4EYCA

Crystal structure of the cathelin-like domain of human cathelicidin ll-37 (hcld)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
103
Chain Sequence
b'GSHMQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathelicidin antimicrobial peptide
publication title Structural and Functional Analysis of the Pro-Domain of Human Cathelicidin, LL-37.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 26
structure length 103
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4eycA00
4IT7A 5A0OB 3QRDA 1G96A 2O9UX 1ROAA 3PXMA 1N5HA 1IV7A 4N6MA 4CCVA 4N6LA 1DVCA 4TX4A 3UL5A 5ELJA 3L0RA 3GAXA 2OCTA 2W9QA 1TIJA 4N6NB 5ELUA 3S67A 1NB5I 1M9GA 1FUWA 1WNHA 3Q2PA 3K9MC 1EQKA 1MNLA 3KFQC 4ZM8A 1CYVA 4N6TA 2CH9A 1KWIA 3LH4A 2KXGA 3NX0A 4N6OB 2W9PA 1N9JA 1YVBI 3KSED 4N6UA 1GD3A 4N6V0 2BO9B 5LC7A 1CYUA 1DVDA 1R4CA 3UL6A 5EQLA 3PS8A 1IV9A 1CEWI 1NB3I 1PFPA 1A67A 1RN7A 1LXEA 1N5PA 1A90A 3MWZA 1GD4A 5LC6A 3PYJA 4LZIA 1STFI 3IMAB 3SVAA 4EYCA 1FA3A 1MOLA
chains in the Genus database with same CATH superfamily
2O3OA 3GRDA 4OUQA 3GWRA 1OF5A 1LRAA 2QGUA 1KSIA 1R4YA 1S5AA 3GZXB 1I8VA 1GOUA 2K54A 2LYXA 2KAAA 1X1YA 4H3UA 5A0OB 4Q53A 3QRDA 2QIYA 3EC9A 4HVNA 2O9UX 4BIRA 4BTWA 2PZVA 1UCIA 3PXMA 1GOYA 4O2HA 1N5HA 4LYLB 5IG0A 2HMMB 3J7Yd 1VQL3 2XFSA 1Q9EA 3EX9A 4K90B 4N6LA 3O8YA 1DVCA 4N6MA 2W04A 3DUKA 5ELJA 1Y4KA 3LT9A 1BOXA 4KT3B 5M19A 4N3VA 3CCV3 4DKIA 3LYGA 2YFJB 3MHEA 3KN4A 2CK3H 1FGRA 1QAKA 2CX0A 3OWSA 1AY7A 3CCR3 1RCKA 3WMDA 3DGYA 3B7CA 1FZUA 1TRQA 3CXC2 1BRIA 2XH9A 3NM2A 1N8QA 3PZWA 7STDA 5ELUA 1ROVA 5D81A 3FG4A 2CFDA 5STDA 1B20A 2P09A 1IDPA 3H3HA 7GSPA 1BUJA 1LVNA 1JNQA 5KP3A 1JKGB 4HAAA 2BMRB 3CME3 4RBNA 4OVMA 1T2IA 1CH0A 1RTUA 5G1KA 3UJMA 1FUSA 3X3YA 1QJGA 4HM3B 1VZZA 1IYYA 5HGRA 2ZHXB 4AKYA 3UNLA 2JDIH 3LT8A 2CG1A 3VGNA 2KXGA 4FMDA 5IEPA 4ORLA 1VQ73 2XF3A 1VQ43 1ISKA 3NXJA 3N8BA 2W03A 2FGTA 3SEDA 2P38A 4RNYA 2ZA4A 1YGEA 3JUNA 1O7NB 1UUGB 3F7XA 4HM8B 4XDWA 2D1WA 4J5GA 1EEJA 3JVCA 3OWUA 5AI1A 3K7CA 4K61A 1YVBI 3I0YA 3KSED 2C4BA 2UGIA 1YNVX 