1V58A

Crystal structure of the reduced protein disulfide bond isomerase dsbg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Crystal structures of the DsbG disulfide isomerase reveal an unstable disulfide
pubmed doi rcsb
source organism Escherichia coli
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1v58A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1v58A02
3US3A 3LFLA 1OVNA 4F0CA 3F6DA 2JZSA 1GP1A 3FRCA 1R26A 1SYRA 2CV4A 4ACSA 3TCOA 3UOMA 2AUVA 5D8IA 1K3YA 1EGOA 2H75A 4OD7A 4IGJA 3WGXA 2C0EA 3GX8A 2BTOT 5GAPD 3IR4A 5CREA 2GSSA 3FKFA 2IPAA 4TRXA 1LU4A 1SL0B 2B7JA 1TJDA 4XS4A 1R4WA 1V57A 1XWAA 2GT6A 3LGCA 4MH2A 2TIRA 6GSVA 4F82A 3TKRA 1A0FA 2XC2A 5ECMB 4NHWA 1GNWA 1FB0A 3KCMA 5ECQB 1YEPA 4AF2A 1GSUA 3LJRA 2O7KA 4Z7XA 4K8MA 3GTUB 1J0FA 1GULA 2LJAA 4POKA 1I9DA 2MMNA 3H93A 2LNTA 1O6JA 1ERTA 4KW6A 5ECLB 4MDCA 3MSZA 1AQWA 1TDIA 1FVJA 3RAZA 8GSSA 2X64A 4ULXA 3K8NA 4HUAA 3H79A 1X9WB 3WT1A 3DRNA 2DJ1A 2P0GA 3A2XA 1Z3EA 4EO3A 1N8JA 1JLVA 1V9WA 4HQZA 3HYPA 3CTGA 1HNAA 3M9JA 3TRQA 1PX7A 1K3LA 3BCIA 1SK0A 5ENUA 1H75A 4OCFA 2PERA 2JZRA 4CW9A 2H73A 3C1RA 10GSA 3LWAA 3ZTLA 3GSTA 1J9BA 1PL2A 1UA5A 1U3AA 2R2JA 3KXOA 2IMEA 3PGTA 4FYUA 1XZOA 2ALBA 1GLPA 1B9YC 3EYTA 1XPVA 4IW9A 1CQHA 2GSRA 2JADA 4ECBA 1O85A 2RLIA 1KNGA 2MBTA 4EE0A 4PX1A 4E8EA 2I1UA 3HY2A 3BCKA 3TOUA 3FY7A 3HVVA 3H1NA 2DBCA 1V98A 1XXUA 3VWXA 4IHUA 20GSA 1K3OA 1U88A 4ID0A 4MZCA 1ZL9A 1T4YA 3IA1A 1M99A 5G5FA 5A4VA 2OA7A 2OACA 3DVXA 3C71A 1WJKA 2FWGA 5LCZA 5CNWA 2IY2A 1EWXA 4HU9A 2HE3A 2GDRA 3CSIA 1HD2A 4EC0A 1ABAA 2VUPA 3F8UA 3O76A 2OADA 2P5RA 2LTKA 1TU8A 1QFNA 5DQYA 5CAXA 4OWYA 2E2MA 4BVYA 3PR8A 4OO4A 4LMVA 1SL2B 2KLXA 1OYJA 3HDCA 3FZ4A 3GH9A 4EDYA 3IHQA 2WDUA 1K0DA 4WBRD 4AGSA 1Z7RA 1XWGA 1YQ1A 4CHSA 3D22A 4JBBA 4XIHA 3IOSA 2D2ZA 3VFIA 5F07A 1QK8A 1O81A 3A5WA 3GN3A 3WD6A 4YAPA 4D73A 4PUAA 4I97A 4FO5A 3F4RA 4NV2A 1R5PA 13GSA 2VL9A 3QCPA 2DJ3A 4J2FA 3CSJA 3ZL5A 4ISDA 4KSMA 5G31A 1MDKA 4JE1A 3EC3A 5IPHA 1JHBA 3WGEA 2L4QA 5IMFA 2V6KA 4EL1A 2PU9C 2DJ0A 2HZEB 3VWWA 2V6OA 1B48A 1LJRA 4V2MA 3KJYA 4QQ7A 3UARA 3FYGA 3G7YA 1EGRA 2Z9SA 3ZZXA 3NOFA 2E2GA 4Q5FA 2WRTA 4I2TA 4DVCA 1K0OA 5ELAA 1ZYEA 6GSUA 2C3NA 2HLSA 1TK5B 4GF0A 4NHZA 2L57A 5ECRB 4RUVA 4X0XA 4HEA2 4JU5A 4RQRA 1E6BA 1PX6A 1ERWA 5IMDA 4ZL8A 1SKSB 5F0GA 2IWTA 3HCZA 1MDJA 5IO2A 4K7OA 5B7CA 5D73A 2IL3A 3UAPA 1LBKA 2REMA 2WZ9A 2C80A 4GXZA 5AIVA 2PBJA 1WWJA 2R3XA 4IP1A 4WR4A 2FLSA 4IELA 3HHVA 5DCGA 3DXBA 2F3MA 2K8VA 3Q74A 9GSSA 1K0CA 1M7TA 3FHKA 4ZBBA 4HZ4A 5DVBA 1ZYQB 1FG4A 4I6XA 2JSZA 22GSA 3G9BA 3P90A 3I9V2 3N9JA 4TR3A 5J9BA 4GSSA 2N5BA 1XOBA 2DJ2A 3CRTA 3EVIA 1K0AA 1BG5A 3PINA 5C04A 3GX0A 4ML1A 3F63A 2L6DA 4FYCA 1T8EB 2H0HA 1ZZYA 4N10A 4HDEA 2IJYA 1A2LA 4JEDA 5JWQB 4WF4A 2TRXA 3KGKA 3KD0A 1PRXA 1S3AA 4HJ2A 2KOKA 2C3QA 1BAYA 4MPGA 2EIOA 2VLVA 3FK8A 4XS1A 2FA4A 4JRRA 4ML6A 5ID2A 1NHOA 2YWNA 2B5YA 3G7JA 3KMNA 4PQIA 1TK0B 2FGXA 3VWUA 5ECIB 4K0GA 4EF0A 2LRCA 3UMAA 4Q5NA 4IS0A 5HFKA 4TR0A 4NAXA 2RM5A 1KTEA 1EV4A 3TRPA 1BQ7A 2B5EA 18GSA 2LNSA 1SYXA 2NVLA 1Z6NA 1SJZA 2KHPA 2H19A 4P3YB 5DAKB 2LRTA 1JLWA 2K9FA 4XS4B 5G1LA 3CMIA 3ERGA 1A2JA 4N11A 4K6XA 4LMWA 3ZRDA 5AIXA 2XBIA 1KEBA 1TK8B 1HNBA 5ECNB 4KUNA 11GSA 3RHCA 1A2MA 2N5AA 5EVOA 1A8LA 3KP8A 3H4KA 1AAZA 5D96A 1YZXA 3FR3A 1GWCA 1OE8A 2AYTA 1JZOA 2VO4A 2B1KA 4MP4A 2KP1A 2L59A 3CYNA 4IP6A 4TR1B 2EIRA 4TOPA 3DIEA 5HFGA 2I9HA 1PD21 4DSRA 2CZ2A 3WT2A 5ECHB 2LJKA 3ZFLA 1O8WA 2HFDA 1DSBA 2YWIA 5E4WA 2AV4A 2FUG2 4ZBDA 1YDKA 1Y6EA 5B6MA 3BJ5A 2HT9A 3ZIJA 4V1Ag 1K0BA 2QC7A 2QGVA 4F0BA 2PPTA 3D21A 2FWHA 4GRFA 1EV9A 1DE1A 3LXZA 1OC8A 1X9MB 2TRCP 3UVHA 3CRUA 1K0MA 4KCAA 4ZB8A 2OE1A 2F8AA 5CYYA 3GNJA 2IMDA 3IRAA 1M9AA 5IMVA 1XWCA 3KIJA 5FWGA 3Q6OA 4KX4A 1SD9A 16GSA 1IYHA 3GA4A 2DMMA 2H6ZA 2NPBA 2H70A 1U6TA 2PVQA 1TRWA 5DCHA 3RPNA 4G2EA 3GKMA 1M2AA 2EIQA 3IC4A 4ZIJA 2H1DA 1I5GA 4POLA 4Q5RA 2GT5A 5HR3A 4V1Ap 1FAAA 4EKZA 4GCIA 1T7PB 3P2AA 1MEKA 3FR9A 4PUFC 3BOAA 3IAM2 4KCEA 4KH7A 4ZILA 4LL1B 2R6KA 1XIYA 2CAQA 5CRGA 1VGLA 1QMVA 2AJQB 4L5LA 1ST9A 2HSYA 2DIZA 4N0ZA 4AJ8A 5GAND 4ZB9A 4HJMA 2I4AA 3TB2A 3GYKA 3J7Yk 1YKAA 2HNLA 1QUWA 1WP0A 1DBYA 2FCHA 4KDYA 2GTUA 1MD3A 1N2AA 4AJ7A 3TJFA 1BYEA 2GGTA 1QGVA 3GUSA 2R4VA 2H74A 2YWOA 2V41A 2VIMA 4WEYA 1DUGA 2QSIA 4IN0A 2YP6A 4Q5QA 2LJRA 4XS6A 1T00A 2H72A 5F06A 3NIVA 3FZ9A 4TN8A 3APQA 4G9HA 1SL1B 3GTUA 1ERVA 1PKZA 2H6YA 3UJ1A 2X99A 1JZDA 1NW2A 3HZ4A 1NHYA 1G0TA 3SBCA 1WE0A 4GTUA 5IOWA 2AHEA 2M72A 1PL1A 4X43A 1OE7A 1GL8A 2CVBA 3I6AA 1FW1A 3RBTA 2VLTA 4K7NA 4TKYA 4PQ1A 1FB6A 2B7KA 5E59A 2BMXA 3LQ7A 2FHEA 3QAVA 1QQ2A 2WULA 4MABA 1F3AA 1GTAA 3JCML 4DEJA 1GSYA 4PQHA 3D0ZA 3TDGA 1GUHA 1OKTA 5D9TA 4FIWA 2VM1A 4HOJA 1UVZA 1SJ6A 3CXGA 3SWLA 4OFNA 4IJ3A 5L71A 3U6VA 2DMLA 4HU7A 2HRNA 2O85A 4D73B 2V2GA 2VD1A 3C73A 3QMXA 3L9VA 3KM6A 1RW1A 3EU3A 3ME8A 5ECOB 2O89A 5IM9A 1U87A 2LEGA 2JU5A 1UN2A 4KDXA 3ZMKA 4I2UA 3M9KA 3ED3A 1JFUA 3WYWA 3LYKA 5CRDA 5D9XA 5CO3A 4LA1A 1C72A 4GQCA 1T3BA 4TW5A 3UVTA 1V2AA 2YCDA 2H76A 1TRUA 1YJ6A 3TRXA 2CAIA 1A24A 4ILFA 5CRWA 2H1GA 4ZL9A 4HZ2A 1XCCA 2M46A 3GRXA 3BD2A 1TXXA 3EWLA 4E8HA 2LUSA 4JR4A 1Z9HA 1THOA 3A3TA 4MJCA 1TI3A 4MLYA 4F9ZA 4IQAA 5CRHA 3IXRA 4L0WA 4TXVA 1X0RA 2DC5A 3GURA 3M1GA 2VCVA 6GSTA 2L5OA 1F2EA 4KA0A 3ZVJA 1WIKA 4TXOB 4O32A 1V58A 2IYJA 4K9ZA 5J4UA 5B8AA 6GSSA 3TKSE 1FOVA 1SD8A 2WS2A 4O7HA 4ECCA 1VF3A 3QAWA 1JZWA 3O3TA 2GZZA 3CTFA 5FHIA 1GSQA 4L0UA 4V2LA 1B4PA 1TP9A 4NXIA 1GH2A 1E2YA 1K0NA 3DYRA 1Y25A 4TR4A 1O7UA 5G30A 2L5LA 4BWSA 3ZYWA 3DEXA 2CQ9A 2ZCTA 3FZAA 3UBKA 2GQMA 2WCIA 4PXOA 2RUEA 1F3BA 12GSA 3QPMA 2PMTA 2PWJA 2CZ3A 1GTBA 3W8SA 1F9MA 1OAZA 2O87A 1TKDB 3TUEA 1BEDA 3GHAA 4MCUA 5HQPA 1F37A 3GIXA 4KDUA 1O8XA 2XBQA 4EUYA 1WOUA 1EOGA 3KZQA 2MBSA 5ID2B 1QXHA 3IAS2 2H8LA 1YY7A 2M80A 3I43A 3IK7A 2R37A 3LORA 1YF1A 2GQKA 2GZYA 1EZKA 3IDVA 4G10A 3QOUA 5ABRA 3ERFA 3QFBC 4IVFA 2HZFA 3C1SA 1EOHA 1H4OA 4MH3A 2LQQA 2MYGA 3NZNA 1USBA 1KBNA 4MA9A 2RIIA 4ZL7A 3BBYA 5H5QA 1HYUA 2HZEA 2LV3A 3UBLA 1VRSD 4EXJA 5KN3A 1VF4A 4WXTA 2MZCA 4MF6A 3APOA 2VM2A 3TJKA 3TJBA 2FD3A 2OKAA 2L4CA 3ZMLA 2EC4A 5G1KA 2BJXA 4PNGA 4GSTA 4KNDA 3M0FA 1X5DA 2H1AA 1PQNA 2E7PA 4GWRA 1X5EA 2A2RA 2YANA 1IYIA 1AQXA 2YZHA 2IFQA 4NV5A 2KP2A 3V1WA 14GSA 3E3EA 5IQYA 1TW9A 2DJKA 3PH9A 5D93A 4F03A 2P5QA 2DLXA 3HA9A 3HKRA 1AQVA 3D4MA 1A23A 1TRVA 1AW9A 2ZNMA 2VCWA 5EY6A 3GH6A 4WR5A 4DSSA 1PKWA 6GSWA 4WBJA 3GL5A 3G7IA 4YQMA 1O73A 3MWHA 2VAFA 3HJMA 3HZ8A 4CDOA 4MJAA 4OFTA 5KN2A 4EDZA 4XTSA 5HR2A 4OO5A 1ZOFA 2N5FA 3QAGA 4BVXA 3IE3A 5JWOB 1VF1A 1B8XA 3GFKA 1A8YA 1GSEA 1SJIA 2MMZA 3FEUA 4LLRA 3VI5A 2G0FA 3TGZA 3F0IA 1GSFA 1BX9A 7GSSA 2K6VA 3KTLA 3ZITA 1SENA 3M3MA 3DKSA 4BWQA 1V40A 3TKQA 3O6TA 1XW9A 1PMTA 2H71A 4GQFA 3KH9A 2LS5A 2B3SA 3LYPA 1EEJA 1TOFA 1RK4A 2RUFA 4HS1A 2WGRA 3ISOA 5LD0A 4ZB6A 2GQLA 4MF7A 6GSYA 4I5QA 5GSTA 4YQUA 3DGQA 19GSA 2V32A 4I8BA 3OR5A 4MJEA 1OC9A 2H1BA 2NBSA 1ZGNA 4KGIA 4IBPA 2GLRA 1TRSA 5IIZA 2X8GA 1XVQA 3KP9A 2H30A 5AISA 3W6GA 4MZBA 3E0UA 5DALA 2GSQA 4YH2A 3EMPA 3VI7A 2PVOC 2YJHA 3EINA 2C0GA 2HI7A 4GLTA 2PUKC 4KAEA 5DAKA 1RQMA 3D4TA 2WFCA 1PGTA 4MF5A 1GSSA 4OMVA 2WJUA 5KN0A 4L8EA 5A5KA 4MJBA 2ES7A 1SK2A 2FA8A 1R5AA 2I3YA 2A2SA 1B9XC 2O8VB 4MZWA 1B4QA 5D9WA 2VCXA 2K18A 3GSSA 3D6IA 4V2NA 2XPEA 3F6FA 5COHA 3LEFA 3GKNA 4BL7A 5JCUA 1ZMAA 5IMCA 1M2BA 1XW5A 3UEMA 1XOAA 5F8BA 4DSQA 2IIYA 3TOTA 2AB6A 4TR1A 1PN9A 2JZTA 2IMFA 2MMAA 3KTBA 3ME7A 2H0IA 1YKCA 1R7HA 4J57E 3MNGA 3DVWA 1GNEA 3J7Yb 3VWVA 5GZZB 1PA3A 5A4UA 1GTUA 4K7IA 2LQOA 1MTCA 3CSHA 4MK3A 2FWFA 5A4WA 5J41A 2X8HA 1J08A 5ECSA 4J56E 2B6MA 3H8QA 1G6WA 2H0GA 3TJJA 2CX4A 1ERUA 2CX3A 4PGTA 5B6NA 1TTZA 4X1UA 2C4JA 5LNKe 4KE3A 2GS3A 5AN1A 5IPGA 1PSQA 1WRYA 2PGTA 5ECPB 5D9VA 3IPZA 1UC7A 5DJLA 3RDWA 1G7OA 4WF5A 2QKEA 2FY6A 3RPPA 3E9JB 2MMOA 4MMMA 1JZRA 5DQSA 3UL3A 2PN8A 2XPDA 5ECKB 2K8SA 4K2DA 2ZUPA 3TKSC 3UIWA 1NM3A 3LSZA 4GSNA 4JZQA 2FNOA 3WGDA 4WKWA 4HQSA 4RQXA 5G5EA 5B8BA 3KEBA 5IMZA 2J9HA 4ECJA 3HVSA 2X8CA 3HXSA 3QDNA 5KN1A 3EURA 5C00A 3R2QA 4BA7A 5IOXA 4O92A 4ECIA 4POBA 1X5CA 1GUKA 4K1FA 5J3RA 2OBKA 3A2WA 3W8JA 1T1VA 1T4ZA 2IN3A 3ZREA 1TI1A 2NDOA 3IV4A 5AGYA 2C3TA 1W89A 1EP7A 2IMIA 4H86A 5KEJA 5H5RA 3QFAC 4ZBAA 1Z6MA 3L78A 3VLNA 2A4VA 2C1YA 3F4TA 2VL2C 5EPFA 1ACVA 2G2QA 3ZFBA 5HR1A 3ZIVA 1M0UA 4YQVA 5J9CA 4TVEA 1GUMA 2HYXA 4RI7A 4FH8A 2OE0A 2F51A 3LG6A 2LRNA 2E0QA 3U5RE 4PNFA 2YOIA 1AXDA 3FW2A 2H01A 3Q19A 5HFIA 1XW6A 2HSHA 3FZ5A 2C0FA 4RI6A 2B5XA 4XHMA 3CBUA 1MDIA 3HD5A 2FWEA 1SU9A 2YV7A 3LXTA 2IMKA 1XVWA 2R5GA 3Q18A 3APSA 3KH7A 1DE2A 5CP1A 4N30A 1MD4A 3DMLA 1GTIA 3IK9A 2RM6A 2GSTA 3VPTA 5JWRB 2CVDA 1TU7A 3VK9A 2F8FA 1OKDA 2YV9A 3ERWA 2VCTA 3VURA 1SKRB 1YF0A 2JL4A 2H66A 3GV1A 4IJIA 1GLQA 4NWYA 1XFLA 2C0DA 5DBQA 2H6XA 1YEXA 1G6YA 1X9SB 1U3IA 3EU4A 4ZXGA 2VCZA 1GSDA 3IBHA 3TKPA 3GKKA 4XCSA 5H5SA 1S3DA 3S9FA 2B1LA 3FR6A 1FO5A 2IFQB 1M9BA 3F4SA 1ZCPA 3P7XA 2J23A 2AAWA 2DIYA 1SK1A 3HVXA 1Q98A 3A2VA 4EVMA 1G7EA 2GZPA 1Z7PA 3ZVJD 2OJLA 2ON7A 3MAKA 2JACA 5HR0A 3MDKA 4HI7A 5JCGA 1THXA 2LSTA 1BJXA 2JSYA 4DSSB 2C8UA 3TKSA 2ON5A 3EE2A 5F05A 2CT6A 4O5RA 2CVKA 3QR6A 4TXOA 5EL8A 3L4NA 3L9UA 2YJ7A 3F9UA 4LL4B 3F3RA 1ML6A 4AJ6A 3QD9A 1VF2A 1M2DA 3P8WA 1ON4A 2P31A 4N0VA 2YN1A 2YWMA 2VOCA 4PURA 2KUCA 1HQOA 5J5NA 3C7MA 1NSWA 5DJMA 2HRFA 4IKHA 1EP8A 2VLUA 1OC3A 2NTOA 1CQGA 2YZUA 4KSOA 3C8EA 4KB3A 1HNCA 5DDLA 3D5JA 1EEMA 4K0NA 1FVKA 4WETA 2WB9A 2HXKA 3AY8A 1GRXA 3EMXA 4XRDA 2XHFA 1WMJA 5JCWA 3GKXA 1WPIA 3HJOA 5IMAA 4NMUA 4F2IA 3GMFA 4NPBA 5IO0A 2GVPA 2I81A 2LKUA 2VL2A 2DSAA 5FT3A 2L6CA 3L9SA 4G19A 1URMA 2YNXA 1ILOA 2VCQA 1OC9B 3DD3A 4OCEA 1AIUA 17GSA 3GL3A 1XWKA 5INYA 1F6MC 4FYBA 1FHEA 4BPYA 3L0HA 2V1MA 6GSXA 4JR6A 3M8NA 3DWVA 5DALB 3RHBA 1XBSA 1Z5YE 1W4VA 1AC1A 4QL9A 4MPFA 2VL3A 2OE3A 4POMA 1A0RP 3TJGA 2CA8A 5ELGA 2DJJA 1Q4JA 4OFMA 3F3QA 3I69A 2F9SA 4IQ1A 5GSSA 1XWBA 3VPQA 1AUCA 3ZLPA 1SKWB 4XRAA 4L5OA 4QL7A 5G2ZA 2YPMA 2OBIA 3KMOA 2VD0A 3HJPA 3N5OA 1S3CA 4YAVA
chains in the Genus database with same CATH superfamily
