1RGAA

Crystal structure of rnase t1 with 3'-gmp and guanosine: a product complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of RNase T1 with 3'-guanylic acid and guanosine.
pubmed rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1993-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgaA00
1BRNL 3D5GA 1FYSA 1TRQA 1RMSA 2RNTA 1RLSA 1A2PA 1RGLA 1I2GA 1I3FA 1B2ZA 1BSDA 1RGKA 1BUJA 1TTOA 1C54A 4GHOA 1I3IA 1I2EA 3AGOA 2KF3A 1I0XA 3URPA 1FW7A 1X1UA 1BANA 1B21A 3A5EA 2RBIA 1RHLA 1GOVA 1R4YA 1BSEA 1BGSA 2C4BA 1FUTA 2F5MA 1GMQA 1RTUA 1PYLA 1T2IA 1AY7A 6RNTA 1IYYA 1BNEA 2KF5A 1HZ1A 1BNGA 1RDSA 1I8VA 2AADA 5BU4A 2GSPA 3DGYA 3AHWA 2KAAA 1LOVA 1GMPA 1JBTA 1YNVX 1RGAA 1Q9EA 1B27A 1RCLA 1BRSA 1RSNA 3WR2A 4GSPA 3AHSA 1HYFA 4BIRA 1ZGXA 1JBSA 3AGNA 1B20A 1I70A 1B2SA 1B2XA 1BNIA 1LRAA 1DE3A 2AAEA 1RN4A 1LNIA 1X1YA 1BSCA 1BRGA 1BAOA 1MGRA 1LOYA 2KF6A 4BU4A 1RN1A 2F5WA 1GMRA 1BSAA 1BOXA 1CH0A 1BRHA 3BU4A 7RNTA 2BIRA 1I0VA 8RNTA 2ZA4A 1BRKA 1RCKA 2F56A 5BIRA 1T2HA 1JBRA 1YGWA 3D4AA 1DETA 3HOHA 1X1XA 1B3SA 1BRIA 1RGEA 1RGCA 1UCJA 2BU4A 1RGGA 6GSPA 5GSPA 3DH2A 5RNTA 1TRPA 1SARA 4RNTA 1BSBA 1B2UA 1RGFA 2KF4A 4HOHA 1BNRA 4J5KA 1FZUA 2F4YA 1I2FA 9RNTA 1LOWA 1RNTA 1BNSA 1PY3A 1RGHA 3GSPA 3D5IA 3RNTA 3BIRA 1B2MA 5HOHA 1AQZA 1BNJA 1UCKA 1GOUA 7GSPA 3WHOA 1MGWA 2HOHA 1FUSA 2SARA 1BU4A 4HAAA 4J5GA 1G02A 3KCHA 1GSPA 1RNBA 1GOYA 1X1WA 1BNFA 1BVIA 3SYUA 1YVSA 1BIRA 1BRJA 1UCIA 3Q3FA 1UCLA
chains in the Genus database with same CATH superfamily
4JF8A 5IEPA 2OQEC 3ROBA 1DMQA 3Q1CA 1YIJ3 3SLUA 1RGLA 5CLKA 1I3FA 1BUJA 1RGKA 1EKMA 1O7GB 2CH9A 4XB5A 1QALA 1SIIA 1E3RA 3FZWA 5AEWB 1I0XA 1ISKA 1FW7A 1BANA 1UI7A 2JDIH 1LQGC 1E3VA 3HIGA 2RBIA 5IERA 2UX0A 1GOVA 1R4YA 1BSEA 1G96A 1YGEA 2FGTA 3CPW2 1OF5B 1GMQA 1UW1A 1RTUA 1T2IA 2UUGC 1IQYA 4KFDA 3PZWA 3BNDA 3NHXA 2E2VA 1NNVA 2E2TA 3CNXA 5AYSC 2ZDJA 3JUPA 4AKZA 3HX8A 4DKIA 3O8YA 4N3VA 1TFKA 2QGUA 1GMPA 4XBYA 1ROVA 3NXJA 4FCMA 1M1XB 1A90A 1STFI 1W6CA 1WNHA 1RCLA 1ZX2A 1FA3A 3L0RA 3KKGA 3AHSA 1N9EA 2XSOB 4BIRA 3RGAA 3F9SA 2QIYA 1NDOB 2CHCA 1B20A 4EV5A 3X3YA 4L8PA 3I563 1B2XA 3S28A 1VQ63 2W56B 1IVXA 5BXQA 1RN4A 2WGOA 1SPUA 3QRDA 5M19A 3HI7A 2K54A 4H61A 4OUQA 2P09A 2HMKB 4MMXB 5EQLA 1K28A 4XBTA 1UUWB 5D82A 2KF6A 1ULIB 1NWWA 1VQO3 1ZO2A 3DM8A 3ZG5A 4HM5B 1GMRA 7STDA 1OHOA 3DGLA 4H3UA 1CH0A 1BRHA 3EE1A 5M1AA 5IW9A 2K3DA 4EYCA 1FGQA 1OHPA 1I0VA 2WGQA 4KZ1A 3UJMA 3SXXA 1OUNA 3LYGA 3MPHA 8RNTA 4LZIA 2YX9A 3OW22 1V58A 1VQN3 2MC8A 1R4CA 4K1UA 2F98A 1VQM3 2P0MA 1YGWA 1LQMB 2RFRA 2Z76A 2GEYA 3I0YA 1X1XA 4PEJA 1PU4A 3FCSB 3FLJA 3RGRA 3U97A 1QMAA 2W0QA 1IQXA 2XH9A 3PCRA 5GSPA 5DRVA 3CC23 5G1LA 1SARA 1A67A 1W02A 1B2UA 4FCZA 1RGFA 2YFIB 1D6ZA 5IF6A 1Z1SA 3N8BA 4HM7B 1IDPA 2V1LA 4HJLB 1NJI4 3PYJA 1FZUA 1JZOA 