3LT8A

A non-biological atp binding protein with a single point mutation (d65v), that contributes to optimized folding and ligand binding, crystallized in the presence of 100 mm atp.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords ATP BINDING PROTEIN-D65V
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lt8A00
3LTCA 3LT9A 1UW1A 2P09A 3LTDA 3DGNA 3LTBA 2P05A 3LT8A 3DGMA 3DGOA 3DGLA 3LTAA 2P0XA
chains in the Genus database with same CATH superfamily
2CW9A 4Q53A 1UGIA 1I8VA 4JF8A 2KF4A 3D4AA 2OOVA 1GY6A 1IVXA 3VSYA 1RDSA 3F40A 1QAKA 5BU4A 4N6TA 4BIRA 1FA3A 2WOHA 1BUJA 2CX1A 2W03A 4LSOA 2E2UA 3LT8A 2PZVA 4HJLB 3V92A 2ML5A 8RNTA 1EUIC 2CX0A 4XDVA 4EXRA 3OWUA 3UL5A 2A15A 5M1AA 2XEPA 1NB3I 1VQP3 1GY5A 1RN4A 5RNTA 1WQLB 3OWSA 3NV0A 3B8LA 3L0RA 1RGFA 3DUKA 4KT3B 1W7CA 5GSPA 4GB5A 3CMA3 5HOHA 1NU3A 3BNDA 5CK6A 4O8SA 1WMPA 4N6MA 3LTBA 4XB5A 1Q7HA 2ML6A 1BRNL 3DGNA 3DGYA 2RSXA 4I4KA 3PYJA 3T8NA 4HZBB 1YGWA 4STDA 1JNQA 3RNTA 1BUQA 3AHSA 1FYSA 3MG3A 4NHFA 1S723 2MC8A 2AAEA 3JVCA 1JV2B 3DM8A 3EBYA 3CCU3 1SPUA 4GL6A 4KVHA 1HKXA 3WR2A 2XH9A 1RLSA 5FW5A 5I97A 3WDGB 4WHAA 2GEYA 5D83A 3CC73 1HU9A 5AIIA 1C7HA 1KWIA 4J5KA 1JJ22 1PY3A 3GZRA 4XDWA 2CFGA 1RNBA 3FG4A 1LXEA 2WGQA 3NQZA 1YJW3 4FCJA 4HM1B 1TFOA 1DMMA 1NB5I 3BNEA 4LMIA 1A90A 5G1KA 1OF5A 5AIHA 1EA2A 1WMNA 1DMNA 3CNMA 1Q7Y4 2ZHXB 3AMOB 4RBNA 3OV4A 4HM8B 3EF8A 1UCLA 1JKGB 1RGKA 1WMOA 9RNTA 1MNLA 1JB5A 3EBTA 2BT3A 2Z76A 3ECFA 3QK9A 4ORLA 3K9MC 1W4NA 3EHCA 3TDGA 1ZS7A 3M8CA 1BSBA 5IG5A 2HMKB 2XF3A 1LNHA 1MGRA 4NPBA 1DVCA 3LOYA 1AV4A 1VQ73 5AIFA 2FXTA 3CU3A 4AKYA 3SYUA 3JUMA 1CYUA 2GEXA 1D6UA 3GSPA 3X3ZA 5IW9A 1AVLA 2JDIH 2C10A 1X1YA 1IYYA 3ZG0A 3DMCA 2BU4A 2K54A 2ZA4A 5AYSC 2E2TA 4N6UA 2KF6A 3U97A 3G4S3 1VQ53 5CLKA 3EB8A 3K0ZA 8CHOA 1RCKA 3CCR3 5JBSA 2CKFB 1DVDA 1LRAA 4HM5B 1JZDA 1RGAA 3RDEA 1VQ93 1UCIA 3J7Yd 3KSPA 4HAAA 3OW22 3F9SA 1BRHA 1J2BA 5EVHA 2W6JH 5CF1A 1B2SA 1M1K4 3WMDA 7RNTA 1WTHA 1KSIA 3LTDA 1I2GA 1QAFA 1OCVA 1OPYA 3BNBA 3GZYB 3NQYA 4HM6B 3F8HA 1RHLA 1CYVA 3GRDA 1LQMB 1IT7A 1IQ8A 1A2PA 1N5PA 4FMBA 1V57A 1UUVB 2XFSA 3N9HA 1OHPA 3OWYA 1T5YA 2UGIA 2F99A 1AQZA 1C54A 2KCDA 3LZAA 5LC7A 2RFRA 4J9AA 4LEHA 5D81A 1X1WA 1RGHA 3SX1A 1A2KA 1O7NB 1N8QA 1UGHI 3S28A 1Z1SA 2MF7A 4BL2A 2KAAA 1JN5B 2F86B 3CCE3 1G02A 3CPOA 3JUNA 1YVBI 2OCTA 5IG3A 2CWUA 1CH0A 1BNEA 3CNXA 4EW5A 3CCS3 3BIRA 1TP6A 2BHMA 4L8OA 4BTXA 1FGMA 1IT8A 3LT9A 4N6V0 3I553 3AGOA 1UCKA 4RNZA 1RKYA 1G96A 1I0XA 1HZ1A 1GMQA 1TFKA 3NV0B 3GAXA 2XGNA 4HM4B 3JUOA 1TRPA 2BO9B 1N9EA 2GBXB 4WWUC 1JN5A 2W2CA 3WOFB 2W0QA 3NM2A 1LOXA 3G0KA 2CFKA 1U8CB 2XRXB 1BRGA 4BL3A 1VQ83 3MWZA 4J5GA 2BNGA 2CG0A 1UUGB 2CH9A 3EN1B 1D6YA 1GOUA 2F5WA 1MWTA 1O7PB 5EQLA 5DREA 4HM2B 3CXC2 6RNTA 3EN8A 3I0YA 1QMAA 1UI8A 4OUQA 1UI7A 1QVG2 2KXGA 1MWUA 4MMYB 1STDA 2XR8B 1I3FA 1ISKA 1RSNA 1Q42A 1OACA 1UDII 1FUTA 4XM4A 1S5AA 4G1MB 2IYJA 1YHQ3 1VQ63 1I0VA 3KIIA 1SIHA 1GOYA 2GSPA 1M904 4X2OA 2OTJ3 1FGQA 6GSPA 1BANA 3X40A 2RNTA 4EV2A 4HM3B 1GD3A 1K8A4 3BLZA 3EE1A 5HGRA 3ROBA 1RGLA 5IEOA 1O7GB 1OF5B 5CXOA 1W02A 3WA2X 1RN1A 1O7WB 2IA7A 3A5EA 3HK4A 3B4PA 3LTAA 4EV5A 1R4CA 1KC84 1BGSA 1MWRA 1Y4KA 3PS8A 4HOHA 1DMQA 3HIIA 3E99A 3SXXA 4O2HA 2JQ5A 5A0OB 1BNRA 3STDA 1B2UA 4O02B 1RGGA 3Q2PA 3DXOA 3KN4A 1K41A 3LXUX 3VGNA 3WHOA 3NBJA 3WODG 4CPKA 1R4YA 1OHOA 1FGTA 1ZGXA 4PEJA 3I563 3FLJA 1DETA 3WA3A 1FGRA 1Q40A 4XBTA 2V1LA 1RTUA 2FGTA 1W6YA 1VQO3 2GBWB 1GOVA 1BSCA 2QIYA 4R9KA 4EYCA 3MPHA 3N8BA 4RZMA 3G8ZA 1A2VA 1I2FA 4ZM8A 4FCMA 3KCHA 5AYRB 3URPA 3MG2A 3CCJ3 3ZFZA 3B4OA 1EEJA 2CK3H 1TU5A 1GMRA 1E97A 1LNIA 1SIIA 2XGLA 5IEPA 4HZ9B 3FSDA 2YFIB 1B21A 