1GMRA 2R41A 2HMJB 5AI1A 5JPPA 3US3A 1LQGC 3LFLA 1OVNA 2A15A 3S27A 2IUKA 4F0CA 5AIGA 3F6DA 2JZSA 1W7CA 1WTHA 1T2HA 1GP1A 3FRCA 1R26A 1MWRA 3AMOA 1SYRA 2CV4A 4ACSA 3TCOA 3UOMA 2AUVA 2F86B 3EX9A 5D8IA 1K3YA 2MF7A 1EGOA 2H75A 2RSXA 4OD7A 4N6OB 2R0CA 4IGJA 2XGNA 1B2ZA 3CXC2 3WGXA 2C0EA 1PFPA 3GX8A 2BTOT 2O9UX 5GAPD 3IR4A 5CREA 2GSSA 3FKFA 2IPAA 4TRXA 1LU4A 4RZMA 1ULJB 1SL0B 2P0XA 1TJDA 3CCM3 2B7JA 4YAVA 2CFLA 4XS4A 1R4WA 3A5IA 1V57A 1XWAA 3NHXA 2GT6A 1Q864 3LGCA 4MH2A 2TIRA 4MJDA 1M9GA 5IENA 6GSVA 4F82A 3TKRA 1A0FA 2XC2A 5ECMB 4NHWA 1MWTA 3MYTA 4EIPA 5CF1A 1GNWA 1FB0A 3KCMA 1M904 1YEPA 4K5RA 3D79A 5ECQB 4AF2A 3EE1A 1GSUA 3LJRA 3N9HA 4R80A 1D6YA 2O7KA 3WODG 2CIUA 3K0ZA 4Z7XA 4K8MA 3GTUB 1J0FA 1GULA 2LJAA 1BRGA 4POKA 1I9DA 2MMNA 3H93A 1TRQA 2LNTA 3B4OA 1A2KA 1O6JA 4QWTA 1ERTA 4KW6A 2INXA 3AHSA 5ECLB 4MDCA 3MSZA 1AQWA 3F7XA 1TDIA 1AV4A 1FVJA 3MG2A 3RAZA 2BHMA 8GSSA 2X64A 4ULXA 3N8BA 1WMOA 4MMXB 3K8NA 4HUAA 2XH9A 1YJ93 3H79A 1X9WB 4TX4A 1F8NA 3WT1A 2W9QA 7STDA 3DRNA 2DJ1A 2P0GA 1RGCA 3A2XA 4WP5A 1Z3EA 3EHCA 1TTOA 4EO3A 1N8JA 1JBSA 1TFKA 1JLVA 1JB4A 1V9WA 4HQZA 3HYPA 3CTGA 2BMRB 1B27A 3CCQ3 1HNAA 4EC6A 5IG4A 4N6UA 2P09A 3M9JA 3TRQA 6STDA 1PX7A 1I3IA 2OOVC 1K3LA 3BCIA 1SK0A 1I3FA 1RJOA 1FGMA 1I2FA 2XF3A 5ENUA 1H75A 4OCFA 2PERA 2JZRA 4CW9A 2H73A 3C1RA 1OF5A 3EQQB 3LWAA 10GSA 3ZTLA 3GSTA 1J9BA 1PL2A 1UA5A 1U3AA 2R2JA 3KXOA 2IMEA 3PGTA 3BLZA 4FYUA 1T2IA 1XZOA 2ALBA 1YVSA 1GLPA 1B9YC 3EYTA 1XPVA 3GZXB 3ZFZA 4IW9A 1CQHA 2GSRA 3NX0A 2JADA 5HGRA 4ECBA 1O85A 3CPOA 2RLIA 4IIAA 1KNGA 2MBTA 4EE0A 4PX1A 1OHOA 2HMNB 4E8EA 2I1UA 1UCJA 3HY2A 1W6GA 3BCKA 3TOUA 3PCSA 2L4VA 3FY7A 3HVVA 3H1NA 2DBCA 3HZPA 4K5SA 4J5GA 3V98A 5FW5A 1V98A 1XXUA 3VWXA 2RBIA 1A2VA 1LOYA 4IHUA 20GSA 1K3OA 1U88A 5HOHA 1RLSA 4LSOA 3SYUA 4ID0A 5EVHA 4MZCA 1ZL9A 1T4YA 1E97A 3IA1A 1M99A 5G5FA 2AAEA 5A4VA 2OA7A 2YFLB 2OACA 3DVXA 3C71A 1WJKA 5M1AA 2OWPA 2FWGA 1Q9EA 5LCZA 5CNWA 2IY2A 5AIIA 1YVBI 1GOYA 1EWXA 4HU9A 5EQLA 2HE3A 1ZO2A 2GDRA 3CSIA 1HD2A 1DVCA 3ZG5A 3FH1A 2WGOA 4EC0A 1ABAA 2ZDJA 2VUPA 5AYRB 2QA43 4AKYA 3F8UA 3O76A 5STDA 2OADA 2KF6A 2P5RA 2LTKA 2CG0A 1TU8A 1UUWB 4BIKA 4FCZA 1QFNA 5DQYA 3BIRA 3FGYA 2E2TA 5CAXA 1RKYA 4N6TA 4OWYA 5KP4A 1Q824 2E2MA 4BVYA 3HIIA 3PR8A 4OO4A 3RNTA 4BIRA 4CY8A 4IT7A 4LYLB 4LMVA 3JUOA 1SL2B 2KLXA 1GSPA 1OYJA 1VQK3 3HDCA 3FZ4A 1RHLA 3GH9A 1BNJA 4N6V0 4EDYA 1EUIC 3IHQA 2WDUA 1K0DA 2GU3A 4WBRD 4AGSA 1SARA 3CMA3 2GEYA 1Z7RA 2UX0A 2HMLB 1JV2B 1XWGA 1AY7A 1Q7HA 2Z77A 1YQ1A 2KF5A 4CHSA 3D22A 4JBBA 4XIHA 3IOSA 2D2ZA 3VFIA 1IQYA 4MMZB 3K5TA 1OGZA 5KP1A 2BIRA 5F07A 1HYFA 1QK8A 1O81A 3A5WA 3GN3A 3WD6A 4YAPA 3I563 4D73A 4PUAA 4I97A 4FO5A 3FSDA 4JRFA 1FYSA 3F4RA 4NV2A 1R5PA 13GSA 2VL9A 3QCPA 2DJ3A 4L8OA 4J2FA 3CSJA 3ZL5A 4ISDA 4KSMA 3ER7A 1BNEA 5G31A 1MDKA 4JE1A 3EC3A 3LW9A 3MG3A 5IPHA 3WGEA 2GU1A 2L4QA 1JHBA 3WA3A 4J8TA 2WO0A 5IMFA 2V6KA 1B2MA 4HKVB 2PU9C 4EL1A 1IVWA 1JN5B 1IDPA 2DJ0A 2HZEB 3VWWA 2V6OA 1B48A 1LJRA 1I70A 4V2MA 3KJYA 4QQ7A 3UARA 3FYGA 1J2BA 1I0XA 3G7YA 2GSPA 1NB5I 3R3EA 1EGRA 2Z9SA 3ZZXA 3NOFA 1ZS7A 2E2GA 1Q42A 3D3LA 4Q5FA 2WRTA 1VQ53 1W2ZA 4I2TA 3L0RA 4DVCA 2OOVA 1K0OA 5ELAA 1ZYEA 6GSUA 3MWZA 4OVMA 1VQ43 2XFTA 2C3NA 4ORLA 2HLSA 1TK5B 4GF0A 4NHZA 2F98A 2L57A 5ECRB 2CFGA 3HX8A 2OTL3 4RUVA 4X0XA 1N5HA 4HEA2 4JU5A 3NQZA 4RQRA 1NB3I 1E6BA 4DKIA 1PX6A 1ERWA 5IMDA 1BNIA 3WDGB 4ZL8A 1SKSB 5F0GA 1BIRA 2IWTA 2ML5A 3HCZA 1MDJA 5IO2A 3G8ZA 4K7OA 5B7CA 1FGQA 5D73A 1B2SA 2IL3A 1VQ83 3UAPA 1LBKA 2REMA 2WZ9A 2C80A 4GXZA 3B4PA 4GB5A 1K9M4 5AIVA 2PBJA 1WWJA 2R3XA 4RNZA 4IP1A 4WR4A 3DUKA 2FLSA 3DGMA 2QEX3 1D6UA 4IELA 1HU9A 3HHVA 5DCGA 3DXBA 2F3MA 2K8VA 3Q74A 3BNDA 1K0CA 9GSSA 1M7TA 3FHKA 2P38A 3D9RA 1N8R4 4ZBBA 4HZ4A 5DVBA 1JBTA 1ZYQB 1FG4A 4I6XA 1R4YA 2JSZA 22GSA 3G9BA 3P90A 4HZ9B 2I9WA 4MNNA 3T8UA 1RGEA 2SBLA 1VQL3 5LC6A 3I9V2 3N9JA 2OQEC 4TR3A 5J9BA 4GSSA 5ELUA 2N5BA 1XOBA 2DJ2A 3CRTA 3EVIA 2UGIA 1W5ZA 1BG5A 1K0AA 1ISKA 3PINA 5C04A 3GX0A 2L1SA 4ML1A 3CNMA 3F63A 1K734 4BL3A 4Z2RA 2L6DA 4FYCA 1T8EB 2H0HA 4MEIA 1FUSA 1ZZYA 4N10A 3E99A 2IJYA 4HDEA 1A2LA 4JEDA 2YFJB 5JWQB 4WF4A 2TRXA 4HM6B 1WMNA 1ROVA 1KD14 3KD0A 3KGKA 1PRXA 1S3AA 4HJ2A 2KOKA 1B20A 1KC84 2C3QA 1BAYA 4MPGA 2EIOA 2VLVA 3FK8A 4XS1A 2FA4A 1B3SA 1W6CA 6RNTA 4XBXA 4JRRA 1FGRA 4ML6A 5ID2A 1NHOA 2YWNA 2A4HA 2B5YA 3G7JA 1JB5A 3KMNA 3FG1A 3AMOB 3G4S3 4PQIA 2CKFB 1UUVB 1TK0B 5TGNA 3UB1A 1RDSA 1LOXA 2FGXA 4RNYA 3V99A 3VWUA 5ECIB 4K0GA 4EF0A 2LRCA 3UMAA 4Q5NA 4IS0A 5HFKA 4TR0A 4NAXA 1EA2A 4AKZA 1X1UA 2RM5A 1BUQA 1KTEA 1VQP3 4HAAA 1EV4A 3TRPA 1BQ7A 1O7MB 2B5EA 1U5OA 18GSA 2LNSA 4CCVA 1FZUA 1SYXA 1M3IA 2NVLA 1Z6NA 1SJZA 2KHPA 2H19A 1AQZA 4P3YB 5DAKB 2LRTA 2SARA 1JLWA 2K9FA 4XS4B 2UZ8A 5G1LA 3CMIA 3ERGA 1A2JA 2YFIB 4N11A 4K6XA 4LMWA 4BTYA 2FXTA 1IVUA 4EV5A 3J7Yd 4EV2A 1VQM3 3ZRDA 2KXGA 5D82A 1N5PA 5AIXA 2XBIA 1KEBA 2CH9A 1TK8B 1HNBA 5ECNB 4KUNA 11GSA 1UI8A 5DREA 4FQUA 2R0PA 3RHCA 2RNTA 1A2MA 2N5AA 5EVOA 1A8LA 1BNGA 3KP8A 3H4KA 3PZWA 1AAZA 4BL7B 5D96A 3DXOA 3LTAA 1S723 1YZXA 4EYCA 3FR3A 1YJN3 1GWCA 1YHQ3 2V1LA 1OE8A 2AYTA 1JZOA 2VO4A 2B1KA 3F9SA 4MP4A 2KP1A 2L59A 3CYNA 4X2OA 4IP6A 4TR1B 2EIRA 1FUTA 4TOPA 4HJLB 5CF2A 3DIEA 5HFGA 4GSPA 2I9HA 2Q07A 1PD21 4DSRA 2CZ2A 3WT2A 1EG9B 1TFOA 5ECHB 2LJKA 3ZFLA 4HSCX 1QMAA 3LZAA 1QJGA 1O8WA 3DZLA 5BIRA 1Y4KA 4O5UA 2HFDA 1DSBA 2YWIA 5E4WA 2AV4A 2FUG2 4ZBDA 1YDKA 1Y6EA 5B6MA 3BJ5A 2HT9A 3ZIJA 4V1Ag 1K0BA 2QC7A 2QGVA 1W02A 2W0QA 2PPTA 4F0BA 3D21A 2FWHA 4GRFA 3NM7A 1K28A 1EV9A 1DE1A 3LXZA 1UCKA 1OC8A 3RGAA 1X9MB 1GMPA 2TRCP 3UVHA 3CRUA 1K0MA 4KCAA 4ZB8A 2OE1A 2F8AA 3FCSB 2JQ5A 5CYYA 5D81A 4RBNA 3GNJA 2IMDA 3IRAA 1M9AA 1YIJ3 5IMVA 1XWCA 3KIJA 5FWGA 3Q6OA 4KX4A 1SD9A 16GSA 1JKGA 1IYHA 1GD3A 3GA4A 2DMMA 3CCS3 2H6ZA 2P05A 2NPBA 3RGRA 2H70A 4X2HA 1U6TA 2PVQA 1TRWA 5DCHA 3RPNA 4G2EA 1WQLB 3GKMA 1M2AA 2F5WA 2EIQA 3X42A 1YIT3 3IC4A 4ZIJA 2H1DA 4HM5B 3LTCA 3VSYA 1I5GA 4POLA 3JUQA 4Q5RA 1UUGB 2GT5A 5HR3A 4BTXA 4YKGA 4V1Ap 1BSAA 2OQEA 1FAAA 4EKZA 4GCIA 1T7PB 2C10A 3P2AA 1Q7Y4 1MEKA 3FR9A 4PUFC 3BOAA 3KSED 1R4CA 1Q40B 3KCHA 3IAM2 4KCEA 2R6KA 4KH7A 4LL1B 4ZILA 1QALA 1MGWA 4N6NB 1XIYA 2CAQA 4FMBA 5CRGA 3LOYA 1VGLA 1QMVA 3KIIA 2AJQB 4L5LA 1O7HB 4CPKA 1ST9A 3JUMA 2XRXB 2HSYA 2HRAA 2DIZA 4N0ZA 4XB5A 4AJ8A 1LVNA 5GAND 4ZB9A 4HJMA 2I4AA 8RNTA 3TB2A 3SX1A 3GYKA 3J7Yk 4HVNA 1YKAA 2HNLA 2LYXA 1QUWA 1WP0A 5I97A 1DBYA 3DGLA 3KN4A 2FCHA 4KDYA 2GTUA 1MD3A 1N2AA 4AJ7A 3TJFA 4IPBA 1BYEA 2GGTA 1QGVA 3GUSA 3FZWA 2R4VA 2H74A 3T0UA 2V41A 2YWOA 2VIMA 3LTDA 1JRQA 1T5YA 1PN0A 4HM0B 5AEWB 1DUGA 4WEYA 2QSIA 4IN0A 2YP6A 4Q5QA 2LJRA 1RTUA 4HM7B 4XS6A 1T00A 2H72A 5ELJA 1IT8A 3Q90A 3DGYA 5F06A 1JB2A 1IV7A 4U13A 3NIVA 3FZ9A 4TN8A 4H3UA 3APQA 4G9HA 1SL1B 3GTUA 1ERVA 1YNVX 1PKZA 4K90B 2H6YA 3UJ1A 2X99A 1JZDA 1ZX2A 4KFEA 1NW2A 3HZ4A 1NHYA 1G0TA 3WR2A 3SBCA 4WYKA 4OK0A 2MC8A 1RCLA 3S67A 1WE0A 4GTUA 2YX9A 5IOWA 1VZZA 3LMLA 2AHEA 2M72A 3NXJA 1PL1A 4X43A 3LH4A 1OE7A 1LOVA 4BVYB 2CVBA 3I6AA 1GL8A 1FW1A 1OUNA 1CEWI 2VLTA 1KSIA 3RBTA 4K7NA 4TKYA 4K61A 4PQ1A 1FB6A 2B7KA 4H61A 5E59A 1M1K4 3CPW2 2BMXA 3LQ7A 2FNQA 2FHEA 3GZRA 1QAKA 2M7OA 3QAVA 5KOWA 3S28A 1QQ2A 2WULA 1EQKA 4MABA 1F3AA 1GTAA 5JPUA 4K1UA 1O7NB 3JCML 4DEJA 1GSYA 4PQHA 3D0ZA 2E2UA 3TDGA 3KKGA 1GUHA 3PPUA 1OKTA 5D9TA 4FIWA 3HVNA 2VM1A 5EEOA 4HOJA 1UVZA 1SJ6A 3KFQC 1RGLA 3CXGA 3SWLA 3NQYA 1Q814 4OFNA 1C7HA 1GMQA 4IJ3A 2JDIH 3ROBA 5L71A 2CC3A 3U6VA 2DMLA 1MWSA 2HSMA 4HU7A 4AEQA 1VQ63 2HRNA 2KF3A 4WWUC 3FG3A 1GY5A 2O85A 4D73B 3JVCA 2V2GA 4EIQA 2VD1A 1RSNA 3C73A 2CHCA 3OV4A 3QMXA 3L9VA 3KM6A 1RW1A 3QRDA 3EU3A 3ME8A 5ECOB 2O89A 1FGTA 3MPHA 5IM9A 1U87A 2LEGA 2BU4A 2JU5A 1UN2A 4KDXA 3ZMKA 4CJNA 1OH0A 4I2UA 4O5QA 4Z2TA 3M9KA 3BNBA 1LQMB 3CC73 3ED3A 1JFUA 4XBYA 3WYWA 3H3HA 3LYKA 5CRDA 5D9XA 5CO3A 4LA1A 1C72A 2CFWA 4GQCA 4GHOA 2C4BA 1T3BA 1CQSA 4BL2A 4TW5A 3UVTA 1MNLA 1V2AA 1MWUA 2YCDA 2H76A 1TRUA 1YJ6A 3TRXA 4I4KA 2CAIA 1A24A 4ILFA 5CRWA 3EC9A 5KP3A 3IPTA 2H1GA 1K41A 4ZL9A 4L7KA 1LXEA 1O7WB 4HZ2A 4STDA 1XCCA 2M46A 3GRXA 3BD2A 1NJI4 1TXXA 3EWLA 4E8HA 2XR8B 2LUSA 1C54A 1US1A 4JR4A 1Z9HA 1THOA 3A3TA 4MJCA 1TI3A 4MLYA 4F9ZA 4KT3B 4IQAA 1STFI 3CQFA 5CRHA 2QA2A 2IMJA 1FUWA 3IXRA 4L0WA 4TXVA 3DY5A 5BMUA 1X0RA 5LC7A 2DC5A 1A67A 3GURA 3M1GA 2VCVA 6GSTA 2L5OA 5M18A 3F8HA 3SOAA 5IERA 1F2EA 1XG8A 4KA0A 3ZVJA 2ZHXB 1WIKA 4TXOB 4O32A 1V58A 2IYJA 4K9ZA 5J4UA 1DVDA 3BNCA 5B8AA 6GSSA 3TKSE 1FOVA 1SD8A 2WS2A 4O7HA 1SJWA 4ECCA 2P0MA 1PFOA 1VF3A 3QAWA 1JZWA 3O3TA 2GZZA 3CTFA 3GSPA 5FHIA 1BAOA 1GSQA 4L0UA 3MKIA 1EKMA 5IG3A 4V2LA 5AYSC 1IQ8A 1B4PA 1TP9A 2BNGA 3T8NA 4NXIA 1GH2A 1E2YA 1K0NA 3F7SA 1Y25A 3DYRA 4TR4A 1O7UA 1ZYNA 5G30A 5DRVA 2L5LA 3OWYA 3FMWA 1AVKA 3ZYWA 4BWSA 3DEXA 2CQ9A 2ZCTA 3FZAA 3UBKA 2GQMA 1DMNA 2WCIA 1RRLA 4PXOA 2RUEA 5AEUB 3PS8A 1K8A4 1F3BA 12GSA 3QPMA 1GY7A 2PMTA 1LNHA 2STDA 4NHFA 3EB8A 2PWJA 3HK4A 2CZ3A 1GTBA 3W8SA 1F9MA 2XGLA 2GEXA 1OAZA 4O02B 3KSPA 1A2PA 2O87A 1TKDB 3TUEA 2OTJ3 1UCIA 2W56B 1BEDA 2B1XB 3RDEA 3GHAA 4MCUA 2R0GA 1Z1SA 5HQPA 1F37A 2BT3A 3OX9A 3GIXA 4KDUA 4ZM8A 1IK3A 1O8XA 2XBQA 4EUYA 1WOUA 1GYBA 2J8XB 1EOGA 3KZQA 3EBTA 2MBSA 5ID2B 1QXHA 3IAS2 2H8LA 3A76A 3EN1B 4RNTA 1YY7A 2M80A 3I43A 3IK7A 3CCE3 3M8CA 2R37A 3LORA 1YF1A 2GQKA 2GZYA 1EZKA 3IDVA 1YGEA 4G10A 3QOUA 5G2GA 5ABRA 3ERFA 1UCLA 3QFBC 4R9LA 4IVFA 3U1WA 4HM8B 1TU5A 2HZFA 3EBYA 1X1XA 3C1SA 2LQVA 1EOHA 1H4OA 2KAAA 3CCJ3 4MH3A 2ZA4A 1GOUA 2LQQA 2MYGA 3NZNA 1USBA 3G0KA 1KBNA 4MA9A 1VQ73 1D6ZA 2RIIA 4ZL7A 3BBYA 5H5QA 1JN5A 1HYUA 2HZEA 2LV3A 2HRKA 1VRSD 3UBLA 2Y73A 1AVLA 2BMOB 2R4IA 2UUGC 4EXJA 5KN3A 1VF4A 3D4AA 3HOHA 4WXTA 2MZCA 4MF6A 1G96A 3NBRA 3APOA 2VM2A 4ICYA 4JF8A 3TJKA 3EJVA 1W4NA 4BU4A 3TJBA 2FD3A 2OKAA 2L4CA 1OGXA 3ZMLA 2EC4A 3PCRA 5G1KA 2BJXA 4PNGA 4GSTA 4KNDA 3M0FA 3NV0A 1X5DA 3WHOA 1UI7A 2H1AA 2C11A 1I2GA 3URPA 2PNCA 4HM1B 1PQNA 2E7PA 4GWRA 3I553 1X5EA 2A2RA 4EBGA 2YANA 1IYIA 1AQXA 1W2B2 2YZHA 2IFQA 4NV5A 1PYLA 2KP2A 3V1WA 2OCTA 14GSA 3E3EA 3GAXA 5IQYA 1TW9A 2DJKA 3PH9A 5D93A 4F03A 2P5QA 1FW7A 2DLXA 3HA9A 1RGAA 3HKRA 1I2EA 1AQVA 1W01A 2XSOB 3D4MA 1A23A 1TRVA 1AW9A 2ZNMA 4J9AA 2VCWA 2K54A 5EY6A 3GH6A 4WR5A 1O7GB 4DSSA 2RCDA 3UL5A 1PKWA 6GSWA 3A5EA 3NBJA 4WBJA 1OPYA 3GL5A 1BSDA 3G7IA 4YQMA 4R1KA 1O73A 3MWHA 4HZBB 2VAFA 3HJMA 5A0OB 3HZ8A 4CDOA 4MJAA 4OFTA 5KN2A 4EDZA 4XTSA 3UNLA 5HR2A 2BMQB 4OO5A 3EN8A 1ZOFA 2N5FA 3QAGA 4BVXA 3IE3A 5JWOB 1M1XB 4KZ1A 1VF1A 1NU3A 1CYUA 4K2XA 1B8XA 3GFKA 3VGNA 4PTSA 1A8YA 1GSEA 1SJIA 2MMZA 3FEUA 3AGNA 4LLRA 3VI5A 2G0FA 3TGZA 3F0IA 3X3ZA 1GSFA 1BX9A 7GSSA 2K6VA 3KTLA 3ZITA 1SENA 1I0VA 3AHWA 3M3MA 3DKSA 2GXFA 3DMCA 4BWQA 1BRSA 1V40A 3TKQA 1N9EA 3O6TA 1MOLA 1XW9A 5AIFA 1O7PB 1PMTA 2H71A 2CW9A 4G0IA 1RN1A 4GQFA 3OW22 1JKGB 1OHSA 4FMAA 3KH9A 3WOFB 2LS5A 2IUJA 3IMAB 1B2XA 2B3SA 3LYPA 1EEJA 1TOFA 1RK4A 2RUFA 4HS1A 1CH0A 2WGRA 3ISOA 5LD0A 2W6JH 4ZB6A 2GQLA 3GZBA 3FKAA 1IQXA 4MF7A 6GSYA 3G6E3 4I5QA 5BXQA 5GSTA 4YQUA 3DGQA 19GSA 2CFKA 5BVBA 2V32A 4I8BA 3GWRA 3OR5A 4MJEA 1OC9A 2H1BA 2NBSA 1ZGNA 3F14A 4HYZA 1VQO3 4KGIA 4IBPA 3UJMA 2GLRA 1SQWA 1TRSA 5IIZA 2X8GA 1XVQA 3KP9A 2H30A 1IVVA 5IG0A 5AISA 3W6GA 1TIJA 4MZBA 3E0UA 5DALA 2GSQA 4YH2A 3EMPA 3BNEA 1I8VA 3VI7A 2PVOC 2YJHA 3EINA 3MHEA 4L8PA 4HM3B 2C0GA 2HI7A 4GLTA 2PUKC 4KAEA 3MSOA 4KVHA 1RQMA 3IC8A 5DAKA 1E3RA 2CFDA 3OXAA 3D4TA 3MYDA 1BNFA 3QK9A 5BU4A 1OACA 1PGTA 2WFCA 4MF5A 3CCV3 1GSSA 4USSA 3EPTA 2ML6A 4XDVA 3WA2X 2WJUA 4KF9A 4OMVA 5KN0A 2CG1A 4L8EA 4HM4B 3CNXA 4KFDA 5IF6A 2X49A 5A5KA 1YI23 4MJBA 1OF5B 2ES7A 1SK2A 2FA8A 1R5AA 2GBWB 2I3YA 2A2SA 1B9XC 2O8VB 7RNTA 3NM2A 4MZWA 1B4QA 5D9WA 3K63A 2VCXA 2K18A 1NDOB 3GSSA 3FLJA 3D6IA 3EF8A 1UGHI 4PEJA 4V2NA 2QA1A 2XPEA 3F6FA 5COHA 3NBBA 3LEFA 5GSPA 1WNHA 3GKNA 5JCUA 4BL7A 1ZMAA 5IMCA 2W2CA 1M2BA 1QAFA 1XW5A 3UEMA 3SEDA 3LYGA 3JUPA 4CY6A 1XOAA 4WYKB 1KQS2 5F8BA 1DETA 2IIYA 4DSQA 1IU7A 1GOVA 3TOTA 1X1WA 2AB6A 4TR1A 4BTWA 1PN9A 1NNVA 2JZTA 2K3DA 3SVAA 2IMFA 1FGOA 4O2HA 2RFRA 2MMAA 2B24B 3KTBA 3ME7A 2H0IA 1YKCA 3S29A 1R7HA 4J57E 4LZIA 3MNGA 4HOHA 4MMYB 3DVWA 4EXRA 1GNEA 3J7Yb 5BRTA 3VWVA 5GZZB 1IYYA 3CC43 1PA3A 1RGHA 3CCR3 5A4UA 1GTUA 4K7IA 2LQOA 1MTCA 1M3JA 1HKXA 3CSHA 1BRNL 4MK3A 1VQ93 2FWFA 1GD4A 5A4WA 5J41A 2X8HA 3JUNA 4LGQA 2KCDA 1J08A 4J56E 5ECSA 1BRHA 2B6MA 3H8QA 2Y74A 1G6WA 1NWWA 4J5KA 2F56A 2H0GA 3TJJA 5JBSA 1DYUA 1V74A 2CX4A 1UDII 1TUHA 1ERUA 2CX3A 4PGTA 1TTZA 5B6NA 3SXXA 1BU4A 3CD63 5IEOA 1B21A 4X1UA 2C4JA 3KE7A 5LNKe 1L5GB 4KE3A 2GS3A 4R9KA 5AN1A 5IPGA 1PSQA 3V92A 4N6MA 1WRYA 2PGTA 3I0YA 5ECPB 4O3VA 5D9VA 2ZL8A 5FGOA 3IPZA 1UC7A 