1RGAA

Crystal structure of rnase t1 with 3'-gmp and guanosine: a product complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of RNase T1 with 3'-guanylic acid and guanosine.
pubmed rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgaA00
1G02A 2RBIA 1B2UA 1DETA 3A5EA 2F5WA 1BNEA 1LOWA 2AADA 2KF4A 1R4YA 1I3FA 1RGGA 1TRQA 7GSPA 1PYLA 1RGHA 3WHOA 1LNIA 1AY7A 1LOVA 1BVIA 1Q9EA 1X1XA 4RNTA 4BIRA 1BAOA 1FZUA 1B2ZA 1GMPA 1BNGA 1RGLA 1I70A 1YNVX 1RNBA 1BU4A 3AGOA 1BRIA 4J5KA 1I0XA 1B20A 9RNTA 1GMRA 1GSPA 3DH2A 2SARA 4BU4A 3DGYA 1LRAA 1B21A 1HYFA 1UCIA 4J5GA 1IYYA 1BSCA 1GMQA 1GOUA 1BNRA 1BSEA 1BGSA 2C4BA 3AGNA 1HZ1A 1BNSA 1B2XA 1BOXA 1ZGXA 3BIRA 1DE3A 3GSPA 1BRNL 1BANA 2KAAA 2KF5A 1BSAA 1RGEA 1AQZA 1BSBA 1UCJA 1T2HA 5HOHA 1B27A 1MGRA 1X1WA 1RDSA 3BU4A 1I0VA 1JBSA 3D5GA 1RSNA 6RNTA 1GOYA 1TRPA 4HOHA 1T2IA 1BNJA 5RNTA 1FW7A 2RNTA 4GSPA 1RCKA 1BRSA 1RHLA 1UCLA 2HOHA 7RNTA 4GHOA 1B2MA 1MGWA 1X1YA 1RGFA 1RCLA 1BSDA 1C54A 1SARA 3HOHA 1YVSA 3SYUA 1FUTA 1JBRA 1UCKA 2F4YA 4HAAA 6GSPA 1I2GA 1RN4A 1A2PA 1BRKA 2ZA4A 1TTOA 3KCHA 2F5MA 5BU4A 1RGCA 3AHSA 1FYSA 1I2EA 2BIRA 3D4AA 1GOVA 3D5IA 3Q3FA 8RNTA 1I2FA 1BUJA 3WR2A 1BRGA 1YGWA 2AAEA 1B2SA 3URPA 1RNTA 5BIRA 1BNFA 1RN1A 1LOYA 1FUSA 5GSPA 1I3IA 2KF6A 1PY3A 1BRHA 3RNTA 1RGKA 3AHWA 1BNIA 1RMSA 1JBTA 2GSPA 2KF3A 1B3SA 1RLSA 1RGAA 1I8VA 1RTUA 1X1UA 1BRJA 2F56A 2BU4A 1CH0A 1BIRA
chains in the Genus database with same CATH superfamily
1VQQA 4OUQA 3A5EA 2F5WA 4CPKA 3K0ZA 1LOWA 3ER7A 3FH1A 3HK4A 1L5GB 2STDA 3KN4A 4U13A 6STDA 1Q9EA 1SQWA 2Q07A 4K1VA 5IG5A 1IT8A 1EA2A 3DMCA 3ZG0A 1M1XB 3NX0A 1Q40A 4FCJA 4K90B 3OX9A 1I70A 2IYJA 3AGOA 3H51A 4XM4A 5BXQA 4LMIA 1UUVB 1YGEA 1AR0A 3FF0A 4BU4A 1A2VA 1O7NB 2Z6BA 2WOFA 3NQYA 4R9KA 3CCM3 1T5YA 3LYGA 4CDLA 7STDA 1IYYA 1BSCA 3CPOA 3LT8A 4FMCA 3AGNA 1HZ1A 5D83A 3IMAB 3CPW2 1GD3A 1B2XA 1WTHA 2P38A 4Q53A 4N6UA 3S29A 2O3OA 3PGBA 2E2TA 2C11A 1IVWA 3PYJA 2KAAA 2A15A 3JUPA 4RBNA 5G1KA 3U97A 3EJVA 1OH0A 1RGEA 1QAKA 1UCJA 1UDII 1FGQA 4N6NB 3X3XA 1MGRA 5EVHA 5FGOA 3BNEA 1ROAA 5M19A 4BTYA 2HMNB 1UI7A 1RDSA 1MOLA 2ZDJA 3BU4A 3NM2A 3D5GA 3X40A 1W00A 2H0IA 3I563 3WOEB 3NBJA 1NJI4 3D79A 4EV2A 3EN1B 1BNJA 3NM7A 4LSOA 3K7CA 5D82A 3BB9A 4N6LA 3S5CA 5JPUA 2FGTA 2GU1A 3B7CA 4HM8B 1MGWA 4IIAA 3ZG5A 1IQYA 1X1YA 3LTDA 1FGTA 3EE1A 3LTBA 3JVCA 4RNZA 3F9SA 1QJGA 1US1A 3T8UA 4EW5A 3JUMA 3LZAA 1V74A 1IT7A 3HOHA 1LVNA 1UCKA 2F4YA 4NREA 2KXGA 2IUJA 3G6E3 2RCDA 2ZA4A 2CG1A 3V92A 3EX9A 4ORLA 1TTOA 5IG0A 4RZMA 1W6CA 3H3HA 5BU4A 2W6JH 1LQGC 5IG3A 1GD4A 2BIRA 2W03A 2W0QA 2HMMB 3D5IA 1MWUA 5IG4A 2D1WA 1BUJA 3WR2A 2BHMA 2KCDA 3CCQ3 1D6YA 1WMNA 1YGWA 4J8TA 1YI23 1A2KA 3KIIA 2B1XB 1FGMA 2Y74A 3CNMA 1W4NA 3CCU3 2HMLB 1FUSA 1N5HA 5AYRB 1GY5A 3OW22 1JJ22 4CCVA 1I3IA 2W04A 4BL2A 