2YX9A 1OGXA 5KP3A 4WP5A 3HIGA 2P09A 4H61A 2B1XB 3SVAA 4BTWA 3HOHA 3SLUA 1ZX2A 1GY7A 1VQQA 3CC43 1Q864 3ER7A 2GU3A 1NO3A 4BTYA 2XFTA 2BMOB 2CC3A 3NM7A 1OHSA 4FMDA 3D3LA 4HM7B 4HYZA 3NX0A 4R1KA 5CF2A 2P38A 4HVNA 5AEUB 3KZTA 4H3UA 3Q3FA 5EEOA 2RCDA 1W00A 3N54B 4OK0A 3CCM3 5STDA 2Z77A 3SOYA 3H51A 2OWPA 2HOHA 1N8R4 3RGAA 2HMNB 3QRDA 3V98A 2OTL3 2RGQA 4IPBA 1M1XB 2F56A 1B27A 2UX0A 2D42A 3Q1CA 1BNFA 3G16A 3WOEB 3G6E3 4LZIA 1N5HA 1VQM3 3CCQ3 4FR9A 1IDPA 1O7HB 4EBGA 2H0IA 1OGZA 4CDLA 4N3VA 2K3DA 2F5MA 4QWTA 4R4KA 1BAOA 1IVWA 3FCSB 2F4YA 1GMPA 2Z7AA 3LYGA 3VF1A 1JRQA 1U5OA 3BNCA 5IF6A 3KSED 3UL6A 2OQEC 1RNTA 3PCSA 2R4IA 4K1VA 4MJDA 4KZ1A 1O7MB 1BSDA 3S67A 3GZXB 1W2ZA 2BMRB 3G713 2CWTA 1YGEA 2LQVA 4MMXB 4N6OB 1TUHA 3PGBA 2P05A 4X2HA 5AI1A 4IIAA 2ZL8A 3AHWA 1IQXA 3KFQC 3Q90A 1JB4A 1I3IA 2HMJB 4HM0B 3ALAA 1BNSA 4AKZA 7GSPA 1NJI4 3V99A 1TJDA 1YNVX 1B3SA 2XSOB 1EKMA 4XBYA 1K734 1VQN3 1F8NA 3U1WA 1MGWA 3BU4A 2HMLB 1X1XA 1UCJA 3OX9A 3AGNA 1AVKA 5FGOA 3FF0A 4AEQA 1TTOA 1IVVA 3D5GA 2SBLA 3BB9A 4CJNA 2K0MA 1JBRA 4L8PA 2GXFA 3UJMA 1G0TA 3X3XA 5IG0A 3NHXA 4R9LA 5AEWB 1X1UA 2WGOA 3ZG5A 1IQYA 3F7XA 1TIJA 3F8XA 5JPPA 1AY7A 1HYFA 2E2VA 5M18A 2YFLB 1GD4A 2KRTA 3KE7A 4WYKA 5IENA 1LOVA 1MOLA 1RRHA 7STDA 3DY5A 3HX8A 4K1UA 1KQS2 2KF3A 1CEWI 1B2ZA 1ROVA 3O8YA 5TGNA 2IUJA 1I70A 1Q814 2BIRA 1JZOA 1JB2A 3FZWA 3D5IA 4JRFA 2J8XB 4RNTA 1BRSA 1VQL3 3H3HA 3IMAB 4KFFA 3IPTA 1T2HA 3FH1A 5M19A 3KKGA 2IMJA 3S29A 2IY2A 1AR0A 1PYLA 2H0GA 2INXA 1SARA 1B20A 1US1A 1OUNA 1VQ43 3K5TA 4MMZB 2L4VA 1FUSA 1UUWB 1IV9A 1Q40B 1CQSA 1QALA 2WO0A 3EQQB 4GSPA 1QJGA 3FG3A 2R41A 3S5CA 3B7CA 2CFLA 4NREA 5BIRA 1I2EA 2LYXA 3EC9A 2STDA 1BNIA 3MKIA 1A67A 1RRLA 2GU1A 1IK3A 1T2IA 1BOXA 1SJWA 3X3YA 2CFWA 2OQEA 3T0UA 2Z6BA 5ELJA 1GSPA 3JUPA 1LQGC 4FMCA 1W5ZA 5IERA 1BRKA 2D1WA 1LOWA 3K7CA 3MSOA 4MEIA 2W56B 1LOYA 2H0HA 3NXJA 4N6LA 3D79A 3CPW2 2W9QA 3GZBA 1MWSA 1NDOB 4K61A 4ILFA 1T3BA 3FF2A 1FUWA 1YJN3 2P0XA 3DZLA 3JUQA 1VZZA 2Q07A 3LMLA 4GHOA 4OVMA 4WFOA 3X42A 5AIGA 5KP1A 1BNGA 1FW7A 1Q824 1IU7A 1YIJ3 1FZUA 1E3VA 2PNCA 2Y74A 1NWWA 1RMSA 2L1SA 2CFDA 1ULIB 1BSAA 1DYUA 2M7OA 2W56A 4RNYA 3CCV3 1QVF2 6STDA 1ASKA 3IJEB 1M9GA 5G2GA 2CG1A 3EJVA 3K63A 3NBRA 2XSHB 2W9PA 2KF5A 1K28A 2OOVC 2FNQA 3A76A 3FKAA 1YVSA 3LTCA 4LYLB 3CCL3 1JBTA 3DH2A 1D6ZA 2SARA 1JBSA 1BU4A 1NNVA 3FGYA 4U13A 2P0MA 1V74A 4J8TA 4I5QA 1WNHA 1IV7A 3F7SA 3CME3 1VQK3 1GS3A 1RN7A 4O3VA 3DGMA 2UUGC 1RGCA 3DGLA 5IG4A 1W01A 1Q9EA 1LVNA 1STFI 3AMOA 3NUVA 1JKGA 1RGEA 2CIUA 1B2XA 1PFPA 2AADA 4R80A 3UB1A 3OXAA 1YI23 1EQKA 1ROAA 1BIRA 1GYBA 1V58A 2B24B 3PZWA 2C11A 1EG9B 2I9WA 3S27A 1K9M4 5D82A 2YFJB 5DRVA 2RBIA 2ZDJA 1DE3A 2F98A 2QGUA 4HBRA 3PCRA 4HKVB 4FMAA 3RGRA 3X41A 3GWRA 1BNJA 1OH0A 2CWVA 2Y73A 4BU4A 1TRQA 5LC6A 3DGOA 3MYTA 5ELUA 1BVIA 4EC6A 3CD63 3F14A 3HZPA 2O9UX 4K90B 2C4BA 2CHCA 4FCZA 1RCLA 3SEDA 2HMOB 4KFDA 3HI7A 1ULJB 1W6CA 5BVBA 2QA43 3D9RA 4TX4A 5G1LA 3UNLA 1N9JA 3EX9A 2O3OA 4XBXA 3T8UA 3NBBA 4N6NB 1KD14 4LGQA 1B2MA 3FG1A 1YIT3 4KFEA 1SQWA 3SOAA 2QEX3 2BMQB 4WYKB 1W6GA 1L5GB 3MHEA 2IUKA 1FGOA 1BSEA 4IT7A 2HMMB 1W2B2 4CCVA 1YJ93 5JPUA 3PXMA 3CC23 3MG1A 4L7KA 1E3RA 1PU4A 4DKIA 1UW1A 1ZO2A 2W04A 1RJOA 5KP4A 2WOFA 1BRJA 5BXQA 1IVUA 1BRIA 3LH4A
chains in the Genus database with same CATH topology