4R9KA 4CPKA 2BHMA 9RNTA 1OH0A 1W2B2 4RBNA 1A2KA 1PY3A 1GY7A 3MG3A 1RGHA 2CIUA 2Y73A 3JUOA 3NV0A 3D5IA 3RNTA 1O7HB 5AEUB 1NU3A 3T8NA 1B2MA 3X41A 1AQZA 1M9GA 2FNQA 3DGNA 4HVNA 4ORLA 3S29A 3WHOA 2M7OA 5EEOA 2SARA 3K0ZA 5FW5A 2JQ5A 3EF8A 2CC3A 3MWZA 1BU4A 2GBXB 3PS8A 5LC7A 3FG1A 3IPTA 1BVIA 2Z77A 4LGQA 1BIRA 3WOEB 4LEHA 2XEPA 1YIT3 3X3ZA 3FKAA 5ELJA 4K61A 4XDVA 1RMSA 4FMCA 1RLSA 1A2PA 3MHEA 3NM2A 2CFWA 1KQS2 1BSDA 2I9WA 1HU9A 2W6JH 1C54A 3HZPA 3NV0B 1JB5A 2KF3A 3X3XA 3URPA 2F86B 1YJN3 2WOHA 1AVLA 4TX4A 1Q40A 4XDWA 3WDGB 1K9M4 5STDA 1FUTA 2CG0A 3CC43 3CCM3 2C10A 2WOFA 3GZYB 4HYZA 3DGMA 1BNEA 2KF5A 1QAFA 3G8ZA 3Q90A 3M8CA 1N8QA 1VQP3 8CHOA 1A2VA 1ASKA 1MWUA 3LXUX 4BTYA 3JUQA 2GU1A 3EN8A 1W01A 3VSYA 4FMDA 3CCL3 1JJ22 3JUMA 4O3VA 3DXOA 4L7KA 1EG9B 4XBXA 5IG0A 1B27A 3K9MC 3NBRA 2O9UX 1HYFA 3T0UA 4MMYB 3LTBA 1ZGXA 1JBSA 2E2UA 1K8A4 4N6TA 2RCDA 1I70A 4EW5A 3LTAA 1B2SA 1U5OA 1SJWA 1LRAA 1JN5A 3S67A 4XM4A 3V92A 1O7NB 3LT8A 1O7MB 1K734 1BAOA 4EBGA 1OPYA 2BMRB 1MWSA 4BU4A 2F5WA 3GZRA 1M1K4 3CXC2 1BSAA 1IVVA 3FGYA 2Q07A 1T3BA 5CF2A 4OVMA 1QVF2 2CFGA 3STDA 2H0IA 3NQYA 3GZBA 4NPBA 4HM2B 4HZ9B 3ER7A 1BRKA 3OXAA 4HZBB 3BB9A 2RGQA 5M18A 1D6YA 1T2HA 3H51A 4Q53A 1CEWI 2Y74A 3MKIA 1QAKA 4RNYA 3HOHA 3TDGA 1DMMA 3Q2PA 1GYBA 4OK0A 1B3SA 1BRIA 1JN5B 1UCJA 2WO0A 3F8HA 1RGGA 6GSPA 2CX1A 5IG4A 1QVG2 2UGIA 1TRPA 1BSBA 1AV4A 2F99A 1VQ53 3CCU3 4HM8B 1UI8A 4HM4B 3CCE3 2K0MA 2KXGA 1IV9A 2KF4A 4HOHA 1STDA 1UGIA 3WA2X 5EVHA 4J5KA 2F4YA 3BNBA 3K7CA 5D83A 3SOAA 4I4KA 4HM0B 3RDEA 2CX0A 3GSPA 4STDA 3BIRA 7GSPA 3G4S3 2FXTA 4L8OA 3NBBA 2XFSA 1YVBI 1Y4KA 3BNCA 1WMNA 2B24B 2XR8B 3B4OA 4WHAA 4J5GA 1G02A 4KFFA 3X40A 2MF7A 1TJDA 1GSPA 3B8LA 4MEIA 3KZTA 1GOYA 4BL3A 3FSDA 3WMDA 1TUHA 2HMLB 4N6V0 1BRJA 2YFJB 2ZHXB 1DVCA 3F14A 3NQZA 4HM6B 3UL6A 2CG1A 1LVNA 3ALAA 3D5GA 1FYSA 1TRQA 1DMNA 3FF0A 2H0GA 1WQLB 2CWTA 3CMA3 3ZFZA 1I2EA 3S27A 3CD63 1X1UA 3NBJA 1QJGA 4MMZB 4IIAA 2L1SA 2YFLB 3F40A 2ML6A 5HGRA 5LC6A 2IUJA 1AR0A 3A5EA 2A15A 1VQ93 1MOLA 4CCVA 1W00A 1YJ93 4HBRA 2C4BA 2XSHB 4R9LA 2F5MA 4K1VA 5FGOA 5KP1A 3JVCA 5JPPA 2CKFB 3CCS3 3DMCA 1NB5I 1IYYA 1OGXA 1HZ1A 4IT7A 1UDII 2INXA 4LMIA 2AADA 1OCVA 2IUKA 3E99A 3DGYA 1W5ZA 1RJOA 1LOVA 4HM1B 1JBTA 1MNLA 1D6UA 1LXEA 1WMPA 1V57A 3GWRA 5JBSA 3CCV3 1YNVX 3ECFA 2J8XB 5AYRB 1IK3A 3D9RA 3F7SA 2OOVA 1JV2B 1BRSA 1C7HA 2P0XA 3WR2A 5G2GA 1Q814 2GU3A 3LT9A 3CC73 1UUGB 2ML5A 1BNIA 4R80A 1K41A 2AAEA 1O7PB 4J8TA 1N5HA 1S5AA 4X2HA 1NB3I 1IT8A 3GZXB 3OX9A 1IQ8A 1BSCA 4JRFA 4WP5A 1BRGA 4R4KA 2H0HA 4KVHA 4N6MA 1VQ43 1W4NA 1LOXA 1LOYA 2OWPA 1YHQ3 3KFQC 2LYXA 3BLZA 2CW9A 3D79A 1YJW3 4LYLB 1BOXA 3GRDA 3BU4A 1IV7A 2P38A 5AIIA 4EC6A 5IG3A 2ZA4A 3EB8A 2OTL3 4N6LA 3B7CA 3PCSA 2Z7AA 1GD3A 3F8XA 3EN1B 3I553 3HK4A 4RZMA 5AI1A 1Q40B 2XGLA 3D4AA 3CCQ3 