1N8QA 1N9JA 3LOYA 3RNTA 2R41A 3CU3A 1ZX2A 2IY2A 1VQ53 3GZXB 3GZRA 3CMA3 3A76A 1KD14 3S28A 1Q42A 4HKVB 2BNGA 2QA43 1OACA 1JNQA 1BRJA 3LMLA 3NHXA 2ZL8A 4AEQA 1IQXA 1N9EA 4WYKA 2INXA 1VQK3 1OGZA 1CH0A 1G02A 2RBIA 1B2UA 1ISKA 2GXFA 3LT9A 2AADA 2KF4A 3MWZA 4OVMA 3LTAA 4STDA 1PYLA 2XH9A 2XR8B 1BVIA 4RNTA 3EHCA 3X3YA 3QRDA 1CQSA 1BAOA 1FZUA 4R4KA 4WP5A 1GMPA 1IVUA 1BNGA 1BU4A 3CCJ3 3PCSA 1E97A 1ULIB 4KT3B 5JBSA 4O3VA 1TFKA 1YJW3 3J7Yd 3DH2A 4N6MA 2FNQA 1ROVA 1D6ZA 3WOFB 1JZOA 1K41A 1ULJB 1RN7A 2C10A 3FG4A 4RNYA 1LRAA 3FLJA 4MEIA 1IVXA 3ZFZA 5G2GA 3Q2PA 2RSXA 3SEDA 2C4BA 3DGMA 4FCMA 1BNSA 2JQ5A 3N8BA 3SVAA 2XRXB 1DVDA 1W7CA 4R9LA 1DE3A 3GSPA 4OK0A 5AEWB 1BANA 3KKGA 3PCRA 1EUIC 2SBLA 3OV4A 3UNLA 1BSBA 1QAFA 1YIT3 4GB5A 4MMYB 5AEUB 1YVBI 3UJMA 2CFGA 3SOYA 2CIUA 4XB5A 2CFWA 2CX0A 1I0VA 2BMOB 2QEX3 1RSNA 3PXMA 5CXOA 2XSOB 5IENA 4X2HA 4BTWA 1FA3A 1QALA 3G8ZA 3IPTA 4ILFA 4HOHA 4KFDA 1DYUA 2ML6A 3KSPA 4HM4B 5AIHA 2PZVA 5AIGA 1YIJ3 2GBXB 1RHLA 2HOHA 2I9WA 1WMOA 2QIYA 5A0OB 2Z77A 1JKGA 3B4PA 3CME3 1V57A 4G1MB 4DKIA 2ZHXB 3WA3A 1BSDA 1IQ8A 1K734 2Z76A 3SYUA 3I0YA 1HU9A 1JBRA 1Y4KA 6GSPA 3D9RA 1I2GA 3O8YA 5LC7A 3QK9A 3SLUA 1BRKA 1EG9B 2OTJ3 4WHAA 2XGNA 5CLKA 1VQ63 2YFIB 3KCHA 2F5MA 3MYTA 3X3ZA 1YHQ3 4WYKB 4L8PA 1DVCA 3STDA 2ML5A 3JUQA 1I2EA 2V1LA 1DMQA 1TUHA 3NV0B 3Q3FA 8RNTA 1S5AA 4HYZA 3EBYA 1D6UA 1JKGB 1C7HA 2K54A 3DGNA 3CNXA 3RGAA 1FUWA 1NDOB 1QVF2 4KFEA 1TU5A 3HIIA 1AV4A 1W6GA 2CK3H 1RNTA 1V58A 3K63A 3EQQB 1RN1A 1K9M4 1PY3A 3RDEA 2HMJB 1BRHA 3JUNA 8CHOA 1VQN3 2UGIA 4HM6B 1JBTA 1K8A4 1OHOA 2KF3A 2Y73A 4LEHA 1B3SA 1AVLA 1FGRA 1RLSA 3CCE3 4FMDA 2CKFB 2L4VA 1T3BA 3RGRA 1JN5B 4EC6A 1PU4A 2Z7AA 4CJNA 3N54B 2WOHA 1CYUA 4IPBA 2B24B 3DGLA 2RFRA 5CF1A 1VQP3 1M1K4 1M904 1F8NA 3BNCA 1DETA 1Q7HA 3NBRA 2GBWB 1R4YA 4FCZA 2XGLA 4HM7B 1Q7Y4 7GSPA 1WMPA 1LNIA 3SOAA 1AY7A 1LOVA 1UI8A 1LNHA 1X1XA 3FG3A 5KP4A 4O2HA 1U8CB 3HZPA 1B2ZA 1WQLB 2R4IA 4HM1B 4IT7A 3EBTA 3ROBA 1RGLA 1YNVX 1RNBA 1IU7A 3CCS3 4J5KA 4K61A 2CHCA 1I0XA 3FGYA 3ECFA 1GMRA 1GSPA 3CC23 1UGHI 3NXJA 3Q90A 1EKMA 1S723 1DMMA 3DGYA 3DUKA 3B8LA 2OQEC 5IF6A 2LQVA 1UCIA 2H0HA 2CWTA 2KRTA 3TDGA 1A67A 1M9GA 1GOUA 2F86B 1BNRA 3KSED 3N9HA 2CG0A 1N5PA 3FCSB 3NQZA 2HMOB 5D81A 1LQMB 2XFSA 3AMOA 1O7WB 2MF7A 1GY6A 2P0XA 1AVKA 1NU3A 2PNCA 4HBRA 3CCR3 1K28A 1BRNL 4N6V0 1O7HB 2O9UX 1BSAA 1AQZA 1T2HA 2BMRB 4O8SA 2XSHB 3WA2X 1RRHA 1TIJA 1VQO3 4H3UA 1O7MB 4LYLB 4BTXA 1VQ43 1SPUA 2J8XB 4HJLB 4X2OA 3MSOA 6RNTA 3OWYA 1UUGB 1NO3A 2WGQA 4HM0B 5STDA 1W02A 1IVVA 2UX0A 3CC73 2OQEA 3F7SA 5RNTA 1FW7A 3F7XA 3UL6A 2F98A 1FGOA 1RJOA 1Q824 2F99A 3CC43 3X41A 3G16A 2XEPA 4KVHA 1RCLA 3V99A 4L7KA 2XF3A 3GWRA 2CFDA 1YVSA 4I4KA 2LYXA 4XDVA 3GZBA 1RN4A 1ZO2A 1STDA 2GEYA 2IMJA 1LOXA 3VF1A 1QVG2 3VGNA 1RGCA 3FG1A 