2CW9A 4Q53A 4JF8A 2OOVA 1GY6A 1IVXA 3VSYA 3F40A 1QAKA 4N6TA 1FA3A 2WOHA 4LSOA 2W03A 2E2UA 3LT8A 2PZVA 4HJLB 3V92A 2ML5A 4XDVA 4EXRA 3OWUA 3UL5A 2A15A 2XEPA 1NB3I 1VQP3 1GY5A 1WQLB 3OWSA 3NV0A 3B8LA 3L0RA 3DUKA 1W7CA 4GB5A 3CMA3 1NU3A 3BNDA 5CK6A 4O8SA 1WMPA 4N6MA 3LTBA 4XB5A 2ML6A 3DGNA 2RSXA 4I4KA 3PYJA 3T8NA 4HZBB 4STDA 1BUQA 1JNQA 3MG3A 4NHFA 1S723 2MC8A 3JVCA 1JV2B 3DM8A 3EBYA 3CCU3 1SPUA 4GL6A 4KVHA 1HKXA 2XH9A 5FW5A 3WDGB 4WHAA 2GEYA 5D83A 3CC73 1HU9A 5AIIA 1C7HA 1KWIA 1JJ22 3GZRA 4XDWA 2CFGA 3FG4A 1LXEA 2WGQA 3NQZA 1YJW3 4FCJA 4HM1B 1TFOA 1DMMA 1NB5I 3BNEA 4LMIA 1A90A 1OF5A 5AIHA 1EA2A 1WMNA 1DMNA 3CNMA 1Q7Y4 3AMOB 4RBNA 3OV4A 4HM8B 3EF8A 1JKGB 1WMOA 1MNLA 1JB5A 3EBTA 2BT3A 2Z76A 3ECFA 3QK9A 4ORLA 3K9MC 1W4NA 3EHCA 3TDGA 3M8CA 5IG5A 2HMKB 2XF3A 1LNHA 1DVCA 3LOYA 1AV4A 1VQ73 5AIFA 2FXTA 3CU3A 4AKYA 3JUMA 1CYUA 2GEXA 1D6UA 3X3ZA 5IW9A 1AVLA 2JDIH 2C10A 3DMCA 2K54A 5AYSC 2E2TA 4N6UA 3G4S3 3U97A 1VQ53 5CLKA 3EB8A 3K0ZA 8CHOA 3CCR3 5JBSA 2CKFB 1DVDA 4HM5B 3RDEA 1VQ93 3J7Yd 3KSPA 3OW22 3F9SA 1J2BA 5EVHA 2W6JH 5CF1A 1M1K4 3WMDA 1WTHA 1KSIA 3LTDA 1QAFA 3BNBA 1OCVA 1OPYA 3NQYA 3GZYB 4HM6B 4AKZA 3F8HA 1CYVA 3GRDA 1IT7A 1IQ8A 1N5PA 4FMBA 1UUVB 2XFSA 3N9HA 1OHPA 3OWYA 1T5YA 2F99A 2KCDA 3LZAA 5LC7A 2RFRA 4J9AA 4LEHA 5D81A 3SX1A 1A2KA 1O7NB 1N8QA 3S28A 1Z1SA 2MF7A 1JN5B 2F86B 3CCE3 3CPOA 3JUNA 1YVBI 2OCTA 5IG3A 2CWUA 3CCS3 3CNXA 1TP6A 2BHMA 4L8OA 4BTXA 1FGMA 1IT8A 3LT9A 4N6V0 3I553 4RNZA 1RKYA 1G96A 1TFKA 3NV0B 3GAXA 2XGNA 4HM4B 3JUOA 2BO9B 1N9EA 2GBXB 4WWUC 1JN5A 2W2CA 3WOFB 2W0QA 3NM2A 1LOXA 3G0KA 2CFKA 1U8CB 2XRXB 1VQ83 3MWZA 2BNGA 2CG0A 2CH9A 3EN1B 1D6YA 5EQLA 1O7PB 3CXC2 5DREA 4HM2B 3EN8A 3I0YA 1QMAA 1UI8A 4OUQA 1UI7A 1QVG2 2KXGA 4MMYB 1STDA 2XR8B 1ISKA 1Q42A 1OACA 4XM4A 1S5AA 4G1MB 1YHQ3 1VQ63 3KIIA 1SIHA 1M904 4X2OA 2OTJ3 1FGQA 3X40A 4EV2A 4HM3B 1GD3A 1K8A4 3BLZA 3EE1A 5HGRA 3ROBA 5IEOA 1O7GB 1OF5B 5CXOA 1W02A 3WA2X 1O7WB 2IA7A 3HK4A 1KC84 3B4PA 3LTAA 4EV5A 1R4CA 1Y4KA 3PS8A 1DMQA 3HIIA 3E99A 3SXXA 4O2HA 2JQ5A 5A0OB 3STDA 4O02B 3Q2PA 3DXOA 3KN4A 1K41A 3LXUX 3VGNA 3WODG 3NBJA 1OHOA 1FGTA 4PEJA 3I563 3FLJA 3WA3A 1FGRA 1Q40A 4XBTA 2V1LA 2FGTA 1W6YA 1VQO3 2GBWB 2QIYA 4R9KA 4EYCA 3MPHA 3N8BA 4RZMA 3G8ZA 1A2VA 4ZM8A 4FCMA 5AYRB 3MG2A 3CCJ3 3B4OA 2CK3H 1TU5A 1E97A 2XGLA 1SIIA 5IEPA 4HZ9B 3FSDA 2YFIB 2YX9A 1OGXA 5KP3A 4WP5A 3HIGA 2P09A 4H61A 2B1XB 3SVAA 4BTWA 3SLUA 1ZX2A 1GY7A 3CC43 1Q864 3ER7A 2GU3A 1NO3A 4BTYA 2XFTA 2BMOB 2CC3A 3NM7A 1OHSA 4FMDA 3D3LA 4HM7B 4HYZA 3NX0A 4R1KA 5CF2A 2P38A 4HVNA 5AEUB 3KZTA 4H3UA 5EEOA 2RCDA 1W00A 3N54B 4OK0A 3CCM3 5STDA 2Z77A 3SOYA 3H51A 2OWPA 1N8R4 3RGAA 2HMNB 3QRDA 3V98A 2OTL3 2RGQA 4IPBA 1M1XB 2UX0A 2D42A 3Q1CA 3G16A 3WOEB 3G6E3 4LZIA 1N5HA 1VQM3 3CCQ3 4FR9A 1IDPA 1O7HB 4EBGA 4CDLA 1OGZA 4N3VA 4QWTA 4R4KA 1IVWA 3FCSB 2Z7AA 3LYGA 3VF1A 1JRQA 1U5OA 3BNCA 5IF6A 3KSED 3UL6A 2OQEC 3PCSA 2R4IA 4K1VA 4MJDA 4KZ1A 1O7MB 3S67A 3GZXB 1W2ZA 2BMRB 3G713 2CWTA 1YGEA 2LQVA 4MMXB 4N6OB 1TUHA 3PGBA 2P05A 4X2HA 5AI1A 4IIAA 2ZL8A 3KFQC 1IQXA 3CC23 3Q90A 1JB4A 2HMJB 4HM0B 3ALAA 1NJI4 3V99A 2XSOB 1EKMA 4XBYA 1K734 1VQN3 1F8NA 3U1WA 2HMLB 3OX9A 1AVKA 5FGOA 3FF0A 4AEQA 1IVVA 2SBLA 3BB9A 2K0MA 4L8PA 2GXFA 3UJMA 3X3XA 5IG0A 3NHXA 4R9LA 5AEWB 2WGOA 1IQYA 3F7XA 1TIJA 3F8XA 5JPPA 2E2VA 2YFLB 1GD4A 2KRTA 3KE7A 4WYKA 5IENA 1MOLA 1RRHA 7STDA 3DY5A 3HX8A 4K1UA 1KQS2 1CEWI 3O8YA 1ROVA 5TGNA 2IUJA 1Q814 1JB2A 3FZWA 4JRFA 1VQL3 3H3HA 3IMAB 4KFFA 3IPTA 3FH1A 3KKGA 2IMJA 3S29A 1AR0A 2INXA 1US1A 1OUNA 1VQ43 3K5TA 4MMZB 2L4VA 1UUWB 1IV9A 1Q40B 1CQSA 1QALA 2WO0A 3EQQB 1QJGA 3FG3A 3S5CA 3B7CA 2CFLA 4NREA 2LYXA 3EC9A 2STDA 3MKIA 1A67A 1RRLA 2GU1A 1IK3A 1SJWA 3X3YA 2CFWA 2OQEA 3T0UA 2Z6BA 5ELJA 3JUPA 4FMCA 1W5ZA 5IERA 2D1WA 3K7CA 3MSOA 4MEIA 2W56B 3NXJA 4N6LA 3CPW2 2W9QA 3GZBA 4K61A 1NDOB 3FF2A 1FUWA 1YJN3 2P0XA 3DZLA 3JUQA 1VZZA 2Q07A 3LMLA 4OVMA 4WFOA 3X42A 5AIGA 5KP1A 1Q824 1IU7A 1YIJ3 1E3VA 2PNCA 2Y74A 1NWWA 2CFDA 1ULIB 