5DJLA 3RDWA 1G7OA 3HIGA 1N9JA 4WF5A 2PZVA 4EW5A 2A2PA 4FMDA 1KWIA 2FY6A 2QKEA 3RPPA 3LT8A 3CC23 3CCU3 3CCL3 1LOWA 3E9JB 2MMOA 4MMMA 1JZRA 5DQSA 3UL3A 4XDWA 2QIYA 2HMOB 2XFSA 2PN8A 2XPDA 5ECKB 2K8SA 1JJ22 1Q40A 5CLKA 4K2DA 2ZUPA 3TKSC 9RNTA 1BGSA 3UIWA 1NM3A 3FF0A 3ZG0A 3LSZA 4GSNA 4JZQA 2FNOA 3WGDA 4WKWA 4HQSA 5CXOA 4RQXA 1STDA 2CK3H 5G5EA 5B8BA 3KEBA 4CDLA 3PYJA 5IMZA 1BSEA 2J9HA 3U97A 4ECJA 3PXMA 3HVSA 2X8CA 3HXSA 3QDNA 5KN1A 3EURA 4NREA 5C00A 3DGOA 3CME3 3R2QA 1JNQA 4A5PA 4BA7A 5IOXA 4O92A 4ECIA 4POBA 2GBXB 1X5CA 5D83A 1GUKA 4K1FA 3K7CA 5J3RA 2OBKA 3DH2A 3A2WA 3W8JA 1T1VA 1T4ZA 2IN3A 1IV9A 1RNTA 1TI1A 3ZREA 2NDOA 3IV4A 2D1WA 5AGYA 1DMQA 6GSPA 2C3TA 2CWUA 4K1VA 1W89A 1RCKA 1EP7A 1MGRA 1B2UA 2IMIA 4H86A 5KOXA 5KEJA 5H5RA 1DE3A 1SPUA 3QFAC 4ZBAA 1Z6MA 3WOEB 5CK6A 2WOFA 4OUQA 3L78A 1BSBA 3VLNA 2A4VA 1SIHA 2C1YA 3F4TA 2E2VA 2VL2C 5EPFA 1ACVA 2G2QA 3ZFBA 5HR1A 3ZIVA 5IEPA 1M0UA 4YQVA 4N3VA 5J9CA 4TVEA 1GUMA 2HYXA 4FCMA 4RI7A 1BNSA 4FH8A 2OE0A 1LRAA 2F51A 3LG6A 2LRNA 2E0QA 3U5RE 1ZGXA 1IT7A 1W6YA 2YOIA 1AXDA 3FW2A 4PNFA 2H01A 1FA3A 3X40A 3Q19A 3D5IA 1BSCA 5HFIA 1XW6A 2HSHA 3FZ5A 2C0FA 4G0LA 4RI6A 1WMPA 2B5XA 4XHMA 3CBUA 1MDIA 3HD5A 2FWEA 1SU9A 3D5GA 2YV7A 1ASKA 3LXTA 2IMKA 1XVWA 4WHAA 2R5GA 2F99A 1YJW3 3Q18A 3APSA 3LTBA 1X1YA 3MG1A 3B7CA 5M19A 1RN7A 2F5MA 3KH7A 2W03A 1DE2A 3OWUA 8CHOA 5CP1A 2W04A 4N30A 1DMMA 1MD4A 3FF2A 3DMLA 1GTIA 3G713 3IK9A 1RN4A 4WFOA 2RM6A 2GSTA 3VPTA 5JWRB 2CVDA 1TU7A 3VK9A 1RRHA 3H51A 4O8SA 2F8FA 1ROAA 1OKDA 2F4YA 2YV9A 2Z7AA 3ERWA 2VCTA 1BUJA 3HI7A 3VURA 2BO9B 1SKRB 1YF0A 2JL4A 3IJEB 1W00A 2H66A 2RGQA 3VF1A 1QVG2 3GV1A 1LNIA 4IJIA 1GLQA 2DKHA 4NWYA 1RGFA 1CYVA 1XFLA 2C0DA 5DBQA 2H6XA 1YEXA 1UW1A 3BB9A 3KZTA 2HOHA 1G6YA 1X9SB 2WGQA 4G0KA 3O8YA 1U3IA 3EU4A 4ZXGA 2VCZA 1G02A 4YKFA 1GSDA 3IBHA 3TKPA 3NV0B 3GKKA 4XCSA 5H5SA 1NO3A 1S3DA 3S9FA 2HMKB 1OCVA 2B1LA 2CWVA 2HMMB 3AGOA 3Q2PA 3X41A 3FR6A 1FO5A 3SOYA 3DGNA 2IFQB 1RGKA 1BANA 1M9BA 1BVIA 3F4SA 3BU4A 4FMCA 5IW9A 1BNRA 1ZCPA 3P7XA 2J23A 2AAWA 4R4KA 2DIYA 1SK1A 3HVXA 1Q98A 3A2VA 3S5CA 4EVMA 1G7EA 2GZPA 2Z76A 1Z7PA 1YGWA 3ZVJD 1VQN3 2OJLA 2ON7A 3MAKA 1GS3A 2JACA 3Q1CA 5HR0A 3X3YA 3MDKA 1TRPA 1RMSA 4HI7A 5JCGA 1VQQA 1BRJA 1THXA 2LSTA 1BJXA 2CWTA 3Q3FA 1ULIB 2JSYA 4DSSB 2C8UA 2K0MA 1IVXA 3TKSA 2D42A 2ON5A 3EE2A 5F05A 2CT6A 4O5RA 2CVKA 3QR6A 4TXOA 5EL8A 3L4NA 4X4JA 3L9UA 2YJ7A 3F9UA 1A90A 4LL4B 3F3RA 1ML6A 2WOHA 4AJ6A 4GL6A 3B8LA 3FG4A 3QD9A 1FOHA 1VF2A 1M2DA 3P8WA 4BVXB 1ON4A 2P31A 4N0VA 2YN1A 1BOXA 3K9MC 3LT9A 2YWMA 4XM4A 2VOCA 1OHPA 5IG5A 3IHGA 4PURA 2KUCA 1HQOA 5J5NA 3C7MA 1NSWA 5DJMA 2HRFA 4IKHA 1EP8A 2VLUA 3GRDA 1OC3A 3G16A 2NTOA 1RGGA 4LEHA 1U8CB 1CQGA 2YZUA 4FR9A 4KSOA 3C8EA 4KB3A 4KFFA 1HNCA 5DDLA 2Z6BA 3D5JA 1PY3A 1EEMA 3OWSA 4K0NA 1FVKA 3UL6A 2WB9A 4WETA 2W56A 2HXKA 1BRKA 3AY8A 1GRXA 3EMXA 2KF4A 4XRDA 3DM8A 1BRIA 3ECFA 1WMJA 2IA7A 2XHFA 5JCWA 2CX0A 4FCJA 3GZYB 3GKXA 1S5AA 3F40A 1WPIA 4LMIA 3HJOA 5IMAA 4NMUA 3ALAA 4F2IA 3MIXA 3GMFA 3WMDA 3SLUA 4NPBA 5IO0A 2GVPA 1UGIA 2X4AA 3N54B 1N8QA 2CX1A 2I81A 2LKUA 3PGBA 1ZYPA 2XSHB 2VL2A 2W9PA 2DSAA 3CU3A 5FT3A 2L6CA 3L9SA 4G19A 1URMA 2YNXA 1ILOA 2QGUA 2VCQA 1OC9B 3DD3A 4OCEA 1AIUA 1RNBA 17GSA 3STDA 3GL3A 1XWKA 5INYA 1F6MC 4FYBA 1FHEA 4BPYA 4Z2UA 3L0HA 1JBRA 2DKIA 2V1MA 2KRTA 6GSXA 4Q53A 5AIHA 4JR6A 3M8NA 1GY6A 3DWVA 5DALB 3RHBA 1PU4A 1XBSA 1Z5YE 1W4VA 1E3VA 2O3OA 1AC1A 4QL9A 4MPFA 4N6LA 1AR0A 7GSPA 2VL3A 2OE3A 4POMA 1QVF2 1A0RP 3TJGA 1S3RA 2CA8A 5ELGA 2DJJA 1Q4JA 3F3QA 4OFMA 4XBTA 3I69A 2F9SA 4IQ1A 5GSSA 3NUVA 1XWBA 3VPQA 1SIIA 1AUCA 1TP6A 3ZLPA 1HZ1A 4XRAA 1SKWB 2FGTA 3X3XA 4L5OA 4QL7A 5G2ZA 2YPMA 2OBIA 4HBRA 3KMOA 2AADA 2VD0A 2XEPA 5RNTA 3HJPA 3LXUX 3N5OA 1S3CA 4HM2B 3F8XA 4G1MB
chains in the Genus database with same CATH topology
3US3A 3LFLA 1OVNA 4F0CA 3F6DA 2JZSA 1GP1A 3FRCA 1R26A 1SYRA 2CV4A 4ACSA 3TCOA 3UOMA 2AUVA 5D8IA 1K3YA 1EGOA 2H75A 4OD7A 2R0CA 4IGJA 3WGXA 2C0EA 3GX8A 2BTOT 5GAPD 3IR4A 5CREA 2GSSA 3FKFA 2IPAA 4TRXA 1LU4A 1SL0B 2B7JA 1TJDA 4XS4A 1R4WA 3A5IA 1V57A 1XWAA 2GT6A 3LGCA 4MH2A 2TIRA 6GSVA 4F82A 3TKRA 1A0FA 2XC2A 5ECMB 4NHWA 4EIPA 1GNWA 1FB0A 3KCMA 4K5RA 1YEPA 5ECQB 4AF2A 1GSUA 3LJRA 2O7KA 4Z7XA 4K8MA 3GTUB 1J0FA 1GULA 2LJAA 4POKA 1I9DA 2MMNA 3H93A 2LNTA 1O6JA 1ERTA 4KW6A 5ECLB 4MDCA 3MSZA 1AQWA 1TDIA 1FVJA 3RAZA 8GSSA 2X64A 4ULXA 3K8NA 4HUAA 3H79A 1X9WB 3WT1A 3DRNA 2DJ1A 2P0GA 3A2XA 1Z3EA 4EO3A 1N8JA 1JLVA 1V9WA 4HQZA 3HYPA 3CTGA 1HNAA 3M9JA 3TRQA 1PX7A 1K3LA 3BCIA 1SK0A 5ENUA 1H75A 4OCFA 2PERA 2JZRA 4CW9A 2H73A 3C1RA 10GSA 3LWAA 3ZTLA 3GSTA 1J9BA 1PL2A 1UA5A 1U3AA 2R2JA 3KXOA 2IMEA 3PGTA 4FYUA 1XZOA 2ALBA 1GLPA 1B9YC 3EYTA 1XPVA 4IW9A 1CQHA 2GSRA 2JADA 4ECBA 1O85A 2RLIA 1KNGA 2MBTA 4EE0A 4PX1A 4E8EA 2I1UA 3HY2A 3BCKA 3TOUA 3FY7A 3HVVA 3H1NA 2DBCA 4K5SA 1V98A 1XXUA 3VWXA 4IHUA 20GSA 1K3OA 1U88A 4ID0A 4MZCA 1ZL9A 1T4YA 3IA1A 1M99A 5G5FA 5A4VA 2OA7A 2OACA 3DVXA 3C71A 1WJKA 2FWGA 5LCZA 5CNWA 2IY2A 1EWXA 4HU9A 2HE3A 2GDRA 3CSIA 1HD2A 4EC0A 1ABAA 2VUPA 3F8UA 3O76A 2OADA 2P5RA 2LTKA 1TU8A 1QFNA 5DQYA 5CAXA 4OWYA 2E2MA 4BVYA 3PR8A 4OO4A 4CY8A 4LMVA 1SL2B 2KLXA 1OYJA 3HDCA 3FZ4A 3GH9A 4EDYA 3IHQA 2WDUA 1K0DA 4WBRD 4AGSA 1Z7RA 1XWGA 1YQ1A 4CHSA 3D22A 4JBBA 4XIHA 3IOSA 2D2ZA 3VFIA 5F07A 1QK8A 1O81A 3A5WA 3GN3A 3WD6A 4YAPA 4D73A 4PUAA 4I97A 4FO5A 3F4RA 4NV2A 1R5PA 13GSA 2VL9A 3QCPA 2DJ3A 4J2FA 3CSJA 3ZL5A 4ISDA 4KSMA 5G31A 4JE1A 1MDKA 3EC3A 3LW9A 5IPHA 1JHBA 3WGEA 2L4QA 5IMFA 2V6KA 4EL1A 2PU9C 2DJ0A 2HZEB 3VWWA 2V6OA 1B48A 1LJRA 4V2MA 3KJYA 4QQ7A 3UARA 3FYGA 3G7YA 1EGRA 3R3EA 2Z9SA 3ZZXA 3NOFA 2E2GA 4Q5FA 2WRTA 4I2TA 4DVCA 1K0OA 5ELAA 1ZYEA 6GSUA 2C3NA 2HLSA 1TK5B 4GF0A 4NHZA 2L57A 5ECRB 4RUVA 4X0XA 4HEA2 4JU5A 4RQRA 1E6BA 1PX6A 1ERWA 5IMDA 4ZL8A 1SKSB 5F0GA 2IWTA 3HCZA 1MDJA 5IO2A 4K7OA 5B7CA 5D73A 2IL3A 3UAPA 1LBKA 2REMA 2WZ9A 2C80A 4GXZA 5AIVA 2PBJA 1WWJA 2R3XA 4IP1A 4WR4A 2FLSA 4IELA 3HHVA 5DCGA 3DXBA 2F3MA 2K8VA 3Q74A 9GSSA 1K0CA 1M7TA 3FHKA 4ZBBA 4HZ4A 5DVBA 1ZYQB 1FG4A 4I6XA 2JSZA 22GSA 3G9BA 3P90A 4MNNA 3I9V2 3N9JA 4TR3A 5J9BA 4GSSA 2N5BA 1XOBA 2DJ2A 3CRTA 3EVIA 1K0AA 1BG5A 3PINA 5C04A 3GX0A 4ML1A 3F63A 4Z2RA 2L6DA 4FYCA 1T8EB 2H0HA 1ZZYA 4N10A 4HDEA 2IJYA 1A2LA 4JEDA 5JWQB 4WF4A 2TRXA 3KGKA 3KD0A 1PRXA 1S3AA 4HJ2A 2KOKA 2C3QA 1BAYA 4MPGA 2EIOA 2VLVA 3FK8A 4XS1A 2FA4A 4JRRA 4ML6A 5ID2A 1NHOA 2YWNA 2A4HA 2B5YA 3G7JA 3KMNA 4PQIA 1TK0B 2FGXA 3VWUA 5ECIB 4K0GA 4EF0A 2LRCA 3UMAA 4Q5NA 4IS0A 5HFKA 4TR0A 4NAXA 2RM5A 1KTEA 1EV4A 3TRPA 1BQ7A 2B5EA 18GSA 2LNSA 1SYXA 2NVLA 1Z6NA 1SJZA 2KHPA 2H19A 4P3YB 5DAKB 2LRTA 1JLWA 2K9FA 4XS4B 2UZ8A 5G1LA 3CMIA 3ERGA 1A2JA 4N11A 4K6XA 4LMWA 3ZRDA 5AIXA 2XBIA 1KEBA 1TK8B 1HNBA 5ECNB 4KUNA 11GSA 4FQUA 2R0PA 3RHCA 1A2MA 2N5AA 5EVOA 1A8LA 3KP8A 3H4KA 1AAZA 4BL7B 5D96A 1YZXA 3FR3A 1GWCA 1OE8A 2AYTA 1JZOA 2VO4A 2B1KA 4MP4A 2KP1A 2L59A 3CYNA 4IP6A 4TR1B 2EIRA 4TOPA 3DIEA 5HFGA 2I9HA 1PD21 4DSRA 2CZ2A 3WT2A 5ECHB 2LJKA 3ZFLA 1O8WA 4O5UA 2HFDA 1DSBA 2YWIA 5E4WA 2AV4A 2FUG2 4ZBDA 1YDKA 1Y6EA 5B6MA 3BJ5A 2HT9A 3ZIJA 4V1Ag 1K0BA 2QC7A 2QGVA 4F0BA 2PPTA 3D21A 2FWHA 4GRFA 1EV9A 1DE1A 3LXZA 1OC8A 1X9MB 2TRCP 3UVHA 3CRUA 1K0MA 4KCAA 4ZB8A 2OE1A 2F8AA 5CYYA 3GNJA 2IMDA 3IRAA 1M9AA 5IMVA 1XWCA 3KIJA 5FWGA 3Q6OA 4KX4A 1SD9A 16GSA 1IYHA 3GA4A 2DMMA 2H6ZA 2NPBA 2H70A 1U6TA 2PVQA 1TRWA 5DCHA 3RPNA 4G2EA 3GKMA 1M2AA 2EIQA 3IC4A 4ZIJA 2H1DA 1I5GA 4POLA 4Q5RA 2GT5A 5HR3A 4YKGA 4V1Ap 1FAAA 4EKZA 4GCIA 1T7PB 3P2AA 1MEKA 3FR9A 4PUFC 3BOAA 3IAM2 4KCEA 4KH7A 4ZILA 4LL1B 2R6KA 1XIYA 2CAQA 5CRGA 1VGLA 1QMVA 2AJQB 4L5LA 1ST9A 2HSYA 2HRAA 2DIZA 4N0ZA 4AJ8A 5GAND 4ZB9A 4HJMA 2I4AA 3TB2A 3GYKA 3J7Yk 1YKAA 2HNLA 1QUWA 1WP0A 1DBYA 2FCHA 4KDYA 2GTUA 1MD3A 1N2AA 4AJ7A 3TJFA 1BYEA 2GGTA 1QGVA 3GUSA 2R4VA 2H74A 2YWOA 2V41A 2VIMA 1PN0A 4WEYA 1DUGA 2QSIA 4IN0A 2YP6A 4Q5QA 2LJRA 4XS6A 1T00A 2H72A 5F06A 3NIVA 3FZ9A 4TN8A 3APQA 4G9HA 1SL1B 3GTUA 1ERVA 1PKZA 2H6YA 3UJ1A 2X99A 1JZDA 1NW2A 3HZ4A 1NHYA 1G0TA 3SBCA 1WE0A 4GTUA 5IOWA 2AHEA 2M72A 1PL1A 4X43A 1OE7A 4BVYB 1GL8A 2CVBA 3I6AA 1FW1A 3RBTA 2VLTA 4K7NA 4TKYA 4PQ1A 1FB6A 2B7KA 5E59A 2BMXA 3LQ7A 2FHEA 3QAVA 5KOWA 1QQ2A 2WULA 4MABA 1F3AA 1GTAA 3JCML 4DEJA 1GSYA 4PQHA 3D0ZA 3TDGA 1GUHA 3PPUA 1OKTA 5D9TA 4FIWA 2VM1A 4HOJA 1UVZA 1SJ6A 3CXGA 3SWLA 4OFNA 4IJ3A 5L71A 3U6VA 2DMLA 2HSMA 4HU7A 2HRNA 2O85A 4D73B 2V2GA 4EIQA 2VD1A 3C73A 3QMXA 3L9VA 3KM6A 1RW1A 3EU3A 3ME8A 5ECOB 2O89A 5IM9A 1U87A 2LEGA 2JU5A 1UN2A 4KDXA 3ZMKA 4O5QA 4I2UA 4Z2TA 3M9KA 3ED3A 1JFUA 3WYWA 3LYKA 5CRDA 5D9XA 5CO3A 4LA1A 1C72A 4GQCA 1T3BA 4TW5A 3UVTA 1V2AA 2YCDA 2H76A 1TRUA 1YJ6A 3TRXA 2CAIA 1A24A 4ILFA 5CRWA 2H1GA 4ZL9A 4HZ2A 1XCCA 2M46A 3GRXA 3BD2A 1TXXA 3EWLA 4E8HA 2LUSA 4JR4A 1Z9HA 1THOA 3A3TA 4MJCA 1TI3A 4MLYA 4F9ZA 4IQAA 5CRHA 2QA2A 3IXRA 4L0WA 4TXVA 5BMUA 1X0RA 2DC5A 3GURA 3M1GA 2VCVA 6GSTA 2L5OA 1F2EA 4KA0A 3ZVJA 1WIKA 4TXOB 4O32A 1V58A 2IYJA 4K9ZA 5J4UA 5B8AA 6GSSA 3TKSE 1FOVA 1SD8A 2WS2A 4O7HA 4ECCA 1VF3A 3QAWA 1JZWA 3O3TA 2GZZA 3CTFA 5FHIA 1GSQA 4L0UA 4V2LA 1B4PA 1TP9A 4NXIA 1GH2A 1E2YA 1K0NA 3DYRA 1Y25A 4TR4A 1O7UA 1ZYNA 5G30A 2L5LA 3FMWA 3ZYWA 4BWSA 3DEXA 2CQ9A 2ZCTA 3FZAA 3UBKA 2GQMA 2WCIA 4PXOA 2RUEA 1F3BA 12GSA 3QPMA 2PMTA 2PWJA 2CZ3A 1GTBA 3W8SA 1F9MA 1OAZA 2O87A 1TKDB 3TUEA 1BEDA 3GHAA 4MCUA 2R0GA 5HQPA 1F37A 3GIXA 4KDUA 1O8XA 2XBQA 4EUYA 1WOUA 1EOGA 3KZQA 2MBSA 5ID2B 1QXHA 3IAS2 2H8LA 1YY7A 2M80A 3I43A 3IK7A 2R37A 3LORA 1YF1A 2GQKA 2GZYA 1EZKA 3IDVA 4G10A 3QOUA 5ABRA 3ERFA 3QFBC 4IVFA 2HZFA 3C1SA 1EOHA 1H4OA 4MH3A 2LQQA 2MYGA 3NZNA 1USBA 1KBNA 4MA9A 2RIIA 4ZL7A 3BBYA 5H5QA 1HYUA 2HZEA 2LV3A 2HRKA 1VRSD 3UBLA 4EXJA 5KN3A 1VF4A 4WXTA 2MZCA 4MF6A 3APOA 2VM2A 4ICYA 3TJKA 3TJBA 2FD3A 2OKAA 2L4CA 3ZMLA 2EC4A 5G1KA 2BJXA 4PNGA 4GSTA 4KNDA 3M0FA 1X5DA 2H1AA 1PQNA 2E7PA 4GWRA 1X5EA 2A2RA 2YANA 1IYIA 1AQXA 2YZHA 2IFQA 4NV5A 2KP2A 3V1WA 14GSA 3E3EA 5IQYA 1TW9A 2DJKA 3PH9A 5D93A 4F03A 2P5QA 2DLXA 3HA9A 3HKRA 1AQVA 3D4MA 1A23A 1TRVA 1AW9A 2ZNMA 2VCWA 5EY6A 3GH6A 4WR5A 4DSSA 1PKWA 6GSWA 4WBJA 3GL5A 3G7IA 4YQMA 1O73A 3MWHA 2VAFA 3HJMA 3HZ8A 4CDOA 4MJAA 4OFTA 5KN2A 4EDZA 4XTSA 5HR2A 4OO5A 1ZOFA 2N5FA 3QAGA 4BVXA 3IE3A 5JWOB 1VF1A 4K2XA 1B8XA 3GFKA 4PTSA 1A8YA 1GSEA 1SJIA 2MMZA 3FEUA 4LLRA 3VI5A 2G0FA 3TGZA 3F0IA 1GSFA 1BX9A 7GSSA 2K6VA 3KTLA 3ZITA 1SENA 3M3MA 3DKSA 4BWQA 1V40A 3TKQA 3O6TA 1XW9A 1PMTA 2H71A 4G0IA 4GQFA 3KH9A 2LS5A 2B3SA 3LYPA 1EEJA 1TOFA 1RK4A 2RUFA 4HS1A 2WGRA 3ISOA 5LD0A 4ZB6A 2GQLA 4MF7A 6GSYA 4I5QA 5GSTA 4YQUA 3DGQA 19GSA 2V32A 4I8BA 3OR5A 4MJEA 1OC9A 2H1BA 2NBSA 1ZGNA 4KGIA 4IBPA 2GLRA 1TRSA 5IIZA 2X8GA 1XVQA 3KP9A 2H30A 5AISA 3W6GA 4MZBA 3E0UA 5DALA 2GSQA 4YH2A 3EMPA 3VI7A 2PVOC 2YJHA 3EINA 2C0GA 2HI7A 4GLTA 2PUKC 4KAEA 1RQMA 5DAKA 3IC8A 3D4TA 3MYDA 2WFCA 1PGTA 4MF5A 1GSSA 4USSA 3EPTA 4OMVA 2WJUA 4KF9A 5KN0A 4L8EA 2X49A 5A5KA 4MJBA 2ES7A 1SK2A 2FA8A 1R5AA 2I3YA 2A2SA 1B9XC 2O8VB 4MZWA 1B4QA 5D9WA 2VCXA 2K18A 3GSSA 3D6IA 4V2NA 2QA1A 2XPEA 3F6FA 5COHA 3LEFA 3GKNA 4BL7A 5JCUA 1ZMAA 5IMCA 1M2BA 1XW5A 3UEMA 4CY6A 1XOAA 5F8BA 4DSQA 2IIYA 3TOTA 2AB6A 4TR1A 1PN9A 2JZTA 2IMFA 2MMAA 3KTBA 3ME7A 2H0IA 1YKCA 1R7HA 4J57E 3MNGA 3DVWA 1GNEA 3J7Yb 5BRTA 3VWVA 5GZZB 1PA3A 5A4UA 1GTUA 4K7IA 2LQOA 1MTCA 3CSHA 4MK3A 2FWFA 5A4WA 5J41A 2X8HA 1J08A 4J56E 5ECSA 