3MG3A 1FYSA 1VQM3 5AI1A 1JB2A 1JB4A 3D4AA 2UUGC 4FR9A 1KQS2 3FZWA 3T0UA 2CH9A 1W2B2 4N6TA 3F14A 1VQL3 3D3LA 4EXRA 1LXEA 2P0MA 2CX1A 2WO0A 2HMKB 3HX8A 3MG2A 1OHSA 2OOVA 5BIRA 5ELUA 5IW9A 4AKYA 1LOYA 4XDWA 5GSPA 4AKZA 4HM5B 5DREA 3T8NA 1NNVA 3LTCA 4WWUC 1VQ83 1CEWI 1RGKA 4N6OB 3AHWA 5I97A 1GYBA 2OOVC 1RMSA 2GSPA 1W01A 1Z1SA 2K3DA 3DXOA 3F8HA 5AIFA 1YJ93 3GAXA 4R80A 5M1AA 3FKAA 4NPBA 1I8VA 5AIIA 3F8XA 3UL5A 3K9MC 2RGQA 3HI7A 3PZWA 5AYSC 1X1UA 3PS8A 3EB8A 3EN8A 3DZLA 4HM2B 1W6YA 1BIRA 1W5ZA 1MWSA 2W2CA 3OWSA 1DMNA 2BMQB 5BVBA 5IERA 1BNEA 2IUKA 2XFTA 4BL3A 3B4OA 1I3FA 1RGGA 3GZYB 1TRQA 3LXUX 1UGIA 3VSYA 1RGHA 3WHOA 3ALAA 4EYCA 1N8R4 2BT3A 1EQKA 2P05A 4FMBA 3OWUA 1G0TA 1SIIA 3Q1CA 4BIRA 1OGXA 4XBXA 3HIGA 1VQ73 4JRFA 1GS3A 1ASKA 1BRIA 3MPHA 1B20A 2GEXA 4LZIA 1VZZA 5ELJA 1MNLA 5G1LA 3WDGB 9RNTA 1Q864 2P09A 1W2ZA 2SARA 3KZTA 2OWPA 1RKYA 3S67A 1B21A 1HYFA 1MWTA 2OCTA 4J5GA 3DM8A 5JPPA 1GMQA 4MMXB 1JN5A 1BSEA 1BGSA 4L8OA 4GL6A 2MC8A 1BOXA 2W56A 1ZGXA 3BIRA 1OF5B 1O7PB 4N3VA 4MMZB 1NB5I 2KF5A 2GU3A 4EV5A 5KP3A 2W9QA 3G0KA 3CXC2 5HOHA 1JV2B 3MHEA 3BNDA 1B27A 4I5QA 3JUOA 4KFFA 3FF2A 1E3VA 1UUWB 4J9AA 1O7GB 1JZDA 2E2VA 3GRDA 1X1WA 4WFOA 2OTL3 3X42A 1OHPA 3M8CA 1JBSA 3DY5A 4PEJA 5HGRA 1G96A 1GOYA 1TRPA 3CD63 3SXXA 3S27A 1Q40B 3G4S3 1T2IA 3FSDA 1QMAA 5DRVA 2RNTA 4GSPA 3NBBA 3BLZA 1RCKA 1BRSA 3CCL3 5LC6A 1UCLA 7RNTA 1STFI 2CC3A 4GHOA 5IEPA 1HKXA 1B2MA 3EC9A 1OF5A 1RGFA 3G713 4ZM8A 1RRLA 1IV9A 1C54A 1NB3I 1SARA 2M7OA 1E3RA 2K0MA 1FUTA 2QGUA 4HM3B 5TGNA 4FMAA 4EBGA 1EEJA 4HAAA 4R1KA 3F40A 2FXTA 1A2PA 3AMOB 3KFQC 3CCV3 1BUQA 5EQLA 1IDPA 5IEOA 2W9PA 4HZBB 2WGOA 3L0RA 4MJDA 1GY7A 2CWVA 3LH4A 4KZ1A 1IV7A 2YFLB 3AHSA 1TP6A 1R4CA 2BO9B 1JRQA 5CF2A 3MG1A 1GOVA 3U1WA 2CFLA 1OUNA 1KC84 4H61A 4XBTA 3BNBA 1I2FA 1MWRA 1PFPA 1BRGA 2E2UA 2D42A 2IA7A 4HVNA 3WODG 3MKIA 3OXAA 1VQ93 3SX1A 3NUVA 3K5TA 2AAEA 1B2SA 3IJEB 1WNHA 4HZ9B 3URPA 3WMDA 3I553 2CW9A 5KP1A 1SJWA 1BNFA 4O02B 1NWWA 4QWTA 5FW5A 1OCVA 1KSIA 2JDIH 4TX4A 2CFKA 5M18A 1TJDA 5CK6A 2KF6A 3V98A 1IK3A 1JB5A 3EF8A 2H0GA 4NHFA 3DGOA 3UB1A 1Q814 1U5OA 1BNIA 1CYVA 1J2BA 2CWUA 4JF8A 3E99A 4K1UA 1RGAA 2YX9A 4LGQA 1KWIA 1RTUA 1SIHA 3KE7A 1ZS7A 3NV0A 1UW1A 1A90A 1YJN3 4XBYA 2F56A 2W56B 1OPYA 2BU4A 2L1SA 2YFJB 5EEOA 1TFOA
chains in the Genus database with same CATH topology
1G02A 2RBIA 1B2UA 1DETA 3A5EA 2F5WA 1BNEA 1LOWA 2AADA 2KF4A 1R4YA 1I3FA 1RGGA 1TRQA 7GSPA 1PYLA 1RGHA 3WHOA 1LNIA 1AY7A 1LOVA 1BVIA 1Q9EA 1X1XA 4RNTA 4BIRA 1BAOA 1FZUA 1B2ZA 1GMPA 1BNGA 1RGLA 1I70A 1YNVX 1RNBA 1BU4A 3AGOA 1BRIA 4J5KA 1I0XA 1B20A 9RNTA 1GMRA 1GSPA 3DH2A 2SARA 4BU4A 3DGYA 1LRAA 1B21A 1HYFA 1UCIA 4J5GA 1IYYA 1BSCA 1GMQA 1GOUA 1BNRA 1BSEA 1BGSA 2C4BA 3AGNA 1HZ1A 1BNSA 1B2XA 1BOXA 1ZGXA 3BIRA 1DE3A 3GSPA 1BRNL 