC7 A;  1TRW A;  1R26 A;  2BMX A;  1IVU A;  1SKR B;  2ON7 A;  2FWE A;  2CC3 A;  1UUV B;  3ALA A;  2LQO A;  2OBI A;  4PNF A;  2GBW B;  1XW6 A;  1BSD A;  3FG3 A;  2GZY A;  3KP9 A;  3NHX A;  2XSH B;  4GCI A;  3C1R A;  1LBK A;  4TKY A;  5IF6 A;  2IFQ B;  3KTL A;  2R4V A;  2CQ9 A;  2RGQ A;  3F8U A;  1JKG B;  3K8N A;  4OD7 A;  3M3M A;  2V6O A;  1EQK A;  5ENU A;  2R4I A;  3F4R A;  1RHL A;  5FGO A;  4PQ1 A;  3LTB A;  3K7C A;  1SD8 A;  1OKT A;  4EC6 A;  3BCK A;  4V1A g;  3IAM 2;  4GWR A;  3HVX A;  5JCG A;  3Q18 A;  2H1A A;  2NVL A;  3B4P A;  2CAI A;  1OAZ A;  2FWF A;  5A0O B;  3KXO A;  1K3Y A;  3M8C A;  5IMA A;  4POM A;  1M9B A;  4OMV A;  2H6Z A;  3ECF A;  5CF1 A;  2H8L A;  3LTC A;  4KFF A;  5CK6 A;  1N5H A;  5J3R A;  3WHO A;  3F8H A;  2ES7 A;  1E6B A;  4F82 A;  2R6K A;  1WPI A;  4DSQ A;  1C7H A;  3LML A;  3GH9 A;  2GSS A;  1O7U A;  1DMN A;  3NOF A;  1F8N A;  1Z5Y E;  3S67 A;  5ECO B;  3JUN A;  2DJ0 A;  2RII A;  1ULI B;  2XRX B;  3RNT A;  5DAK A;  1GWC A;  3EHC A;  1Q7Y 4;  1BUQ A;  2IME A;  4HJ2 A;  2OE0 A;  4JR4 A;  2VIM A;  1FGO A;  2WFC A;  4FO5 A;  2W9P A;  1LRA A;  5D9X A;  3MNG A;  3HHV A;  9GSS A;  2GST A;  3CCR 3;  3JUM A;  1YQ1 A;  3D9R A;  4BA7 A;  2FY6 A;  3UBL A;  4Z2U A;  3EB8 A;  1M9G A;  1WMJ A;  5CNW A;  2KLX A;  1TRQ A;  1VQK 3;  4OCE A;  2JZR A;  1BVI A;  5JWO B;  3D21 A;  3UVT A;  4N6V 0;  3ZYW A;  1FGT A;  3HA9 A;  5KN3 A;  1O73 A;  2B5E A;  3F6F A;  2MC8 A;  1BIR A;  1RGL A;  6GSU A;  1A24 A;  3P8W A;  3ED3 A;  1OCV A;  4HVN A;  4MZC A;  4POB A;  4EV2 A;  4GF0 A;  4JRR A;  1TDI A;  3BNC A;  4IP6 A;  4JU5 A;  3GFK A;  4WXT A;  3KP8 A;  3KZQ A;  3VGN A;  5BIR A;  1V9W A;  6GSP A;  1FUW A;  1E3R A;  3X3Y A;  4Q5Q A;  2CFG A;  4OVM A;  2MF7 A;  1CH0 A;  3TKS E;  1UW1 A;  2KXG A;  2OCT A;  5I97 A;  2HZE B;  2KHP A;  1GLQ A;  1S5A A;  3BJ5 A;  4LLR A;  3BOA A;  4MJA A;  2E2T A;  3QPM A;  2Z6B A;  2L4Q A;  1UI8 A;  1FAA A;  3M0F A;  1QK8 A;  1LVN A;  1JBR A;  3LOR A;  1GOU A;  3HK4 A;  3P90 A;  1K0A A;  1O8W A;  4F0C A;  2YWO A;  3PS8 A;  1PY3 A;  1HNA A;  4GQF A;  1XFL A;  5M18 A;  5EVO A;  1GSD A;  1U87 A;  2J9H A;  1CYV A;  4GHO A;  2FWH A;  3BU4 A;  1NO3 A;  3L0R A;  4TXO B;  1I2F A;  2W03 A;  2K3D A;  4ACS A;  1ILO A;  1IK3 A;  4J8T A;  3IE3 A;  2KCD A;  3F9S A;  4N11 A;  1VF1 A;  1WQL B;  3CXC 2;  2X8H A;  4XDV A;  1G6Y A;  2R3X A;  2ZHX B;  4TR1 A;  3TJF A;  1A90 A;  4GTU A;  3UL6 A;  8CHO A;  2QGV A;  3VK9 A;  1GD3 A;  4TX4 A;  2GSP A;  5KP4 A;  3IV4 A;  3FKF A;  2R0G A;  1C54 A;  3LEF A;  4GSN A;  2B7K A;  4HM7 B;  4PUA A;  1O7W B;  5RNT A;  3F9U A;  2L4V A;  3OXA A;  4RQX A;  2LKU A;  1BAO A;  3HOH A;  1A2L A;  5G2G A;  3RGA A;  3D6I A;  5H5S A;  3F7X A;  2XHF A;  3C71 A;  3SXX A;  4EIQ A;  4K1U A;  5ID2 A;  2BJX A;  3D4A A;  1LNI A;  1XOA A;  3F6D A;  2IL3 A;  1QVG 2;  1W00 A;  1EUI C;  5KN1 A;  2BU4 A;  3B8L A;  3G7I A;  2YWI A;  1UI7 A;  1FHE A;  