2B6MA 3H8QA 1G6WA 2H0GA 3TJJA 2CX4A 1ERUA 2CX3A 4PGTA 5B6NA 1TTZA 4X1UA 2C4JA 5LNKe 4KE3A 2GS3A 5AN1A 5IPGA 1PSQA 1WRYA 2PGTA 5ECPB 5D9VA 3IPZA 1UC7A 5DJLA 3RDWA 1G7OA 4WF5A 2A2PA 2QKEA 2FY6A 3RPPA 3E9JB 2MMOA 4MMMA 1JZRA 5DQSA 3UL3A 2PN8A 2XPDA 5ECKB 2K8SA 4K2DA 2ZUPA 3TKSC 3UIWA 1NM3A 3LSZA 4GSNA 4JZQA 2FNOA 3WGDA 4WKWA 4HQSA 4RQXA 5G5EA 5B8BA 3KEBA 5IMZA 2J9HA 4ECJA 3HVSA 2X8CA 3HXSA 3QDNA 5KN1A 3EURA 5C00A 3R2QA 4A5PA 4BA7A 5IOXA 4O92A 4ECIA 4POBA 1X5CA 1GUKA 4K1FA 5J3RA 2OBKA 3A2WA 3W8JA 1T1VA 1T4ZA 2IN3A 3ZREA 1TI1A 2NDOA 3IV4A 5AGYA 2C3TA 1W89A 1EP7A 2IMIA 4H86A 5KOXA 5KEJA 5H5RA 3QFAC 4ZBAA 1Z6MA 3L78A 3VLNA 2A4VA 2C1YA 3F4TA 2VL2C 5EPFA 1ACVA 2G2QA 3ZFBA 5HR1A 3ZIVA 1M0UA 4YQVA 5J9CA 4TVEA 1GUMA 2HYXA 4RI7A 4FH8A 2OE0A 2F51A 3LG6A 2LRNA 2E0QA 3U5RE 4PNFA 2YOIA 1AXDA 3FW2A 2H01A 3Q19A 5HFIA 1XW6A 2HSHA 3FZ5A 2C0FA 4G0LA 4RI6A 2B5XA 4XHMA 3CBUA 1MDIA 3HD5A 2FWEA 1SU9A 2YV7A 3LXTA 2IMKA 1XVWA 2R5GA 3Q18A 3APSA 3KH7A 1DE2A 5CP1A 4N30A 1MD4A 3DMLA 1GTIA 3IK9A 2RM6A 2GSTA 3VPTA 5JWRB 2CVDA 1TU7A 3VK9A 2F8FA 1OKDA 2YV9A 3ERWA 2VCTA 3VURA 1SKRB 1YF0A 2JL4A 2H66A 3GV1A 4IJIA 1GLQA 2DKHA 4NWYA 1XFLA 2C0DA 5DBQA 2H6XA 1YEXA 1G6YA 1X9SB 4G0KA 1U3IA 3EU4A 4ZXGA 2VCZA 4YKFA 1GSDA 3IBHA 3TKPA 3GKKA 4XCSA 5H5SA 1S3DA 3S9FA 2B1LA 3FR6A 1FO5A 2IFQB 1M9BA 3F4SA 1ZCPA 3P7XA 2J23A 2AAWA 2DIYA 1SK1A 3HVXA 1Q98A 3A2VA 4EVMA 1G7EA 2GZPA 1Z7PA 3ZVJD 2OJLA 2ON7A 3MAKA 2JACA 5HR0A 3MDKA 4HI7A 5JCGA 1THXA 2LSTA 1BJXA 2JSYA 4DSSB 2C8UA 3TKSA 2ON5A 3EE2A 5F05A 2CT6A 4O5RA 2CVKA 3QR6A 4TXOA 5EL8A 3L4NA 4X4JA 3L9UA 2YJ7A 3F9UA 4LL4B 3F3RA 1ML6A 4AJ6A 3QD9A 1FOHA 1VF2A 1M2DA 3P8WA 4BVXB 1ON4A 2P31A 4N0VA 2YN1A 2YWMA 2VOCA 3IHGA 4PURA 2KUCA 1HQOA 5J5NA 3C7MA 1NSWA 5DJMA 2HRFA 4IKHA 1EP8A 2VLUA 1OC3A 2NTOA 1CQGA 2YZUA 4KSOA 3C8EA 4KB3A 1HNCA 5DDLA 3D5JA 1EEMA 4K0NA 1FVKA 4WETA 2WB9A 2HXKA 3AY8A 1GRXA 3EMXA 4XRDA 2XHFA 1WMJA 5JCWA 3GKXA 1WPIA 3HJOA 5IMAA 4NMUA 4F2IA 3MIXA 3GMFA 4NPBA 5IO0A 2GVPA 2X4AA 2I81A 2LKUA 1ZYPA 2VL2A 2DSAA 5FT3A 2L6CA 3L9SA 4G19A 1URMA 2YNXA 1ILOA 2VCQA 1OC9B 3DD3A 4OCEA 1AIUA 17GSA 3GL3A 1XWKA 5INYA 1F6MC 4FYBA 1FHEA 4BPYA 4Z2UA 3L0HA 2DKIA 2V1MA 6GSXA 4JR6A 3M8NA 3DWVA 5DALB 3RHBA 1XBSA 1Z5YE 1W4VA 1AC1A 4QL9A 4MPFA 2VL3A 2OE3A 4POMA 1A0RP 3TJGA 2CA8A 5ELGA 2DJJA 1Q4JA 4OFMA 3F3QA 3I69A 2F9SA 4IQ1A 5GSSA 1XWBA 3VPQA 1AUCA 3ZLPA 1SKWB 4XRAA 4L5OA 4QL7A 5G2ZA 2YPMA 2OBIA 3KMOA 2VD0A 3HJPA 3N5OA 1S3CA 4YAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3US3 A;  3LFL A;  1OVN A;  4F0C A;  3F6D A;  2JZS A;  1GP1 A;  3FRC A;  1R26 A;  1SYR A;  2CV4 A;  4ACS A;  3TCO A;  3UOM A;  2AUV A;  5D8I A;  1K3Y A;  1EGO A;  2H75 A;  4OD7 A;  4IGJ A;  3WGX A;  2C0E A;  3GX8 A;  2BTO T;  5GAP D;  3IR4 A;  5CRE A;  2GSS A;  3FKF A;  2IPA A;  4TRX A;  1LU4 A;  1SL0 B;  2B7J A;  1TJD A;  4XS4 A;  1R4W A;  1V57 A;  1XWA A;  2GT6 A;  3LGC A;  4MH2 A;  2TIR A;  6GSV A;  4F82 A;  3TKR A;  1A0F A;  2XC2 A;  5ECM B;  4NHW A;  1GNW A;  1FB0 A;  3KCM A;  5ECQ B;  1YEP A;  4AF2 A;  1GSU A;  3LJR A;  2O7K A;  4Z7X A;  4K8M A;  3GTU B;  1J0F A;  1GUL A;  2LJA A;  4POK A;  1I9D A;  2MMN A;  3H93 A;  2LNT A;  1O6J A;  1ERT A;  4KW6 A;  5ECL B;  4MDC A;  3MSZ A;  1AQW A;  1TDI A;  1FVJ A;  3RAZ A;  8GSS A;  2X64 A;  4ULX A;  3K8N A;  4HUA A;  3H79 A;  1X9W B;  3WT1 A;  3DRN A;  2DJ1 A;  2P0G A;  3A2X A;  1Z3E A;  4EO3 A;  1N8J A;  1JLV A;  1V9W A;  4HQZ A;  3HYP A;  3CTG A;  1HNA A;  3M9J A;  3TRQ A;  1PX7 A;  1K3L A;  3BCI A;  1SK0 A;  5ENU A;  1H75 A;  4OCF A;  2PER A;  2JZR A;  4CW9 A;  2H73 A;  3C1R A;  10GS A;  3LWA A;  3ZTL A;  3GST A;  1J9B A;  1PL2 A;  1UA5 A;  1U3A A;  2R2J A;  3KXO A;  2IME A;  3PGT A;  4FYU A;  1XZO A;  2ALB A;  1GLP A;  1B9Y C;  3EYT A;  1XPV A;  4IW9 A;  1CQH A;  2GSR A;  2JAD A;  4ECB A;  1O85 A;  2RLI A;  1KNG A;  2MBT A;  4EE0 A;  4PX1 A;  4E8E A;  2I1U A;  3HY2 A;  3BCK A;  3TOU A;  3FY7 A;  3HVV A;  3H1N A;  2DBC A;  1V98 A;  1XXU A;  3VWX A;  4IHU A;  20GS A;  1K3O A;  1U88 A;  4ID0 A;  4MZC A;  1ZL9 A;  1T4Y A;  3IA1 A;  1M99 A;  5G5F A;  5A4V A;  2OA7 A;  2OAC A;  3DVX A;  3C71 A;  1WJK A;  2FWG A;  5LCZ A;  5CNW A;  2IY2 A;  1EWX A;  4HU9 A;  2HE3 A;  2GDR A;  3CSI A;  1HD2 A;  4EC0 A;  1ABA A;  2VUP A;  3F8U A;  3O76 A;  2OAD A;  2P5R A;  2LTK A;  1TU8 A;  1QFN A;  5DQY A;  5CAX A;  4OWY A;  2E2M A;  4BVY A;  3PR8 A;  4OO4 A;  4LMV A;  1SL2 B;  2KLX A;  1OYJ A;  3HDC A;  3FZ4 A;  3GH9 A;  4EDY A;  3IHQ A;  2WDU A;  1K0D A;  4WBR D;  4AGS A;  1Z7R A;  1XWG A;  1YQ1 A;  4CHS A;  3D22 A;  4JBB A;  4XIH A;  3IOS A;  2D2Z A;  3VFI A;  5F07 A;  1QK8 A;  1O81 A;  3A5W A;  3GN3 A;  3WD6 A;  4YAP A;  4D73 A;  4PUA A;  4I97 A;  4FO5 A;  3F4R A;  4NV2 A;  1R5P A;  13GS A;  2VL9 A;  3QCP A;  2DJ3 A;  4J2F A;  3CSJ A;  3ZL5 A;  4ISD A;  4KSM A;  5G31 A;  1MDK A;  4JE1 A;  3EC3 A;  5IPH A;  1JHB A;  3WGE A;  2L4Q A;  5IMF A;  2V6K A;  4EL1 A;  2PU9 C;  2DJ0 A;  2HZE B;  3VWW A;  2V6O A;  1B48 A;  1LJR A;  4V2M A;  3KJY A;  4QQ7 A;  3UAR A;  3FYG A;  3G7Y A;  1EGR A;  2Z9S A;  3ZZX A;  3NOF A;  2E2G A;  4Q5F A;  2WRT A;  4I2T A;  4DVC A;  1K0O A;  5ELA A;  1ZYE A;  6GSU A;  2C3N A;  2HLS A;  1TK5 B;  4GF0 A;  4NHZ A;  2L57 A;  5ECR B;  4RUV A;  4X0X A;  4HEA 2;  4JU5 A;  4RQR A;  1E6B A;  1PX6 A;  1ERW A;  5IMD A;  4ZL8 A;  1SKS B;  5F0G A;  2IWT A;  3HCZ A;  1MDJ A;  5IO2 A;  4K7O A;  5B7C A;  5D73 A;  2IL3 A;  3UAP A;  1LBK A;  2REM A;  2WZ9 A;  2C80 A;  4GXZ A;  5AIV A;  2PBJ A;  1WWJ A;  2R3X A;  4IP1 A;  4WR4 A;  2FLS A;  4IEL A;  3HHV A;  5DCG A;  3DXB A;  2F3M A;  2K8V A;  3Q74 A;  9GSS A;  1K0C A;  1M7T A;  3FHK A;  4ZBB A;  4HZ4 A;  5DVB A;  1ZYQ B;  1FG4 A;  4I6X A;  2JSZ A;  22GS A;  3G9B A;  3P90 A;  3I9V 2;  3N9J A;  4TR3 A;  5J9B A;  4GSS A;  2N5B A;  1XOB A;  2DJ2 A;  3CRT A;  3EVI A;  1K0A A;  1BG5 A;  3PIN A;  5C04 A;  3GX0 A;  4ML1 A;  3F63 A;  2L6D A;  4FYC A;  1T8E B;  2H0H A;  1ZZY A;  4N10 A;  4HDE A;  2IJY A;  1A2L A;  4JED A;  5JWQ B;  4WF4 A;  2TRX A;  3KGK A;  3KD0 A;  1PRX A;  1S3A A;  4HJ2 A;  2KOK A;  2C3Q A;  1BAY A;  4MPG A;  2EIO A;  2VLV A;  3FK8 A;  4XS1 A;  2FA4 A;  4JRR A;  4ML6 A;  5ID2 A;  1NHO A;  2YWN A;  2B5Y A;  3G7J A;  3KMN A;  4PQI A;  1TK0 B;  2FGX A;  3VWU A;  5ECI B;  4K0G A;  4EF0 A;  2LRC A;  3UMA A;  4Q5N A;  4IS0 A;  5HFK A;  4TR0 A;  4NAX A;  2RM5 A;  1KTE A;  1EV4 A;  3TRP A;  1BQ7 A;  2B5E A;  18GS A;  2LNS A;  1SYX A;  2NVL A;  1Z6N A;  1SJZ A;  2KHP A;  2H19 A;  4P3Y B;  5DAK B;  2LRT A;  1JLW A;  2K9F A;  4XS4 B;  5G1L A;  3CMI A;  3ERG A;  1A2J A;  4N11 A;  4K6X A;  4LMW A;  3ZRD A;  5AIX A;  2XBI A;  1KEB A;  1TK8 B;  1HNB A;  5ECN B;  4KUN A;  11GS A;  3RHC A;  1A2M A;  2N5A A;  5EVO A;  1A8L A;  3KP8 A;  3H4K A;  1AAZ A;  5D96 A;  1YZX A;  3FR3 A;  1GWC A;  1OE8 A;  2AYT A;  1JZO A;  2VO4 A;  2B1K A;  4MP4 A;  2KP1 A;  2L59 A;  3CYN A;  4IP6 A;  4TR1 B;  2EIR A;  4TOP A;  3DIE A;  5HFG A;  2I9H A;  1PD2 1;  4DSR A;  2CZ2 A;  3WT2 A;  5ECH B;  2LJK A;  3ZFL A;  1O8W A;  2HFD A;  1DSB A;  2YWI A;  5E4W A;  2AV4 A;  2FUG 2;  4ZBD A;  1YDK A;  1Y6E A;  5B6M A;  3BJ5 A;  2HT9 A;  3ZIJ A;  4V1A g;  1K0B A;  2QC7 A;  2QGV A;  4F0B A;  2PPT A;  3D21 A;  2FWH A;  4GRF A;  1EV9 A;  1DE1 A;  3LXZ A;  1OC8 A;  1X9M B;  2TRC P;  3UVH A;  3CRU A;  1K0M A;  4KCA A;  4ZB8 A;  2OE1 A;  2F8A A;  5CYY A;  3GNJ A;  2IMD A;  3IRA A;  1M9A A;  5IMV A;  1XWC A;  3KIJ A;  5FWG A;  3Q6O A;  4KX4 A;  1SD9 A;  16GS A;  1IYH A;  3GA4 A;  2DMM A;  2H6Z A;  2NPB A;  2H70 A;  1U6T A;  2PVQ A;  1TRW A;  5DCH A;  3RPN A;  4G2E A;  3GKM A;  1M2A A;  2EIQ A;  3IC4 A;  4ZIJ A;  2H1D A;  1I5G A;  4POL A;  4Q5R A;  2GT5 A;  5HR3 A;  4V1A p;  1FAA A;  4EKZ A;  4GCI A;  1T7P B;  3P2A A;  1MEK A;  3FR9 A;  4PUF C;  3BOA A;  3IAM 2;  4KCE A;  4KH7 A;  4ZIL A;  4LL1 B;  2R6K A;  1XIY A;  2CAQ A;  5CRG A;  1VGL A;  1QMV A;  2AJQ B;  4L5L A;  1ST9 A;  2HSY A;  2DIZ A;  4N0Z A;  4AJ8 A;  5GAN D;  4ZB9 A;  4HJM A;  2I4A A;  3TB2 A;  3GYK A;  3J7Y k;  1YKA A;  2HNL A;  1QUW A;  1WP0 A;  1DBY A;  2FCH A;  4KDY A;  2GTU A;  1MD3 A;  1N2A A;  4AJ7 A;  3TJF A;  1BYE A;  2GGT A;  1QGV A;  3GUS A;  2R4V A;  2H74 A;  2YWO A;  2V41 A;  2VIM A;  4WEY A;  1DUG A;  2QSI A;  4IN0 A;  2YP6 A;  4Q5Q A;  2LJR A;  4XS6 A;  1T00 A;  2H72 A;  5F06 A;  3NIV A;  3FZ9 A;  4TN8 A;  3APQ A;  4G9H A;  1SL1 B;  3GTU A;  1ERV A;  1PKZ A;  2H6Y A;  3UJ1 A;  2X99 A;  1JZD A;  1NW2 A;  3HZ4 A;  1NHY A;  1G0T A;  3SBC A;  1WE0 A;  4GTU A;  5IOW A;  2AHE A;  2M72 A;  1PL1 A;  4X43 A;  1OE7 A;  1GL8 A;  2CVB A;  3I6A A;  1FW1 A;  3RBT A;  2VLT A;  4K7N A;  4TKY A;  4PQ1 A;  1FB6 A;  2B7K A;  5E59 A;  2BMX A;  3LQ7 A;  2FHE A;  3QAV A;  1QQ2 A;  2WUL A;  4MAB A;  1F3A A;  1GTA A;  3JCM L;  4DEJ A;  1GSY A;  4PQH A;  3D0Z A;  3TDG A;  1GUH A;  1OKT A;  5D9T A;  4FIW A;  2VM1 A;  4HOJ A;  1UVZ A;  1SJ6 A;  3CXG A;  3SWL A;  4OFN A;  4IJ3 A;  5L71 A;  3U6V A;  2DML A;  4HU7 A;  2HRN A;  2O85 A;  4D73 B;  2V2G A;  2VD1 A;  3C73 A;  3QMX A;  3L9V A;  3KM6 A;  1RW1 A;  3EU3 A;  3ME8 A;  5ECO B;  2O89 A;  5IM9 A;  1U87 A;  2LEG A;  2JU5 A;  1UN2 A;  4KDX A;  3ZMK A;  4I2U A;  3M9K A;  3ED3 A;  1JFU A;  3WYW A;  3LYK A;  5CRD A;  5D9X A;  5CO3 A;  4LA1 A;  1C72 A;  4GQC A;  1T3B A;  4TW5 A;  3UVT A;  1V2A A;  2YCD A;  2H76 A;  1TRU A;  1YJ6 A;  3TRX A;  2CAI A;  1A24 A;  4ILF A;  5CRW A;  2H1G A;  4ZL9 A;  4HZ2 A;  1XCC A;  2M46 A;  3GRX A;  3BD2 A;  1TXX A;  3EWL A;  4E8H A;  2LUS A;  4JR4 A;  1Z9H A;  1THO A;  3A3T A;  4MJC A;  1TI3 A;  4MLY A;  4F9Z A;  4IQA A;  5CRH A;  3IXR A;  4L0W A;  4TXV A;  1X0R A;  2DC5 A;  3GUR A;  3M1G A;  2VCV A;  6GST A;  2L5O A;  1F2E A;  4KA0 A;  3ZVJ A;  1WIK A;  4TXO B;  4O32 A;  1V58 A;  2IYJ A;  4K9Z A;  5J4U A;  5B8A A;  6GSS A;  3TKS E;  1FOV A;  1SD8 A;  2WS2 A;  4O7H A;  4ECC A;  1VF3 A;  3QAW A;  1JZW A;  3O3T A;  2GZZ A;  3CTF A;  5FHI A;  1GSQ A;  4L0U A;  4V2L A;  1B4P A;  1TP9 A;  4NXI A;  1GH2 A;  1E2Y A;  1K0N A;  3DYR A;  1Y25 A;  4TR4 A;  1O7U A;  5G30 A;  2L5L A;  4BWS A;  3ZYW A;  3DEX A;  2CQ9 A;  2ZCT A;  3FZA A;  3UBK A;  2GQM A;  2WCI A;  4PXO A;  2RUE A;  1F3B A;  12GS A;  3QPM A;  2PMT A;  2PWJ A;  2CZ3 A;  1GTB A;  3W8S A;  1F9M A;  1OAZ A;  2O87 A;  1TKD B;  3TUE A;  1BED A;  3GHA A;  4MCU A;  5HQP A;  1F37 A;  3GIX A;  4KDU A;  1O8X A;  2XBQ A;  4EUY A;  1WOU A;  1EOG A;  3KZQ A;  2MBS A;  5ID2 B;  1QXH A;  3IAS 2;  2H8L A;  1YY7 A;  2M80 A;  3I43 A;  3IK7 A;  2R37 A;  3LOR A;  1YF1 A;  2GQK A;  2GZY A;  1EZK A;  3IDV A;  4G10 A;  3QOU A;  5ABR A;  3ERF A;  3QFB C;  4IVF A;  2HZF A;  3C1S A;  1EOH A;  1H4O A;  4MH3 A;  2LQQ A;  2MYG A;  3NZN A;  1USB A;  1KBN A;  4MA9 A;  2RII A;  4ZL7 A;  3BBY A;  5H5Q A;  1HYU A;  2HZE A;  2LV3 A;  3UBL A;  1VRS D;  4EXJ A;  5KN3 A;  1VF4 A;  4WXT A;  2MZC A;  4MF6 A;  3APO A;  2VM2 A;  3TJK A;  3TJB A;  2FD3 A;  2OKA A;  2L4C A;  3ZML A;  2EC4 A;  5G1K A;  2BJX A;  4PNG A;  4GST A;  4KND A;  3M0F A;  1X5D A;  2H1A A;  1PQN A;  2E7P A;  4GWR A;  1X5E A;  2A2R A;  2YAN A;  1IYI A;  1AQX A;  2YZH A;  2IFQ A;  4NV5 A;  2KP2 