1DYUA 2M7OA 2W56A 4RNYA 3CCV3 1QVF2 6STDA 1ASKA 3IJEB 1M9GA 5G2GA 2CG1A 3EJVA 3K63A 3NBRA 2XSHB 2W9PA 3A76A 1K28A 2OOVC 2FNQA 3FKAA 3LTCA 5I97A 3CCL3 1D6ZA 3FGYA 4U13A 2P0MA 1V74A 4J8TA 1WNHA 1IV7A 3F7SA 3CME3 1VQK3 1GS3A 1RN7A 4O3VA 3DGMA 3DGLA 5IG4A 1STFI 1W01A 1LVNA 3AMOA 3NUVA 1JKGA 2CIUA 1PFPA 4R80A 3UB1A 3OXAA 1YI23 1EQKA 1ROAA 1GYBA 2B24B 3PZWA 1K9M4 2C11A 1EG9B 2I9WA 3S27A 5D82A 2YFJB 5DRVA 2ZDJA 2F98A 2QGUA 4HBRA 3PCRA 4HKVB 4FMAA 3RGRA 3X41A 3GWRA 1OH0A 2CWVA 2Y73A 4EC6A 5LC6A 3DGOA 3MYTA 5ELUA 3CD63 3F14A 3HZPA 2O9UX 4K90B 2CHCA 4FCZA 3SEDA 2HMOB 4KFDA 3HI7A 1ULJB 1W6CA 5BVBA 2QA43 3D9RA 4TX4A 3UNLA 1N9JA 3EX9A 2O3OA 4XBXA 3T8UA 3NBBA 4N6NB 1KD14 4LGQA 3FG1A 1YIT3 4KFEA 1SQWA 3SOAA 2QEX3 2BMQB 4WYKB 1W6GA 1L5GB 3MHEA 2IUKA 1FGOA 4IT7A 2HMMB 1W2B2 4CCVA 1YJ93 5JPUA 3PXMA 3MG1A 4L7KA 1E3RA 1PU4A 1UW1A 1ZO2A 2W04A 1RJOA 5KP4A 2WOFA 5BXQA 1IVUA 3LH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LTC A;  3LT9 A;  1UW1 A;  2P09 A;  3LTD A;  3DGN A;  3LTB A;  2P05 A;  3LT8 A;  3DGM A;  3DGO A;  3DGL A;  3LTA A;  2P0X A; 
#chains in the Genus database with same CATH topology
 2CW9 A;  4Q53 A;  1UGI A;  1I8V A;  4JF8 A;  2KF4 A;  3D4A A;  2OOV A;  1GY6 A;  1IVX A;  3VSY A;  1RDS A;  3F40 A;  1QAK A;  5BU4 A;  4N6T A;  4BIR A;  1FA3 A;  2WOH A;  1BUJ A;  2CX1 A;  2W03 A;  4LSO A;  2E2U A;  3LT8 A;  2PZV A;  4HJL B;  3V92 A;  2ML5 A;  8RNT A;  1EUI C;  2CX0 A;  4XDV A;  4EXR A;  3OWU A;  3UL5 A;  2A15 A;  5M1A A;  2XEP A;  1NB3 I;  1VQP 3;  1GY5 A;  1RN4 A;  5RNT A;  1WQL B;  3OWS A;  3NV0 A;  3B8L A;  3L0R A;  1RGF A;  3DUK A;  4KT3 B;  1W7C A;  5GSP A;  4GB5 A;  3CMA 3;  5HOH A;  1NU3 A;  3BND A;  5CK6 A;  4O8S A;  1WMP A;  4N6M A;  3LTB A;  4XB5 A;  1Q7H A;  2ML6 A;  1BRN L;  3DGN A;  3DGY A;  2RSX A;  4I4K A;  3PYJ A;  3T8N A;  4HZB B;  1YGW A;  4STD A;  1JNQ A;  3RNT A;  1BUQ A;  3AHS A;  1FYS A;  3MG3 A;  4NHF A;  1S72 3;  2MC8 A;  2AAE A;  3JVC A;  1JV2 B;  3DM8 A;  3EBY A;  3CCU 3;  1SPU A;  4GL6 A;  4KVH A;  1HKX A;  3WR2 A;  2XH9 A;  1RLS A;  5FW5 A;  5I97 A;  3WDG B;  4WHA A;  2GEY A;  5D83 A;  3CC7 3;  1HU9 A;  5AII A;  1C7H A;  1KWI A;  4J5K A;  1JJ2 2;  1PY3 A;  3GZR A;  4XDW A;  2CFG A;  1RNB A;  3FG4 A;  1LXE A;  2WGQ A;  3NQZ A;  1YJW 3;  4FCJ A;  4HM1 B;  1TFO A;  1DMM A;  1NB5 I;  3BNE A;  4LMI A;  1A90 A;  5G1K A;  1OF5 A;  5AIH A;  1EA2 A;  1WMN A;  1DMN A;  3CNM A;  1Q7Y 4;  2ZHX B;  3AMO B;  4RBN A;  3OV4 A;  4HM8 B;  3EF8 A;  1UCL A;  1JKG B;  1RGK A;  1WMO A;  9RNT A;  1MNL A;  1JB5 A;  3EBT A;  2BT3 A;  2Z76 A;  3ECF A;  3QK9 A;  4ORL A;  3K9M C;  1W4N A;  3EHC A;  3TDG A;  1ZS7 A;  3M8C A;  1BSB A;  5IG5 A;  2HMK B;  2XF3 A;  1LNH A;  1MGR A;  4NPB A;  1DVC A;  3LOY A;  1AV4 A;  1VQ7 3;  5AIF A;  2FXT A;  3CU3 A;  4AKY A;  3SYU A;  3JUM A;  1CYU A;  2GEX A;  1D6U A;  3GSP A;  3X3Z A;  5IW9 A;  1AVL A;  2JDI H;  2C10 A;  1X1Y A;  1IYY A;  3ZG0 A;  3DMC A;  2BU4 A;  2K54 A;  2ZA4 A;  5AYS C;  2E2T A;  4N6U A;  2KF6 A;  3U97 A;  3G4S 3;  1VQ5 3;  5CLK A;  3EB8 A;  3K0Z A;  8CHO A;  1RCK A;  3CCR 3;  5JBS A;  2CKF B;  1DVD A;  1LRA A;  4HM5 B;  1JZD A;  1RGA A;  3RDE A;  1VQ9 3;  1UCI A;  3J7Y d;  3KSP A;  4HAA A;  3OW2 2;  3F9S A;  1BRH A;  1J2B A;  5EVH A;  2W6J H;  5CF1 A;  1B2S A;  1M1K 4;  3WMD A;  7RNT A;  1WTH A;  1KSI A;  3LTD A;  1I2G A;  1QAF A;  1OCV A;  1OPY A;  3BNB A;  3GZY B;  3NQY A;  4HM6 B;  3F8H A;  1RHL A;  1CYV A;  3GRD A;  1LQM B;  1IT7 A;  1IQ8 A;  1A2P A;  1N5P A;  4FMB A;  1V57 A;  1UUV B;  2XFS A;  3N9H A;  1OHP A;  3OWY A;  1T5Y A;  2UGI A;  