3GKM A;  1N8R 4;  4K90 B;  4KX4 A;  4ZL8 A;  3GST A;  5AGY A;  3M8N A;  8RNT A;  2WDU A;  4G9H A;  4FYC A;  1OUN A;  3CSJ A;  3Q1C A;  4N6O B;  3FY7 A;  1O8X A;  3UAR A;  2CK3 H;  3A5W A;  3GRX A;  2CWT A;  5B8A A;  1Z9H A;  2PWJ A;  1B9X C;  3GHA A;  1SJZ A;  4KUN A;  4RZM A;  4IHU A;  4WBJ A;  1IYH A;  2DKH A;  1I2E A;  4KH7 A;  4BVY A;  1HD2 A;  2GEY A;  4HM4 B;  4ORL A;  5TGN A;  3SWL A;  1GS3 A;  2B5X A;  1ERU A;  3Q6O A;  4MF7 A;  3TGZ A;  1ZO2 A;  3MPH A;  2TRX A;  3EE1 A;  3M1G A;  3AGN A;  2RLI A;  4AEQ A;  3A3T A;  3VSY A;  3MAK A;  3CXG A;  3KD0 A;  4MMZ B;  2C3Q A;  1O85 A;  1B27 A;  2IMF A;  3FZW A;  3I43 A;  1W5Z A;  1R7H A;  2XFT A;  2ZL8 A;  2PZV A;  1K73 4;  5IMF A;  4BPY A;  1K0M A;  2O89 A;  1N8Q A;  3KEB A;  1DE1 A;  5IMZ A;  4ML6 A;  1RTU A;  3RPN A;  1OHS A;  1NNV A;  2F5M A;  4ZBB A;  1NJI 4;  1XG8 A;  3LJR A;  3QDN A;  2F99 A;  1O81 A;  1WRY A;  3CCE 3;  4JF8 A;  1Y25 A;  2JU5 A;  1LOX A;  1AW9 A;  5H5R A;  2GSQ A;  2R0C A;  2OE1 A;  3B7C A;  1DYU A;  1XWK A;  3ZFL A;  4IKH A;  5JPU A;  3NM2 A;  3WDG B;  1Z6M A;  2PVO C;  3ZMK A;  3IXR A;  1M3J A;  3VPT A;  1PL1 A;  2YPM A;  1PKW A;  1B8X A;  5G30 A;  1EGR A;  1K3O A;  2XBQ A;  2X4A A;  1I0V A;  2O3O A;  1IYY A;  3GZY B;  3LT8 A;  1JBT A;  1K41 A;  3S5C A;  3FF0 A;  1B4P A;  3D5J A;  3KTB A;  5G2Z A;  4KGI A;  4I2U A;  3ZRD A;  4F9Z A;  1K8A 4;  3CD6 3;  1EV4 A;  3VWX A;  3E9J B;  4MZW A;  2CAQ A;  3ISO A;  1VF2 A;  1SL1 B;  3SYU A;  3ZFB A;  4NV2 A;  2AHE A;  2AV4 A;  3IC8 A;  2IIY A;  3GWR A;  5G1K A;  3NBB A;  4MAB A;  2UZ8 A;  2OOV A;  4ECB A;  3N9J A;  1XBS A;  2FD3 A;  3WGD A;  3K63 A;  1C72 A;  1WMO A;  3KCH A;  4LSO A;  4MH2 A;  5HFK A;  1VZZ A;  4I8B A;  4WF5 A;  4L0U A;  3CNX A;  3EMP A;  2LYX A;  2R41 A;  1SL2 B;  2AAW A;  1ML6 A;  4O2H A;  5EEO A;  2X8C A;  1D6Y A;  4RI7 A;  2X99 A;  4O5R A;  3X40 A;  1JB2 A;  3U5R E;  4EXJ A;  4D73 A;  2F5W A;  2ZA4 A;  5ELU A;  3HI7 A;  2FCH A;  5AEW B;  1DUG A;  4ZB8 A;  3G6E 3;  1VF3 A;  5CLK A;  5C00 A;  4DSS A;  1GSU A;  5IMD A;  2IA7 A;  1BRN L;  1MDK A;  1FO5 A;  4KAE A;  5ECM B;  1QAK A;  1I3F A;  3JVC A;  1RMS A;  2V41 A;  1FB0 A;  5DAK B;  2P0M A;  4HUA A;  3Q90 A;  2WS2 A;  3HZ4 A;  2DSA A;  4BTW A;  2MBT A;  4HM0 B;  4HZ2 A;  2VUP A;  2CZ2 A;  2BHM A;  1OPY A;  1JB5 A;  4G10 A;  5ELA A;  4RNT A;  1YNV X;  3GTU A;  1AR0 A;  1VGL A;  2CWU A;  1ZCP A;  3N5O A;  2RUE A;  3HJM A;  1Q98 A;  1X5D A;  3BLZ A;  4WEY A;  5B8B A;  2D2Z A;  5B6N A;  5ELJ A;  4L5O A;  3ZML A;  3NM7 A;  1J9B A;  1MTC A;  3DUK A;  3Q2P A;  1O6J A;  2VL2 C;  1FW1 A;  1T2I A;  1GH2 A;  2LV3 A;  2PPT A;  2QC7 A;  1TP6 A;  1S3C A;  4L8P A;  2I81 A;  1SII A;  2VAF A;  2HRK A;  1NHY A;  2DMM A;  2BT3 A;  2A4H A;  2PER A;  4QQ7 A;  2VCT A;  3GZR A;  2CZ3 A;  2GU3 A;  4G19 A;  5J4U A;  4G2E A;  1ROA A;  4TXV A;  3E99 A;  4LL4 B;  1GMR A;  1VF4 A;  4MCU A;  1HZ1 A;  5DCG A;  