A;  3V1W A;  14GS A;  3E3E A;  5IQY A;  1TW9 A;  2DJK A;  3PH9 A;  5D93 A;  4F03 A;  2P5Q A;  2DLX A;  3HA9 A;  3HKR A;  1AQV A;  3D4M A;  1A23 A;  1TRV A;  1AW9 A;  2ZNM A;  2VCW A;  5EY6 A;  3GH6 A;  4WR5 A;  4DSS A;  1PKW A;  6GSW A;  4WBJ A;  3GL5 A;  3G7I A;  4YQM A;  1O73 A;  3MWH A;  2VAF A;  3HJM A;  3HZ8 A;  4CDO A;  4MJA A;  4OFT A;  5KN2 A;  4EDZ A;  4XTS A;  5HR2 A;  4OO5 A;  1ZOF A;  2N5F A;  3QAG A;  4BVX A;  3IE3 A;  5JWO B;  1VF1 A;  1B8X A;  3GFK A;  1A8Y A;  1GSE A;  1SJI A;  2MMZ A;  3FEU A;  4LLR A;  3VI5 A;  2G0F A;  3TGZ A;  3F0I A;  1GSF A;  1BX9 A;  7GSS A;  2K6V A;  3KTL A;  3ZIT A;  1SEN A;  3M3M A;  3DKS A;  4BWQ A;  1V40 A;  3TKQ A;  3O6T A;  1XW9 A;  1PMT A;  2H71 A;  4GQF A;  3KH9 A;  2LS5 A;  2B3S A;  3LYP A;  1EEJ A;  1TOF A;  1RK4 A;  2RUF A;  4HS1 A;  2WGR A;  3ISO A;  5LD0 A;  4ZB6 A;  2GQL A;  4MF7 A;  6GSY A;  4I5Q A;  5GST A;  4YQU A;  3DGQ A;  19GS A;  2V32 A;  4I8B A;  3OR5 A;  4MJE A;  1OC9 A;  2H1B A;  2NBS A;  1ZGN A;  4KGI A;  4IBP A;  2GLR A;  1TRS A;  5IIZ A;  2X8G A;  1XVQ A;  3KP9 A;  2H30 A;  5AIS A;  3W6G A;  4MZB A;  3E0U A;  5DAL A;  2GSQ A;  4YH2 A;  3EMP A;  3VI7 A;  2PVO C;  2YJH A;  3EIN A;  2C0G A;  2HI7 A;  4GLT A;  2PUK C;  4KAE A;  5DAK A;  1RQM A;  3D4T A;  2WFC A;  1PGT A;  4MF5 A;  1GSS A;  4OMV A;  2WJU A;  5KN0 A;  4L8E A;  5A5K A;  4MJB A;  2ES7 A;  1SK2 A;  2FA8 A;  1R5A A;  2I3Y A;  2A2S A;  1B9X C;  2O8V B;  4MZW A;  1B4Q A;  5D9W A;  2VCX A;  2K18 A;  3GSS A;  3D6I A;  4V2N A;  2XPE A;  3F6F A;  5COH A;  3LEF A;  3GKN A;  4BL7 A;  5JCU A;  1ZMA A;  5IMC A;  1M2B A;  1XW5 A;  3UEM A;  1XOA A;  5F8B A;  4DSQ A;  2IIY A;  3TOT A;  2AB6 A;  4TR1 A;  1PN9 A;  2JZT A;  2IMF A;  2MMA A;  3KTB A;  3ME7 A;  2H0I A;  1YKC A;  1R7H A;  4J57 E;  3MNG A;  3DVW A;  1GNE A;  3J7Y b;  3VWV A;  5GZZ B;  1PA3 A;  5A4U A;  1GTU A;  4K7I A;  2LQO A;  1MTC A;  3CSH A;  4MK3 A;  2FWF A;  5A4W A;  5J41 A;  2X8H A;  1J08 A;  5ECS A;  4J56 E;  2B6M A;  3H8Q A;  1G6W A;  2H0G A;  3TJJ A;  2CX4 A;  1ERU A;  2CX3 A;  4PGT A;  5B6N A;  1TTZ A;  4X1U A;  2C4J A;  5LNK e;  4KE3 A;  2GS3 A;  5AN1 A;  5IPG A;  1PSQ A;  1WRY A;  2PGT A;  5ECP B;  5D9V A;  3IPZ A;  1UC7 A;  5DJL A;  3RDW A;  1G7O A;  4WF5 A;  2QKE A;  2FY6 A;  3RPP A;  3E9J B;  2MMO A;  4MMM A;  1JZR A;  5DQS A;  3UL3 A;  2PN8 A;  2XPD A;  5ECK B;  2K8S A;  4K2D A;  2ZUP A;  3TKS C;  3UIW A;  1NM3 A;  3LSZ A;  4GSN A;  4JZQ A;  2FNO A;  3WGD A;  4WKW A;  4HQS A;  4RQX A;  5G5E A;  5B8B A;  3KEB A;  5IMZ A;  2J9H A;  4ECJ A;  3HVS A;  2X8C A;  3HXS A;  3QDN A;  5KN1 A;  3EUR A;  5C00 A;  3R2Q A;  4BA7 A;  5IOX A;  4O92 A;  4ECI A;  4POB A;  1X5C A;  1GUK A;  4K1F A;  5J3R A;  2OBK A;  3A2W A;  3W8J A;  1T1V A;  1T4Z A;  2IN3 A;  3ZRE A;  1TI1 A;  2NDO A;  3IV4 A;  5AGY A;  2C3T A;  1W89 A;  1EP7 A;  2IMI A;  4H86 A;  5KEJ A;  5H5R A;  3QFA C;  4ZBA A;  1Z6M A;  3L78 A;  3VLN A;  2A4V A;  2C1Y A;  3F4T A;  2VL2 C;  5EPF A;  1ACV A;  2G2Q A;  3ZFB A;  5HR1 A;  3ZIV A;  1M0U A;  4YQV A;  5J9C A;  4TVE A;  1GUM A;  2HYX A;  4RI7 A;  4FH8 A;  2OE0 A;  2F51 A;  3LG6 A;  2LRN A;  2E0Q A;  3U5R E;  4PNF A;  2YOI A;  1AXD A;  3FW2 A;  2H01 A;  3Q19 A;  5HFI A;  1XW6 A;  2HSH A;  3FZ5 A;  2C0F A;  4RI6 A;  2B5X A;  4XHM A;  3CBU A;  1MDI A;  3HD5 A;  2FWE A;  1SU9 A;  2YV7 A;  3LXT A;  2IMK A;  1XVW A;  2R5G A;  3Q18 A;  3APS A;  3KH7 A;  1DE2 A;  5CP1 A;  4N30 A;  1MD4 A;  3DML A;  1GTI A;  3IK9 A;  2RM6 A;  2GST A;  3VPT A;  5JWR B;  2CVD A;  1TU7 A;  3VK9 A;  2F8F A;  1OKD A;  2YV9 A;  3ERW A;  2VCT A;  3VUR A;  1SKR B;  1YF0 A;  2JL4 A;  2H66 A;  3GV1 A;  4IJI A;  1GLQ A;  4NWY A;  1XFL A;  2C0D A;  5DBQ A;  2H6X A;  1YEX A;  1G6Y A;  1X9S B;  1U3I A;  3EU4 A;  4ZXG A;  2VCZ A;  1GSD A;  3IBH A;  3TKP A;  3GKK A;  4XCS A;  5H5S A;  1S3D A;  3S9F A;  2B1L A;  3FR6 A;  1FO5 A;  2IFQ B;  1M9B A;  3F4S A;  1ZCP A;  3P7X A;  2J23 A;  2AAW A;  2DIY A;  1SK1 A;  3HVX A;  1Q98 A;  3A2V A;  4EVM A;  1G7E A;  2GZP A;  1Z7P A;  3ZVJ D;  2OJL A;  2ON7 A;  3MAK A;  2JAC A;  5HR0 A;  3MDK A;  4HI7 A;  5JCG A;  1THX A;  2LST A;  1BJX A;  2JSY A;  4DSS B;  2C8U A;  3TKS A;  2ON5 A;  3EE2 A;  5F05 A;  2CT6 A;  4O5R A;  2CVK A;  3QR6 A;  4TXO A;  5EL8 A;  3L4N A;  3L9U A;  2YJ7 A;  3F9U A;  4LL4 B;  3F3R A;  1ML6 A;  4AJ6 A;  3QD9 A;  1VF2 A;  1M2D A;  3P8W A;  1ON4 A;  2P31 A;  4N0V A;  2YN1 A;  2YWM A;  2VOC A;  4PUR A;  2KUC A;  1HQO A;  5J5N A;  3C7M A;  1NSW A;  5DJM A;  2HRF A;  4IKH A;  1EP8 A;  2VLU A;  1OC3 A;  2NTO A;  1CQG A;  2YZU A;  4KSO A;  3C8E A;  4KB3 A;  1HNC A;  5DDL A;  3D5J A;  1EEM A;  4K0N A;  1FVK A;  4WET A;  2WB9 A;  2HXK A;  3AY8 A;  1GRX A;  3EMX A;  4XRD A;  2XHF A;  1WMJ A;  5JCW A;  3GKX A;  1WPI A;  3HJO A;  5IMA A;  4NMU A;  4F2I A;  3GMF A;  4NPB A;  5IO0 A;  2GVP A;  2I81 A;  2LKU A;  2VL2 A;  2DSA A;  5FT3 A;  2L6C A;  3L9S A;  4G19 A;  1URM A;  2YNX A;  1ILO A;  2VCQ A;  1OC9 B;  3DD3 A;  4OCE A;  1AIU A;  17GS A;  3GL3 A;  1XWK A;  5INY A;  1F6M C;  4FYB A;  1FHE A;  4BPY A;  3L0H A;  2V1M A;  6GSX A;  4JR6 A;  3M8N A;  3DWV A;  5DAL B;  3RHB A;  1XBS A;  1Z5Y E;  1W4V A;  1AC1 A;  4QL9 A;  4MPF A;  2VL3 A;  2OE3 A;  4POM A;  1A0R P;  3TJG A;  2CA8 A;  5ELG A;  2DJJ A;  1Q4J A;  4OFM A;  3F3Q A;  3I69 A;  2F9S A;  4IQ1 A;  5GSS A;  1XWB A;  3VPQ A;  1AUC A;  3ZLP A;  1SKW B;  4XRA A;  4L5O A;  4QL7 A;  5G2Z A;  2YPM A;  2OBI A;  3KMO A;  2VD0 A;  3HJP A;  3N5O A;  1S3C A;  4YAV A; 
#chains in the Genus database with same CATH topology
 1GMR A;  2R41 A;  2HMJ B;  5AI1 A;  5JPP A;  3US3 A;  1LQG C;  3LFL A;  1OVN A;  2A15 A;  3S27 A;  2IUK A;  4F0C A;  5AIG A;  3F6D A;  2JZS A;  1W7C A;  1WTH A;  1T2H A;  1GP1 A;  3FRC A;  1R26 A;  1MWR A;  3AMO A;  1SYR A;  2CV4 A;  4ACS A;  3TCO A;  3UOM A;  2AUV A;  2F86 B;  3EX9 A;  5D8I A;  1K3Y A;  2MF7 A;  1EGO A;  2H75 A;  2RSX A;  4OD7 A;  4N6O B;  2R0C A;  4IGJ A;  2XGN A;  1B2Z A;  3CXC 2;  3WGX A;  2C0E A;  1PFP A;  3GX8 A;  2BTO T;  2O9U X;  5GAP D;  3IR4 A;  5CRE A;  2GSS A;  3FKF A;  2IPA A;  4TRX A;  1LU4 A;  4RZM A;  1ULJ B;  1SL0 B;  2P0X A;  1TJD A;  3CCM 3;  2B7J A;  4YAV A;  2CFL A;  4XS4 A;  1R4W A;  3A5I A;  1V57 A;  1XWA A;  3NHX A;  2GT6 A;  1Q86 4;  3LGC A;  4MH2 A;  2TIR A;  4MJD A;  1M9G A;  5IEN A;  6GSV A;  4F82 A;  3TKR A;  1A0F A;  2XC2 A;  5ECM B;  4NHW A;  1MWT A;  3MYT A;  4EIP A;  5CF1 A;  1GNW A;  1FB0 A;  3KCM A;  1M90 4;  1YEP A;  4K5R A;  3D79 A;  5ECQ B;  4AF2 A;  3EE1 A;  1GSU A;  3LJR A;  3N9H A;  4R80 A;  1D6Y A;  2O7K A;  3WOD G;  2CIU A;  3K0Z A;  4Z7X A;  4K8M A;  3GTU B;  1J0F A;  1GUL A;  2LJA A;  1BRG A;  4POK A;  1I9D A;  2MMN A;  3H93 A;  1TRQ A;  2LNT A;  3B4O A;  1A2K A;  1O6J A;  4QWT A;  1ERT A;  4KW6 A;  2INX A;  3AHS A;  5ECL B;  4MDC A;  3MSZ A;  1AQW A;  3F7X A;  1TDI A;  1AV4 A;  1FVJ A;  3MG2 A;  3RAZ A;  2BHM A;  8GSS A;  2X64 A;  4ULX A;  3N8B A;  1WMO A;  4MMX B;  3K8N A;  4HUA A;  2XH9 A;  1YJ9 3;  3H79 A;  1X9W B;  4TX4 A;  1F8N A;  3WT1 A;  2W9Q A;  7STD A;  3DRN A;  2DJ1 A;  2P0G A;  1RGC A;  3A2X A;  4WP5 A;  1Z3E A;  3EHC A;  1TTO A;  4EO3 A;  1N8J A;  1JBS A;  1TFK A;  1JLV A;  1JB4 A;  1V9W A;  4HQZ A;  3HYP A;  3CTG A;  2BMR B;  1B27 A;  3CCQ 3;  1HNA A;  4EC6 A;  5IG4 A;  4N6U A;  2P09 A;  3M9J A;  3TRQ A;  6STD A;  1PX7 A;  1I3I A;  2OOV C;  1K3L A;  3BCI A;  1SK0 A;  1I3F A;  1RJO A;  1FGM A;  1I2F A;  2XF3 A;  5ENU A;  1H75 A;  4OCF A;  2PER A;  2JZR A;  4CW9 A;  2H73 A;  3C1R A;  1OF5 A;  3EQQ B;  3LWA A;  10GS A;  3ZTL A;  3GST A;  1J9B A;  1PL2 A;  1UA5 A;  1U3A A;  2R2J A;  3KXO A;  2IME A;  3PGT A;  3BLZ A;  4FYU A;  1T2I A;  1XZO A;  2ALB A;  1YVS A;  1GLP A;  1B9Y C;  3EYT A;  1XPV A;  3GZX B;  3ZFZ A;  4IW9 A;  1CQH A;  2GSR A;  3NX0 A;  2JAD A;  5HGR A;  4ECB A;  1O85 A;  3CPO A;  2RLI A;  4IIA A;  1KNG A;  2MBT A;  4EE0 A;  4PX1 A;  1OHO A;  2HMN B;  4E8E A;  2I1U A;  1UCJ A;  3HY2 A;  1W6G A;  3BCK A;  3TOU A;  3PCS A;  2L4V A;  3FY7 A;  3HVV A;  3H1N A;  2DBC A;  3HZP A;  4K5S A;  4J5G A;  3V98 A;  5FW5 A;  1V98 A;  1XXU A;  3VWX A;  2RBI A;  1A2V A;  1LOY A;  4IHU A;  20GS A;  1K3O A;  1U88 A;  5HOH A;  1RLS A;  4LSO A;  3SYU A;  4ID0 A;  5EVH A;  4MZC A;  1ZL9 A;  1T4Y A;  1E97 A;  3IA1 A;  1M99 A;  5G5F A;  2AAE A;  5A4V A;  2OA7 A;  2YFL B;  2OAC A;  3DVX A;  3C71 A;  1WJK A;  5M1A A;  2OWP A;  2FWG A;  1Q9E A;  5LCZ A;  5CNW A;  2IY2 A;  5AII A;  1YVB I;  1GOY A;  1EWX A;  4HU9 A;  5EQL A;  2HE3 A;  1ZO2 A;  2GDR A;  3CSI A;  1HD2 A;  1DVC A;  3ZG5 A;  3FH1 A;  2WGO A;  4EC0 A;  1ABA A;  2ZDJ A;  2VUP A;  5AYR B;  2QA4 3;  4AKY A;  3F8U A;  3O76 A;  5STD A;  2OAD A;  2KF6 A;  2P5R A;  2LTK A;  2CG0 A;  1TU8 A;  1UUW B;  4BIK A;  4FCZ A;  1QFN A;  5DQY A;  3BIR A;  3FGY A;  2E2T A;  5CAX A;  1RKY A;  4N6T A;  4OWY A;  5KP4 A;  1Q82 4;  2E2M A;  4BVY A;  3HII A;  3PR8 A;  4OO4 A;  3RNT A;  4BIR A;  4CY8 A;  4IT7 A;  4LYL B;  4LMV A;  3JUO A;  1SL2 B;  2KLX A;  1GSP A;  1OYJ A;  1VQK 3;  3HDC A;  3FZ4 A;  1RHL A;  3GH9 A;  1BNJ A;  4N6V 0;  4EDY A;  1EUI C;  3IHQ A;  2WDU A;  1K0D A;  2GU3 A;  4WBR D;  4AGS A;  1SAR A;  3CMA 3;  2GEY A;  1Z7R A;  2UX0 A;  2HML B;  1JV2 B;  1XWG A;  1AY7 A;  1Q7H A;  2Z77 A;  1YQ1 A;  2KF5 A;  4CHS A;  3D22 A;  4JBB A;  4XIH A;  3IOS A;  2D2Z A;  3VFI A;  1IQY A;  4MMZ B;  3K5T A;  1OGZ A;  5KP1 A;  2BIR A;  5F07 A;  1HYF A;  1QK8 A;  1O81 A;  3A5W A;  3GN3 A;  3WD6 A;  4YAP A;  3I56 3;  4D73 A;  4PUA A;  4I97 A;  4FO5 A;  3FSD A;  4JRF A;  1FYS A;  3F4R A;  4NV2 A;  1R5P A;  13GS A;  2VL9 A;  3QCP A;  2DJ3 A;  4L8O A;  4J2F A;  3CSJ A;  3ZL5 A;  4ISD A;  4KSM A;  3ER7 A;  1BNE A;  5G31 A;  1MDK A;  4JE1 A;  3EC3 A;  3LW9 A;  3MG3 A;  5IPH A;  3WGE A;  2GU1 A;  2L4Q A;  1JHB A;  3WA3 A;  4J8T A;  2WO0 A;  5IMF A;  2V6K A;  1B2M A;  4HKV B;  2PU9 C;  4EL1 A;  1IVW A;  1JN5 B;  1IDP A;  2DJ0 A;  2HZE B;  3VWW A;  2V6O A;  1B48 A;  1LJR A;  1I70 A;  4V2M A;  3KJY A;  4QQ7 A;  3UAR A;  3FYG A;  1J2B A;  1I0X A;  3G7Y A;  2GSP A;  1NB5 I;  3R3E A;  1EGR A;  2Z9S A;  3ZZX A;  3NOF A;  1ZS7 A;  2E2G A;  1Q42 A;  3D3L A;  4Q5F A;  2WRT A;  1VQ5 3;  1W2Z A;  4I2T A;  3L0R A;  4DVC A;  2OOV A;  1K0O A;  5ELA A;  1ZYE A;  6GSU A;  3MWZ A;  4OVM A;  1VQ4 3;  2XFT A;  2C3N A;  4ORL A;  2HLS A;  1TK5 B;  4GF0 A;  4NHZ A;  2F98 A;  2L57 A;  5ECR B;  2CFG A;  3HX8 A;  2OTL 3;  4RUV A;  4X0X A;  1N5H A;  4HEA 2;  4JU5 A;  3NQZ A;  4RQR A;  1NB3 I;  1E6B A;  4DKI A;  1PX6 A;  1ERW A;  5IMD A;  1BNI A;  3WDG B;  4ZL8 A;  1SKS B;  5F0G A;  1BIR A;  2IWT A;  2ML5 A;  3HCZ A;  1MDJ A;  5IO2 A;  3G8Z A;  4K7O A;  5B7C A;  1FGQ A;  5D73 A;  1B2S A;  2IL3 A;  1VQ8 3;  3UAP A;  1LBK A;  2REM A;  2WZ9 A;  2C80 A;  4GXZ A;  3B4P A;  4GB5 A;  1K9M 4;  5AIV A;  2PBJ A;  1WWJ A;  2R3X A;  4RNZ A;  4IP1 A;  4WR4 A;  3DUK A;  2FLS A;  3DGM A;  2QEX 3;  1D6U A;  4IEL A;  1HU9 A;  3HHV A;  5DCG A;  3DXB A;  2F3M A;  2K8V A;  3Q74 A;  3BND A;  1K0C A;  9GSS A;  1M7T A;  3FHK A;  2P38 A;  3D9R A;  1N8R 4;  4ZBB A;  4HZ4 A;  5DVB A;  1JBT A;  1ZYQ B;  