1WMOA 1G0TA 1RGEA 4WFOA 1TFOA 2HMOB 2XRXB 1VQL3 5ELUA 5G1KA 5RNTA 5KP4A 1GS3A 4RNTA 2L4VA 3OWUA 1OACA 1JB2A 1EQKA 2QEX3 3U1WA 2HMNB 3EBTA 1HKXA 3KE7A 3LMLA 5AIGA 1GD4A 5A0OB 1S723 1BNRA 1CYUA 1VQQA 3EQQB 1OHSA 2CFDA 2BMOB 2XF3A 1KWIA 4FMAA 3VF1A 2PNCA 3N9HA 1JZDA 1MWRA 2W2CA 1RNTA 1TP6A 4CDLA 2D1WA 2LQVA 1VQK3 4X2OA 2B1XB 4J9AA 1UCKA 1GOUA 3X42A 5CXOA 1MGWA 2HOHA 1RRHA 2BT3A 4ILFA 1FUSA 3SX1A 1IT7A 3LOYA 2IY2A 3ZG0A 2W56A 4AKYA 5AIHA 1NO3A 1GY6A 1BNFA 3SYUA 3UB1A 4U13A 3SEDA 3T8UA 3CU3A 4I5QA 1ULJB 2CFKA 1UCLA 3Q3FA 1IVUA 2XFTA 2W04A 4O8SA 3JUNA 1BRNL 3H3HA 1IU7A 3UL5A 3KSED 4QWTA 2RNTA 1KC84 3DY5A 1I2GA 1SQWA 1B2ZA 1PFPA 3G16A 1TTOA 3FF2A 5TGNA 2O3OA 3QK9A 1I3IA 4GHOA 1W7CA 3AGOA 1E97A 5D81A 1Q7HA 1LNHA 3CPOA 3LZAA 3NX0A 3IJEB 4HKVB 1FGMA 1IVWA 5CF1A 1B21A 2GEXA 2R41A 3KN4A 3V99A 2SBLA 1Q7Y4 3PXMA 1RHLA 5AIFA 1VQ73 1ZS7A 3LTCA 3SOYA 2QA43 3CCJ3 1BGSA 1O7WB 3DZLA 4BL2A 4MJDA 1J2BA 3K5TA 4LSOA 1MWTA 4HM3B 2RSXA 1PYLA 4WYKA 1AY7A 4R1KA 1F8NA 3LH4A 1JKGA 4FCJA 6RNTA 6STDA 5IG5A 1BNGA 1RDSA 2KRTA 1I8VA 1FGTA 4GB5A 4K90B 5BU4A 1N8R4 3KSPA 3OWYA 3AHWA 1RKYA 2CK3H 2KAAA 3CME3 3V98A 1DVDA 1Q42A 3F7XA 2GBWB 1RGAA 3EX9A 3D3LA 1Q9EA 1SIHA 2CFLA 1AVKA 3G0KA 1RSNA 3K63A 4O2HA 4GSPA 2IMJA 5DREA 1KD14 1RRLA 3AGNA 3CNMA 3EC9A 4G1MB 3A76A 3G6E3 1US1A 4WYKB 4NHFA 1FUWA 3EHCA 1DE3A 1JKGB 4N6OB 2XGNA 3FG3A 1FGOA 1LNIA 1X1YA 4FMBA 4IPBA 4WWUC 5KP3A 1EUIC 3NUVA 3UNLA 3VGNA 1Q824 4EV2A 3WODG 5IENA 3AMOA 1MGRA 4KFEA 2HMMB 1JNQA 1VZZA 1TIJA 2OCTA 4RNZA 1EEJA 1L5GB 4BTWA 4ZM8A 4EXRA 1RN1A 1JRQA 2OOVC 3KIIA 1UUVB 4N6UA 5IEOA 7RNTA 2D42A 1VQ83 2BIRA 3HIIA 1T5YA 1W6YA 2CWUA 4NREA 1EA2A 2W9PA 2OTJ3 1RCKA 1RN7A 3BNEA 3IMAB 3N54B 2F56A 4BTXA 5BIRA 3MYTA 2BMQB 1WTHA 3DGOA 5I97A 1JBRA 2ZL8A 1FGRA 1DETA 1GY5A 1OGZA 1W2ZA 4O02B 1RGCA 2W9QA 2OQEA 1N5PA 1UGHI 2BU4A 3LTDA 5JPUA 3DH2A 2PZVA 3AMOB 2BNGA 1TU5A 4AEQA 3OWSA 2C11A 2R4IA 3G713 1M904 2GXFA 2STDA 3EJVA 3S5CA 3J7Yd 2IA7A 3MSOA 1I2FA 2KCDA 2W03A 4CJNA 1LOWA 2Z6BA 1BNSA 5CK6A 4KT3B 2P05A 3PGBA 1ROAA 2CWVA 3FG4A 3GAXA 1KSIA 2HMJB 5HOHA 3FH1A 3WA3A 1BNJA 1YI23 3MG2A 1W6GA 1CQSA 1JB4A 4FR9A 3CCR3 1N9JA 3NM7A 4HAAA 1U8CB 4N6NB 5BVBA 1BUQA 3DUKA 3KCHA 3MG1A 1RNBA 3B4PA 1OF5A 3EBYA 1X1WA 1DYUA 2IYJA 4GL6A 1Q864 1YVSA 2BO9B 1UCIA 1CYVA 3SVAA 3WOFB 1V74A 3OV4A 2GSPA
chains in the Genus database with same CATH topology