1CQG A;  1PGT A;  2G2Q A;  5F06 A;  4AKY A;  3ZG0 A;  2YWN A;  3RAZ A;  1XWA A;  3N9H A;  1TXX A;  3CPO A;  1FGQ A;  4EF0 A;  2H6X A;  2B5Y A;  2H72 A;  1B3S A;  1IQY A;  1VQ7 3;  3PXM A;  4OK0 A;  1M3I A;  4XBT A;  1T3B A;  1T5Y A;  3KGK A;  3WGX A;  2C3T A;  3NUV A;  4WWU C;  1NSW A;  1T4Z A;  1IU7 A;  2STD A;  4TR0 A;  4FQU A;  1YGW A;  3DY5 A;  5CXO A;  4K0N A;  2C0G A;  4BIR A;  5AYS C;  5DAL A;  1YGE A;  1ZGN A;  1MEK A;  2K0M A;  1SU9 A;  2W9Q A;  1PL2 A;  4HYZ A;  4WKW A;  2F51 A;  4AGS A;  4TR1 B;  1SKW B;  3DGL A;  1D6U A;  2H0H A;  1GP1 A;  1H4O A;  3LW9 A;  5JPP A;  5G5E A;  3URP A;  3O3T A;  4WR5 A;  1WJK A;  2E2G A;  3J7Y k;  2JSZ A;  3FKA A;  4LEH A;  2YWM A;  3QOU A;  4R80 A;  3J7Y b;  1GY7 A;  1BYE A;  3T8N A;  2LQV A;  3US3 A;  4KA0 A;  1I70 A;  4N6T A;  5ID2 B;  3EJV A;  3NV0 B;  3PGB A;  4BTX A;  2GT6 A;  3VLN A;  1W01 A;  1YI2 3;  4GB5 A;  1VQM 3;  3QCP A;  4RNY A;  4MJE A;  1UVZ A;  1X1X A;  3CSI A;  1X1U A;  3CPW 2;  4HS1 A;  3FYG A;  3IK9 A;  4ID0 A;  4XS6 A;  5A4V A;  1A2P A;  5GZZ B;  4U13 A;  3CCV 3;  4EO3 A;  1AQW A;  1AQV A;  4IJ3 A;  3TB2 A;  2CVD A;  2IMJ A;  2M72 A;  2D1W A;  1RQM A;  2OKA A;  4L0W A;  1QAL A;  2Z77 A;  5BU4 A;  3KSP A;  4OO5 A;  3GH6 A;  5BXQ A;  1LU4 A;  1NHO A;  2HT9 A;  2CX3 A;  1CQS A;  2DML A;  2IJY A;  3APQ A;  4USS A;  4BVY B;  4IT7 A;  4PEJ A;  2O8V B;  2K6V A;  2VM2 A;  3V98 A;  2XBI A;  18GS A;  1M2B A;  1A8L A;  1N2A A;  3Q19 A;  1VQQ A;  1A2J A;  5FW5 A;  5CRD A;  2JSY A;  1F6M C;  1GOY A;  3R3E A;  2X8G A;  3N54 B;  4AJ6 A;  2P38 A;  1PX7 A;  4XBX A;  4HEA 2;  1YJ6 A;  5L71 A;  2VL3 A;  1ULJ B;  2L57 A;  2FNO A;  4HZB B;  1QGV A;  4O5U A;  2A2R A;  2KAA A;  1K0B A;  3IDV A;  3UJ1 A;  5DQS A;  1T8E B;  3BBY A;  4G0I A;  1BNG A;  5IMV A;  4BU4 A;  1M2D A;  4GRF A;  4YQU A;  1N5P A;  1DSB A;  2IMD A;  3IR4 A;  1HYU A;  3NZN A;  1DBY A;  3UIW A;  3DH2 A;  2PNC A;  2E2M A;  1AIU A;  2GZP A;  4DVC A;  5HR1 A;  3UBK A;  2XPD A;  1U8C B;  3H3H A;  4PUF C;  4JZQ A;  1SQW A;  2HSM A;  2VLV A;  3C8E A;  4HU7 A;  4EDY A;  4KND A;  4OWY A;  1OAC A;  1VQP 3;  1OC9 A;  3ZIT A;  3HJP A;  3RBT A;  2YP6 A;  4X43 A;  1EGO A;  4NXI A;  1IQ8 A;  1XVQ A;  3WT1 A;  3LZA A;  4K9Z A;  3FMW A;  2RM5 A;  1EA2 A;  5DQY A;  3PGT A;  4HQZ A;  5H5Q A;  2B24 B;  3TOU A;  3CCQ 3;  2OJL A;  1RN7 A;  2E0Q A;  4CY8 A;  3PH9 A;  1TTZ A;  3BD2 A;  1ERV A;  1BJX A;  2GS3 A;  2N5F A;  1I2G A;  1QXH A;  1SPU A;  1DMQ A;  2ML6 A;  3F0I A;  1IV7 A;  2KF4 A;  2YX9 A;  4MH3 A;  3GNJ A;  1QMA A;  3DKS A;  1CEW I;  2VLT A;  3MG1 A;  2VLU A;  5KP1 A;  2X49 A;  2YJ7 A;  4CDO A;  1MWT A;  1WOU A;  2IN3 A;  2C80 A;  1NB5 I;  3EU4 A;  1JLV A;  5HFI A;  2HSY A;  1XOB A;  16GS A;  1UUW B;  3L9V A; 
#chains in the Genus database with same CATH homology