3KKGA 6RNTA 5JPUA 2BO9B 3NV0B 1RCLA 1RGLA 3FLJA 3UB1A 2XFTA 7RNTA 1KQS2 1W02A 2B1XB 3WOEB 3KZTA 1QVF2 1DVDA 1R4CA 3G8ZA 4JF8A 2OQEA 4MMZB 4HZBB 2FNQA 2M7OA 3PS8A 4XBYA 1ULIB 1K9M4 2CC3A 2ML5A 9RNTA 1MWUA 1RGCA 4KFEA 3LTBA 3CD63 2LQVA 4STDA 1PFPA 2CWVA 5IERA 5M18A 4HOHA 2MC8A 1K28A 1JBSA 1A67A 3G16A 1DE3A 4EBGA 2XR8B 3EF8A 8CHOA 4O02B 1ASKA 5EEOA 2W0QA 5FGOA 2GXFA 2HMLB 1BNRA 1RNTA 1MWRA 2GEYA 3SYUA 1I70A 1X1WA 2W2CA 3N9HA 1JBTA 1GD4A 3JUMA 5G1LA 1HU9A 3AHSA 1BRKA 2KF3A 1TFOA 2K3DA 5TGNA 4G1MB 5AYSC 2E2UA 1O7MB 3WOFB 1MOLA 3NBJA 1RSNA 3NM7A 2KRTA 3NQYA 2PNCA 1AQZA 2IYJA 3CMA3 2F4YA 1JZOA 1SJWA 3CCM3 2L1SA 2GU1A 1VQ93 3WDGB 4QWTA 2BMQB 2ML6A 1LQMB 3CPOA 1JZDA 3FG1A 3STDA 2W56B 3D3LA 1G96A 4RNZA 1W00A 2KCDA 3FG3A 3RGAA 1HYFA 3A5EA 2BMOB 2Q07A 2XEPA 3BNDA 3D5IA 1IVUA 5BIRA 1IV7A 2CX1A 1GMRA 1STDA 1OHSA 1RN1A 4FCZA 2R4IA 4HM6B 4HM5B 2SBLA 3X40A 1LNIA 1FGQA 5I97A 2OCTA 1V57A 5DREA 3T8NA 1YJ93 3SOYA 3F40A 1JRQA 1B2XA 1IQYA 1NDOB 1MWTA 3JUQA 2B24B 3HZPA 2P0MA 4CJNA 4XDVA 1B2SA 3IPTA 1C54A 3F9SA 1GOVA 4N6NB 5M1AA 3GSPA 4GSPA 1NB5I 2HMKB 5JPPA 4KZ1A 1VQP3 5AIFA 3U1WA 3X3XA 3Q2PA 1HZ1A 4HM0B 2HOHA 4KFFA 3X42A 3K9MC 5AIHA 2UX0A 1LQGC 3EB8A 3CC73 3OW22 1VQM3 3NQZA 3FSDA 3SX1A 1W6YA 1T5YA 4NHFA 1RRHA 2CFWA 3EN1B 5EVHA 1YVSA 4R9LA 1CYVA 4KVHA 3CCQ3 2C10A 1B2MA 1E3RA 4N6TA 1G02A 1IVWA 3CNXA 4X2HA 1GS3A 1V58A 1BNGA 3NBRA 1GY7A 4R1KA 2IUKA 3NX0A 6GSPA 3E99A 3HX8A 3ZG0A 1BAOA 5GSPA 1K41A 1JB5A 5BXQA 1BIRA 2HMJB 1Q40B 2E2VA 3M8CA 2ZL8A 3V92A 2F98A 1A2KA 3Q90A 5CXOA 4N6UA 3NBBA 1GD3A 3AMOA 3EBYA 3MG3A 4RZMA 4WYKB 5LC7A 1W2ZA 1S723 2UUGC 2Z6BA 3DMCA 1BRHA 3MYTA 3UL6A 3X3ZA 1UGIA 3BNBA 1T2HA 3GZYB 3KCHA 3WA3A 1TFKA 1WMPA 2CFGA 4HYZA 1BNJA 3ALAA 1RGHA 1RGKA 4BTXA 3I553 1KD14 1FYSA 4L7KA 4L8PA 1U8CB 1JN5A 1I2EA 1NB3I 3D4AA 3H51A 1SARA 2IA7A 3CU3A 5CF1A 3FCSB 2WGOA 1DMNA 1EG9B 1AVLA 1AV4A 4HZ9B 4LEHA 4WP5A 1UI7A 1L5GB 1RGFA 1IT8A 2H0HA 4EC6A 3CC43 1J2BA 4MMXB 2CW9A 2QEX3 2AADA 4K1VA 5AEUB 2GSPA 3AGNA 4I5QA 1SPUA 3K63A 2XGLA 3PYJA 3RDEA 1UCJA 1G0TA 3SVAA 