1BRNL 3D5GA 1FYSA 1TRQA 1RMSA 2RNTA 1RLSA 1A2PA 1RGLA 1I2GA 1I3FA 1B2ZA 1BSDA 1RGKA 1BUJA 1TTOA 1C54A 4GHOA 1I3IA 1I2EA 3AGOA 2KF3A 1I0XA 3URPA 1FW7A 1X1UA 1BANA 1B21A 3A5EA 2RBIA 1RHLA 1GOVA 1R4YA 1BSEA 1BGSA 2C4BA 1FUTA 2F5MA 1GMQA 1RTUA 1PYLA 1T2IA 1AY7A 6RNTA 1IYYA 1BNEA 2KF5A 1HZ1A 1BNGA 1RDSA 1I8VA 2AADA 5BU4A 2GSPA 3DGYA 3AHWA 2KAAA 1LOVA 1GMPA 1JBTA 1YNVX 1RGAA 1Q9EA 1B27A 1RCLA 1BRSA 1RSNA 3WR2A 4GSPA 3AHSA 1HYFA 4BIRA 1ZGXA 1JBSA 3AGNA 1B20A 1I70A 1B2SA 1B2XA 1BNIA 1LRAA 1DE3A 2AAEA 1RN4A 1LNIA 1X1YA 1BSCA 1BRGA 1BAOA 1MGRA 1LOYA 2KF6A 4BU4A 1RN1A 2F5WA 1GMRA 1BSAA 1BOXA 1CH0A 1BRHA 3BU4A 7RNTA 2BIRA 1I0VA 8RNTA 2ZA4A 1BRKA 1RCKA 2F56A 5BIRA 1T2HA 1JBRA 1YGWA 3D4AA 1DETA 3HOHA 1X1XA 1B3SA 1BRIA 1RGEA 1RGCA 1UCJA 2BU4A 1RGGA 6GSPA 5GSPA 3DH2A 5RNTA 1TRPA 1SARA 4RNTA 1BSBA 1B2UA 1RGFA 2KF4A 4HOHA 1BNRA 4J5KA 1FZUA 2F4YA 1I2FA 9RNTA 1LOWA 1RNTA 1BNSA 1PY3A 1RGHA 3GSPA 3D5IA 3RNTA 3BIRA 1B2MA 5HOHA 1AQZA 1BNJA 1UCKA 1GOUA 7GSPA 3WHOA 1MGWA 2HOHA 1FUSA 2SARA 1BU4A 4HAAA 4J5GA 1G02A 3KCHA 1GSPA 1RNBA 1GOYA 1X1WA 1BNFA 1BVIA 3SYUA 1YVSA 1BIRA 1BRJA 1UCIA 3Q3FA 1UCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRN L;  3D5G A;  1FYS A;  1TRQ A;  1RMS A;  2RNT A;  1RLS A;  1A2P A;  1RGL A;  1I2G A;  1I3F A;  1B2Z A;  1BSD A;  1RGK A;  1BUJ A;  1TTO A;  1C54 A;  4GHO A;  1I3I A;  1I2E A;  3AGO A;  2KF3 A;  1I0X A;  3URP A;  1FW7 A;  1X1U A;  1BAN A;  1B21 A;  3A5E A;  2RBI A;  1RHL A;  1GOV A;  1R4Y A;  1BSE A;  1BGS A;  2C4B A;  1FUT A;  2F5M A;  1GMQ A;  1RTU A;  1PYL A;  1T2I A;  1AY7 A;  6RNT A;  1IYY A;  1BNE A;  2KF5 A;  1HZ1 A;  1BNG A;  1RDS A;  1I8V A;  2AAD A;  5BU4 A;  2GSP A;  3DGY A;  3AHW A;  2KAA A;  1LOV A;  1GMP A;  1JBT A;  1YNV X;  1RGA A;  1Q9E A;  1B27 A;  1RCL A;  1BRS A;  1RSN A;  3WR2 A;  4GSP A;  3AHS A;  1HYF A;  4BIR A;  1ZGX A;  1JBS A;  3AGN A;  1B20 A;  1I70 A;  1B2S A;  1B2X A;  1BNI A;  1LRA A;  1DE3 A;  2AAE A;  1RN4 A;  1LNI A;  1X1Y A;  1BSC A;  1BRG A;  1BAO A;  1MGR A;  1LOY A;  2KF6 A;  4BU4 A;  1RN1 A;  2F5W A;  1GMR A;  1BSA A;  1BOX A;  1CH0 A;  1BRH A;  3BU4 A;  7RNT A;  2BIR A;  1I0V A;  8RNT A;  2ZA4 A;  1BRK A;  1RCK A;  2F56 A;  5BIR A;  1T2H A;  1JBR A;  1YGW A;  3D4A A;  1DET A;  3HOH A;  1X1X A;  1B3S A;  1BRI A;  1RGE A;  1RGC A;  1UCJ A;  2BU4 A;  1RGG A;  6GSP A;  5GSP A;  3DH2 A;  5RNT A;  1TRP A;  1SAR A;  4RNT A;  1BSB A;  1B2U A;  1RGF A;  2KF4 A;  4HOH A;  1BNR A;  4J5K A;  1FZU A;  2F4Y A;  1I2F A;  9RNT A;  1LOW A;  1RNT A;  1BNS A;  1PY3 A;  1RGH A;  3GSP A;  3D5I A;  3RNT A;  3BIR A;  1B2M A;  5HOH A;  1AQZ A;  1BNJ A;  1UCK A;  1GOU A;  7GSP A;  3WHO A;  1MGW A;  2HOH A;  1FUS A;  2SAR A;  1BU4 A;  4HAA A;  4J5G A;  1G02 A;  3KCH A;  1GSP A;  1RNB A;  1GOY A;  1X1W A;  1BNF A;  1BVI A;  3SYU A;  1YVS A;  1BIR A;  1BRJ A;  1UCI A;  3Q3F A;  1UCL A; 
#chains in the Genus database with same CATH topology