1FG4 A;  4I6X A;  1R4Y A;  2JSZ A;  22GS A;  3G9B A;  3P90 A;  4HZ9 B;  2I9W A;  4MNN A;  3T8U A;  1RGE A;  2SBL A;  1VQL 3;  5LC6 A;  3I9V 2;  3N9J A;  2OQE C;  4TR3 A;  5J9B A;  4GSS A;  5ELU A;  2N5B A;  1XOB A;  2DJ2 A;  3CRT A;  3EVI A;  2UGI A;  1W5Z A;  1BG5 A;  1K0A A;  1ISK A;  3PIN A;  5C04 A;  3GX0 A;  2L1S A;  4ML1 A;  3CNM A;  3F63 A;  1K73 4;  4BL3 A;  4Z2R A;  2L6D A;  4FYC A;  1T8E B;  2H0H A;  4MEI A;  1FUS A;  1ZZY A;  4N10 A;  3E99 A;  2IJY A;  4HDE A;  1A2L A;  4JED A;  2YFJ B;  5JWQ B;  4WF4 A;  2TRX A;  4HM6 B;  1WMN A;  1ROV A;  1KD1 4;  3KD0 A;  3KGK A;  1PRX A;  1S3A A;  4HJ2 A;  2KOK A;  1B20 A;  1KC8 4;  2C3Q A;  1BAY A;  4MPG A;  2EIO A;  2VLV A;  3FK8 A;  4XS1 A;  2FA4 A;  1B3S A;  1W6C A;  6RNT A;  4XBX A;  4JRR A;  1FGR A;  4ML6 A;  5ID2 A;  1NHO A;  2YWN A;  2A4H A;  2B5Y A;  3G7J A;  1JB5 A;  3KMN A;  3FG1 A;  3AMO B;  3G4S 3;  4PQI A;  2CKF B;  1UUV B;  1TK0 B;  5TGN A;  3UB1 A;  1RDS A;  1LOX A;  2FGX A;  4RNY A;  3V99 A;  3VWU A;  5ECI B;  4K0G A;  4EF0 A;  2LRC A;  3UMA A;  4Q5N A;  4IS0 A;  5HFK A;  4TR0 A;  4NAX A;  1EA2 A;  4AKZ A;  1X1U A;  2RM5 A;  1BUQ A;  1KTE A;  1VQP 3;  4HAA A;  1EV4 A;  3TRP A;  1BQ7 A;  1O7M B;  2B5E A;  1U5O A;  18GS A;  2LNS A;  4CCV A;  1FZU A;  1SYX A;  1M3I A;  2NVL A;  1Z6N A;  1SJZ A;  2KHP A;  2H19 A;  1AQZ A;  4P3Y B;  5DAK B;  2LRT A;  2SAR A;  1JLW A;  2K9F A;  4XS4 B;  2UZ8 A;  5G1L A;  3CMI A;  3ERG A;  1A2J A;  2YFI B;  4N11 A;  4K6X A;  4LMW A;  4BTY A;  2FXT A;  1IVU A;  4EV5 A;  3J7Y d;  4EV2 A;  1VQM 3;  3ZRD A;  2KXG A;  5D82 A;  1N5P A;  5AIX A;  2XBI A;  1KEB A;  2CH9 A;  1TK8 B;  1HNB A;  5ECN B;  4KUN A;  11GS A;  1UI8 A;  5DRE A;  4FQU A;  2R0P A;  3RHC A;  2RNT A;  1A2M A;  2N5A A;  5EVO A;  1A8L A;  1BNG A;  3KP8 A;  3H4K A;  3PZW A;  1AAZ A;  4BL7 B;  5D96 A;  3DXO A;  3LTA A;  1S72 3;  1YZX A;  4EYC A;  3FR3 A;  1YJN 3;  1GWC A;  1YHQ 3;  2V1L A;  1OE8 A;  2AYT A;  1JZO A;  2VO4 A;  2B1K A;  3F9S A;  4MP4 A;  2KP1 A;  2L59 A;  3CYN A;  4X2O A;  4IP6 A;  4TR1 B;  2EIR A;  1FUT A;  4TOP A;  4HJL B;  5CF2 A;  3DIE A;  5HFG A;  4GSP A;  2I9H A;  2Q07 A;  1PD2 1;  4DSR A;  2CZ2 A;  3WT2 A;  1EG9 B;  1TFO A;  5ECH B;  2LJK A;  3ZFL A;  4HSC X;  1QMA A;  3LZA A;  1QJG A;  1O8W A;  3DZL A;  5BIR A;  1Y4K A;  4O5U A;  2HFD A;  1DSB A;  2YWI A;  5E4W A;  2AV4 A;  2FUG 2;  4ZBD A;  1YDK A;  1Y6E A;  5B6M A;  3BJ5 A;  2HT9 A;  3ZIJ A;  4V1A g;  1K0B A;  2QC7 A;  2QGV A;  1W02 A;  2W0Q A;  2PPT A;  4F0B A;  3D21 A;  2FWH A;  4GRF A;  3NM7 A;  1K28 A;  1EV9 A;  1DE1 A;  3LXZ A;  1UCK A;  1OC8 A;  3RGA A;  1X9M B;  1GMP A;  2TRC P;  3UVH A;  3CRU A;  1K0M A;  4KCA A;  4ZB8 A;  2OE1 A;  2F8A A;  3FCS B;  2JQ5 A;  5CYY A;  5D81 A;  4RBN A;  3GNJ A;  2IMD A;  3IRA A;  1M9A A;  1YIJ 3;  5IMV A;  1XWC A;  3KIJ A;  5FWG A;  3Q6O A;  4KX4 A;  1SD9 A;  16GS A;  1JKG A;  1IYH A;  1GD3 A;  3GA4 A;  2DMM A;  3CCS 3;  2H6Z A;  2P05 A;  2NPB A;  3RGR A;  2H70 A;  4X2H A;  1U6T A;  2PVQ A;  1TRW A;  5DCH A;  3RPN A;  4G2E A;  1WQL B;  3GKM A;  1M2A A;  2F5W A;  2EIQ A;  3X42 A;  1YIT 3;  3IC4 A;  4ZIJ A;  2H1D A;  4HM5 B;  3LTC A;  3VSY A;  1I5G A;  4POL A;  3JUQ A;  4Q5R A;  1UUG B;  2GT5 A;  5HR3 A;  4BTX A;  4YKG A;  4V1A p;  1BSA A;  2OQE A;  1FAA A;  4EKZ A;  4GCI A;  1T7P B;  2C10 A;  3P2A A;  1Q7Y 4;  1MEK A;  3FR9 A;  4PUF C;  3BOA A;  3KSE D;  1R4C A;  1Q40 B;  3KCH A;  3IAM 2;  4KCE A;  2R6K A;  4KH7 A;  4LL1 B;  4ZIL A;  1QAL A;  1MGW A;  4N6N B;  1XIY A;  2CAQ A;  4FMB A;  5CRG A;  3LOY A;  1VGL A;  1QMV A;  3KII A;  2AJQ B;  4L5L A;  1O7H B;  4CPK A;  1ST9 A;  3JUM A;  2XRX B;  2HSY A;  2HRA A;  2DIZ A;  4N0Z A;  4XB5 A;  4AJ8 A;  1LVN A;  5GAN D;  4ZB9 A;  4HJM A;  2I4A A;  8RNT A;  3TB2 A;  3SX1 A;  3GYK A;  3J7Y k;  4HVN A;  1YKA A;  2HNL A;  2LYX A;  1QUW A;  1WP0 A;  5I97 A;  1DBY A;  3DGL A;  3KN4 A;  2FCH A;  4KDY A;  2GTU A;  1MD3 A;  1N2A A;  4AJ7 A;  3TJF A;  4IPB A;  1BYE A;  2GGT A;  1QGV A;  3GUS A;  3FZW A;  2R4V A;  2H74 A;  3T0U A;  2V41 A;  2YWO A;  2VIM A;  3LTD A;  1JRQ A;  1T5Y A;  1PN0 A;  4HM0 B;  5AEW B;  1DUG A;  4WEY A;  2QSI A;  4IN0 A;  2YP6 A;  4Q5Q A;  2LJR A;  1RTU A;  4HM7 B;  4XS6 A;  1T00 A;  2H72 A;  5ELJ A;  1IT8 A;  3Q90 A;  3DGY A;  5F06 A;  1JB2 A;  1IV7 A;  4U13 A;  3NIV A;  3FZ9 A;  4TN8 A;  4H3U A;  3APQ A;  4G9H A;  1SL1 B;  3GTU A;  1ERV A;  1YNV X;  1PKZ A;  4K90 B;  2H6Y A;  3UJ1 A;  2X99 A;  1JZD A;  1ZX2 A;  4KFE A;  1NW2 A;  3HZ4 A;  1NHY A;  1G0T A;  3WR2 A;  3SBC A;  4WYK A;  4OK0 A;  2MC8 A;  1RCL A;  3S67 A;  1WE0 A;  4GTU A;  2YX9 A;  5IOW A;  1VZZ A;  3LML A;  2AHE A;  2M72 A;  3NXJ A;  1PL1 A;  4X43 A;  3LH4 A;  1OE7 A;  1LOV A;  4BVY B;  2CVB A;  3I6A A;  1GL8 A;  1FW1 A;  1OUN A;  1CEW I;  2VLT A;  1KSI A;  3RBT A;  4K7N A;  4TKY A;  4K61 A;  4PQ1 A;  1FB6 A;  2B7K A;  4H61 A;  5E59 A;  1M1K 4;  3CPW 2;  2BMX A;  3LQ7 A;  2FNQ A;  2FHE A;  3GZR A;  1QAK A;  2M7O A;  3QAV A;  5KOW A;  3S28 A;  1QQ2 A;  2WUL A;  1EQK A;  4MAB A;  1F3A A;  1GTA A;  5JPU A;  4K1U A;  1O7N B;  3JCM L;  4DEJ A;  1GSY A;  4PQH A;  3D0Z A;  2E2U A;  3TDG A;  3KKG A;  1GUH A;  3PPU A;  1OKT A;  5D9T A;  4FIW A;  3HVN A;  2VM1 A;  5EEO A;  4HOJ A;  1UVZ A;  1SJ6 A;  3KFQ C;  1RGL A;  3CXG A;  3SWL A;  3NQY A;  1Q81 4;  4OFN A;  1C7H A;  1GMQ A;  4IJ3 A;  2JDI H;  3ROB A;  5L71 A;  2CC3 A;  3U6V A;  2DML A;  1MWS A;  2HSM A;  4HU7 A;  4AEQ A;  1VQ6 3;  2HRN A;  2KF3 A;  4WWU C;  3FG3 A;  1GY5 A;  2O85 A;  4D73 B;  3JVC A;  2V2G A;  4EIQ A;  2VD1 A;  1RSN A;  3C73 A;  2CHC A;  3OV4 A;  3QMX A;  3L9V A;  3KM6 A;  1RW1 A;  3QRD A;  3EU3 A;  3ME8 A;  5ECO B;  2O89 A;  1FGT A;  3MPH A;  5IM9 A;  1U87 A;  2LEG A;  2BU4 A;  2JU5 A;  1UN2 A;  4KDX A;  3ZMK A;  4CJN A;  1OH0 A;  4I2U A;  4O5Q A;  4Z2T A;  3M9K A;  3BNB A;  1LQM B;  3CC7 3;  3ED3 A;  1JFU A;  4XBY A;  3WYW A;  3H3H A;  3LYK A;  5CRD A;  5D9X A;  5CO3 A;  4LA1 A;  1C72 A;  2CFW A;  4GQC A;  4GHO A;  2C4B A;  1T3B A;  1CQS A;  4BL2 A;  4TW5 A;  3UVT A;  1MNL A;  1V2A A;  1MWU A;  2YCD A;  2H76 A;  1TRU A;  1YJ6 A;  3TRX A;  4I4K A;  2CAI A;  1A24 A;  4ILF A;  5CRW A;  3EC9 A;  5KP3 A;  3IPT A;  2H1G A;  1K41 A;  4ZL9 A;  4L7K A;  1LXE A;  1O7W B;  4HZ2 A;  4STD A;  1XCC A;  2M46 A;  3GRX A;  3BD2 A;  1NJI 4;  1TXX A;  3EWL A;  4E8H A;  2XR8 B;  2LUS A;  1C54 A;  1US1 A;  4JR4 A;  1Z9H A;  1THO A;  3A3T A;  4MJC A;  1TI3 A;  4MLY A;  4F9Z A;  4KT3 B;  4IQA A;  1STF I;  3CQF A;  5CRH A;  2QA2 A;  2IMJ A;  1FUW A;  3IXR A;  4L0W A;  4TXV A;  3DY5 A;  5BMU A;  1X0R A;  5LC7 A;  2DC5 A;  1A67 A;  3GUR A;  3M1G A;  2VCV A;  6GST A;  2L5O A;  5M18 A;  3F8H A;  3SOA A;  5IER A;  1F2E A;  1XG8 A;  4KA0 A;  3ZVJ A;  2ZHX B;  1WIK A;  4TXO B;  4O32 A;  1V58 A;  2IYJ A;  4K9Z A;  5J4U A;  1DVD A;  3BNC A;  5B8A A;  6GSS A;  3TKS E;  1FOV A;  1SD8 A;  2WS2 A;  4O7H A;  1SJW A;  4ECC A;  2P0M A;  1PFO A;  1VF3 A;  3QAW A;  1JZW A;  3O3T A;  2GZZ A;  3CTF A;  3GSP A;  5FHI A;  1BAO A;  1GSQ A;  4L0U A;  3MKI A;  1EKM A;  5IG3 A;  4V2L A;  5AYS C;  1IQ8 A;  1B4P A;  1TP9 A;  2BNG A;  3T8N A;  4NXI A;  1GH2 A;  1E2Y A;  1K0N A;  3F7S A;  1Y25 A;  3DYR A;  4TR4 A;  1O7U A;  1ZYN A;  5G30 A;  5DRV A;  2L5L A;  3OWY A;  3FMW A;  1AVK A;  3ZYW A;  4BWS A;  3DEX A;  2CQ9 A;  2ZCT A;  3FZA A;  3UBK A;  2GQM A;  1DMN A;  2WCI A;  1RRL A;  4PXO A;  2RUE A;  5AEU B;  3PS8 A;  1K8A 4;  1F3B A;  12GS A;  3QPM A;  1GY7 A;  2PMT A;  1LNH A;  2STD A;  4NHF A;  3EB8 A;  2PWJ A;  3HK4 A;  2CZ3 A;  1GTB A;  3W8S A;  1F9M A;  2XGL A;  2GEX A;  1OAZ A;  4O02 B;  3KSP A;  1A2P A;  2O87 A;  1TKD B;  3TUE A;  2OTJ 3;  1UCI A;  2W56 B;  1BED A;  2B1X B;  3RDE A;  3GHA A;  4MCU A;  2R0G A;  1Z1S A;  5HQP A;  1F37 A;  2BT3 A;  3OX9 A;  3GIX A;  4KDU A;  4ZM8 A;  1IK3 A;  1O8X A;  2XBQ A;  4EUY A;  1WOU A;  1GYB A;  2J8X B;  1EOG A;  3KZQ A;  3EBT A;  2MBS A;  5ID2 B;  1QXH A;  3IAS 2;  2H8L A;  3A76 A;  3EN1 B;  4RNT A;  1YY7 A;  2M80 A;  3I43 A;  3IK7 A;  3CCE 3;  3M8C A;  2R37 A;  3LOR A;  1YF1 A;  2GQK A;  2GZY A;  1EZK A;  3IDV A;  1YGE A;  4G10 A;  3QOU A;  5G2G A;  5ABR A;  3ERF A;  1UCL A;  3QFB C;  4R9L A;  4IVF A;  3U1W A;  4HM8 B;  1TU5 A;  2HZF A;  3EBY A;  1X1X A;  3C1S A;  2LQV A;  1EOH A;  1H4O A;  2KAA A;  3CCJ 3;  4MH3 A;  2ZA4 A;  1GOU A;  2LQQ A;  2MYG A;  3NZN A;  1USB A;  3G0K A;  1KBN A;  4MA9 A;  1VQ7 3;  1D6Z A;  2RII A;  4ZL7 A;  3BBY A;  5H5Q A;  1JN5 A;  1HYU A;  2HZE A;  2LV3 A;  2HRK A;  1VRS D;  3UBL A;  2Y73 A;  1AVL A;  2BMO B;  2R4I A;  2UUG C;  4EXJ A;  5KN3 A;  1VF4 A;  3D4A A;  3HOH A;  4WXT A;  2MZC A;  4MF6 A;  1G96 A;  3NBR A;  3APO A;  2VM2 A;  4ICY A;  4JF8 A;  3TJK A;  3EJV A;  1W4N A;  4BU4 A;  3TJB A;  2FD3 A;  2OKA A;  2L4C A;  1OGX A;  3ZML A;  2EC4 A;  3PCR A;  5G1K A;  2BJX A;  4PNG A;  4GST A;  4KND A;  3M0F A;  3NV0 A;  1X5D A;  3WHO A;  1UI7 A;  2H1A A;  2C11 A;  1I2G A;  3URP A;  2PNC A;  4HM1 B;  1PQN A;  2E7P A;  4GWR A;  3I55 3;  1X5E A;  2A2R A;  4EBG A;  2YAN A;  1IYI A;  1AQX A;  1W2B 2;  2YZH A;  2IFQ A;  4NV5 A;  1PYL A;  2KP2 A;  3V1W A;  2OCT A;  14GS A;  3E3E A;  3GAX A;  5IQY A;  1TW9 A;  2DJK A;  3PH9 A;  5D93 A;  4F03 A;  2P5Q A;  1FW7 A;  2DLX A;  3HA9 A;  1RGA A;  3HKR A;  1I2E A;  1AQV A;  1W01 A;  2XSO B;  3D4M A;  1A23 A;  1TRV A;  1AW9 A;  2ZNM A;  4J9A A;  2VCW A;  2K54 A;  5EY6 A;  3GH6 A;  4WR5 A;  1O7G B;  4DSS A;  2RCD A;  3UL5 A;  1PKW A;  6GSW A;  3A5E A;  3NBJ A;  4WBJ A;  1OPY A;  3GL5 A;  1BSD A;  3G7I A;  4YQM A;  4R1K A;  1O73 A;  3MWH A;  4HZB B;  2VAF A;  3HJM A;  5A0O B;  3HZ8 A;  4CDO A;  4MJA A;  4OFT A;  5KN2 A;  4EDZ A;  4XTS A;  3UNL A;  5HR2 A;  2BMQ B;  4OO5 A;  3EN8 A;  1ZOF A;  2N5F A;  3QAG A;  4BVX A;  3IE3 A;  5JWO B;  1M1X B;  4KZ1 A;  1VF1 A;  1NU3 A;  1CYU A;  4K2X A;  1B8X A;  3GFK A;  3VGN A;  4PTS A;  1A8Y A;  1GSE A;  1SJI A;  2MMZ A;  3FEU A;  3AGN A;  4LLR A;  3VI5 A;  2G0F A;  3TGZ A;  3F0I A;  3X3Z A;  1GSF A;  1BX9 A;  7GSS A;  2K6V A;  3KTL A;  3ZIT A;  1SEN A;  1I0V A;  3AHW A;  3M3M A;  3DKS A;  2GXF A;  3DMC A;  4BWQ A;  1BRS A;  1V40 A;  3TKQ A;  1N9E A;  3O6T A;  1MOL A;  1XW9 A;  5AIF A;  1O7P B;  1PMT A;  2H71 A;  2CW9 A;  4G0I A;  1RN1 A;  4GQF A;  3OW2 2;  1JKG B;  1OHS A;  4FMA A;  3KH9 A;  3WOF B;  2LS5 A;  2IUJ A;  3IMA B;  1B2X A;  2B3S A;  3LYP A;  1EEJ A;  1TOF A;  1RK4 A;  2RUF A;  4HS1 A;  1CH0 A;  2WGR A;  3ISO A;  5LD0 A;  2W6J H;  4ZB6 A;  2GQL A;  3GZB A;  3FKA A;  1IQX A;  4MF7 A;  6GSY A;  3G6E 3;  4I5Q A;  5BXQ A;  5GST A;  4YQU A;  3DGQ A;  19GS A;  2CFK A;  5BVB A;  2V32 A;  4I8B A;  3GWR A;  3OR5 A;  4MJE A;  1OC9 A;  2H1B A;  2NBS A;  1ZGN A;  3F14 A;  4HYZ A;  1VQO 3;  4KGI A;  4IBP A;  3UJM A;  2GLR A;  1SQW A;  1TRS A;  5IIZ A;  2X8G A;  1XVQ A;  3KP9 A;  2H30 A;  1IVV A;  5IG0 A;  5AIS A;  3W6G A;  1TIJ A;  4MZB A;  3E0U A;  5DAL A;  2GSQ A;  4YH2 A;  3EMP A;  3BNE A;  1I8V A;  3VI7 A;  2PVO C;  2YJH A;  3EIN A;  3MHE A;  4L8P A;  4HM3 B;  2C0G A;  2HI7 A;  4GLT A;  2PUK C;  4KAE A;  3MSO A;  4KVH A;  1RQM A;  3IC8 A;  5DAK A;  