 4NHZ A;  1EWX A;  1N8J A;  5GSS A;  1XIY A;  3TRP A;  5LCZ A;  3RHC A;  2LS5 A;  1IYI A;  1T1V A;  5IM9 A;  2GDR A;  2H6Y A;  2B3S A;  3ME7 A;  2WUL A;  3DD3 A;  2LST A;  2I4A A;  1V57 A;  3D4T A;  13GS A;  2GQM A;  4J57 E;  5F0G A;  4ILF A;  1MD3 A;  2AB6 A;  3IHQ A;  3UMA A;  2VCX A;  3QAG A;  3FRC A;  4GLT A;  3TKS C;  3I9V 2;  2AJQ B;  3TCO A;  2DJ2 A;  4DSS B;  2PN8 A;  4IQ1 A;  2X64 A;  3EPT A;  2H01 A;  3GSS A;  1XWC A;  4ULX A;  2OAC A;  4BWS A;  3QMX A;  3TKS A;  1F3B A;  5KN2 A;  1BG5 A;  1URM A;  3GTU B;  3TJK A;  4XRA A;  1AQX A;  1W4V A;  1M2A A;  2C0F A;  1OC8 A;  4GSS A;  1U6T A;  1GRX A;  4V2M A;  1KTE A;  2H76 A;  2K8S A;  1OE8 A;  2LNS A;  1R5A A;  1SKS B;  3KMN A;  4LA1 A;  3GKK A;  4KF9 A;  2YV7 A;  5CYY A;  5EY6 A;  3O76 A;  2I9H A;  4F03 A;  4HDE A;  3W6G A;  4BVX A;  1X9S B;  2CT6 A;  3GL3 A;  3FZA A;  2CVB A;  4FH8 A;  4TR4 A;  2IYJ A;  2GSR A;  1YZX A;  1RW1 A;  1JFU A;  4JE1 A;  1ZOF A;  4X1U A;  3F3R A;  4XRD A;  1PD2 1;  2M80 A;  2O87 A;  5LD0 A;  1JZW A;  5KEJ A;  2KUC A;  3KH7 A;  5AIV A;  2C4J A;  5HR0 A;  3A2X A;  2IPA A;  4E8E A;  2YCD A;  4CHS A;  5G5F A;  2JZT A;  5AIX A;  4MLY A;  1G7E A;  2LJR A;  5DAL B;  4EC0 A;  4P3Y B;  2H74 A;  4FYB A;  1JLW A;  2NDO A;  1E2Y A;  3VI7 A;  4YKF A;  4ZBA A;  1NW2 A;  2YZU A;  2H73 A;  4JR6 A;  6GST A;  22GS A;  3APO A;  2HYX A;  3FR6 A;  3RDW A;  4PTS A;  3FEU A;  4BL7 A;  4HU9 A;  2XC2 A;  3HDC A;  2PUK C;  5FT3 A;  2IMK A;  3FHK A;  5A4W A;  3A5I A;  1PA3 A;  2MMN A;  1X9M B;  5ECL B;  5B6M A;  2LRC A;  4O5Q A;  4AF2 A;  2DIZ A;  4N0Z A;  2VD1 A;  2HSH A;  3GX0 A;  1UC7 A;  2VL9 A;  2H70 A;  5ECN B;  4TR3 A;  5ELG A;  3LFL A;  3ZL5 A;  2HZF A;  5DBQ A;  3FZ9 A;  3VI5 A;  1F2E A;  2DC5 A;  2GQK A;  14GS A;  1V40 A;  3EC3 A;  2FWG A;  1TK8 B;  1QQ2 A;  1FB6 A;  3DVW A;  4NPB A;  3E0U A;  1OC3 A;  4Q5R A;  4IP1 A;  5HFG A;  3MSZ A;  1Q4J A;  2L5L A;  4H86 A;  2PBJ A;  3ZLP A;  6GSS A;  2C3N A;  1TI1 A;  5E4W A;  3TRX A;  3C1S A;  4MP4 A;  1MDJ A;  4N30 A;  1M7T A;  2YJH A;  3MDK A;  3GX8 A;  5IMC A;  1TJD A;  5G1L A;  4PUR A;  4KCA A;  4IBP A;  5F07 A;  1HNC A;  2NPB A;  1K0O A;  1EZK A;  1X5E A;  4K8M A;  2V2G A;  1K0N A;  1FVK A;  3CBU A;  3PIN A;  1GSS A;  4IGJ A;  1TU7 A;  3ERG A;  1SYX A;  2K9F A;  4QL9 A;  2H0I A;  5BMU A;  1XXU A;  3EMX A;  4DEJ A;  5A5K A;  3Q74 A;  3UEM A;  3H1N A;  2HRF A;  2H19 A;  3IPZ A;  4NMU A;  3S9F A;  2LJK A;  2R2J A;  3WD6 A;  3GUS A;  3M9K A;  4KDY A;  4MJC A;  3EWL A;  3W8S A;  2P5R A;  3L0H A;  2MYG A;  1PQN A;  2R37 A;  1OC9 B;  3FW2 A;  1B9Y C;  3DYR A;  4QL7 A;  2I1U A;  5F05 A;  5J9C A;  1YEP A;  1S3A A;  2AYT A;  3UOM A;  1ERT A;  3I69 A;  1R5P A;  3HXS A;  5GST A;  3WGE A;  2B6M A;  4N10 A;  5CP1 A;  3IOS A;  3ERW A;  2ZCT A;  2PGT A;  1XCC A;  1M0U A;  2FGX A;  2TRC P;  3U6V A;  3I6A A;  1SJI A;  1T7P B;  3IBH A;  4K2D A;  3H4K A;  2K8V A;  1J08 A;  1TRV A;  4IJI A;  3DWV A;  3EUR A;  4J2F A;  1JHB A;  2YNX A;  2GVP A;  2PU9 C;  4WET A;  5D93 A;  2ZNM