 4JF8 A;  5IEP A;  2OQE C;  3ROB A;  1DMQ A;  3Q1C A;  1YIJ 3;  3SLU A;  1RGL A;  5CLK A;  1I3F A;  1BUJ A;  1RGK A;  1EKM A;  1O7G B;  2CH9 A;  4XB5 A;  1QAL A;  1SII A;  1E3R A;  3FZW A;  5AEW B;  1I0X A;  1ISK A;  1FW7 A;  1BAN A;  1UI7 A;  2JDI H;  1LQG C;  1E3V A;  3HIG A;  2RBI A;  5IER A;  2UX0 A;  1GOV A;  1R4Y A;  1BSE A;  1G96 A;  1YGE A;  2FGT A;  3CPW 2;  1OF5 B;  1GMQ A;  1UW1 A;  1RTU A;  1T2I A;  2UUG C;  1IQY A;  4KFD A;  3PZW A;  3BND A;  3NHX A;  2E2V A;  1NNV A;  2E2T A;  3CNX A;  5AYS C;  2ZDJ A;  3JUP A;  4AKZ A;  3HX8 A;  4DKI A;  3O8Y A;  4N3V A;  1TFK A;  2QGU A;  1GMP A;  4XBY A;  1ROV A;  3NXJ A;  4FCM A;  1M1X B;  1A90 A;  1STF I;  1W6C A;  1WNH A;  1RCL A;  1ZX2 A;  1FA3 A;  3L0R A;  3KKG A;  3AHS A;  1N9E A;  2XSO B;  4BIR A;  3RGA A;  3F9S A;  2QIY A;  1NDO B;  2CHC A;  1B20 A;  4EV5 A;  3X3Y A;  4L8P A;  3I56 3;  1B2X A;  3S28 A;  1VQ6 3;  2W56 B;  1IVX A;  5BXQ A;  1RN4 A;  2WGO A;  1SPU A;  3QRD A;  5M19 A;  3HI7 A;  2K54 A;  4H61 A;  4OUQ A;  2P09 A;  2HMK B;  4MMX B;  5EQL A;  1K28 A;  4XBT A;  1UUW B;  5D82 A;  2KF6 A;  1ULI B;  1NWW A;  1VQO 3;  1ZO2 A;  3DM8 A;  3ZG5 A;  4HM5 B;  1GMR A;  7STD A;  1OHO A;  3DGL A;  4H3U A;  1CH0 A;  1BRH A;  3EE1 A;  5M1A A;  5IW9 A;  2K3D A;  4EYC A;  1FGQ A;  1OHP A;  1I0V A;  2WGQ A;  4KZ1 A;  3UJM A;  3SXX A;  1OUN A;  3LYG A;  3MPH A;  8RNT A;  4LZI A;  2YX9 A;  3OW2 2;  1V58 A;  1VQN 3;  2MC8 A;  1R4C A;  4K1U A;  2F98 A;  1VQM 3;  2P0M A;  1YGW A;  1LQM B;  2RFR A;  2Z76 A;  2GEY A;  3I0Y A;  1X1X A;  4PEJ A;  1PU4 A;  3FCS B;  3FLJ A;  3RGR A;  3U97 A;  1QMA A;  2W0Q A;  1IQX A;  2XH9 A;  3PCR A;  5GSP A;  5DRV A;  3CC2 3;  5G1L A;  1SAR A;  1A67 A;  1W02 A;  1B2U A;  4FCZ A;  1RGF A;  2YFI B;  1D6Z A;  5IF6 A;  1Z1S A;  3N8B A;  4HM7 B;  1IDP A;  2V1L A;  4HJL B;  1NJI 4;  3PYJ A;  1FZU A;  1JZO A;  4R9K A;  4CPK A;  2BHM A;  9RNT A;  1OH0 A;  1W2B 2;  4RBN A;  1A2K A;  1PY3 A;  1GY7 A;  3MG3 A;  1RGH A;  2CIU A;  2Y73 A;  3JUO A;  3NV0 A;  3D5I A;  3RNT A;  1O7H B;  5AEU B;  1NU3 A;  3T8N A;  1B2M A;  3X41 A;  1AQZ A;  1M9G A;  2FNQ A;  3DGN A;  4HVN A;  4ORL A;  3S29 A;  3WHO A;  2M7O A;  5EEO A;  2SAR A;  3K0Z A;  5FW5 A;  2JQ5 A;  3EF8 A;  2CC3 A;  3MWZ A;  1BU4 A;  2GBX B;  3PS8 A;  5LC7 A;  3FG1 A;  3IPT A;  1BVI A;  2Z77 A;  4LGQ A;  1BIR A;  3WOE B;  4LEH A;  2XEP A;  1YIT 3;  3X3Z A;  3FKA A;  5ELJ A;  4K61 A;  4XDV A;  1RMS A;  4FMC A;  1RLS A;  1A2P A;  3MHE A;  3NM2 A;  2CFW A;  1KQS 2;  1BSD A;  2I9W A;  1HU9 A;  2W6J H;  1C54 A;  3HZP A;  3NV0 B;  1JB5 A;  2KF3 A;  3X3X A;  3URP A;  2F86 B;  1YJN 3;  2WOH A;  1AVL A;  4TX4 A;  1Q40 A;  4XDW A;  3WDG B;  1K9M 4;  5STD A;  1FUT A;  2CG0 A;  3CC4 3;  3CCM 3;  2C10 A;  2WOF A;  3GZY B;  4HYZ A;  3DGM A;  1BNE A;  2KF5 A;  1QAF A;  3G8Z A;  3Q90 A;  3M8C A;  1N8Q A;  1VQP 3;  8CHO A;  1A2V A;  1ASK A;  1MWU A;  3LXU X;  4BTY A;  3JUQ A;  2GU1 A;  3EN8 A;  1W01 A;  3VSY A;  4FMD A;  3CCL 3;  1JJ2 