3PGBA 1FGOA 3S29A 2Z76A 3F8XA 2WOFA 4FCJA 4MMYB 3WA2X 1RNBA 4HBRA 4GB5A 5BU4A 2Y74A 1RMSA 1WMOA 3EHCA 4IT7A 1D6UA 1JB2A 2OQEC 5D82A 1OPYA 2CFKA 3AHWA 1BSEA 5AEWB 4BL3A 1BRJA 3DM8A 4AKZA 2F99A 3MG2A 1BANA 1YJW3 1SQWA 4XB5A 1QVG2 3DGNA 1BNEA 1OF5B 3MPHA 3FH1A 1GSPA 3T0UA 1BSDA 3EBTA 2Z77A 4TX4A 3A76A 2R41A 1OHOA 5HOHA 1MGWA 3L0RA 2E2TA 3LTAA 1YHQ3 2XSOB 2HMOB 2BU4A 3GAXA 4BL2A 3T8UA 1SIIA 1B2ZA 2IY2A 1BRSA 2YFLB 8RNTA 1I2GA 1IVVA 1QMAA 2L4VA 4GL6A 2RFRA 2OOVA 5IG5A 4FMAA 1BRNL 1FGTA 3ECFA 1A2VA 2KF5A 4MJDA 3NHXA 4FCMA 1W7CA 2IMJA 3DY5A 3CCU3 1DYUA 1BUQA 3HIGA 3LOYA 4J8TA 2OTL3 1JKGA 4H61A 2C11A 2BT3A 1BSBA 1ZO2A 1NNVA 4JRFA 3RNTA 1K734 1FUWA 3D79A 4J9AA 2W6JH 1VQ53 1BSAA 2BIRA 2F5WA 1GMQA 1I0VA 3PCSA 1GYBA 1W4NA 1WTHA 3DZLA 3S27A 5RNTA 2YFIB 5JBSA 1VQ63 1FUTA 3EN8A 3FF2A 1QALA 3B4OA 2ZDJA 3QK9A 4FMBA 3OXAA 4WHAA 1LNHA 2XGNA 1MNLA 3OWYA 5CLKA 5IG4A 1B21A 1Q824 1N9EA 2CH9A 2K0MA 1CQSA 3NV0A 3BIRA 1F8NA 1NWWA 5AIGA 4HJLB 4FMCA 1YJN3 1OGXA 1X1UA 1IK3A 1BNSA 2F86B 1GY6A 2CWTA 1W6CA 2XSHB 1B27A 3B4PA 3DGOA 3EE1A 3FZWA 4LSOA 1RGEA 4N6V0 4EV2A 1W6GA 3F8HA 3G4S3 4ILFA 3LTCA 2GBXB 1W2B2 1Q864 5CF2A 3DGLA 4EXRA 1O7GB 4O3VA 4O8SA 2AAEA 1I3IA 1O7HB 3ZFZA 4NPBA 4EV5A 3DXOA 1ZX2A 1ZGXA 2OWPA 2MF7A 5BVBA 1OH0A 3CNMA 1A2PA 1YIJ3 2RGQA 2Z7AA 1IV9A 5CK6A 1D6ZA 1IU7A 1VQK3 2P05A 1V74A 4R80A 3FGYA 1RN7A 1RHLA 2CHCA 2J8XB 3B8LA 5AYRB 4BU4A 1VQ83 4EW5A 1UCKA 2H0IA 3LMLA 2V1LA 2RSXA 3LXUX 1DMQA 1BNIA 1MGRA 4OK0A 3S28A 3LZAA 3F7SA 4K1UA 3MWZA 3K0ZA 1W01A 1TTOA 3SLUA 1UUWB 5D83A 2CFLA 2RNTA 4FR9A 4L8OA 5LC6A 1ZS7A 4LZIA 4X2OA 3DGMA 3IMAB 4HM2B 3URPA 2XRXB 4EYCA 3V98A 2F56A 1Z1SA 1BVIA 1LOVA 2RCDA 2W56A 3OX9A 1I3FA 1N8R4 1OCVA 2GBWB 3BNEA 3JUPA 1NO3A 3FF0A 1DMMA 1E97A 1OGZA 1C7HA 1JJ22 3G713 1RJOA 1OHPA 3V99A 4CDLA 4R4KA 3HI7A 5DRVA 3ROBA 1ROAA 3WR2A 2FXTA 4WWUC 3U97A 5IG3A 4RNTA 3BNCA 1YIT3 2KF6A 3CCE3 3SXXA 1UCLA 2I9WA 3GZRA 2KF4A 4CCVA 1U5OA 1IT7A 3UL5A 3EJVA 2STDA 1PY3A 1M904 1B2UA 2OTJ3 1TRPA 4XBXA 5IENA 4I4KA 2CWUA 3NUVA 3CPW2 4IPBA 4NREA 1VQQA 