A;  4TVE A;  4ECI A;  3O6T A;  1UA5 A;  4KSO A;  5FHI A;  1LJR A;  4KSM A;  3UAP A;  2GT5 A;  4HQS A;  2H0G A;  20GS A;  1PSQ A;  1FOV A;  1Z7R A;  3GV1 A;  4MA9 A;  2VL2 A;  3A2V A;  1THO A;  4K1F A;  2LJA A;  3KCM A;  4JBB A;  5IOW A;  2EIR A;  5CRG A;  2V32 A;  2MMZ A;  5B7C A;  2LNT A;  5BRT A;  1PN9 A;  1F3A A;  3OR5 A;  4G0K A;  1ON4 A;  4ZL7 A;  2VD0 A;  4ECJ A;  2OA7 A;  1EP8 A;  4X4J A;  5CRE A;  2L59 A;  4IEL A;  1G0T A;  1TKD B;  3PR8 A;  4KW6 A;  1YF1 A;  3DEX A;  8GSS A;  2KP1 A;  4KB3 A;  1XW5 A;  5CRW A;  3FK8 A;  2R5G A;  3QAV A;  4YQM A;  1JZD A;  1FVJ A;  4EVM A;  2IY2 A;  5D9T A;  3EVI A;  4AJ7 A;  3P7X A;  1TK0 B;  2YAN A;  3D0Z A;  4PGT A;  1ACV A;  1MDI A;  1GUH A;  3G7J A;  4L8E A;  3MIX A;  4BVX B;  1U88 A;  4JED A;  2H1G A;  2P5Q A;  1YKA A;  1XZO A;  2HE3 A;  1WWJ A;  4XS1 A;  2VO4 A;  4V1A p;  1KEB A;  2RUF A;  3CYN A;  3R2Q A;  3JCM L;  1XWB A;  3ZRE A;  4YQV A;  1A2M A;  2LRT A;  1YKC A;  3GA4 A;  3HVS A;  4NAX A;  3VWV A;  2AUV A;  3APS A;  2DIY A;  5ECP B;  4K6X A;  2MBS A;  4HI7 A;  3HKR A;  1QMV A;  4NWY A;  1A0F A;  4Z2T A;  1ZYE A;  2LQQ A;  3DGQ A;  2G0F A;  1ZMA A;  1QFN A;  1ZYP A;  3WT2 A;  4O32 A;  4MZB A;  4K5S A;  2VCV A;  2V1M A;  5IPH A;  1ZZY A;  3TUE A;  3C73 A;  4BL7 B;  1SK0 A;  1OYJ A;  2REM A;  4I6X A;  3ZTL A;  4LMW A;  3LSZ A;  1HNB A;  3P2A A;  2LTK A;  3D4M A;  5HR2 A;  4PNG A;  3QAW A;  4ML1 A;  4FYU A;  4K7O A;  2B7J A;  5IOX A;  5ECH B;  3DXB A;  1GUM A;  1A23 A;  2HI7 A;  1GUK A;  2HNL A;  3CMI A;  1XWG A;  3GL5 A;  2IWT A;  3MWH A;  5IO2 A;  4EE0 A;  3TDG A;  2H1B A;  5COH A;  1BQ7 A;  4WBR D;  4K0G A;  3CSH A;  1J0F A;  2CA8 A;  2OAD A;  2DJ3 A;  3F4S A;  3HCZ A;  1I9D A;  2M46 A;  1BX9 A;  1GSE A;  4ZBD A;  4LL1 B;  2A2P A;  2NTO A;  1SD9 A;  11GS A;  5D8I A;  2WB9 A;  2IMI A;  1FG4 A;  1U3I A;  2F3M A;  1SYR A;  3LXT A;  1V2A A;  3ZIJ A;  1VRS D;  2ON5 A;  4PXO A;  4Q5N A;  3FR9 A;  3DRN A;  2N5A A;  1Z6N A;  4G0L A;  4E8H A;  1AC1 A;  2CVK A;  3D22 A;  1S3D A;  2FA8 A;  4NHW A;  3HZ8 A;  4PX1 A;  4ZIL A;  3ERF A;  4MF5 A;  2NBS A;  5JWR B;  3H79 A;  1ZYN A;  4F0B A;  2A4V A;  3VPQ A;  1SK2 A;  4L5L A;  3KIJ A;  3QFB C;  2WGR A;  4Z7X A;  1ERW A;  3KJY A;  4PQI A;  5EL8 A;  4EUY A;  2VCW A;  5G31 A;  4D73 B;  4LMV A;  4X0X A;  1UN2 A;  2DLX A;  4K2X A;  3TJJ A;  1WP0 A;  4ZIJ A;  1T00 A;  5DDL A;  4EIP A;  1MD4 A;  2C0E A;  3H93 A;  1U3A A;  2F9S A;  3IK7 A;  3TRQ A;  2CV4 A;  2WRT A;  4XS4 A;  1AXD A;  5JWQ B;  2V6K A;  5D73 A;  1OE7 A;  5ABR A;  4RQR A;  2PVQ A;  3CTF A;  1A0R P;  4I5Q A;  3EU3 A;  3HYP A;  3TJB A;  3GMF A;  3BCI A;  4A5P A;  3VUR A;  1XPV A;  4J56 E;  2L6D A;  2TIR A;  5AIS A;  5IO0 A;  1GTA A;  2R0P A;  4AJ8 A;  4ECC A;  2EC4 A;  1R4W A;  2GQL A;  4WR4 A;  5C04 A;  3L9U A;  2WCI A;  4YAV A;  4MPF A;  3F3Q A;  3TKP A;  2J23 A;  3ZIV A;  2HFD A;  5J5N A;  1PKZ A;  3KH9 A;  5GAN D;  4V2L