2;  3JUM A;  4O3V A;  3DXO A;  4L7K A;  1EG9 B;  4XBX A;  5IG0 A;  1B27 A;  3K9M C;  3NBR A;  2O9U X;  1HYF A;  3T0U A;  4MMY B;  3LTB A;  1ZGX A;  1JBS A;  2E2U A;  1K8A 4;  4N6T A;  2RCD A;  1I70 A;  4EW5 A;  3LTA A;  1B2S A;  1U5O A;  1SJW A;  1LRA A;  1JN5 A;  3S67 A;  4XM4 A;  3V92 A;  1O7N B;  3LT8 A;  1O7M B;  1K73 4;  1BAO A;  4EBG A;  1OPY A;  2BMR B;  1MWS A;  4BU4 A;  2F5W A;  3GZR A;  1M1K 4;  3CXC 2;  1BSA A;  1IVV A;  3FGY A;  2Q07 A;  1T3B A;  5CF2 A;  4OVM A;  1QVF 2;  2CFG A;  3STD A;  2H0I A;  3NQY A;  3GZB A;  4NPB A;  4HM2 B;  4HZ9 B;  3ER7 A;  1BRK A;  3OXA A;  4HZB B;  3BB9 A;  2RGQ A;  5M18 A;  1D6Y A;  1T2H A;  3H51 A;  4Q53 A;  1CEW I;  2Y74 A;  3MKI A;  1QAK A;  4RNY A;  3HOH A;  3TDG A;  1DMM A;  3Q2P A;  1GYB A;  4OK0 A;  1B3S A;  1BRI A;  1JN5 B;  1UCJ A;  2WO0 A;  3F8H A;  1RGG A;  6GSP A;  2CX1 A;  5IG4 A;  1QVG 2;  2UGI A;  1TRP A;  1BSB A;  1AV4 A;  2F99 A;  1VQ5 3;  3CCU 3;  4HM8 B;  1UI8 A;  4HM4 B;  3CCE 3;  2K0M A;  2KXG A;  1IV9 A;  2KF4 A;  4HOH A;  1STD A;  1UGI A;  3WA2 X;  5EVH A;  4J5K A;  2F4Y A;  3BNB A;  3K7C A;  5D83 A;  3SOA A;  4I4K A;  4HM0 B;  3RDE A;  2CX0 A;  3GSP A;  4STD A;  3BIR A;  7GSP A;  3G4S 3;  2FXT A;  4L8O A;  3NBB A;  2XFS A;  1YVB I;  1Y4K A;  3BNC A;  1WMN A;  2B24 B;  2XR8 B;  3B4O A;  4WHA A;  4J5G A;  1G02 A;  4KFF A;  3X40 A;  2MF7 A;  1TJD A;  1GSP A;  3B8L A;  4MEI A;  3KZT A;  1GOY A;  4BL3 A;  3FSD A;  3WMD A;  1TUH A;  2HML B;  4N6V 0;  1BRJ A;  2YFJ B;  2ZHX B;  1DVC A;  3F14 A;  3NQZ A;  4HM6 B;  3UL6 A;  2CG1 A;  1LVN A;  3ALA A;  3D5G A;  1FYS A;  1TRQ A;  1DMN A;  3FF0 A;  2H0G A;  1WQL B;  2CWT A;  3CMA 3;  3ZFZ A;  1I2E A;  3S27 A;  3CD6 3;  1X1U A;  3NBJ A;  1QJG A;  4MMZ B;  4IIA A;  2L1S A;  2YFL B;  3F40 A;  2ML6 A;  5HGR A;  5LC6 A;  2IUJ A;  1AR0 A;  3A5E A;  2A15 A;  1VQ9 3;  1MOL A;  4CCV A;  1W00 A;  1YJ9 3;  4HBR A;  2C4B A;  2XSH B;  4R9L A;  2F5M A;  4K1V A;  5FGO A;  5KP1 A;  3JVC A;  5JPP A;  2CKF B;  3CCS 3;  3DMC A;  1NB5 I;  1IYY A;  1OGX A;  1HZ1 A;  4IT7 A;  1UDI I;  2INX A;  4LMI A;  2AAD A;  1OCV A;  2IUK A;  3E99 A;  3DGY A;  1W5Z A;  1RJO A;  1LOV A;  4HM1 B;  1JBT A;  1MNL A;  1D6U A;  1LXE A;  1WMP A;  1V57 A;  3GWR A;  5JBS A;  3CCV 3;  1YNV X;  3ECF A;  2J8X B;  5AYR B;  1IK3 A;  3D9R A;  3F7S A;  2OOV A;  1JV2 B;  1BRS A;  1C7H A;  2P0X A;  3WR2 A;  5G2G A;  1Q81 4;  2GU3 A;  3LT9 A;  3CC7 3;  1UUG B;  2ML5 A;  1BNI A;  4R80 A;  1K41 A;  2AAE A;  1O7P B;  4J8T A;  1N5H A;  1S5A A;  4X2H A;  1NB3 I;  1IT8 A;  3GZX B;  3OX9 A;  1IQ8 A;  1BSC A;  4JRF A;  4WP5 A;  1BRG A;  4R4K A;  2H0H A;  4KVH A;  4N6M A;  1VQ4 3;  1W4N A;  1LOX A;  1LOY A;  2OWP A;  1YHQ 3;  3KFQ C;  2LYX A;  3BLZ A;  2CW9 A;  3D79 