2F99 A;  1AQZ A;  1C54 A;  2KCD A;  3LZA A;  5LC7 A;  2RFR A;  4J9A A;  4LEH A;  5D81 A;  1X1W A;  1RGH A;  3SX1 A;  1A2K A;  1O7N B;  1N8Q A;  1UGH I;  3S28 A;  1Z1S A;  2MF7 A;  4BL2 A;  2KAA A;  1JN5 B;  2F86 B;  3CCE 3;  1G02 A;  3CPO A;  3JUN A;  1YVB I;  2OCT A;  5IG3 A;  2CWU A;  1CH0 A;  1BNE A;  3CNX A;  4EW5 A;  3CCS 3;  3BIR A;  1TP6 A;  2BHM A;  4L8O A;  4BTX A;  1FGM A;  1IT8 A;  3LT9 A;  4N6V 0;  3I55 3;  3AGO A;  1UCK A;  4RNZ A;  1RKY A;  1G96 A;  1I0X A;  1HZ1 A;  1GMQ A;  1TFK A;  3NV0 B;  3GAX A;  2XGN A;  4HM4 B;  3JUO A;  1TRP A;  2BO9 B;  1N9E A;  2GBX B;  4WWU C;  1JN5 A;  2W2C A;  3WOF B;  2W0Q A;  3NM2 A;  1LOX A;  3G0K A;  2CFK A;  1U8C B;  2XRX B;  1BRG A;  4BL3 A;  1VQ8 3;  3MWZ A;  4J5G A;  2BNG A;  2CG0 A;  1UUG B;  2CH9 A;  3EN1 B;  1D6Y A;  1GOU A;  2F5W A;  1MWT A;  1O7P B;  5EQL A;  5DRE A;  4HM2 B;  3CXC 2;  6RNT A;  3EN8 A;  3I0Y A;  1QMA A;  1UI8 A;  4OUQ A;  1UI7 A;  1QVG 2;  2KXG A;  1MWU A;  4MMY B;  1STD A;  2XR8 B;  1I3F A;  1ISK A;  1RSN A;  1Q42 A;  1OAC A;  1UDI I;  1FUT A;  4XM4 A;  1S5A A;  4G1M B;  2IYJ A;  1YHQ 3;  1VQ6 3;  1I0V A;  3KII A;  1SIH A;  1GOY A;  2GSP A;  1M90 4;  4X2O A;  2OTJ 3;  1FGQ A;  6GSP A;  1BAN A;  3X40 A;  2RNT A;  4EV2 A;  4HM3 B;  1GD3 A;  1K8A 4;  3BLZ A;  3EE1 A;  5HGR A;  3ROB A;  1RGL A;  5IEO A;  1O7G B;  1OF5 B;  5CXO A;  1W02 A;  3WA2 X;  1RN1 A;  1O7W B;  2IA7 A;  3A5E A;  3HK4 A;  3B4P A;  3LTA A;  4EV5 A;  1R4C A;  1KC8 4;  1BGS A;  1MWR A;  1Y4K A;  3PS8 A;  4HOH A;  1DMQ A;  3HII A;  3E99 A;  3SXX A;  4O2H A;  2JQ5 A;  5A0O B;  1BNR A;  3STD A;  1B2U A;  4O02 B;  1RGG A;  3Q2P A;  3DXO A;  3KN4 A;  1K41 A;  3LXU X;  3VGN A;  3WHO A;  3NBJ A;  3WOD G;  4CPK A;  1R4Y A;  1OHO A;  1FGT A;  1ZGX A;  4PEJ A;  3I56 3;  3FLJ A;  1DET A;  3WA3 A;  1FGR A;  1Q40 A;  4XBT A;  2V1L A;  1RTU A;  2FGT A;  1W6Y A;  1VQO 3;  2GBW B;  1GOV A;  1BSC A;  2QIY A;  4R9K A;  4EYC A;  3MPH A;  3N8B A;  4RZM A;  3G8Z A;  1A2V A;  1I2F A;  4ZM8 A;  4FCM A;  3KCH A;  5AYR B;  3URP A;  3MG2 A;  3CCJ 3;  3ZFZ A;  3B4O A;  1EEJ A;  2CK3 H;  1TU5 A;  1GMR A;  1E97 A;  1LNI A;  1SII A;  2XGL A;  5IEP A;  4HZ9 B;  3FSD A;  2YFI B;  1B21 A;  2YX9 A;  1OGX A;  5KP3 A;  4WP5 A;  3HIG A;  2P09 A;  4H61 A;  2B1X B;  3SVA A;  4BTW A;  3HOH A;  3SLU A;  1ZX2 A;  1GY7 A;  1VQQ A;  3CC4 3;  1Q86 4;  3ER7 A;  2GU3 A;  1NO3 A;  4BTY A;  2XFT A;  2BMO B;  2CC3 A;  3NM7 A;  1OHS A;  4FMD A;  3D3L A;  4HM7 B;  4HYZ A;  3NX0 A;  4R1K A;  5CF2 A;  2P38 A;  4HVN A;  5AEU B;  3KZT A;  4H3U A;  3Q3F A;  5EEO A;  2RCD A;  1W00 A;  3N54 B;  4OK0 A;  3CCM 3;  5STD A;  2Z77 A;  3SOY A;  3H51 A;  2OWP A;  2HOH A;  1N8R 4;  3RGA A;  2HMN B;  3QRD A;  3V98 A;  2OTL 3;  2RGQ A;  4IPB A;  1M1X B;  2F56 A;  1B27 A;  2UX0 A;  2D42 A;  3Q1C A;  1BNF A;  3G16 A;  3WOE B;  3G6E 3;  4LZI A;  1N5H A;  1VQM 3;  3CCQ 3;  4FR9 A;  1IDP A;  1O7H B;  4EBG A;  2H0I A;  1OGZ A;  4CDL A;  4N3V A;  2K3D A;  2F5M A;  4QWT A;  4R4K A;  1BAO A;  1IVW A;  3FCS B;  2F4Y A;  1GMP A;  2Z7A A;  3LYG A;  3VF1 A;  1JRQ A;  1U5O A;  3BNC A;  5IF6 A;  3KSE D;  3UL6 A;  2OQE C;  1RNT A;  3PCS A;  2R4I A;  4K1V A;  4MJD A;  4KZ1 A;  1O7M B;  1BSD A;  3S67 A;  3GZX B;  1W2Z A;  2BMR B;  3G71 3;  2CWT A;  1YGE A;  2LQV A;  4MMX B;  4N6O B;  1TUH A;  3PGB A;  2P05 A;  4X2H A;  5AI1 A;  4IIA A;  2ZL8 A;  3AHW A;  1IQX A;  3KFQ C;  3Q90 A;  1JB4 A;  1I3I A;  2HMJ B;  4HM0 B;  3ALA A;  1BNS A;  4AKZ A;  7GSP A;  1NJI 4;  3V99 A;  1TJD A;  1YNV X;  1B3S A;  2XSO B;  1EKM A;  4XBY A;  1K73 4;  1VQN 3;  1F8N