1BANA 2KAAA 2KF5A 1BSAA 1RGEA 1AQZA 1BSBA 1UCJA 1T2HA 5HOHA 1B27A 1MGRA 1X1WA 1RDSA 3BU4A 1I0VA 1JBSA 3D5GA 1RSNA 6RNTA 1GOYA 1TRPA 4HOHA 1T2IA 1BNJA 5RNTA 1FW7A 2RNTA 4GSPA 1RCKA 1BRSA 1RHLA 1UCLA 2HOHA 7RNTA 4GHOA 1B2MA 1MGWA 1X1YA 1RGFA 1RCLA 1BSDA 1C54A 1SARA 3HOHA 1YVSA 3SYUA 1FUTA 1JBRA 1UCKA 2F4YA 4HAAA 6GSPA 1I2GA 1RN4A 1A2PA 1BRKA 2ZA4A 1TTOA 3KCHA 2F5MA 5BU4A 1RGCA 3AHSA 1FYSA 1I2EA 2BIRA 3D4AA 1GOVA 3D5IA 3Q3FA 8RNTA 1I2FA 1BUJA 3WR2A 1BRGA 1YGWA 2AAEA 1B2SA 3URPA 1RNTA 5BIRA 1BNFA 1RN1A 1LOYA 1FUSA 5GSPA 1I3IA 2KF6A 1PY3A 1BRHA 3RNTA 1RGKA 3AHWA 1BNIA 1RMSA 1JBTA 2GSPA 2KF3A 1B3SA 1RLSA 1RGAA 1I8VA 1RTUA 1X1UA 1BRJA 2F56A 2BU4A 1CH0A 1BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G02 A;  2RBI A;  1B2U A;  1DET A;  3A5E A;  2F5W A;  1BNE A;  1LOW A;  2AAD A;  2KF4 A;  1R4Y A;  1I3F A;  1RGG A;  1TRQ A;  7GSP A;  1PYL A;  1RGH A;  3WHO A;  1LNI A;  1AY7 A;  1LOV A;  1BVI A;  1Q9E A;  1X1X A;  4RNT A;  4BIR A;  1BAO A;  1FZU A;  1B2Z A;  1GMP A;  1BNG A;  1RGL A;  1I70 A;  1YNV X;  1RNB A;  1BU4 A;  3AGO A;  1BRI A;  4J5K A;  1I0X A;  1B20 A;  9RNT A;  1GMR A;  1GSP A;  3DH2 A;  2SAR A;  4BU4 A;  3DGY A;  1LRA A;  1B21 A;  1HYF A;  1UCI A;  4J5G A;  1IYY A;  1BSC A;  1GMQ A;  1GOU A;  1BNR A;  1BSE A;  1BGS A;  2C4B A;  3AGN A;  1HZ1 A;  1BNS A;  1B2X A;  1BOX A;  1ZGX A;  3BIR A;  1DE3 A;  3GSP A;  1BRN L;  1BAN A;  2KAA A;  2KF5 A;  1BSA A;  1RGE A;  1AQZ A;  1BSB A;  1UCJ A;  1T2H A;  5HOH A;  1B27 A;  1MGR A;  1X1W A;  1RDS A;  3BU4 A;  1I0V A;  1JBS A;  3D5G A;  1RSN A;  6RNT A;  1GOY A;  1TRP A;  4HOH A;  1T2I A;  1BNJ A;  5RNT A;  1FW7 A;  2RNT A;  4GSP A;  1RCK A;  1BRS A;  1RHL A;  1UCL A;  2HOH A;  7RNT A;  4GHO A;  1B2M A;  1MGW A;  1X1Y A;  1RGF A;  1RCL A;  1BSD A;  1C54 A;  1SAR A;  3HOH A;  1YVS A;  3SYU A;  1FUT A;  1JBR A;  1UCK A;  2F4Y A;  4HAA A;  6GSP A;  1I2G A;  1RN4 A;  1A2P A;  1BRK A;  2ZA4 A;  1TTO A;  3KCH A;  2F5M A;  5BU4 A;  1RGC A;  3AHS A;  1FYS A;  1I2E A;  2BIR A;  3D4A A;  1GOV A;  3D5I A;  3Q3F A;  8RNT A;  1I2F A;  1BUJ A;  3WR2 A;  1BRG A;  1YGW A;  2AAE A;  1B2S A;  3URP A;  1RNT A;  5BIR A;  1BNF A;  1RN1 A;  1LOY A;  1FUS A;  5GSP A;  1I3I A;  2KF6 A;  1PY3 A;  1BRH A;  3RNT A;  1RGK A;  3AHW A;  1BNI A;  1RMS A;  1JBT A;  2GSP A;  2KF3 A;  1B3S A;  1RLS A;  1RGA A;  1I8V A;  1RTU A;  1X1U A;  1BRJ A;  2F56 A;  2BU4 A;  1CH0 A;  1BIR A; 
#chains in the Genus database with same CATH topology