1M1K4 1PYLA 2GU3A 2QA43 2WO0A 3I563 2A15A 2W9QA 1WQLB 1YI23 1TIJA 2YX9A 1RRLA 1YGWA 4XBTA 5G2GA 3RGRA 3G0KA 4BTYA 3PCRA 1Q7HA 4CPKA 3OV4A 1UW1A 1RKYA 1D6YA 1FGMA 3VSYA 1UUVB 1JB4A 3S67A 2P0XA 1M9GA 3X41A 1US1A 3KSPA 3Q3FA 2CKFB 1LOXA 1WNHA 3IJEB 3CCL3 1VQN3 2JQ5A 2GEXA 2WGQA 1RGAA 1LOWA 4PEJA 1O7PB 3CC23 4KFDA 1EQKA 1JBRA 5IW9A 4IIAA 3AGOA 1MWSA 3KE7A 3F14A 4HM4B 3K5TA 3G6E3 1FW7A 2INXA 1Q814 5KP4A 3KFQC 1TU5A 1LOYA 3ZG5A 4ZM8A 1RN4A 3MKIA 1RDSA 2F5MA 3JUOA 4LGQA 1Q40A 5IF6A 1KWIA 3LH4A 3CCS3 1OUNA 3LTDA 3S5CA 1EUIC 4HKVB 1JV2B 1Q7Y4 4R9KA 1QAFA 1IQ8A 2WOHA 1UDII 2Y73A 4N6OB 3D9RA 1BU4A 4WYKA 1B3SA 2OOVC 2W9PA 3WHOA 1AVKA 1N9JA 1OACA 4WFOA 3DH2A 3WODG 1HKXA 3VF1A 1TJDA 2D42A 1EKMA 1EA2A 3D5GA 2SARA 3HIIA 3MSOA 3N54B 1TP6A 1CYUA 3BLZA 3KIIA 1E3VA 1M1XB 3HOHA 2IUJA 5EQLA 2CG0A 1Q42A 1K8A4 5KP1A 1KC84 1NJI4 1BNFA 1CEWI 3AMOB 5AIIA 5IEOA 1VQO3 1TUHA 4J5KA 1X1XA 1I2FA 2H0GA 4AEQA 1W5ZA 4MEIA 1GY5A 1LXEA 3EQQB 1I0XA 2BHMA 1GMPA 4LMIA 1N5PA 4XM4A 3SOAA 1NU3A 1T3BA 1PU4A 3TDGA 4HM1B 1BRGA 1JN5B 3ER7A 1ULJB 6STDA 1A90A 1AR0A 3Q1CA 4HM7B 1BSCA 2HMNB 5FW5A 2CIUA 3FKAA 1DETA 3BU4A 1SIHA 3MG1A 4GHOA 1RGGA 1IQXA 1RLSA 1STFI 3CCJ3 2BNGA 1O7WB 1BGSA 1UGHI 1IVXA 3HK4A 1FA3A 2RBIA 3BB9A 1WMNA 1UI8A 4U13A 3GZBA
chains in the Genus database with same CATH topology
2O3OA 3GRDA 4OUQA 3GWRA 1OF5A 2QGUA 1KSIA 1S5AA 3GZXB 2K54A 2LYXA 4H3UA 5A0OB 4Q53A 3QRDA 2QIYA 3EC9A 4HVNA 2O9UX 4BTWA 2PZVA 3PXMA 4O2HA 1N5HA 5IG0A 2HMMB 3J7Yd 1VQL3 2XFSA 3EX9A 4K90B 4N6MA 4N6LA 3O8YA 1DVCA 2W04A 3DUKA 5ELJA 1Y4KA 3LT9A 4N3VA 3CCV3 3LYGA 2YFJB 3MHEA 3KN4A 2CK3H 1FGRA 1QAKA 3OWSA 3CCR3 3WMDA 3B7CA 3CXC2 2XH9A 3NM2A 1N8QA 3PZWA 7STDA 5ELUA 1ROVA 5D81A 3FG4A 2CFDA 5STDA 2P09A 1IDPA 3H3HA 1LVNA 1JNQA 5KP3A 1JKGB 2BMRB 3CME3 4RBNA 4OVMA 3X3YA 3UJMA 1QJGA 4HM3B 1VZZA 5HGRA 4AKYA 3UNLA 2JDIH 3LT8A 2CG1A 3VGNA 2KXGA 4FMDA 5IEPA 4ORLA 1VQ73 2XF3A 1VQ43 1ISKA 3NXJA 3N8BA 2W03A 2FGTA 3SEDA 2P38A 4RNYA 3JUNA 1YGEA 1O7NB 4HM8B 3F7XA 4XDWA 2D1WA 3JVCA 3OWUA 5AI1A 3K7CA 4K61A 1YVBI 