A;  1YJW 3;  4LYL B;  1BOX A;  3GRD A;  3BU4 A;  1IV7 A;  2P38 A;  5AII A;  4EC6 A;  5IG3 A;  2ZA4 A;  3EB8 A;  2OTL 3;  4N6L A;  3B7C A;  3PCS A;  2Z7A A;  1GD3 A;  3F8X A;  3EN1 B;  3I55 3;  3HK4 A;  4RZM A;  5AI1 A;  1Q40 B;  2XGL A;  3D4A A;  3CCQ 3;  1WMO A;  1G0T A;  1RGE A;  4WFO A;  1TFO A;  2HMO B;  2XRX B;  1VQL 3;  5ELU A;  5G1K A;  5RNT A;  5KP4 A;  1GS3 A;  4RNT A;  2L4V A;  3OWU A;  1OAC A;  1JB2 A;  1EQK A;  2QEX 3;  3U1W A;  2HMN B;  3EBT A;  1HKX A;  3KE7 A;  3LML A;  5AIG A;  1GD4 A;  5A0O B;  1S72 3;  1BNR A;  1CYU A;  1VQQ A;  3EQQ B;  1OHS A;  2CFD A;  2BMO B;  2XF3 A;  1KWI A;  4FMA A;  3VF1 A;  2PNC A;  3N9H A;  1JZD A;  1MWR A;  2W2C A;  1RNT A;  1TP6 A;  4CDL A;  2D1W A;  2LQV A;  1VQK 3;  4X2O A;  2B1X B;  4J9A A;  1UCK A;  1GOU A;  3X42 A;  5CXO A;  1MGW A;  2HOH A;  1RRH A;  2BT3 A;  4ILF A;  1FUS A;  3SX1 A;  1IT7 A;  3LOY A;  2IY2 A;  3ZG0 A;  2W56 A;  4AKY A;  5AIH A;  1NO3 A;  1GY6 A;  1BNF A;  3SYU A;  3UB1 A;  4U13 A;  3SED A;  3T8U A;  3CU3 A;  4I5Q A;  1ULJ B;  2CFK A;  1UCL A;  3Q3F A;  1IVU A;  2XFT A;  2W04 A;  4O8S A;  3JUN A;  1BRN L;  3H3H A;  1IU7 A;  3UL5 A;  3KSE D;  4QWT A;  2RNT A;  1KC8 4;  3DY5 A;  1I2G A;  1SQW A;  1B2Z A;  1PFP A;  3G16 A;  1TTO A;  3FF2 A;  5TGN A;  2O3O A;  3QK9 A;  1I3I A;  4GHO A;  1W7C A;  3AGO A;  1E97 A;  5D81 A;  1Q7H A;  1LNH A;  3CPO A;  3LZA A;  3NX0 A;  3IJE B;  4HKV B;  1FGM A;  1IVW A;  5CF1 A;  1B21 A;  2GEX A;  2R41 A;  3KN4 A;  3V99 A;  2SBL A;  1Q7Y 4;  3PXM A;  1RHL A;  5AIF A;  1VQ7 3;  1ZS7 A;  3LTC A;  3SOY A;  2QA4 3;  3CCJ 3;  1BGS A;  1O7W B;  3DZL A;  4BL2 A;  4MJD A;  1J2B A;  3K5T A;  4LSO A;  1MWT A;  4HM3 B;  2RSX A;  1PYL A;  4WYK A;  1AY7 A;  4R1K A;  1F8N A;  3LH4 A;  1JKG A;  4FCJ A;  6RNT A;  6STD A;  5IG5 A;  1BNG A;  1RDS A;  2KRT A;  1I8V A;  1FGT A;  4GB5 A;  4K90 B;  5BU4 A;  1N8R 4;  3KSP A;  3OWY A;  3AHW A;  1RKY A;  2CK3 H;  2KAA A;  3CME 3;  3V98 A;  1DVD A;  1Q42 A;  3F7X A;  2GBW B;  1RGA A;  3EX9 A;  3D3L A;  1Q9E A;  1SIH A;  2CFL A;  1AVK A;  3G0K A;  1RSN A;  3K63 A;  4O2H A;  4GSP A;  2IMJ A;  5DRE A;  1KD1 4;  1RRL A;  3AGN A;  3CNM A;  3EC9 A;  4G1M B;  3A76 A;  3G6E 3;  1US1 A;  4WYK B;  4NHF A;  1FUW A;  3EHC A;  1DE3 A;  1JKG B;  4N6O B;  2XGN A;  3FG3 A;  1FGO A;  1LNI A;  1X1Y A;  4FMB A;  4IPB A;  4WWU C;  5KP3 A;  1EUI C;  3NUV A;  3UNL A;  3VGN A;  1Q82 4;  4EV2 A;  3WOD G;  5IEN A;  3AMO A;  1MGR A;  4KFE A;  2HMM B;  1JNQ A;  1VZZ A;  1TIJ A;  2OCT A;  4RNZ A;  1EEJ A;  1L5G B;  4BTW A;  4ZM8 A;  4EXR A;  1RN1 A;  1JRQ A;  2OOV C;  3KII A;  1UUV B;  4N6U A;  5IEO A;  7RNT A;  2D42 A;  1VQ8 3;  2BIR A;  3HII A;  1T5Y A;  1W6Y A;  2CWU A;  4NRE A;  1EA2 A;  2W9P A;  2OTJ 3;  1RCK