 1VQQ A;  4OUQ A;  3A5E A;  2F5W A;  4CPK A;  3K0Z A;  1LOW A;  3ER7 A;  3FH1 A;  3HK4 A;  1L5G B;  2STD A;  3KN4 A;  4U13 A;  6STD A;  1Q9E A;  1SQW A;  2Q07 A;  4K1V A;  5IG5 A;  1IT8 A;  1EA2 A;  3DMC A;  3ZG0 A;  1M1X B;  3NX0 A;  1Q40 A;  4FCJ A;  4K90 B;  3OX9 A;  1I70 A;  2IYJ A;  3AGO A;  3H51 A;  4XM4 A;  5BXQ A;  4LMI A;  1UUV B;  1YGE A;  1AR0 A;  3FF0 A;  4BU4 A;  1A2V A;  1O7N B;  2Z6B A;  2WOF A;  3NQY A;  4R9K A;  3CCM 3;  1T5Y A;  3LYG A;  4CDL A;  7STD A;  1IYY A;  1BSC A;  3CPO A;  3LT8 A;  4FMC A;  3AGN A;  1HZ1 A;  5D83 A;  3IMA B;  3CPW 2;  1GD3 A;  1B2X A;  1WTH A;  2P38 A;  4Q53 A;  4N6U A;  3S29 A;  2O3O A;  3PGB A;  2E2T A;  2C11 A;  1IVW A;  3PYJ A;  2KAA A;  2A15 A;  3JUP A;  4RBN A;  5G1K A;  3U97 A;  3EJV A;  1OH0 A;  1RGE A;  1QAK A;  1UCJ A;  1UDI I;  1FGQ A;  4N6N B;  3X3X A;  1MGR A;  5EVH A;  5FGO A;  3BNE A;  1ROA A;  5M19 A;  4BTY A;  2HMN B;  1UI7 A;  1RDS A;  1MOL A;  2ZDJ A;  3BU4 A;  3NM2 A;  3D5G A;  3X40 A;  1W00 A;  2H0I A;  3I56 3;  3WOE B;  3NBJ A;  1NJI 4;  3D79 A;  4EV2 A;  3EN1 B;  1BNJ A;  3NM7 A;  4LSO A;  3K7C A;  5D82 A;  3BB9 A;  4N6L A;  3S5C A;  5JPU A;  2FGT A;  2GU1 A;  3B7C A;  4HM8 B;  1MGW A;  4IIA A;  3ZG5 A;  1IQY A;  1X1Y A;  3LTD A;  1FGT A;  3EE1 A;  3LTB A;  3JVC A;  4RNZ A;  3F9S A;  1QJG A;  1US1 A;  3T8U A;  4EW5 A;  3JUM A;  3LZA A;  1V74 A;  1IT7 A;  3HOH A;  1LVN A;  1UCK A;  2F4Y A;  4NRE A;  2KXG A;  2IUJ A;  3G6E 3;  2RCD A;  2ZA4 A;  2CG1 A;  3V92 A;  3EX9 A;  4ORL A;  1TTO A;  5IG0 A;  4RZM A;  1W6C A;  3H3H A;  5BU4 A;  2W6J H;  1LQG C;  5IG3 A;  1GD4 A;  2BIR A;  2W03 A;  2W0Q A;  2HMM B;  3D5I A;  1MWU A;  5IG4 A;  2D1W A;  1BUJ A;  3WR2 A;  2BHM A;  2KCD A;  3CCQ 3;  1D6Y A;  1WMN A;  1YGW A;  4J8T A;  1YI2 3;  1A2K A;  3KII A;  2B1X B;  1FGM A;  2Y74 A;  3CNM A;  1W4N A;  3CCU 3;  2HML B;  1FUS A;  1N5H A;  5AYR B;  1GY5 A;  3OW2 2;  1JJ2 2;  4CCV A;  1I3I A;  2W04 A;  4BL2 A;  1N8Q A;  1N9J A;  3LOY A;  3RNT A;  2R41 A;  3CU3 A;  1ZX2 A;  2IY2 A;  1VQ5 3;  3GZX B;  3GZR A;  3CMA 3;  3A76 A;  1KD1 4;  3S28 A;  1Q42 A;  4HKV B;  2BNG A;  2QA4 3;  1OAC A;  1JNQ A;  1BRJ A;  3LML A;  3NHX A;  2ZL8 A;  4AEQ A;  1IQX A;  1N9E A;  4WYK A;  2INX A;  1VQK 3;  1OGZ A;  1CH0 A;  1G02 A;  2RBI A;  1B2U A;  1ISK A;  2GXF A;  3LT9 A;  2AAD A;  2KF4 A;  3MWZ A;  4OVM A;  3LTA A;  4STD A;  1PYL A;  2XH9 A;  2XR8 B;  1BVI A;  4RNT A;  3EHC A;  3X3Y A;  3QRD A;  1CQS A;  1BAO A;  1FZU A;  4R4K A;  4WP5 A;  1GMP A;  1IVU A;  1BNG A;  1BU4 A;  3CCJ 3;  3PCS A;  1E97 A;  1ULI B;  4KT3 B;  5JBS A;  4O3V A;  1TFK A;  1YJW 3;  3J7Y d;  3DH2 A;  4N6M A;  2FNQ A;  1ROV A;  1D6Z A;  3WOF B;  1JZO A;  1K41 A;  1ULJ B;  1RN7 A;  2C10 A;  3FG4 A;  4RNY A;  1LRA A;  3FLJ A;  4MEI A;  1IVX A;  3ZFZ A;  5G2G A;  3Q2P A;  2RSX A;  3SED A;  2C4B A;  3DGM A;  4FCM A;  1BNS A;  2JQ5 A;  3N8B A;  3SVA A;  2XRX B;  1DVD A;  1W7C A;  4R9L A;  1DE3 A;  3GSP A;  4OK0 A;  5AEW B;  1BAN A;  3KKG A;  3PCR A;  1EUI