A;  1USB A;  4IVF A;  4KCE A;  4GST A;  4ZB6 A;  2YN1 A;  1HQO A;  3KM6 A;  2GLR A;  2HRA A;  1GLP A;  17GS A;  2MZC A;  2DJK A;  4HZ4 A;  4Q5F A;  4FIW A;  4POL A;  1W89 A;  5IIZ A;  1M99 A;  5HQP A;  2HLS A;  4PQH A;  4POK A;  2EIO A;  5DVB A;  4Z2R A;  1K0D A;  1YDK A;  1YEX A;  1Z3E A;  1CQH A;  4MJB A;  5DJM A;  2KP2 A;  1Z7P A;  4BWQ A;  3MYD A;  4YKG A;  2VCQ A;  4OFN A;  4EL1 A;  1QUW A;  3ZVJ D;  4GQC A;  1TW9 A;  6GSY A;  2ALB A;  2KOK A;  2F8A A;  3LGC A;  2H30 A;  4XCS A;  2L5O A;  2QA2 A;  3VWW A;  2LUS A;  1K0C A;  3IA1 A;  4CY6 A;  4I97 A;  2YV9 A;  2FLS A;  4IW9 A;  5KOW A;  3LYP A;  1BAY A;  3E3E A;  1T4Y A;  1JZO A;  2E7P A;  1G7O A;  4IN0 A;  2K18 A;  1ABA A;  2C0D A;  4K7N A;  2Z9S A;  2GTU A;  2FUG 2;  4MDC A;  3WYW A;  4MNN A;  1M9A A;  3FR3 A;  2IFQ A;  5F8B A;  2LRN A;  1K3L A;  1PX6 A;  3HVV A;  7GSS A;  5CO3 A;  1G6W A;  1X0R A;  1WE0 A;  1TRS A;  4RUV A;  2PMT A;  3QD9 A;  1V98 A;  1TK5 B;  1YF0 A;  2JL4 A;  1F9M A;  2EIQ A;  2MMA A;  1ZYQ B;  4RI6 A;  1TP9 A;  1GNW A;  2A2S A;  1B4Q A;  1RK4 A;  2ZUP A;  2DJJ A;  4K5R A;  3KMO A;  1JZR A;  4MF6 A;  3HY2 A;  5D9V A;  3SBC A;  1PMT A;  5CAX A;  5D9W A;  3PPU A;  1PN0 A;  1EP7 A;  4ICY A;  1A8Y A;  1TRU A;  3L78 A;  1EEJ A;  3FZ5 A;  5IQY A;  1EV9 A;  2WJU A;  3IC4 A;  2H75 A;  6GSV A;  5IPG A;  1AAZ A;  4YAP A;  5AN1 A;  1XVW A;  3EYT A;  5E59 A;  1EOH A;  1GSF A;  2HRN A;  4ZL9 A;  3NIV A;  6GSW A;  5GAP D;  3GN3 A;  3M9J A;  5KN0 A;  4EDZ A;  5ECI B;  1EEM A;  1GTI A;  2WZ9 A;  3DIE A;  5ECK B;  5D96 A;  4XHM A;  4CW9 A;  4XIH A;  2L4C A;  3DML A;  2JAC A;  4WF4 A;  1GNE A;  5FWG A;  4IQA A;  4MMM A;  1H75 A;  4MPG A;  2CX4 A;  3UVH A;  2QA1 A;  1TOF A;  3ZZX A;  2OBK A;  2VOC A;  1BED A;  1V58 A;  4XTS A;  4NV5 A;  3IHG A;  2HZE A;  1YY7 A;  1EOG A;  4MK3 A;  5INY A;  1WIK A;  3ME8 A;  1PRX A;  2MMO A;  2GGT A;  6GSX A;  2C1Y A;  2JZS A;  2RM6 A;  2OE3 A;  3TKR A;  3V1W A;  1I5G A;  5A4U A;  2H1D A;  4HOJ A;  4TXO A;  3CRT A;  1GL8 A;  5EPF A;  1OKD A;  2P31 A;  3GYK A;  2H66 A;  5J41 A;  3GKN A;  3DVX A;  3H8Q A;  3F63 A;  4I2T A;  3UL3 A;  1SL0 B;  3CTG A;  4GXZ A;  1GSY A;  3RHB A;  3TOT A;  4ZXG A;  3LWA A;  1GTU A;  2FA4 A;  4KDU A;  1GUL A;  5JCW A;  5ECS A;  2I3Y A;  4N0V A;  3GIX A;  4KDX A;  4XS4 B;  3EIN A;  4TOP A;  1KNG A;  3L4N A;  4TRX A;  3RPP A;  4V2N A;  1AUC A;  1THX A;  3HJO A;  2B1K A;  1GSQ A;  5KOX A;  2C8U A;  3EE2 A;  5ECR B;  1OVN A;  1B48 A;  5HR3 A;  1NM3 A;  1SJ6 A;  1SEN A;  3FZ4 A;  1FOH A;  1KBN A;  1ZL9 A;  2LEG A;  4K7I A;  3A2W A;  4ISD A;  1F37 A;  12GS A;  4TW5 A;  3IRA A;  2L6C A;  1TU8 A;  1DE2 A;  2XPE A;  5J9B A;  2N5B A;  1GTB A;  10GS A;  3TJG A;  2VM1 A;  3W8J A;  3QR6 A;  5DJL A;  4ZB9 A;  4DSR A;  3L9S A;  2QKE A;  2HXK A;  2QSI A;  3VFI A;  5DCH A;  2F8F A;  4TN8 A;  3GKX A;  3IAS 2;  2FHE A;  1X5C A;  3GUR A;  4OO4 A;  3TKQ A;  3HD5 A;  2JAD