3I0YA 3KSED 3KKGA 5JPUA 2BO9B 3NV0B 3UB1A 3FLJA 2XFTA 1KQS2 1W02A 2B1XB 3WOEB 3KZTA 1QVF2 1DVDA 1R4CA 3G8ZA 4JF8A 2OQEA 4MMZB 4HZBB 2FNQA 2M7OA 3PS8A 4XBYA 1ULIB 1K9M4 2CC3A 2ML5A 4KFEA 3CD63 3LTBA 2LQVA 4STDA 1PFPA 2CWVA 5IERA 2MC8A 1K28A 1A67A 3G16A 4EBGA 2XR8B 3EF8A 8CHOA 4O02B 1ASKA 5EEOA 2W0QA 5FGOA 2GXFA 2HMLB 2GEYA 3N9HA 2W2CA 1GD4A 3JUMA 1HU9A 1TFOA 5TGNA 4G1MB 5AYSC 2E2UA 1O7MB 3WOFB 1MOLA 3NBJA 3NM7A 2KRTA 3NQYA 2PNCA 3CMA3 1SJWA 3CCM3 1VQ93 2GU1A 3WDGB 4QWTA 2BMQB 2ML6A 3CPOA 3FG1A 3STDA 2W56B 3D3LA 1G96A 4RNZA 1W00A 2KCDA 3FG3A 3RGAA 2BMOB 2Q07A 2XEPA 3BNDA 1IVUA 1IV7A 1STDA 1OHSA 4FCZA 2R4IA 4HM6B 4HM5B 2SBLA 3X40A 1FGQA 5I97A 2OCTA 5DREA 3T8NA 1YJ93 3SOYA 3F40A 1JRQA 1IQYA 1NDOB 3JUQA 2B24B 3HZPA 2P0MA 4XDVA 3IPTA 3F9SA 4N6NB 1NB5I 2HMKB 5JPPA 4KZ1A 1VQP3 5AIFA 3U1WA 3X3XA 3Q2PA 4HM0B 4KFFA 3X42A 3K9MC 5AIHA 2UX0A 3EB8A 3CC73 3OW22 1VQM3 3NQZA 3FSDA 3SX1A 1W6YA 1T5YA 4NHFA 1RRHA 2CFWA 3EN1B 5EVHA 4R9LA 1CYVA 4KVHA 3CCQ3 2C10A 1E3RA 4N6TA 1IVWA 3CNXA 4X2HA 1GS3A 3NBRA 1GY7A 4R1KA 2IUKA 3NX0A 3E99A 3HX8A 1K41A 1JB5A 5BXQA 2HMJB 1Q40B 2E2VA 3M8CA 2ZL8A 3V92A 2F98A 1A2KA 3Q90A 5CXOA 4N6UA 3NBBA 1GD3A 3AMOA 3EBYA 3MG3A 4RZMA 4WYKB 5LC7A 1W2ZA 1S723 2Z6BA 3DMCA 3X3ZA 3MYTA 3UL6A 3BNBA 3GZYB 3WA3A 1TFKA 1WMPA 2CFGA 4HYZA 4BTXA 3ALAA 3I553 1KD14 4L7KA 4L8PA 1U8CB 1JN5A 1NB3I 3H51A 2IA7A 3CU3A 5CF1A 3FCSB 2WGOA 1DMNA 1EG9B 1AVLA 1AV4A 4HZ9B 4LEHA 4WP5A 1UI7A 1L5GB 1IT8A 4EC6A 1J2BA 3CC43 4MMXB 2CW9A 2QEX3 4K1VA 5AEUB 1SPUA 3K63A 2XGLA 3PYJA 3RDEA 3SVAA 3PGBA 1FGOA 3S29A 2Z76A 3F8XA 2WOFA 4FCJA 4MMYB 3WA2X 4HBRA 4GB5A 2Y74A 1WMOA 3EHCA 4IT7A 1D6UA 1JB2A 2OQEC 5D82A 1OPYA 2CFKA 5AEWB 3DM8A 4AKZA 2F99A 3MG2A 1QVG2 1SQWA 4XB5A 3DGNA 1OF5B 3MPHA 3FH1A 3T0UA 3EBTA 2Z77A 4TX4A 3A76A 1OHOA 3L0RA 2E2TA 3LTAA 1YHQ3 2XSOB 2HMOB 3GAXA 3T8UA 1SIIA 2YFLB 1IVVA 1QMAA 2L4VA 4GL6A 2RFRA 2OOVA 5IG5A 4FMAA 1FGTA 3ECFA 1A2VA 4MJDA 3NHXA 4FCMA 1W7CA 2IMJA 3DY5A 3CCU3 1DYUA 1BUQA 3HIGA 3LOYA 4J8TA 2OTL3 1JKGA 4H61A 2C11A 2BT3A 1ZO2A 4JRFA 