C;  2SBL A;  3OV4 A;  3UNL A;  1BSB A;  1QAF A;  1YIT 3;  4GB5 A;  4MMY B;  5AEU B;  1YVB I;  3UJM A;  2CFG A;  3SOY A;  2CIU A;  4XB5 A;  2CFW A;  2CX0 A;  1I0V A;  2BMO B;  2QEX 3;  1RSN A;  3PXM A;  5CXO A;  2XSO B;  5IEN A;  4X2H A;  4BTW A;  1FA3 A;  1QAL A;  3G8Z A;  3IPT A;  4ILF A;  4HOH A;  4KFD A;  1DYU A;  2ML6 A;  3KSP A;  4HM4 B;  5AIH A;  2PZV A;  5AIG A;  1YIJ 3;  2GBX B;  1RHL A;  2HOH A;  2I9W A;  1WMO A;  2QIY A;  5A0O B;  2Z77 A;  1JKG A;  3B4P A;  3CME 3;  1V57 A;  4G1M B;  4DKI A;  2ZHX B;  3WA3 A;  1BSD A;  1IQ8 A;  1K73 4;  2Z76 A;  3SYU A;  3I0Y A;  1HU9 A;  1JBR A;  1Y4K A;  6GSP A;  3D9R A;  1I2G A;  3O8Y A;  5LC7 A;  3QK9 A;  3SLU A;  1BRK A;  1EG9 B;  2OTJ 3;  4WHA A;  2XGN A;  5CLK A;  1VQ6 3;  2YFI B;  3KCH A;  2F5M A;  3MYT A;  3X3Z A;  1YHQ 3;  4WYK B;  4L8P A;  1DVC A;  3STD A;  2ML5 A;  3JUQ A;  1I2E A;  2V1L A;  1DMQ A;  1TUH A;  3NV0 B;  3Q3F A;  8RNT A;  1S5A A;  4HYZ A;  3EBY A;  1D6U A;  1JKG B;  1C7H A;  2K54 A;  3DGN A;  3CNX A;  3RGA A;  1FUW A;  1NDO B;  1QVF 2;  4KFE A;  1TU5 A;  3HII A;  1AV4 A;  1W6G A;  2CK3 H;  1RNT A;  1V58 A;  3K63 A;  3EQQ B;  1RN1 A;  1K9M 4;  1PY3 A;  3RDE A;  2HMJ B;  1BRH A;  3JUN A;  8CHO A;  1VQN 3;  2UGI A;  4HM6 B;  1JBT A;  1K8A 4;  1OHO A;  2KF3 A;  2Y73 A;  4LEH A;  1B3S A;  1AVL A;  1FGR A;  1RLS A;  3CCE 3;  4FMD A;  2CKF B;  2L4V A;  1T3B A;  3RGR A;  1JN5 B;  4EC6 A;  1PU4 A;  2Z7A A;  4CJN A;  3N54 B;  2WOH A;  1CYU A;  4IPB A;  2B24 B;  3DGL A;  2RFR A;  5CF1 A;  1VQP 3;  1M1K 4;  1M90 4;  1F8N A;  3BNC A;  1DET A;  1Q7H A;  3NBR A;  2GBW B;  1R4Y A;  4FCZ A;  2XGL A;  4HM7 B;  1Q7Y 4;  7GSP A;  1WMP A;  1LNI A;  3SOA A;  1AY7 A;  1LOV A;  1UI8 A;  1LNH A;  1X1X A;  3FG3 A;  5KP4 A;  4O2H A;  1U8C B;  3HZP A;  1B2Z A;  1WQL B;  2R4I A;  4HM1 B;  4IT7 A;  3EBT A;  3ROB A;  1RGL A;  1YNV X;  1RNB A;  1IU7 A;  3CCS 3;  4J5K A;  4K61 A;  2CHC A;  1I0X A;  3FGY A;  3ECF A;  1GMR A;  1GSP A;  3CC2 3;  1UGH I;  3NXJ A;  3Q90 A;  1EKM A;  1S72 3;  1DMM A;  3DGY A;  3DUK A;  3B8L A;  2OQE C;  5IF6 A;  2LQV A;  1UCI A;  2H0H A;  2CWT A;  2KRT A;  3TDG A;  1A67 A;  1M9G A;  1GOU A;  2F86 B;  1BNR A;  3KSE D;  3N9H A;  2CG0 A;  1N5P A;  3FCS B;  3NQZ A;  2HMO B;  5D81 A;  1LQM B;  2XFS A;  3AMO A;  1O7W B;  2MF7 A;  1GY6 A;  2P0X A;  1AVK A;  1NU3 A;  2PNC A;  4HBR A;  3CCR 3;  1K28 A;  1BRN L;  4N6V 0;  1O7H B;  2O9U X;  1BSA A;  1AQZ A;  1T2H A;  2BMR B;  4O8S A;  2XSH B;  3WA2 X;  1RRH A;  1TIJ A;  1VQO 3;  4H3U A;  1O7M B;  4LYL B;  4BTX A;  1VQ4 3;  1SPU A;  2J8X B;  4HJL B;  4X2O A;  3MSO A;  6RNT A;  3OWY A;  1UUG B;  1NO3 A;  2WGQ A;  4HM0 B;  5STD A;  1W02 A;  1IVV A;  2UX0 A;  3CC7 3;  2OQE A;  3F7S A;  5RNT A;  1FW7 A;  