1E3R A;  2CFD A;  3OXA A;  3D4T A;  3MYD A;  1BNF A;  3QK9 A;  5BU4 A;  1OAC A;  1PGT A;  2WFC A;  4MF5 A;  3CCV 3;  1GSS A;  4USS A;  3EPT A;  2ML6 A;  4XDV A;  3WA2 X;  2WJU A;  4KF9 A;  4OMV A;  5KN0 A;  2CG1 A;  4L8E A;  4HM4 B;  3CNX A;  4KFD A;  5IF6 A;  2X49 A;  5A5K A;  1YI2 3;  4MJB A;  1OF5 B;  2ES7 A;  1SK2 A;  2FA8 A;  1R5A A;  2GBW B;  2I3Y A;  2A2S A;  1B9X C;  2O8V B;  7RNT A;  3NM2 A;  4MZW A;  1B4Q A;  5D9W A;  3K63 A;  2VCX A;  2K18 A;  1NDO B;  3GSS A;  3FLJ A;  3D6I A;  3EF8 A;  1UGH I;  4PEJ A;  4V2N A;  2QA1 A;  2XPE A;  3F6F A;  5COH A;  3NBB A;  3LEF A;  5GSP A;  1WNH A;  3GKN A;  5JCU A;  4BL7 A;  1ZMA A;  5IMC A;  2W2C A;  1M2B A;  1QAF A;  1XW5 A;  3UEM A;  3SED A;  3LYG A;  3JUP A;  4CY6 A;  1XOA A;  4WYK B;  1KQS 2;  5F8B A;  1DET A;  2IIY A;  4DSQ A;  1IU7 A;  1GOV A;  3TOT A;  1X1W A;  2AB6 A;  4TR1 A;  4BTW A;  1PN9 A;  1NNV A;  2JZT A;  2K3D A;  3SVA A;  2IMF A;  1FGO A;  4O2H A;  2RFR A;  2MMA A;  2B24 B;  3KTB A;  3ME7 A;  2H0I A;  1YKC A;  3S29 A;  1R7H A;  4J57 E;  4LZI A;  3MNG A;  4HOH A;  4MMY B;  3DVW A;  4EXR A;  1GNE A;  3J7Y b;  5BRT A;  3VWV A;  5GZZ B;  1IYY A;  3CC4 3;  1PA3 A;  1RGH A;  3CCR 3;  5A4U A;  1GTU A;  4K7I A;  2LQO A;  1MTC A;  1M3J A;  1HKX A;  3CSH A;  1BRN L;  4MK3 A;  1VQ9 3;  2FWF A;  1GD4 A;  5A4W A;  5J41 A;  2X8H A;  3JUN A;  4LGQ A;  2KCD A;  1J08 A;  4J56 E;  5ECS A;  1BRH A;  2B6M A;  3H8Q A;  2Y74 A;  1G6W A;  1NWW A;  4J5K A;  2F56 A;  2H0G A;  3TJJ A;  5JBS A;  1DYU A;  1V74 A;  2CX4 A;  1UDI I;  1TUH A;  1ERU A;  2CX3 A;  4PGT A;  1TTZ A;  5B6N A;  3SXX A;  1BU4 A;  3CD6 3;  5IEO A;  1B21 A;  4X1U A;  2C4J A;  3KE7 A;  5LNK e;  1L5G B;  4KE3 A;  2GS3 A;  4R9K A;  5AN1 A;  5IPG A;  1PSQ A;  3V92 A;  4N6M A;  1WRY A;  2PGT A;  3I0Y A;  5ECP B;  4O3V A;  5D9V A;  2ZL8 A;  5FGO A;  3IPZ A;  1UC7 A;  5DJL A;  3RDW A;  1G7O A;  3HIG A;  1N9J A;  4WF5 A;  2PZV A;  4EW5 A;  2A2P A;  4FMD A;  1KWI A;  2FY6 A;  2QKE A;  3RPP A;  3LT8 A;  3CC2 3;  3CCU 3;  3CCL 3;  1LOW A;  3E9J B;  2MMO A;  4MMM A;  1JZR A;  5DQS A;  3UL3 A;  4XDW A;  2QIY A;  2HMO B;  2XFS A;  2PN8 A;  2XPD A;  5ECK B;  2K8S A;  1JJ2 2;  1Q40 A;  5CLK A;  4K2D A;  2ZUP A;  3TKS C;  9RNT A;  1BGS A;  3UIW A;  1NM3 A;  3FF0 A;  3ZG0 A;  3LSZ A;  4GSN A;  4JZQ A;  2FNO A;  3WGD A;  4WKW A;  4HQS A;  5CXO A;  4RQX A;  1STD A;  2CK3 H;  5G5E A;  5B8B A;  3KEB A;  4CDL A;  3PYJ A;  5IMZ A;  1BSE A;  2J9H A;  3U97 A;  4ECJ A;  3PXM A;  3HVS A;  2X8C A;  3HXS A;  3QDN A;  5KN1 A;  3EUR A;  4NRE A;  5C00 A;  3DGO A;  3CME 3;  3R2Q A;  1JNQ A;  4A5P A;  4BA7 A;  5IOX A;  4O92 A;  4ECI A;  4POB A;  2GBX B;  1X5C A;  5D83 A;  1GUK A;  4K1F A;  3K7C A;  5J3R A;  2OBK A;  3DH2 A;  3A2W A;  3W8J A;  1T1V A;  1T4Z A;  2IN3 A;  1IV9 A;  1RNT A;  1TI1 A;  3ZRE A;  2NDO A;  3IV4 A;  2D1W A;  5AGY A;  1DMQ A;  6GSP A;  2C3T A;  2CWU A;  4K1V A;  1W89 A;  1RCK A;  1EP7 A;  1MGR A;  1B2U A;  2IMI A;  4H86 A;  5KOX A;  5KEJ A;  5H5R A;  1DE3 A;  1SPU A;  3QFA C;  4ZBA A;  1Z6M A;  3WOE B;  5CK6 A;  2WOF A;  4OUQ A;  3L78 A;  1BSB A;  3VLN A;  2A4V A;  1SIH A;  2C1Y A;  3F4T A;  2E2V A;  2VL2 C;  5EPF A;  1ACV A;  2G2Q A;  3ZFB A;  5HR1 A;  3ZIV A;  5IEP A;  1M0U A;  4YQV A;  4N3V A;  5J9C A;  4TVE A;  1GUM A;  2HYX A;  4FCM A;  4RI7 A;  1BNS A;  4FH8 A;  2OE0 A;  1LRA A;  2F51 A;  3LG6 A;  2LRN A;  2E0Q A;  3U5R E;  1ZGX A;  1IT7 A;  1W6Y A;  2YOI A;  1AXD A;  3FW2 A;  4PNF A;  2H01 A;  1FA3 A;  3X40 A;  3Q19 A;  3D5I A;  1BSC A;  5HFI A;  1XW6 A;  2HSH A;  3FZ5 A;  2C0F A;  4G0L A;  4RI6 A;  1WMP A;  2B5X A;  4XHM A;  3CBU A;  1MDI A;  3HD5 A;  2FWE A;  1SU9 A;  3D5G A;  2YV7 A;  1ASK A;  3LXT A;  2IMK A;  1XVW A;  4WHA A;  2R5G A;  2F99 A;  1YJW 3;  3Q18 A;  3APS A;  3LTB A;  1X1Y A;  3MG1 A;  3B7C A;  5M19 A;  1RN7 A;  2F5M A;  3KH7 A;  2W03 A;  1DE2 A;  3OWU A;  8CHO A;  5CP1 A;  2W04 A;  4N30 A;  1DMM A;  1MD4 A;  3FF2 A;  3DML A;  1GTI A;  3G71 3;  3IK9 A;  1RN4 A;  4WFO A;  2RM6 A;  2GST A;  3VPT A;  5JWR B;  2CVD A;  1TU7 A;  3VK9 A;  1RRH A;  3H51 A;  4O8S A;  2F8F A;  1ROA A;  1OKD A;  2F4Y A;  2YV9 A;  2Z7A A;  3ERW A;  2VCT A;  1BUJ A;  3HI7 A;  3VUR A;  2BO9 B;  1SKR B;  1YF0 A;  2JL4 A;  3IJE B;  1W00 A;  2H66 A;  2RGQ A;  3VF1 A;  1QVG 2;  3GV1 A;  1LNI A;  4IJI A;  1GLQ A;  2DKH A;  4NWY A;  1RGF A;  1CYV A;  1XFL A;  2C0D A;  5DBQ A;  2H6X A;  1YEX A;  1UW1 A;  3BB9 A;  3KZT A;  2HOH A;  1G6Y A;  1X9S B;  2WGQ A;  4G0K A;  3O8Y A;  1U3I A;  3EU4 A;  4ZXG A;  2VCZ A;  1G02 A;  4YKF A;  1GSD A;  3IBH A;  3TKP A;  3NV0 B;  3GKK A;  4XCS A;  5H5S A;  1NO3 A;  1S3D A;  3S9F A;  2HMK B;  1OCV A;  2B1L A;  2CWV A;  2HMM B;  3AGO A;  3Q2P A;  3X41 A;  3FR6 A;  1FO5 A;  3SOY A;  3DGN A;  2IFQ B;  1RGK A;  1BAN A;  1M9B A;  1BVI A;  3F4S A;  3BU4 A;  4FMC A;  5IW9 A;  1BNR A;  1ZCP A;  3P7X A;  2J23 A;  2AAW A;  4R4K A;  2DIY A;  1SK1 A;  3HVX A;  1Q98 A;  3A2V A;  3S5C A;  4EVM A;  1G7E A;  2GZP A;  2Z76 A;  1Z7P A;  1YGW A;  3ZVJ D;  1VQN 3;  2OJL A;  2ON7 A;  3MAK A;  1GS3 A;  2JAC A;  3Q1C A;  5HR0 A;  3X3Y A;  3MDK A;  1TRP A;  1RMS A;  4HI7 A;  5JCG A;  1VQQ A;  1BRJ A;  1THX A;  2LST A;  1BJX A;  2CWT A;  3Q3F A;  1ULI B;  2JSY A;  4DSS B;  2C8U A;  2K0M A;  1IVX A;  3TKS A;  2D42 A;  2ON5 A;  3EE2 A;  5F05 A;  2CT6 A;  4O5R A;  2CVK A;  3QR6 A;  4TXO A;  5EL8 A;  3L4N A;  4X4J A;  3L9U A;  2YJ7 A;  3F9U A;  1A90 A;  4LL4 B;  3F3R A;  1ML6 A;  2WOH A;  4AJ6 A;  4GL6 A;  3B8L A;  3FG4 A;  3QD9 A;  1FOH A;  1VF2 A;  1M2D A;  3P8W A;  4BVX B;  1ON4 A;  2P31 A;  4N0V A;  2YN1 A;  1BOX A;  3K9M C;  3LT9 A;  2YWM A;  4XM4 A;  2VOC A;  1OHP A;  5IG5 A;  3IHG A;  4PUR A;  2KUC A;  1HQO A;  5J5N A;  3C7M A;  1NSW A;  5DJM A;  2HRF A;  4IKH A;  1EP8 A;  2VLU A;  3GRD A;  1OC3 A;  3G16 A;  2NTO A;  1RGG A;  4LEH A;  1U8C B;  1CQG A;  2YZU A;  4FR9 A;  4KSO A;  3C8E A;  4KB3 A;  4KFF A;  1HNC A;  5DDL A;  2Z6B A;  3D5J A;  1PY3 A;  1EEM A;  3OWS A;  4K0N A;  1FVK A;  3UL6 A;  2WB9 A;  4WET A;  2W56 A;  2HXK A;  1BRK A;  3AY8 A;  1GRX A;  3EMX A;  2KF4 A;  4XRD A;  3DM8 A;  1BRI A;  3ECF A;  1WMJ A;  2IA7 A;  2XHF A;  5JCW A;  2CX0 A;  4FCJ A;  3GZY B;  3GKX A;  1S5A A;  3F40 A;  1WPI A;  4LMI A;  3HJO A;  5IMA A;  4NMU A;  3ALA A;  4F2I A;  3MIX A;  3GMF A;  3WMD A;  3SLU A;  4NPB A;  5IO0 A;  2GVP A;  1UGI A;  2X4A A;  3N54 B;  1N8Q A;  2CX1 A;  2I81 A;  2LKU A;  3PGB A;  1ZYP A;  2XSH B;  2VL2 A;  2W9P A;  2DSA A;  3CU3 A;  5FT3 A;  2L6C A;  3L9S A;  4G19 A;  1URM A;  2YNX A;  1ILO A;  2QGU A;  2VCQ A;  1OC9 B;  3DD3 A;  4OCE A;  1AIU A;  1RNB A;  17GS A;  3STD A;  3GL3 A;  1XWK A;  5INY A;  1F6M C;  4FYB A;  1FHE A;  4BPY A;  4Z2U A;  3L0H A;  1JBR A;  2DKI A;  2V1M A;  2KRT A;  6GSX A;  4Q53 A;  5AIH A;  4JR6 A;  3M8N A;  1GY6 A;  3DWV A;  5DAL B;  3RHB A;  1PU4 A;  1XBS A;  1Z5Y E;  1W4V A;  1E3V A;  2O3O A;  1AC1 A;  4QL9 A;  4MPF A;  4N6L A;  1AR0 A;  7GSP A;  2VL3 A;  2OE3 A;  4POM A;  1QVF 2;  1A0R P;  3TJG A;  1S3R A;  2CA8 A;  5ELG A;  2DJJ A;  1Q4J A;  3F3Q A;  4OFM A;  4XBT A;  3I69 A;  2F9S A;  4IQ1 A;  5GSS A;  3NUV A;  1XWB A;  3VPQ A;  1SII A;  1AUC A;  1TP6 A;  3ZLP A;  1HZ1 A;  4XRA A;  1SKW B;  2FGT A;  3X3X A;  4L5O A;  4QL7 A;  5G2Z A;  2YPM A;  2OBI A;  4HBR A;  3KMO A;  2AAD A;  2VD0 A;  2XEP A;  5RNT A;  3HJP A;  3LXU X;  3N5O A;  1S3C A;  4HM2 B;  3F8X A;  4G1M B; 
#chains in the Genus database with same CATH homology
 3US3 A;  3LFL A;  1OVN A;  4F0C A;  3F6D A;  2JZS A;  1GP1 A;  3FRC A;  1R26 A;  1SYR A;  2CV4 A;  4ACS A;  3TCO A;  3UOM A;  2AUV A;  5D8I A;  1K3Y A;  1EGO A;  2H75 A;  4OD7 A;  2R0C A;  4IGJ A;  3WGX A;  2C0E A;  3GX8 A;  2BTO T;  5GAP D;  3IR4 A;  5CRE A;  2GSS A;  3FKF A;  2IPA A;  4TRX A;  1LU4 A;  1SL0 B;  2B7J A;  1TJD A;  4XS4 A;  1R4W A;  3A5I A;  1V57 A;  1XWA A;  2GT6 A;  3LGC A;  4MH2 A;  2TIR A;  6GSV A;  4F82 A;  3TKR A;  1A0F A;  2XC2 A;  5ECM B;  4NHW A;  4EIP A;  1GNW A;  1FB0 A;  3KCM A;  4K5R A;  1YEP A;  5ECQ B;  4AF2 A;  1GSU A;  3LJR A;  2O7K A;  4Z7X A;  4K8M A;  3GTU B;  1J0F A;  1GUL A;  2LJA A;  4POK A;  1I9D A;  2MMN A;  3H93 A;  2LNT A;  1O6J A;  1ERT A;  4KW6 A;  5ECL B;  4MDC A;  3MSZ A;  1AQW A;  1TDI A;  1FVJ A;  3RAZ A;  8GSS A;  2X64 A;  4ULX A;  3K8N A;  4HUA A;  3H79 A;  1X9W B;  3WT1 A;  3DRN A;  2DJ1 A;  2P0G A;  3A2X A;  1Z3E A;  4EO3 A;  1N8J A;  1JLV A;  1V9W A;  4HQZ A;  3HYP A;  3CTG A;  1HNA A;  3M9J A;  3TRQ A;  1PX7 A;  1K3L A;  3BCI A;  1SK0 A;  5ENU A;  1H75 A;  4OCF A;  2PER A;  2JZR A;  4CW9 A;  2H73 A;  3C1R A;  10GS A;  3LWA A;  3ZTL A;  3GST A;  1J9B A;  1PL2 A;  1UA5 A;  1U3A A;  2R2J A;  3KXO A;  2IME A;  3PGT A;  4FYU A;  1XZO A;  2ALB A;  1GLP A;  1B9Y C;  3EYT A;  1XPV A;  4IW9 A;  1CQH A;  2GSR A;  2JAD A;  4ECB A;  1O85 A;  2RLI A;  1KNG A;  2MBT A;  4EE0 A;  4PX1 A;  4E8E A;  2I1U A;  3HY2 A;  3BCK A;  3TOU A;  3FY7 A;  3HVV A;  3H1N A;  2DBC A;  4K5S A;  1V98 A;  1XXU A;  3VWX A;  4IHU A;  20GS A;  1K3O A;  1U88 A;  4ID0 A;  4MZC A;  1ZL9 A;  1T4Y A;  3IA1 A;  1M99 A;  5G5F A;  5A4V A;  2OA7 A;  2OAC A;  3DVX A;  3C71 A;  1WJK A;  2FWG A;  5LCZ A;  5CNW A;  2IY2 A;  1EWX A;  4HU9 A;  2HE3 A;  2GDR A;  3CSI A;  1HD2 A;  4EC0 A;  1ABA A;  2VUP A;  3F8U A;  3O76 A;  2OAD A;  2P5R A;  2LTK A;  1TU8 A;  1QFN A;  5DQY A;  5CAX A;  4OWY A;  2E2M A;  4BVY A;  3PR8 A;  4OO4 A;  4CY8 A;  4LMV A;  1SL2 B;  2KLX A;  1OYJ A;  3HDC A;  3FZ4 A;  3GH9 A;  4EDY A;  3IHQ A;  2WDU A;  1K0D A;  4WBR D;  4AGS A;  1Z7R A;  1XWG A;  1YQ1 A;  4CHS A;  3D22 A;  4JBB A;  4XIH A;  3IOS A;  2D2Z A;  3VFI A;  5F07 A;  1QK8 A;  1O81 A;  3A5W A;  3GN3 A;  3WD6 A;  4YAP A;  4D73 A;  4PUA A;  4I97 A;  4FO5 A;  3F4R A;  4NV2 A;  1R5P A;  13GS A;  2VL9 A;  3QCP A;  2DJ3 A;  4J2F A;  3CSJ A;  3ZL5 A;  4ISD A;  4KSM A;  5G31 A;  4JE1 A;  1MDK A;  3EC3 A;  3LW9 A;  5IPH A;  1JHB A;  3WGE A;  2L4Q A;  5IMF A;  2V6K A;  4EL1 A;  2PU9 C;  2DJ0 A;  2HZE B;  3VWW A;  2V6O A;  1B48 A;  1LJR A;  4V2M A;  3KJY A;  4QQ7 A;  3UAR A;  3FYG A;  3G7Y A;  1EGR A;  3R3E A;  2Z9S A;  3ZZX A;  3NOF A;  2E2G A;  4Q5F A;  2WRT A;  4I2T A;  4DVC A;  1K0O A;  5ELA A;  1ZYE A;  6GSU A;  2C3N A;  2HLS A;  1TK5 B;  4GF0 A;  4NHZ A;  2L57 A;  5ECR B;  4RUV A;  4X0X A;  4HEA 2;  4JU5 A;  4RQR A;  1E6B A;  1PX6 A;  1ERW A;  5IMD A;  4ZL8 A;  1SKS B;  5F0G A;  2IWT A;  3HCZ A;  1MDJ A;  5IO2 A;  4K7O A;  5B7C A;  5D73 A;  2IL3 A;  3UAP A;  1LBK A;  2REM A;  2WZ9 A;  2C80 A;  4GXZ A;  5AIV A;  2PBJ A;  1WWJ A;  2R3X A;  4IP1 A;  4WR4 A;  2FLS A;  4IEL A;  3HHV A;  5DCG A;  3DXB A;  2F3M A;  2K8V A;  3Q74 A;  9GSS A;  1K0C A;  1M7T A;  3FHK A;  4ZBB A;  4HZ4 A;  5DVB A;  1ZYQ B;  1FG4 A;  4I6X A;  2JSZ A;  22GS A;  3G9B A;  3P90 A;  4MNN A;  3I9V 2;  3N9J A;  4TR3 A;  5J9B A;  4GSS A;  2N5B A;  1XOB A;  2DJ2 A;  3CRT A;  3EVI A;  1K0A A;  1BG5 A;  3PIN A;  5C04 A;  3GX0 A;  4ML1 A;  3F63 A;  4Z2R A;  2L6D A;  4FYC A;  1T8E B;  2H0H A;  1ZZY A;  4N10 A;  4HDE A;  2IJY A;  1A2L A;  4JED A;  5JWQ B;  4WF4 A;  2TRX A;  3KGK A;  3KD0 A;  1PRX