A;  3U1W A;  1MGW A;  3BU4 A;  2HML B;  1X1X A;  1UCJ A;  3OX9 A;  3AGN A;  1AVK A;  5FGO A;  3FF0 A;  4AEQ A;  1TTO A;  1IVV A;  3D5G A;  2SBL A;  3BB9 A;  4CJN A;  2K0M A;  1JBR A;  4L8P A;  2GXF A;  3UJM A;  1G0T A;  3X3X A;  5IG0 A;  3NHX A;  4R9L A;  5AEW B;  1X1U A;  2WGO A;  3ZG5 A;  1IQY A;  3F7X A;  1TIJ A;  3F8X A;  5JPP A;  1AY7 A;  1HYF A;  2E2V A;  5M18 A;  2YFL B;  1GD4 A;  2KRT A;  3KE7 A;  4WYK A;  5IEN A;  1LOV A;  1MOL A;  1RRH A;  7STD A;  3DY5 A;  3HX8 A;  4K1U A;  1KQS 2;  2KF3 A;  1CEW I;  1B2Z A;  1ROV A;  3O8Y A;  5TGN A;  2IUJ A;  1I70 A;  1Q81 4;  2BIR A;  1JZO A;  1JB2 A;  3FZW A;  3D5I A;  4JRF A;  2J8X B;  4RNT A;  1BRS A;  1VQL 3;  3H3H A;  3IMA B;  4KFF A;  3IPT A;  1T2H A;  3FH1 A;  5M19 A;  3KKG A;  2IMJ A;  3S29 A;  2IY2 A;  1AR0 A;  1PYL A;  2H0G A;  2INX A;  1SAR A;  1B20 A;  1US1 A;  1OUN A;  1VQ4 3;  3K5T A;  4MMZ B;  2L4V A;  1FUS A;  1UUW B;  1IV9 A;  1Q40 B;  1CQS A;  1QAL A;  2WO0 A;  3EQQ B;  4GSP A;  1QJG A;  3FG3 A;  2R41 A;  3S5C A;  3B7C A;  2CFL A;  4NRE A;  5BIR A;  1I2E A;  2LYX A;  3EC9 A;  2STD A;  1BNI A;  3MKI A;  1A67 A;  1RRL A;  2GU1 A;  1IK3 A;  1T2I A;  1BOX A;  1SJW A;  3X3Y A;  2CFW A;  2OQE A;  3T0U A;  2Z6B A;  5ELJ A;  1GSP A;  3JUP A;  1LQG C;  4FMC A;  1W5Z A;  5IER A;  1BRK A;  2D1W A;  1LOW A;  3K7C A;  3MSO A;  4MEI A;  2W56 B;  1LOY A;  2H0H A;  3NXJ A;  4N6L A;  3D79 A;  3CPW 2;  2W9Q A;  3GZB A;  1MWS A;  1NDO B;  4K61 A;  4ILF A;  1T3B A;  3FF2 A;  1FUW A;  1YJN 3;  2P0X A;  3DZL A;  3JUQ A;  1VZZ A;  2Q07 A;  3LML A;  4GHO A;  4OVM A;  4WFO A;  3X42 A;  5AIG A;  5KP1 A;  1BNG A;  1FW7 A;  1Q82 4;  1IU7 A;  1YIJ 3;  1FZU A;  1E3V A;  2PNC A;  2Y74 A;  1NWW A;  1RMS A;  2L1S A;  2CFD A;  1ULI B;  1BSA A;  1DYU A;  2M7O A;  2W56 A;  4RNY A;  3CCV 3;  1QVF 2;  6STD A;  1ASK A;  3IJE B;  1M9G A;  5G2G A;  2CG1 A;  3EJV A;  3K63 A;  3NBR A;  2XSH B;  2W9P A;  2KF5 A;  1K28 A;  2OOV C;  2FNQ A;  3A76 A;  3FKA A;  1YVS A;  3LTC A;  4LYL B;  3CCL 3;  1JBT A;  3DH2 A;  1D6Z A;  2SAR A;  1JBS A;  1BU4 A;  1NNV A;  3FGY A;  4U13 A;  2P0M A;  1V74 A;  4J8T A;  4I5Q A;  1WNH A;  1IV7 A;  3F7S A;  3CME 3;  1VQK 3;  1GS3 A;  1RN7 A;  4O3V A;  3DGM A;  2UUG C;  1RGC A;  3DGL A;  5IG4 A;  1W01 A;  1Q9E A;  1LVN A;  1STF I;  3AMO A;  3NUV A;  1JKG A;  1RGE A;  2CIU A;  1B2X A;  1PFP A;  2AAD A;  4R80 A;  3UB1 A;  3OXA A;  1YI2 3;  1EQK A;  1ROA A;  1BIR A;  1GYB A;  1V58 A;  2B24 B;  3PZW A;  2C11 A;  1EG9 B;  2I9W A;  3S27 A;  1K9M 4;  5D82 A;  2YFJ B;  5DRV A;  2RBI A;  2ZDJ A;  1DE3 A;  2F98 A;  2QGU A;  4HBR A;  3PCR A;  4HKV B;  4FMA A;  3RGR A;  3X41 A;  3GWR A;  1BNJ A;  1OH0 A;  2CWV A;  2Y73 A;  4BU4 A;  1TRQ A;  5LC6 A;  3DGO A;  3MYT A;  5ELU A;  1BVI A;  4EC6 A;  3CD6 3;  3F14 A;  3HZP A;  2O9U X;  4K90 B;  2C4B A;  2CHC A;  4FCZ A;  1RCL A;  3SED A;  2HMO B;  4KFD A;  3HI7 A;  1ULJ B;  1W6C A;  5BVB A;  2QA4 3;  3D9R A;  4TX4 A;  5G1L A;  3UNL A;  1N9J A;  3EX9 A;  2O3O A;  4XBX A;  3T8U A;  3NBB A;  4N6N B;  1KD1 4;  4LGQ A;  1B2M A;  3FG1 A;  1YIT 3;  4KFE A;  1SQW A;  3SOA A;  2QEX 3;  2BMQ B;  4WYK B;  1W6G A;  1L5G B;  3MHE A;  2IUK A;  1FGO A;  1BSE A;  4IT7 A;  2HMM B;  1W2B 2;  4CCV A;  1YJ9 3;  5JPU A;  3PXM A;  3CC2 3;  3MG1 A;  4L7K A;  1E3R A;  1PU4 A;  4DKI A;  1UW1 A;  1ZO2 A;  2W04 A;  1RJO A;  5KP4 A;  2WOF A;  1BRJ A;  5BXQ A;  1IVU A;  1BRI A;  3LH4 A; 
#chains in the Genus database with same CATH homology