3F7X A;  3UL6 A;  2F98 A;  1FGO A;  1RJO A;  1Q82 4;  2F99 A;  3CC4 3;  3X41 A;  3G16 A;  2XEP A;  4KVH A;  1RCL A;  3V99 A;  4L7K A;  2XF3 A;  3GWR A;  2CFD A;  1YVS A;  4I4K A;  2LYX A;  4XDV A;  3GZB A;  1RN4 A;  1ZO2 A;  1STD A;  2GEY A;  2IMJ A;  1LOX A;  3VF1 A;  1QVG 2;  3VGN A;  1RGC A;  3FG1 A;  3MG3 A;  1FYS A;  1VQM 3;  5AI1 A;  1JB2 A;  1JB4 A;  3D4A A;  2UUG C;  4FR9 A;  1KQS 2;  3FZW A;  3T0U A;  2CH9 A;  1W2B 2;  4N6T A;  3F14 A;  1VQL 3;  3D3L A;  4EXR A;  1LXE A;  2P0M A;  2CX1 A;  2WO0 A;  2HMK B;  3HX8 A;  3MG2 A;  1OHS A;  2OOV A;  5BIR A;  5ELU A;  5IW9 A;  4AKY A;  1LOY A;  4XDW A;  5GSP A;  4AKZ A;  4HM5 B;  5DRE A;  3T8N A;  1NNV A;  3LTC A;  4WWU C;  1VQ8 3;  1CEW I;  1RGK A;  4N6O B;  3AHW A;  5I97 A;  1GYB A;  2OOV C;  1RMS A;  2GSP A;  1W01 A;  1Z1S A;  2K3D A;  3DXO A;  3F8H A;  5AIF A;  1YJ9 3;  3GAX A;  4R80 A;  5M1A A;  3FKA A;  4NPB A;  1I8V A;  5AII A;  3F8X A;  3UL5 A;  3K9M C;  2RGQ A;  3HI7 A;  3PZW A;  5AYS C;  1X1U A;  3PS8 A;  3EB8 A;  3EN8 A;  3DZL A;  4HM2 B;  1W6Y A;  1BIR A;  1W5Z A;  1MWS A;  2W2C A;  3OWS A;  1DMN A;  2BMQ B;  5BVB A;  5IER A;  1BNE A;  2IUK A;  2XFT A;  4BL3 A;  3B4O A;  1I3F A;  1RGG A;  3GZY B;  1TRQ A;  3LXU X;  1UGI A;  3VSY A;  1RGH A;  3WHO A;  3ALA A;  4EYC A;  1N8R 4;  2BT3 A;  1EQK A;  2P05 A;  4FMB A;  3OWU A;  1G0T A;  1SII A;  3Q1C A;  4BIR A;  1OGX A;  4XBX A;  3HIG A;  1VQ7 3;  4JRF A;  1GS3 A;  1ASK A;  1BRI A;  3MPH A;  1B20 A;  2GEX A;  4LZI A;  1VZZ A;  5ELJ A;  1MNL A;  5G1L A;  3WDG B;  9RNT A;  1Q86 4;  2P09 A;  1W2Z A;  2SAR A;  3KZT A;  2OWP A;  1RKY A;  3S67 A;  1B21 A;  1HYF A;  1MWT A;  2OCT A;  4J5G A;  3DM8 A;  5JPP A;  1GMQ A;  4MMX B;  1JN5 A;  1BSE A;  1BGS A;  4L8O A;  4GL6 A;  2MC8 A;  1BOX A;  2W56 A;  1ZGX A;  3BIR A;  1OF5 B;  1O7P B;  4N3V A;  4MMZ B;  1NB5 I;  2KF5 A;  2GU3 A;  4EV5 A;  5KP3 A;  2W9Q A;  3G0K A;  3CXC 2;  5HOH A;  1JV2 B;  3MHE A;  3BND A;  1B27 A;  4I5Q A;  3JUO A;  4KFF A;  3FF2 A;  1E3V A;  1UUW B;  4J9A A;  1O7G B;  1JZD A;  2E2V A;  3GRD A;  1X1W A;  4WFO A;  2OTL 3;  3X42 A;  1OHP A;  3M8C A;  1JBS A;  3DY5 A;  4PEJ A;  5HGR A;  1G96 A;  1GOY A;  1TRP A;  3CD6 3;  3SXX A;  3S27 A;  1Q40 B;  3G4S 3;  1T2I A;  3FSD A;  1QMA A;  5DRV A;  2RNT A;  4GSP A;  3NBB A;  3BLZ A;  1RCK A;  1BRS A;  3CCL 3;  5LC6 A;  1UCL A;  7RNT A;  1STF I;  2CC3 A;  4GHO A;  5IEP A;  1HKX A;  1B2M A;  3EC9 A;  1OF5 A;  1RGF A;  3G71 3;  4ZM8 A;  1RRL A;  1IV9 A;  1C54 A;  1NB3 I;  1SAR A;  2M7O A;  1E3R A;  2K0M A;  1FUT A;  2QGU A;  4HM3 B;  5TGN A;  4FMA A;  4EBG A;  1EEJ A;  4HAA A;  4R1K A;  3F40 A;  2FXT A;  1A2P A;  3AMO B;  3KFQ C;  3CCV 3;  1BUQ A;  5EQL A;  1IDP A;  5IEO A;  2W9P A;  4HZB B;  