A;  1RN7 A;  3BNE A;  3IMA B;  3N54 B;  2F56 A;  4BTX A;  5BIR A;  3MYT A;  2BMQ B;  1WTH A;  3DGO A;  5I97 A;  1JBR A;  2ZL8 A;  1FGR A;  1DET A;  1GY5 A;  1OGZ A;  1W2Z A;  4O02 B;  1RGC A;  2W9Q A;  2OQE A;  1N5P A;  1UGH I;  2BU4 A;  3LTD A;  5JPU A;  3DH2 A;  2PZV A;  3AMO B;  2BNG A;  1TU5 A;  4AEQ A;  3OWS A;  2C11 A;  2R4I A;  3G71 3;  1M90 4;  2GXF A;  2STD A;  3EJV A;  3S5C A;  3J7Y d;  2IA7 A;  3MSO A;  1I2F A;  2KCD A;  2W03 A;  4CJN A;  1LOW A;  2Z6B A;  1BNS A;  5CK6 A;  4KT3 B;  2P05 A;  3PGB A;  1ROA A;  2CWV A;  3FG4 A;  3GAX A;  1KSI A;  2HMJ B;  5HOH A;  3FH1 A;  3WA3 A;  1BNJ A;  1YI2 3;  3MG2 A;  1W6G A;  1CQS A;  1JB4 A;  4FR9 A;  3CCR 3;  1N9J A;  3NM7 A;  4HAA A;  1U8C B;  4N6N B;  5BVB A;  1BUQ A;  3DUK A;  3KCH A;  3MG1 A;  1RNB A;  3B4P A;  1OF5 A;  3EBY A;  1X1W A;  1DYU A;  2IYJ A;  4GL6 A;  1Q86 4;  1YVS A;  2BO9 B;  1UCI A;  1CYV A;  3SVA A;  3WOF B;  1V74 A;  3OV4 A;  2GSP A; 
#chains in the Genus database with same CATH homology
 1BRN L;  3D5G A;  1FYS A;  1TRQ A;  1RMS A;  2RNT A;  1RLS A;  1A2P A;  1RGL A;  1I2G A;  1I3F A;  1B2Z A;  1BSD A;  1RGK A;  1BUJ A;  1TTO A;  1C54 A;  4GHO A;  1I3I A;  1I2E A;  3AGO A;  2KF3 A;  1I0X A;  3URP A;  1FW7 A;  1X1U A;  1BAN A;  1B21 A;  3A5E A;  2RBI A;  1RHL A;  1GOV A;  1R4Y A;  1BSE A;  1BGS A;  2C4B A;  1FUT A;  2F5M A;  1GMQ A;  1RTU A;  1PYL A;  1T2I A;  1AY7 A;  6RNT A;  1IYY A;  1BNE A;  2KF5 A;  1HZ1 A;  1BNG A;  1RDS A;  1I8V A;  2AAD A;  5BU4 A;  2GSP A;  3DGY A;  3AHW A;  2KAA A;  1LOV A;  1GMP A;  1JBT A;  1YNV X;  1RGA A;  1Q9E A;  1B27 A;  1RCL A;  1BRS A;  1RSN A;  3WR2 A;  4GSP A;  3AHS A;  1HYF A;  4BIR A;  1ZGX A;  1JBS A;  3AGN A;  1B20 A;  1I70 A;  1B2S A;  1B2X A;  1BNI A;  1LRA A;  1DE3 A;  2AAE A;  1RN4 A;  1LNI A;  1X1Y A;  1BSC A;  1BRG A;  1BAO A;  1MGR A;  1LOY A;  2KF6 A;  4BU4 A;  1RN1 A;  2F5W A;  1GMR A;  1BSA A;  1BOX A;  1CH0 A;  1BRH A;  3BU4 A;  7RNT A;  2BIR A;  1I0V A;  8RNT A;  2ZA4 A;  1BRK A;  1RCK A;  2F56 A;  5BIR A;  1T2H A;  1JBR A;  1YGW A;  3D4A A;  1DET A;  3HOH A;  1X1X A;  1B3S A;  1BRI A;  1RGE A;  1RGC A;  1UCJ A;  2BU4 A;  1RGG A;  6GSP A;  5GSP A;  3DH2 A;  5RNT A;  1TRP A;  1SAR A;  4RNT A;  1BSB A;  1B2U A;  1RGF A;  2KF4 A;  4HOH A;  1BNR A;  4J5K A;  1FZU A;  2F4Y A;  1I2F A;  9RNT A;  1LOW A;  1RNT A;  1BNS A;  1PY3 A;  1RGH A;  3GSP A;  3D5I A;  3RNT A;  3BIR A;  1B2M A;  5HOH A;  1AQZ A;  1BNJ A;  1UCK A;  1GOU A;  7GSP A;  3WHO A;  1MGW A;  2HOH A;  1FUS A;  2SAR A;  1BU4 A;  4HAA A;  4J5G A;  1G02 A;  3KCH A;  1GSP A;  1RNB A;  1GOY A;  1X1W A;  1BNF A;  1BVI A;  3SYU A;  1YVS A;  1BIR A;  1BRJ A;  1UCI A;  3Q3F A;  1UCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...