1K734 1FUWA 4J9AA 2W6JH 1VQ53 3PCSA 1GYBA 1W4NA 1WTHA 3DZLA 3S27A 2YFIB 5JBSA 1VQ63 3EN8A 3FF2A 1QALA 3B4OA 2ZDJA 3QK9A 4FMBA 3OXAA 4WHAA 1LNHA 2XGNA 1MNLA 3OWYA 5CLKA 5IG4A 1Q824 1N9EA 2CH9A 2K0MA 1CQSA 3NV0A 1F8NA 1NWWA 5AIGA 4HJLB 4FMCA 1YJN3 1OGXA 1IK3A 2F86B 1GY6A 2CWTA 1W6CA 2XSHB 3B4PA 3DGOA 3EE1A 4LSOA 3FZWA 4N6V0 4EV2A 1W6GA 3F8HA 3G4S3 1W2B2 3LTCA 2GBXB 1Q864 5CF2A 3DGLA 4EXRA 1O7GB 4O3VA 4O8SA 1O7HB 4EV5A 3DXOA 1ZX2A 2OWPA 2MF7A 5BVBA 1OH0A 3CNMA 1YIJ3 2RGQA 2Z7AA 1IV9A 5CK6A 1D6ZA 1IU7A 1VQK3 2P05A 1V74A 4R80A 3FGYA 1RN7A 2CHCA 3B8LA 5AYRB 1VQ83 3LMLA 2V1LA 2RSXA 3LXUX 1DMQA 4OK0A 3S28A 3LZAA 3F7SA 4K1UA 3MWZA 3K0ZA 1W01A 3SLUA 1UUWB 5D83A 2CFLA 4FR9A 4L8OA 5LC6A 4LZIA 4X2OA 3DGMA 3IMAB 4HM2B 4EYCA 2XRXB 3V98A 1Z1SA 2RCDA 2W56A 3OX9A 1N8R4 1OCVA 2GBWB 3BNEA 3JUPA 1NO3A 3FF0A 1DMMA 1E97A 1OGZA 1C7HA 1JJ22 3G713 1RJOA 1OHPA 3V99A 4CDLA 4R4KA 3HI7A 5DRVA 3ROBA 1ROAA 2FXTA 4WWUC 3U97A 5IG3A 3BNCA 1YIT3 3CCE3 3SXXA 2I9WA 3GZRA 4CCVA 1U5OA 1IT7A 3UL5A 3EJVA 2STDA 1M904 2OTJ3 4XBXA 5IENA 4I4KA 2CWUA 3NUVA 3CPW2 4IPBA 4NREA 1M1K4 2GU3A 2QA43 2WO0A 3I563 2A15A 2W9QA 1WQLB 1YI23 1TIJA 2YX9A 1RRLA 4XBTA 5G2GA 3RGRA 3G0KA 4BTYA 3PCRA 3OV4A 1UW1A 1RKYA 1D6YA 1FGMA 3VSYA 1UUVB 1JB4A 3S67A 2P0XA 1M9GA 3X41A 1US1A 3KSPA 2CKFB 1LOXA 1WNHA 3IJEB 3CCL3 1VQN3 2JQ5A 2GEXA 2WGQA 4PEJA 1O7PB 3CC23 4KFDA 1EQKA 5IW9A 4IIAA 3KE7A 3F14A 4HM4B 3K5TA 3G6E3 2INXA 1Q814 5KP4A 3KFQC 1TU5A 4ZM8A 3MKIA 3JUOA 4LGQA 1Q40A 5IF6A 1KWIA 3LH4A 3CCS3 1OUNA 3LTDA 3S5CA 4HKVB 1JV2B 1Q7Y4 4R9KA 1QAFA 1IQ8A 2WOHA 2Y73A 4N6OB 3D9RA 4WYKA 1YJW3 2OOVC 2W9PA 1AVKA 1N9JA 1OACA 4WFOA 3WODG 1HKXA 3VF1A 2D42A 1EKMA 1EA2A 3HIIA 3MSOA 3N54B 1TP6A 1CYUA 3BLZA 3KIIA 1E3VA 1M1XB 2IUJA 5EQLA 2CG0A 1Q42A 1K8A4 5KP1A 1KC84 1NJI4 1CEWI 3AMOB 5AIIA 5IEOA 1VQO3 1TUHA 4AEQA 1W5ZA 4MEIA 1GY5A 1LXEA 3EQQB 2BHMA 4LMIA 1N5PA 4XM4A 3SOAA 1NU3A 1PU4A 3TDGA 4HM1B 1JN5B 3ER7A 1ULJB 6STDA 1A90A 1AR0A 3Q1CA 4HM7B 2HMNB 5FW5A 2CIUA 3FKAA 3MG1A 1SIHA 1IQXA 1STFI 3CCJ3 2BNGA 1O7WB 1IVXA 3HK4A 