2WGO A;  3L0R A;  4MJD A;  1GY7 A;  2CWV A;  3LH4 A;  4KZ1 A;  1IV7 A;  2YFL B;  3AHS A;  1TP6 A;  1R4C A;  2BO9 B;  1JRQ A;  5CF2 A;  3MG1 A;  1GOV A;  3U1W A;  2CFL A;  1OUN A;  1KC8 4;  4H61 A;  4XBT A;  3BNB A;  1I2F A;  1MWR A;  1PFP A;  1BRG A;  2E2U A;  2D42 A;  2IA7 A;  4HVN A;  3WOD G;  3MKI A;  3OXA A;  1VQ9 3;  3SX1 A;  3NUV A;  3K5T A;  2AAE A;  1B2S A;  3IJE B;  1WNH A;  4HZ9 B;  3URP A;  3WMD A;  3I55 3;  2CW9 A;  5KP1 A;  1SJW A;  1BNF A;  4O02 B;  1NWW A;  4QWT A;  5FW5 A;  1OCV A;  1KSI A;  2JDI H;  4TX4 A;  2CFK A;  5M18 A;  1TJD A;  5CK6 A;  2KF6 A;  3V98 A;  1IK3 A;  1JB5 A;  3EF8 A;  2H0G A;  4NHF A;  3DGO A;  3UB1 A;  1Q81 4;  1U5O A;  1BNI A;  1CYV A;  1J2B A;  2CWU A;  4JF8 A;  3E99 A;  4K1U A;  1RGA A;  2YX9 A;  4LGQ A;  1KWI A;  1RTU A;  1SIH A;  3KE7 A;  1ZS7 A;  3NV0 A;  1UW1 A;  1A90 A;  1YJN 3;  4XBY A;  2F56 A;  2W56 B;  1OPY A;  2BU4 A;  2L1S A;  2YFJ B;  5EEO A;  1TFO A; 
#chains in the Genus database with same CATH homology
 1G02 A;  2RBI A;  1B2U A;  1DET A;  3A5E A;  2F5W A;  1BNE A;  1LOW A;  2AAD A;  2KF4 A;  1R4Y A;  1I3F A;  1RGG A;  1TRQ A;  7GSP A;  1PYL A;  1RGH A;  3WHO A;  1LNI A;  1AY7 A;  1LOV A;  1BVI A;  1Q9E A;  1X1X A;  4RNT A;  4BIR A;  1BAO A;  1FZU A;  1B2Z A;  1GMP A;  1BNG A;  1RGL A;  1I70 A;  1YNV X;  1RNB A;  1BU4 A;  3AGO A;  1BRI A;  4J5K A;  1I0X A;  1B20 A;  9RNT A;  1GMR A;  1GSP A;  3DH2 A;  2SAR A;  4BU4 A;  3DGY A;  1LRA A;  1B21 A;  1HYF A;  1UCI A;  4J5G A;  1IYY A;  1BSC A;  1GMQ A;  1GOU A;  1BNR A;  1BSE A;  1BGS A;  2C4B A;  3AGN A;  1HZ1 A;  1BNS A;  1B2X A;  1BOX A;  1ZGX A;  3BIR A;  1DE3 A;  3GSP A;  1BRN L;  1BAN A;  2KAA A;  2KF5 A;  1BSA A;  1RGE A;  1AQZ A;  1BSB A;  1UCJ A;  1T2H A;  5HOH A;  1B27 A;  1MGR A;  1X1W A;  1RDS A;  3BU4 A;  1I0V A;  1JBS A;  3D5G A;  1RSN A;  6RNT A;  1GOY A;  1TRP A;  4HOH A;  1T2I A;  1BNJ A;  5RNT A;  1FW7 A;  2RNT A;  4GSP A;  1RCK A;  1BRS A;  1RHL A;  1UCL A;  2HOH A;  7RNT A;  4GHO A;  1B2M A;  1MGW A;  1X1Y A;  1RGF A;  1RCL A;  1BSD A;  1C54 A;  1SAR A;  3HOH A;  1YVS A;  3SYU A;  1FUT A;  1JBR A;  1UCK A;  2F4Y A;  4HAA A;  6GSP A;  1I2G A;  1RN4 A;  1A2P A;  1BRK A;  2ZA4 A;  1TTO A;  3KCH A;  2F5M A;  5BU4 A;  1RGC A;  3AHS A;  1FYS A;  1I2E A;  2BIR A;  3D4A A;  1GOV A;  3D5I A;  3Q3F A;  8RNT A;  1I2F A;  1BUJ A;  3WR2 A;  1BRG A;  1YGW A;  2AAE A;  1B2S A;  3URP A;  1RNT A;  5BIR A;  1BNF A;  1RN1 A;  1LOY A;  1FUS A;  5GSP A;  1I3I A;  2KF6 A;  1PY3 A;  1BRH A;  3RNT A;  1RGK A;  3AHW A;  1BNI A;  1RMS A;  1JBT A;  2GSP A;  2KF3 A;  1B3S A;  1RLS A;  1RGA A;  1I8V A;  1RTU A;  1X1U A;  1BRJ A;  2F56 A;  2BU4 A;  1CH0 A;  1BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...