A;  2YZH A;  2YOI A;  4O92 A;  3ZVJ A;  3AY8 A;  2B1L A;  3LYK A;  2DBC A;  3C7M A;  1TI3 A;  1Y6E A;  2O7K A;  1ST9 A;  3LXZ A;  4F2I A;  2VCZ A;  4O7H A;  5CRH A;  2O85 A;  4OFM A;  4YH2 A;  3LQ7 A;  3CRU A;  2DJ1 A;  3QFA C;  4KE3 A;  1X9W B;  4OFT A;  2GZZ A;  4OCF A;  3G9B A;  3VWU A;  1XW9 A;  4EKZ A;  1SK1 A;  3G7Y A;  2BTO T;  2DKI A;  2H71 A;  3F4T A;  5LNK e;  5ECQ B;  2P0G A;  3LG6 A;  19GS A;  5JCU A;  4IS0 A;  1TRW A;  1R26 A;  2BMX A;  1SKR B;  2ON7 A;  2FWE A;  2LQO A;  2OBI A;  4PNF A;  1XW6 A;  3KP9 A;  2GZY A;  4GCI A;  3C1R A;  1LBK A;  4TKY A;  2IFQ B;  3KTL A;  2R4V A;  2CQ9 A;  3F8U A;  3K8N A;  4OD7 A;  3M3M A;  2V6O A;  5ENU A;  3F4R A;  4PQ1 A;  1SD8 A;  1OKT A;  3BCK A;  4V1A g;  3IAM 2;  4GWR A;  3HVX A;  5JCG A;  3Q18 A;  2H1A A;  2NVL A;  2FWF A;  2CAI A;  1OAZ A;  3KXO A;  1K3Y A;  5IMA A;  4POM A;  1M9B A;  4OMV A;  2H6Z A;  2H8L A;  5J3R A;  2ES7 A;  1E6B A;  4F82 A;  2R6K A;  1WPI A;  4DSQ A;  3GH9 A;  2GSS A;  1O7U A;  3NOF A;  1Z5Y E;  5ECO B;  2DJ0 A;  2RII A;  5DAK A;  1GWC A;  2IME A;  4HJ2 A;  2OE0 A;  4JR4 A;  2VIM A;  2WFC A;  4FO5 A;  5D9X A;  3MNG A;  3HHV A;  9GSS A;  2GST A;  1YQ1 A;  4BA7 A;  2FY6 A;  3UBL A;  4Z2U A;  1WMJ A;  5CNW A;  2KLX A;  4OCE A;  2JZR A;  5JWO B;  3D21 A;  3UVT A;  3ZYW A;  3HA9 A;  5KN3 A;  1O73 A;  2B5E A;  3F6F A;  6GSU A;  1A24 A;  3P8W A;  3ED3 A;  4MZC A;  4POB A;  4GF0 A;  4JRR A;  1TDI A;  4IP6 A;  4JU5 A;  3GFK A;  4WXT A;  3KP8 A;  3KZQ A;  1V9W A;  4Q5Q A;  3TKS E;  2HZE B;  2KHP A;  1GLQ A;  3BJ5 A;  4LLR A;  3BOA A;  4MJA A;  3QPM A;  2L4Q A;  1FAA A;  3M0F A;  1QK8 A;  3LOR A;  3P90 A;  1K0A A;  1O8W A;  4F0C A;  2YWO A;  1HNA A;  4GQF A;  1XFL A;  5EVO A;  1GSD A;  1U87 A;  2J9H A;  2FWH A;  4TXO B;  4ACS A;  1ILO A;  3IE3 A;  4N11 A;  1VF1 A;  2X8H A;  1G6Y A;  2R3X A;  4TR1 A;  3TJF A;  4GTU A;  2QGV A;  3VK9 A;  3IV4 A;  3FKF A;  2R0G A;  3LEF A;  4GSN A;  2B7K A;  4PUA A;  3F9U A;  4RQX A;  2LKU A;  1A2L A;  3D6I A;  5H5S A;  2XHF A;  3C71 A;  4EIQ A;  5ID2 A;  2BJX A;  1XOA A;  3F6D A;  2IL3 A;  5KN1 A;  3G7I A;  2YWI A;  1FHE A;  3GKM A;  4KX4 A;  4ZL8 A;  3GST A;  5AGY A;  3M8N A;  2WDU A;  4G9H A;  4FYC A;  3CSJ A;  3FY7 A;  3UAR A;  1O8X A;  3A5W A;  3GRX A;  5B8A A;  1Z9H A;  2PWJ A;  1B9X C;  3GHA A;  1SJZ A;  4KUN A;  4IHU A;  4WBJ A;  1IYH A;  2DKH A;  4KH7 A;  4BVY A;  1HD2 A;  3SWL A;  2B5X A;  1ERU A;  3Q6O A;  4MF7 A;  3TGZ A;  2TRX A;  3M1G A;  2RLI A;  3A3T A;  3MAK A;  3CXG A;  3KD0 A;  2C3Q A;  1O85 A;  2IMF A;  3I43 A;  1R7H A;  5IMF A;  4BPY A;  1K0M A;  2O89 A;  3KEB A;  1DE1 A;  5IMZ A;  4ML6 A;  3RPN A;  4ZBB A;  3LJR A;  3QDN A;  1O81 A;  1WRY A;  1Y25 A;  5H5R A;  2JU5 A;  1AW9 A;  2GSQ A;  2R0C A;  2OE1 A;  1XWK A;  3ZFL A;  4IKH A;  1Z6M A;  2PVO C;  3ZMK A;  3IXR A;  3VPT A;  1PL1 A;  2YPM A;  1PKW A;  1B8X A;  5G30 A;  1EGR A;  1K3O A;  2XBQ A;  2X4A