1FA3A 3BB9A 1WMNA 1UI8A 4U13A 3GZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT7 A;  5A0O B;  3QRD A;  1G96 A;  2O9U X;  1ROA A;  3PXM A;  1N5H A;  1IV7 A;  4N6M A;  4CCV A;  4N6L A;  1DVC A;  4TX4 A;  3UL5 A;  5ELJ A;  3L0R A;  3GAX A;  2OCT A;  2W9Q A;  1TIJ A;  4N6N B;  5ELU A;  3S67 A;  1NB5 I;  1M9G A;  1FUW A;  1WNH A;  3Q2P A;  3K9M C;  1EQK A;  1MNL A;  3KFQ C;  4ZM8 A;  1CYV A;  4N6T A;  2CH9 A;  1KWI A;  3LH4 A;  2KXG A;  3NX0 A;  4N6O B;  2W9P A;  1N9J A;  1YVB I;  3KSE D;  4N6U A;  1GD3 A;  4N6V 0;  2BO9 B;  5LC7 A;  1CYU A;  1DVD A;  1R4C A;  3UL6 A;  5EQL A;  3PS8 A;  1IV9 A;  1CEW I;  1NB3 I;  1PFP A;  1A67 A;  1RN7 A;  1LXE A;  1N5P A;  1A90 A;  3MWZ A;  1GD4 A;  5LC6 A;  3PYJ A;  4LZI A;  1STF I;  3IMA B;  3SVA A;  4EYC A;  1FA3 A;  1MOL A; 
#chains in the Genus database with same CATH topology
 2O3O A;  3GRD A;  4OUQ A;  3GWR A;  1OF5 A;  1LRA A;  2QGU A;  1KSI A;  1R4Y A;  1S5A A;  3GZX B;  1I8V A;  1GOU A;  2K54 A;  2LYX A;  2KAA A;  1X1Y A;  4H3U A;  5A0O B;  4Q53 A;  3QRD A;  2QIY A;  3EC9 A;  4HVN A;  2O9U X;  4BIR A;  4BTW A;  2PZV A;  1UCI A;  3PXM A;  1GOY A;  4O2H A;  1N5H A;  4LYL B;  5IG0 A;  2HMM B;  3J7Y d;  1VQL 3;  2XFS A;  1Q9E A;  3EX9 A;  4K90 B;  4N6L A;  3O8Y A;  1DVC A;  4N6M A;  2W04 A;  3DUK A;  5ELJ A;  1Y4K A;  3LT9 A;  1BOX A;  4KT3 B;  5M19 A;  4N3V A;  3CCV 3;  4DKI A;  3LYG A;  2YFJ B;  3MHE A;  3KN4 A;  2CK3 H;  1FGR A;  1QAK A;  2CX0 A;  3OWS A;  1AY7 A;  3CCR 3;  1RCK A;  3WMD A;  3DGY A;  3B7C A;  1FZU A;  1TRQ A;  3CXC 2;  1BRI A;  2XH9 A;  3NM2 A;  1N8Q A;  3PZW A;  7STD A;  5ELU A;  1ROV A;  5D81 A;  3FG4 A;  2CFD A;  5STD A;  1B20 A;  2P09 A;  1IDP A;  3H3H A;  7GSP A;  1BUJ A;  1LVN A;  1JNQ A;  5KP3 A;  1JKG B;  4HAA A;  2BMR B;  3CME 3;  4RBN A;  4OVM A;  1T2I A;  1CH0 A;  1RTU A;  5G1K A;  3UJM A;  1FUS A;  3X3Y A;  1QJG A;  4HM3 B;  1VZZ A;  1IYY A;  5HGR A;  2ZHX B;  4AKY A;  3UNL A;  2JDI H;  3LT8 A;  2CG1 A;  3VGN A;  2KXG A;  4FMD A;  5IEP A;  4ORL A;  