 2CW9 A;  4Q53 A;  4JF8 A;  2OOV A;  1GY6 A;  1IVX A;  3VSY A;  3F40 A;  1QAK A;  4N6T A;  1FA3 A;  2WOH A;  4LSO A;  2W03 A;  2E2U A;  3LT8 A;  2PZV A;  4HJL B;  3V92 A;  2ML5 A;  4XDV A;  4EXR A;  3OWU A;  3UL5 A;  2A15 A;  2XEP A;  1NB3 I;  1VQP 3;  1GY5 A;  1WQL B;  3OWS A;  3NV0 A;  3B8L A;  3L0R A;  3DUK A;  1W7C A;  4GB5 A;  3CMA 3;  1NU3 A;  3BND A;  5CK6 A;  4O8S A;  1WMP A;  4N6M A;  3LTB A;  4XB5 A;  2ML6 A;  3DGN A;  2RSX A;  4I4K A;  3PYJ A;  3T8N A;  4HZB B;  4STD A;  1BUQ A;  1JNQ A;  3MG3 A;  4NHF A;  1S72 3;  2MC8 A;  3JVC A;  1JV2 B;  3DM8 A;  3EBY A;  3CCU 3;  1SPU A;  4GL6 A;  4KVH A;  1HKX A;  2XH9 A;  5FW5 A;  3WDG B;  4WHA A;  2GEY A;  5D83 A;  3CC7 3;  1HU9 A;  5AII A;  1C7H A;  1KWI A;  1JJ2 2;  3GZR A;  4XDW A;  2CFG A;  3FG4 A;  1LXE A;  2WGQ A;  3NQZ A;  1YJW 3;  4FCJ A;  4HM1 B;  1TFO A;  1DMM A;  1NB5 I;  3BNE A;  4LMI A;  1A90 A;  1OF5 A;  5AIH A;  1EA2 A;  1WMN A;  1DMN A;  3CNM A;  1Q7Y 4;  3AMO B;  4RBN A;  3OV4 A;  4HM8 B;  3EF8 A;  1JKG B;  1WMO A;  1MNL A;  1JB5 A;  3EBT A;  2BT3 A;  2Z76 A;  3ECF A;  3QK9 A;  4ORL A;  3K9M C;  1W4N A;  3EHC A;  3TDG A;  3M8C A;  5IG5 A;  2HMK B;  2XF3 A;  1LNH A;  1DVC A;  3LOY A;  1AV4 A;  1VQ7 3;  5AIF A;  2FXT A;  3CU3 A;  4AKY A;  3JUM A;  1CYU A;  2GEX A;  1D6U A;  3X3Z A;  5IW9 A;  1AVL A;  2JDI H;  2C10 A;  3DMC A;  2K54 A;  5AYS C;  2E2T A;  4N6U A;  3G4S 3;  3U97 A;  1VQ5 3;  5CLK A;  3EB8 A;  3K0Z A;  8CHO A;  3CCR 3;  5JBS A;  2CKF B;  1DVD A;  4HM5 B;  3RDE A;  1VQ9 3;  3J7Y d;  3KSP A;  3OW2 2;  3F9S A;  1J2B A;  5EVH A;  2W6J H;  5CF1 A;  1M1K 4;  3WMD A;  1WTH A;  1KSI A;  3LTD A;  1QAF A;  3BNB A;  1OCV A;  1OPY A;  3NQY A;  3GZY B;  4HM6 B;  4AKZ A;  3F8H A;  1CYV A;  3GRD A;  1IT7 A;  1IQ8 A;  1N5P A;  4FMB A;  1UUV B;  2XFS A;  3N9H A;  1OHP A;  3OWY A;  1T5Y A;  2F99 A;  2KCD A;  3LZA A;  5LC7 A;  2RFR A;  4J9A A;  4LEH A;  5D81 A;  3SX1 A;  1A2K A;  1O7N B;  1N8Q A;  3S28 A;  1Z1S A;  2MF7 A;  1JN5 B;  2F86 B;  3CCE 3;  3CPO A;  3JUN A;  1YVB I;  2OCT A;  5IG3 A;  2CWU A;  3CCS 3;  3CNX A;  1TP6 A;  2BHM A;  4L8O A;  4BTX A;  1FGM A;  1IT8 A;  3LT9 A;  4N6V 0;  3I55 3;  4RNZ A;  1RKY A;  1G96 A;  1TFK A;  3NV0 B;  3GAX A;  2XGN A;  4HM4 B;  3JUO A;  2BO9 B;  1N9E A;  2GBX B;  4WWU C;  1JN5 A;  2W2C A;  3WOF B;  2W0Q A;  3NM2 A;  1LOX A;  3G0K A;  2CFK A;  1U8C B;  2XRX B;  1VQ8 3;  3MWZ A;  2BNG A;  2CG0 A;  2CH9 A;  3EN1 B;  1D6Y A;  5EQL A;  1O7P B;  3CXC 2;  5DRE A;  4HM2 B;  3EN8 A;  3I0Y A;  1QMA A;  1UI8 A;  4OUQ A;  1UI7 A;  1QVG 2;  2KXG A;  4MMY B;  1STD A;  2XR8 B;  1ISK A;  1Q42 A;  1OAC A;  4XM4 A;  1S5A A;  4G1M B;  1YHQ 3;  1VQ6 3;  3KII A;  1SIH A;  1M90 4;  4X2O A;  2OTJ 3;  1FGQ A;  3X40 A;  4EV2 A;  4HM3 B;  1GD3 A;  1K8A 4;  3BLZ A;  3EE1 A;  5HGR A;  3ROB A;  5IEO A;  1O7G B;  1OF5 B;  5CXO A;  1W02 A;  3WA2 X;  1O7W B;  2IA7 A;  3HK4 A;  1KC8 4;  3B4P A;  3LTA A;  4EV5 A;  1R4C A;  1Y4K A;  3PS8 A;  1DMQ A;  3HII A;  3E99 A;  3SXX A;  4O2H A;  2JQ5 A;  5A0O B;  3STD A;  4O02 B;  3Q2P A;  3DXO A;  3KN4 A;  1K41 A;  3LXU X;  3VGN A;  3WOD G;  3NBJ A;  1OHO A;  1FGT A;  4PEJ A;  3I56 3;  3FLJ A;  3WA3 A;  1FGR A;  1Q40 A;  4XBT A;  2V1L A;  2FGT A;  1W6Y A;  1VQO 3;  2GBW B;  2QIY A;  4R9K A;  4EYC A;  3MPH A;  3N8B A;  4RZM A;  3G8Z A;  1A2V A;  4ZM8 A;  4FCM A;  5AYR B;  3MG2 A;  3CCJ 3;  3B4O A;  2CK3 H;  1TU5 A;  1E97 A;  2XGL A;  1SII A;  5IEP A;  4HZ9 B;  3FSD A;  2YFI B;  2YX9 A;  1OGX A;  5KP3 A;  4WP5 A;  3HIG A;  2P09 A;  4H61 A;  2B1X B;  3SVA A;  4BTW A;  3SLU A;  1ZX2 A;  1GY7 A;  3CC4 3;  1Q86 4;  3ER7 A;  2GU3 A;  1NO3 A;  4BTY A;  2XFT A;  2BMO B;  2CC3 A;  3NM7 A;  1OHS A;  