A;  1S3A A;  4HJ2 A;  2KOK A;  2C3Q A;  1BAY A;  4MPG A;  2EIO A;  2VLV A;  3FK8 A;  4XS1 A;  2FA4 A;  4JRR A;  4ML6 A;  5ID2 A;  1NHO A;  2YWN A;  2A4H A;  2B5Y A;  3G7J A;  3KMN A;  4PQI A;  1TK0 B;  2FGX A;  3VWU A;  5ECI B;  4K0G A;  4EF0 A;  2LRC A;  3UMA A;  4Q5N A;  4IS0 A;  5HFK A;  4TR0 A;  4NAX A;  2RM5 A;  1KTE A;  1EV4 A;  3TRP A;  1BQ7 A;  2B5E A;  18GS A;  2LNS A;  1SYX A;  2NVL A;  1Z6N A;  1SJZ A;  2KHP A;  2H19 A;  4P3Y B;  5DAK B;  2LRT A;  1JLW A;  2K9F A;  4XS4 B;  2UZ8 A;  5G1L A;  3CMI A;  3ERG A;  1A2J A;  4N11 A;  4K6X A;  4LMW A;  3ZRD A;  5AIX A;  2XBI A;  1KEB A;  1TK8 B;  1HNB A;  5ECN B;  4KUN A;  11GS A;  4FQU A;  2R0P A;  3RHC A;  1A2M A;  2N5A A;  5EVO A;  1A8L A;  3KP8 A;  3H4K A;  1AAZ A;  4BL7 B;  5D96 A;  1YZX A;  3FR3 A;  1GWC A;  1OE8 A;  2AYT A;  1JZO A;  2VO4 A;  2B1K A;  4MP4 A;  2KP1 A;  2L59 A;  3CYN A;  4IP6 A;  4TR1 B;  2EIR A;  4TOP A;  3DIE A;  5HFG A;  2I9H A;  1PD2 1;  4DSR A;  2CZ2 A;  3WT2 A;  5ECH B;  2LJK A;  3ZFL A;  1O8W A;  4O5U A;  2HFD A;  1DSB A;  2YWI A;  5E4W A;  2AV4 A;  2FUG 2;  4ZBD A;  1YDK A;  1Y6E A;  5B6M A;  3BJ5 A;  2HT9 A;  3ZIJ A;  4V1A g;  1K0B A;  2QC7 A;  2QGV A;  4F0B A;  2PPT A;  3D21 A;  2FWH A;  4GRF A;  1EV9 A;  1DE1 A;  3LXZ A;  1OC8 A;  1X9M B;  2TRC P;  3UVH A;  3CRU A;  1K0M A;  4KCA A;  4ZB8 A;  2OE1 A;  2F8A A;  5CYY A;  3GNJ A;  2IMD A;  3IRA A;  1M9A A;  5IMV A;  1XWC A;  3KIJ A;  5FWG A;  3Q6O A;  4KX4 A;  1SD9 A;  16GS A;  1IYH A;  3GA4 A;  2DMM A;  2H6Z A;  2NPB A;  2H70 A;  1U6T A;  2PVQ A;  1TRW A;  5DCH A;  3RPN A;  4G2E A;  3GKM A;  1M2A A;  2EIQ A;  3IC4 A;  4ZIJ A;  2H1D A;  1I5G A;  4POL A;  4Q5R A;  2GT5 A;  5HR3 A;  4YKG A;  4V1A p;  1FAA A;  4EKZ A;  4GCI A;  1T7P B;  3P2A A;  1MEK A;  3FR9 A;  4PUF C;  3BOA A;  3IAM 2;  4KCE A;  4KH7 A;  4ZIL A;  4LL1 B;  2R6K A;  1XIY A;  2CAQ A;  5CRG A;  1VGL A;  1QMV A;  2AJQ B;  4L5L A;  1ST9 A;  2HSY A;  2HRA A;  2DIZ A;  4N0Z A;  4AJ8 A;  5GAN D;  4ZB9 A;  4HJM A;  2I4A A;  3TB2 A;  3GYK A;  3J7Y k;  1YKA A;  2HNL A;  1QUW A;  1WP0 A;  1DBY A;  2FCH A;  4KDY A;  2GTU A;  1MD3 A;  1N2A A;  4AJ7 A;  3TJF A;  1BYE A;  2GGT A;  1QGV A;  3GUS A;  2R4V A;  2H74 A;  2YWO A;  2V41 A;  2VIM A;  1PN0 A;  4WEY A;  1DUG A;  2QSI A;  4IN0 A;  2YP6 A;  4Q5Q A;  2LJR A;  4XS6 A;  1T00 A;  2H72 A;  5F06 A;  3NIV A;  3FZ9 A;  4TN8 A;  3APQ A;  4G9H A;  1SL1 B;  3GTU A;  1ERV A;  1PKZ A;  2H6Y A;  3UJ1 A;  2X99 A;  1JZD A;  1NW2 A;  3HZ4 A;  1NHY A;  1G0T A;  3SBC A;  1WE0 A;  4GTU A;  5IOW A;  2AHE A;  2M72 A;  1PL1 A;  4X43 A;  1OE7 A;  4BVY B;  1GL8 A;  2CVB A;  3I6A A;  1FW1 A;  3RBT A;  2VLT A;  4K7N A;  4TKY A;  4PQ1 A;  1FB6 A;  2B7K A;  5E59 A;  2BMX A;  3LQ7 A;  2FHE A;  3QAV A;  5KOW A;  1QQ2 A;  2WUL A;  4MAB A;  1F3A A;  1GTA A;  3JCM L;  4DEJ A;  1GSY A;  4PQH A;  3D0Z A;  3TDG A;  1GUH A;  3PPU A;  1OKT A;  5D9T A;  4FIW A;  2VM1 A;  4HOJ A;  1UVZ A;  1SJ6 A;  3CXG A;  3SWL A;  4OFN A;  4IJ3 A;  5L71 A;  3U6V A;  2DML A;  2HSM A;  4HU7 A;  2HRN A;  2O85 A;  4D73 B;  2V2G A;  4EIQ A;  2VD1 A;  3C73 A;  3QMX A;  3L9V A;  3KM6 A;  1RW1 A;  3EU3 A;  3ME8 A;  5ECO B;  2O89 A;  5IM9 A;  1U87 A;  2LEG A;  2JU5 A;  1UN2 A;  4KDX A;  3ZMK A;  4O5Q A;  4I2U A;  4Z2T A;  3M9K A;  3ED3 A;  1JFU A;  3WYW A;  3LYK A;  5CRD A;  5D9X A;  5CO3 A;  4LA1 A;  1C72 A;  4GQC A;  1T3B A;  4TW5 A;  3UVT A;  1V2A A;  2YCD A;  2H76 A;  1TRU A;  1YJ6 A;  3TRX A;  2CAI A;  1A24 A;  4ILF A;  5CRW A;  2H1G A;  4ZL9 A;  4HZ2 A;  1XCC A;  2M46 A;  3GRX A;  3BD2 A;  1TXX A;  3EWL A;  4E8H A;  2LUS A;  4JR4 A;  1Z9H A;  1THO A;  3A3T A;  4MJC A;  1TI3 A;  4MLY A;  4F9Z A;  4IQA A;  5CRH A;  2QA2 A;  3IXR A;  4L0W A;  4TXV A;  5BMU A;  1X0R A;  2DC5 A;  3GUR A;  3M1G A;  2VCV A;  6GST A;  2L5O A;  1F2E A;  4KA0 A;  3ZVJ A;  1WIK A;  4TXO B;  4O32 A;  1V58 A;  2IYJ A;  4K9Z A;  5J4U A;  5B8A A;  6GSS A;  3TKS E;  1FOV A;  1SD8 A;  2WS2 A;  4O7H A;  4ECC A;  1VF3 A;  3QAW A;  1JZW A;  3O3T A;  2GZZ A;  3CTF A;  5FHI A;  1GSQ A;  4L0U A;  4V2L A;  1B4P A;  1TP9 A;  4NXI A;  1GH2 A;  1E2Y A;  1K0N A;  3DYR A;  1Y25 A;  4TR4 A;  1O7U A;  1ZYN A;  5G30 A;  2L5L A;  3FMW A;  3ZYW A;  4BWS A;  3DEX A;  2CQ9 A;  2ZCT A;  3FZA A;  3UBK A;  2GQM A;  2WCI A;  4PXO A;  2RUE A;  1F3B A;  12GS A;  3QPM A;  2PMT A;  2PWJ A;  2CZ3 A;  1GTB A;  3W8S A;  1F9M A;  1OAZ A;  2O87 A;  1TKD B;  3TUE A;  1BED A;  3GHA A;  4MCU A;  2R0G A;  5HQP A;  1F37 A;  3GIX A;  4KDU A;  1O8X A;  2XBQ A;  4EUY A;  1WOU A;  1EOG A;  3KZQ A;  2MBS A;  5ID2 B;  1QXH A;  3IAS 2;  2H8L A;  1YY7 A;  2M80 A;  3I43 A;  3IK7 A;  2R37 A;  3LOR A;  1YF1 A;  2GQK A;  2GZY A;  1EZK A;  3IDV A;  4G10 A;  3QOU A;  5ABR A;  3ERF A;  3QFB C;  4IVF A;  2HZF A;  3C1S A;  1EOH A;  1H4O A;  4MH3 A;  2LQQ A;  2MYG A;  3NZN A;  1USB A;  1KBN A;  4MA9 A;  2RII A;  4ZL7 A;  3BBY A;  5H5Q A;  1HYU A;  2HZE A;  2LV3 A;  2HRK A;  1VRS D;  3UBL A;  4EXJ A;  5KN3 A;  1VF4 A;  4WXT A;  2MZC A;  4MF6 A;  3APO A;  2VM2 A;  4ICY A;  3TJK A;  3TJB A;  2FD3 A;  2OKA A;  2L4C A;  3ZML A;  2EC4 A;  5G1K A;  2BJX A;  4PNG A;  4GST A;  4KND A;  3M0F A;  1X5D A;  2H1A A;  1PQN A;  2E7P A;  4GWR A;  1X5E A;  2A2R A;  2YAN A;  1IYI A;  1AQX A;  2YZH A;  2IFQ A;  4NV5 A;  2KP2 A;  3V1W A;  14GS A;  3E3E A;  5IQY A;  1TW9 A;  2DJK A;  3PH9 A;  5D93 A;  4F03 A;  2P5Q A;  2DLX A;  3HA9 A;  3HKR A;  1AQV A;  3D4M A;  1A23 A;  1TRV A;  1AW9 A;  2ZNM A;  2VCW A;  5EY6 A;  3GH6 A;  4WR5 A;  4DSS A;  1PKW A;  6GSW A;  4WBJ A;  3GL5 A;  3G7I A;  4YQM A;  1O73 A;  3MWH A;  2VAF A;  3HJM A;  3HZ8 A;  4CDO A;  4MJA A;  4OFT A;  5KN2 A;  4EDZ A;  4XTS A;  5HR2 A;  4OO5 A;  1ZOF A;  2N5F A;  3QAG A;  4BVX A;  3IE3 A;  5JWO B;  1VF1 A;  4K2X A;  1B8X A;  3GFK A;  4PTS A;  1A8Y A;  1GSE A;  1SJI A;  2MMZ A;  3FEU A;  4LLR A;  3VI5 A;  2G0F A;  3TGZ A;  3F0I A;  1GSF A;  1BX9 A;  7GSS A;  2K6V A;  3KTL A;  3ZIT A;  1SEN A;  3M3M A;  3DKS A;  4BWQ A;  1V40 A;  3TKQ A;  3O6T A;  1XW9 A;  1PMT A;  2H71 A;  4G0I A;  4GQF A;  3KH9 A;  2LS5 A;  2B3S A;  3LYP A;  1EEJ A;  1TOF A;  1RK4 A;  2RUF A;  4HS1 A;  2WGR A;  3ISO A;  5LD0 A;  4ZB6 A;  2GQL A;  4MF7 A;  6GSY A;  4I5Q A;  5GST A;  4YQU A;  3DGQ A;  19GS A;  2V32 A;  4I8B A;  3OR5 A;  4MJE A;  1OC9 A;  2H1B A;  2NBS A;  1ZGN A;  4KGI A;  4IBP A;  2GLR A;  1TRS A;  5IIZ A;  2X8G A;  1XVQ A;  3KP9 A;  2H30 A;  5AIS A;  3W6G A;  4MZB A;  3E0U A;  5DAL A;  2GSQ A;  4YH2 A;  3EMP A;  3VI7 A;  2PVO C;  2YJH A;  3EIN A;  2C0G A;  2HI7 A;  4GLT A;  2PUK C;  4KAE A;  1RQM A;  5DAK A;  3IC8 A;  3D4T A;  3MYD A;  2WFC A;  1PGT A;  4MF5 A;  1GSS A;  4USS A;  3EPT A;  4OMV A;  2WJU A;  4KF9 A;  5KN0 A;  4L8E A;  2X49 A;  5A5K A;  4MJB A;  2ES7 A;  1SK2 A;  2FA8 A;  1R5A A;  2I3Y A;  2A2S A;  1B9X C;  2O8V B;  4MZW A;  1B4Q A;  5D9W A;  2VCX A;  2K18 A;  3GSS A;  3D6I A;  4V2N A;  2QA1 A;  2XPE A;  3F6F A;  5COH A;  3LEF A;  3GKN A;  4BL7 A;  5JCU A;  1ZMA A;  5IMC A;  1M2B A;  1XW5 A;  3UEM A;  4CY6 A;  1XOA A;  5F8B A;  4DSQ A;  2IIY A;  3TOT A;  2AB6 A;  4TR1 A;  1PN9 A;  2JZT A;  2IMF A;  2MMA A;  3KTB A;  3ME7 A;  2H0I A;  1YKC A;  1R7H A;  4J57 E;  3MNG A;  3DVW A;  1GNE A;  3J7Y b;  5BRT A;  3VWV A;  5GZZ B;  1PA3 A;  5A4U A;  1GTU A;  4K7I A;  2LQO A;  1MTC A;  3CSH A;  4MK3 A;  2FWF A;  5A4W A;  5J41 A;  2X8H A;  1J08 A;  4J56 E;  5ECS A;  2B6M A;  3H8Q A;  1G6W A;  2H0G A;  3TJJ A;  2CX4 A;  1ERU A;  2CX3 A;  4PGT A;  5B6N A;  1TTZ A;  4X1U A;  2C4J A;  5LNK e;  4KE3 A;  2GS3 A;  5AN1 A;  5IPG A;  1PSQ A;  1WRY A;  2PGT A;  5ECP B;  5D9V A;  3IPZ A;  1UC7 A;  5DJL A;  3RDW A;  1G7O A;  4WF5 A;  2A2P A;  2QKE A;  2FY6 A;  3RPP A;  3E9J B;  2MMO A;  4MMM A;  1JZR A;  5DQS A;  3UL3 A;  2PN8 A;  2XPD A;  5ECK B;  2K8S A;  4K2D A;  2ZUP A;  3TKS C;  3UIW A;  1NM3 A;  3LSZ A;  4GSN A;  4JZQ A;  2FNO A;  3WGD A;  4WKW A;  4HQS A;  4RQX A;  5G5E A;  5B8B A;  3KEB A;  5IMZ A;  2J9H A;  4ECJ A;  3HVS A;  2X8C A;  3HXS A;  3QDN A;  5KN1 A;  3EUR A;  5C00 A;  3R2Q A;  4A5P A;  4BA7 A;  5IOX A;  4O92 A;  4ECI A;  4POB A;  1X5C A;  1GUK A;  4K1F A;  5J3R A;  2OBK A;  3A2W A;  3W8J A;  1T1V A;  1T4Z A;  2IN3 A;  3ZRE A;  1TI1 A;  2NDO A;  3IV4 A;  5AGY A;  2C3T A;  1W89 A;  1EP7 A;  2IMI A;  4H86 A;  5KOX A;  5KEJ A;  5H5R A;  3QFA C;  4ZBA A;  1Z6M A;  3L78 A;  3VLN A;  2A4V A;  2C1Y A;  3F4T A;  2VL2 C;  5EPF A;  1ACV A;  2G2Q A;  3ZFB A;  5HR1 A;  3ZIV A;  1M0U A;  4YQV A;  5J9C A;  4TVE A;  1GUM A;  2HYX A;  4RI7 A;  4FH8 A;  2OE0 A;  2F51 A;  3LG6 A;  2LRN A;  2E0Q A;  3U5R E;  4PNF A;  2YOI A;  1AXD A;  3FW2 A;  2H01 A;  3Q19 A;  5HFI A;  1XW6 A;  2HSH A;  3FZ5 A;  2C0F A;  4G0L A;  4RI6 A;  2B5X A;  4XHM A;  3CBU A;  1MDI A;  3HD5 A;  2FWE A;  1SU9 A;  2YV7 A;  3LXT A;  2IMK A;  1XVW A;  2R5G A;  3Q18 A;  3APS A;  3KH7 A;  1DE2 A;  5CP1 A;  4N30 A;  1MD4 A;  3DML A;  1GTI A;  3IK9 A;  2RM6 A;  2GST A;  3VPT A;  5JWR B;  2CVD A;  1TU7 A;  3VK9 A;  2F8F A;  1OKD A;  2YV9 A;  3ERW A;  2VCT A;  3VUR A;  1SKR B;  1YF0 A;  2JL4 A;  2H66 A;  3GV1 A;  4IJI A;  1GLQ A;  2DKH A;  4NWY A;  1XFL A;  2C0D A;  5DBQ A;  2H6X A;  1YEX A;  1G6Y A;  1X9S B;  4G0K A;  1U3I A;  3EU4 A;  4ZXG A;  2VCZ A;  4YKF A;  1GSD A;  3IBH A;  3TKP A;  3GKK A;  4XCS A;  5H5S A;  1S3D A;  3S9F A;  2B1L A;  3FR6 A;  1FO5 A;  2IFQ B;  1M9B A;  3F4S A;  1ZCP A;  3P7X A;  2J23 A;  2AAW A;  2DIY A;  1SK1 A;  3HVX A;  1Q98 A;  3A2V A;  4EVM A;  1G7E A;  2GZP A;  1Z7P A;  3ZVJ D;  2OJL A;  2ON7 A;  3MAK A;  2JAC A;  5HR0 A;  3MDK A;  4HI7 A;  5JCG A;  1THX A;  2LST A;  1BJX A;  2JSY A;  4DSS B;  2C8U A;  3TKS A;  2ON5 A;  3EE2 A;  5F05 A;  2CT6 A;  4O5R A;  2CVK A;  3QR6 A;  4TXO A;  5EL8 A;  3L4N A;  4X4J A;  3L9U A;  2YJ7 A;  3F9U A;  4LL4 B;  3F3R A;  1ML6 A;  4AJ6 A;  3QD9 A;  1FOH A;  1VF2 A;  1M2D A;  3P8W A;  4BVX B;  1ON4 A;  2P31 A;  4N0V A;  2YN1 A;  2YWM A;  2VOC A;  3IHG A;  4PUR A;  2KUC A;  1HQO A;  5J5N A;  3C7M A;  1NSW A;  5DJM A;  2HRF A;  4IKH A;  1EP8 A;  2VLU A;  1OC3 A;  2NTO A;  1CQG A;  2YZU A;  4KSO A;  3C8E A;  4KB3 A;  1HNC A;  5DDL A;  3D5J A;  1EEM A;  4K0N A;  1FVK A;  4WET A;  2WB9 A;  2HXK A;  3AY8 A;  1GRX A;  3EMX A;  4XRD A;  2XHF A;  1WMJ A;  5JCW A;  3GKX A;  1WPI A;  3HJO A;  5IMA A;  4NMU A;  4F2I A;  3MIX A;  3GMF A;  4NPB A;  5IO0 A;  2GVP A;  2X4A A;  2I81 A;  2LKU A;  1ZYP A;  2VL2 A;  2DSA A;  5FT3 A;  2L6C A;  3L9S A;  4G19 A;  1URM A;  2YNX A;  1ILO A;  2VCQ A;  1OC9 B;  3DD3 A;  4OCE A;  1AIU A;  17GS A;  3GL3 A;  1XWK A;  5INY A;  1F6M C;  4FYB A;  1FHE A;  4BPY A;  4Z2U A;  3L0H A;  2DKI A;  2V1M A;  6GSX A;  4JR6 A;  3M8N A;  3DWV A;  5DAL B;  3RHB A;  1XBS A;  1Z5Y E;  1W4V A;  1AC1 A;  4QL9 A;  4MPF A;  2VL3 A;  2OE3 A;  4POM A;  1A0R P;  3TJG A;  2CA8 A;  5ELG A;  2DJJ A;  1Q4J A;  4OFM A;  3F3Q A;  3I69 A;  2F9S A;  4IQ1 A;  5GSS A;  1XWB A;  3VPQ A;  1AUC A;  3ZLP A;  1SKW B;  4XRA A;  4L5O A;  4QL7 A;  5G2Z A;  2YPM A;  2OBI A;  3KMO A;  2VD0 A;  3HJP A;  3N5O A;  1S3C A;  4YAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...