A;  1B4P A;  3KTB A;  3D5J A;  5G2Z A;  4KGI A;  4I2U A;  3ZRD A;  4F9Z A;  1EV4 A;  3VWX A;  3E9J B;  4MZW A;  2CAQ A;  3ISO A;  1VF2 A;  1SL1 B;  3ZFB A;  4NV2 A;  2AHE A;  2AV4 A;  3IC8 A;  2IIY A;  5G1K A;  4MAB A;  2UZ8 A;  4ECB A;  3N9J A;  1XBS A;  2FD3 A;  3WGD A;  1C72 A;  4MH2 A;  5HFK A;  4I8B A;  4WF5 A;  4L0U A;  3EMP A;  1SL2 B;  2AAW A;  1ML6 A;  2X8C A;  4RI7 A;  2X99 A;  4O5R A;  3U5R E;  4EXJ A;  4D73 A;  2FCH A;  1DUG A;  4ZB8 A;  1VF3 A;  5C00 A;  4DSS A;  1GSU A;  5IMD A;  1MDK A;  1FO5 A;  4KAE A;  5ECM B;  2V41 A;  1FB0 A;  5DAK B;  4HUA A;  2WS2 A;  3HZ4 A;  2DSA A;  2MBT A;  4HZ2 A;  2VUP A;  2CZ2 A;  4G10 A;  5ELA A;  3GTU A;  1VGL A;  1ZCP A;  3N5O A;  2RUE A;  3HJM A;  1Q98 A;  1X5D A;  4WEY A;  5B8B A;  2D2Z A;  5B6N A;  4L5O A;  3ZML A;  1J9B A;  1MTC A;  1O6J A;  2VL2 C;  1FW1 A;  1GH2 A;  2LV3 A;  2PPT A;  2QC7 A;  1S3C A;  2I81 A;  2VAF A;  2HRK A;  1NHY A;  2DMM A;  2A4H A;  2PER A;  4QQ7 A;  2VCT A;  2CZ3 A;  4G19 A;  5J4U A;  4G2E A;  4TXV A;  4LL4 B;  1VF4 A;  4MCU A;  5DCG A;  1CQG A;  1PGT A;  2G2Q A;  5F06 A;  2YWN A;  3RAZ A;  1XWA A;  1TXX A;  4EF0 A;  2H6X A;  2B5Y A;  2H72 A;  1T3B A;  3KGK A;  3WGX A;  2C3T A;  1NSW A;  1T4Z A;  4TR0 A;  4FQU A;  4K0N A;  2C0G A;  5DAL A;  1ZGN A;  1MEK A;  1SU9 A;  1PL2 A;  4WKW A;  2F51 A;  4AGS A;  4TR1 B;  1SKW B;  2H0H A;  1GP1 A;  1H4O A;  3LW9 A;  5G5E A;  3O3T A;  4WR5 A;  1WJK A;  2E2G A;  3J7Y k;  2JSZ A;  2YWM A;  3QOU A;  3J7Y b;  1BYE A;  3US3 A;  4KA0 A;  5ID2 B;  2GT6 A;  3VLN A;  3QCP A;  4MJE A;  1UVZ A;  3CSI A;  4HS1 A;  3FYG A;  3IK9 A;  4ID0 A;  4XS6 A;  5A4V A;  5GZZ B;  4EO3 A;  1AQW A;  1AQV A;  4IJ3 A;  3TB2 A;  2CVD A;  2M72 A;  2OKA A;  1RQM A;  4L0W A;  4OO5 A;  3GH6 A;  1LU4 A;  1NHO A;  2HT9 A;  2CX3 A;  2DML A;  2IJY A;  3APQ A;  4USS A;  4BVY B;  2O8V B;  2K6V A;  2VM2 A;  2XBI A;  18GS A;  1M2B A;  1A8L A;  1N2A A;  3Q19 A;  1A2J A;  5CRD A;  2JSY A;  1F6M C;  3R3E A;  2X8G A;  4AJ6 A;  1PX7 A;  4HEA 2;  1YJ6 A;  5L71 A;  2VL3 A;  2L57 A;  2FNO A;  1QGV A;  4O5U A;  2A2R A;  1K0B A;  3IDV A;  3UJ1 A;  5DQS A;  1T8E B;  3BBY A;  4G0I A;  5IMV A;  1M2D A;  4GRF A;  4YQU A;  1DSB A;  2IMD A;  3IR4 A;  1HYU A;  3NZN A;  1DBY A;  3UIW A;  2E2M A;  1AIU A;  2GZP A;  4DVC A;  5HR1 A;  3UBK A;  2XPD A;  4PUF C;  4JZQ A;  2HSM A;  2VLV A;  3C8E A;  4HU7 A;  4EDY A;  4KND A;  4OWY A;  1OC9 A;  3ZIT A;  3HJP A;  3RBT A;  2YP6 A;  4X43 A;  1EGO A;  4NXI A;  1XVQ A;  3WT1 A;  4K9Z A;  3FMW A;  2RM5 A;  5DQY A;  3PGT A;  4HQZ A;  5H5Q A;  3TOU A;  2OJL A;  2E0Q A;  4CY8 A;  3PH9 A;  1TTZ A;  3BD2 A;  1ERV A;  1BJX A;  2GS3 A;  2N5F A;  1QXH A;  3F0I A;  4MH3 A;  3GNJ A;  3DKS A;  2VLU A;  2VLT A;  2X49 A;  4CDO A;  2YJ7 A;  1WOU A;  2IN3 A;  2C80 A;  3EU4 A;  1JLV A;  5HFI A;  2HSY A;  1XOB A;  16GS A;  4HJM A;  3L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...