4FMD A;  3D3L A;  4HM7 B;  4HYZ A;  3NX0 A;  4R1K A;  5CF2 A;  2P38 A;  4HVN A;  5AEU B;  3KZT A;  4H3U A;  5EEO A;  2RCD A;  1W00 A;  3N54 B;  4OK0 A;  3CCM 3;  5STD A;  2Z77 A;  3SOY A;  3H51 A;  2OWP A;  1N8R 4;  3RGA A;  2HMN B;  3QRD A;  3V98 A;  2OTL 3;  2RGQ A;  4IPB A;  1M1X B;  2UX0 A;  2D42 A;  3Q1C A;  3G16 A;  3WOE B;  3G6E 3;  4LZI A;  1N5H A;  1VQM 3;  3CCQ 3;  4FR9 A;  1IDP A;  1O7H B;  4EBG A;  4CDL A;  1OGZ A;  4N3V A;  4QWT A;  4R4K A;  1IVW A;  3FCS B;  2Z7A A;  3LYG A;  3VF1 A;  1JRQ A;  1U5O A;  3BNC A;  5IF6 A;  3KSE D;  3UL6 A;  2OQE C;  3PCS A;  2R4I A;  4K1V A;  4MJD A;  4KZ1 A;  1O7M B;  3S67 A;  3GZX B;  1W2Z A;  2BMR B;  3G71 3;  2CWT A;  1YGE A;  2LQV A;  4MMX B;  4N6O B;  1TUH A;  3PGB A;  2P05 A;  4X2H A;  5AI1 A;  4IIA A;  2ZL8 A;  3KFQ C;  1IQX A;  3CC2 3;  3Q90 A;  1JB4 A;  2HMJ B;  4HM0 B;  3ALA A;  1NJI 4;  3V99 A;  2XSO B;  1EKM A;  4XBY A;  1K73 4;  1VQN 3;  1F8N A;  3U1W A;  2HML B;  3OX9 A;  1AVK A;  5FGO A;  3FF0 A;  4AEQ A;  1IVV A;  2SBL A;  3BB9 A;  2K0M A;  4L8P A;  2GXF A;  3UJM A;  3X3X A;  5IG0 A;  3NHX A;  4R9L A;  5AEW B;  2WGO A;  1IQY A;  3F7X A;  1TIJ A;  3F8X A;  5JPP A;  2E2V A;  2YFL B;  1GD4 A;  2KRT A;  3KE7 A;  4WYK A;  5IEN A;  1MOL A;  1RRH A;  7STD A;  3DY5 A;  3HX8 A;  4K1U A;  1KQS 2;  1CEW I;  3O8Y A;  1ROV A;  5TGN A;  2IUJ A;  1Q81 4;  1JB2 A;  3FZW A;  4JRF A;  1VQL 3;  3H3H A;  3IMA B;  4KFF A;  3IPT A;  3FH1 A;  3KKG A;  2IMJ A;  3S29 A;  1AR0 A;  2INX A;  1US1 A;  1OUN A;  1VQ4 3;  3K5T A;  4MMZ B;  2L4V A;  1UUW B;  1IV9 A;  1Q40 B;  1CQS A;  1QAL A;  2WO0 A;  3EQQ B;  1QJG A;  3FG3 A;  3S5C A;  3B7C A;  2CFL A;  4NRE A;  2LYX A;  3EC9 A;  2STD A;  3MKI A;  1A67 A;  1RRL A;  2GU1 A;  1IK3 A;  1SJW A;  3X3Y A;  2CFW A;  2OQE A;  3T0U A;  2Z6B A;  5ELJ A;  3JUP A;  4FMC A;  1W5Z A;  5IER A;  2D1W A;  3K7C A;  3MSO A;  4MEI A;  2W56 B;  3NXJ A;  4N6L A;  3CPW 2;  2W9Q A;  3GZB A;  4K61 A;  1NDO B;  3FF2 A;  1FUW A;  1YJN 3;  2P0X A;  3DZL A;  3JUQ A;  1VZZ A;  2Q07 A;  3LML A;  4OVM A;  4WFO A;  3X42 A;  5AIG A;  5KP1 A;  1Q82 4;  1IU7 A;  1YIJ 3;  1E3V A;  2PNC A;  2Y74 A;  1NWW A;  2CFD A;  1ULI B;  1DYU A;  2M7O A;  2W56 A;  4RNY A;  3CCV 3;  1QVF 2;  6STD A;  1ASK A;  3IJE B;  1M9G A;  5G2G A;  2CG1 A;  3EJV A;  3K63 A;  3NBR A;  2XSH B;  2W9P A;  3A76 A;  1K28 A;  2OOV C;  2FNQ A;  3FKA A;  3LTC A;  5I97 A;  3CCL 3;  1D6Z A;  3FGY A;  4U13 A;  2P0M A;  1V74 A;  4J8T A;  1WNH A;  1IV7 A;  3F7S A;  3CME 3;  1VQK 3;  1GS3 A;  1RN7 A;  4O3V A;  3DGM A;  3DGL A;  5IG4 A;  1STF I;  1W01 A;  1LVN A;  3AMO A;  3NUV A;  1JKG A;  2CIU A;  1PFP A;  4R80 A;  3UB1 A;  3OXA A;  1YI2 3;  1EQK A;  1ROA A;  1GYB A;  2B24 B;  3PZW A;  1K9M 4;  2C11 A;  1EG9 B;  2I9W A;  3S27 A;  5D82 A;  2YFJ B;  5DRV A;  2ZDJ A;  2F98 A;  2QGU A;  4HBR A;  3PCR A;  4HKV B;  4FMA A;  3RGR A;  3X41 A;  3GWR A;  1OH0 A;  2CWV A;  2Y73 A;  4EC6 A;  5LC6 A;  3DGO A;  3MYT A;  5ELU A;  3CD6 3;  3F14 A;  3HZP A;  2O9U X;  4K90 B;  2CHC A;  4FCZ A;  3SED A;  2HMO B;  4KFD A;  3HI7 A;  1ULJ B;  1W6C A;  5BVB A;  2QA4 3;  3D9R A;  4TX4 A;  3UNL A;  1N9J A;  3EX9 A;  2O3O A;  4XBX A;  3T8U A;  3NBB A;  4N6N B;  1KD1 4;  4LGQ A;  3FG1 A;  1YIT 3;  4KFE A;  1SQW A;  3SOA A;  2QEX 3;  2BMQ B;  4WYK B;  1W6G A;  1L5G B;  3MHE A;  2IUK A;  1FGO A;  4IT7 A;  2HMM B;  1W2B 2;  4CCV A;  1YJ9 3;  5JPU A;  3PXM A;  3MG1 A;  4L7K A;  1E3R A;  1PU4 A;  1UW1 A;  1ZO2 A;  2W04 A;  1RJO A;  5KP4 A;  2WOF A;  5BXQ A;  1IVU A;  3LH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...