1VQ7 3;  2XF3 A;  1VQ4 3;  1ISK A;  3NXJ A;  3N8B A;  2W03 A;  2FGT A;  3SED A;  2P38 A;  4RNY A;  2ZA4 A;  1YGE A;  3JUN A;  1O7N B;  1UUG B;  3F7X A;  4HM8 B;  4XDW A;  2D1W A;  4J5G A;  1EEJ A;  3JVC A;  3OWU A;  5AI1 A;  3K7C A;  4K61 A;  1YVB I;  3I0Y A;  3KSE D;  2C4B A;  2UGI A;  1YNV X;  3KKG A;  6RNT A;  5JPU A;  2BO9 B;  3NV0 B;  1RCL A;  1RGL A;  3FLJ A;  3UB1 A;  2XFT A;  7RNT A;  1KQS 2;  1W02 A;  2B1X B;  3WOE B;  3KZT A;  1QVF 2;  1DVD A;  1R4C A;  3G8Z A;  4JF8 A;  2OQE A;  4MMZ B;  4HZB B;  2FNQ A;  2M7O A;  3PS8 A;  4XBY A;  1ULI B;  1K9M 4;  2CC3 A;  2ML5 A;  9RNT A;  1MWU A;  1RGC A;  4KFE A;  3LTB A;  3CD6 3;  2LQV A;  4STD A;  1PFP A;  2CWV A;  5IER A;  5M18 A;  4HOH A;  2MC8 A;  1K28 A;  1JBS A;  1A67 A;  3G16 A;  1DE3 A;  4EBG A;  2XR8 B;  3EF8 A;  8CHO A;  4O02 B;  1ASK A;  5EEO A;  2W0Q A;  5FGO A;  2GXF A;  2HML B;  1BNR A;  1RNT A;  1MWR A;  2GEY A;  3SYU A;  1I70 A;  1X1W A;  2W2C A;  3N9H A;  1JBT A;  1GD4 A;  3JUM A;  5G1L A;  1HU9 A;  3AHS A;  1BRK A;  2KF3 A;  1TFO A;  2K3D A;  5TGN A;  4G1M B;  5AYS C;  2E2U A;  1O7M B;  3WOF B;  1MOL A;  3NBJ A;  1RSN A;  3NM7 A;  2KRT A;  3NQY A;  2PNC A;  1AQZ A;  2IYJ A;  3CMA 3;  2F4Y A;  1JZO A;  1SJW A;  3CCM 3;  2L1S A;  2GU1 A;  1VQ9 3;  3WDG B;  4QWT A;  2BMQ B;  2ML6 A;  1LQM B;  3CPO A;  1JZD A;  3FG1 A;  3STD A;  2W56 B;  3D3L A;  1G96 A;  4RNZ A;  1W00 A;  2KCD A;  3FG3 A;  3RGA A;  1HYF A;  3A5E A;  2BMO B;  2Q07 A;  2XEP A;  3BND A;  3D5I A;  1IVU A;  5BIR A;  1IV7 A;  2CX1 A;  1GMR A;  1STD A;  1OHS A;  1RN1 A;  4FCZ A;  2R4I A;  4HM6 B;  4HM5 B;  2SBL A;  3X40 A;  1LNI A;  1FGQ A;  5I97 A;  2OCT A;  1V57 A;  5DRE A;  3T8N A;  1YJ9 3;  3SOY A;  3F40 A;  1JRQ A;  1B2X A;  1IQY A;  1NDO B;  1MWT A;  3JUQ A;  2B24 B;  3HZP A;  2P0M A;  4CJN A;  4XDV A;  1B2S A;  3IPT A;  1C54 A;  3F9S A;  1GOV A;  4N6N B;  5M1A A;  3GSP A;  4GSP A;  1NB5 I;  2HMK B;  5JPP A;  4KZ1 A;  1VQP 3;  5AIF A;  3U1W A;  3X3X A;  3Q2P A;  1HZ1 A;  4HM0 B;  2HOH A;  4KFF A;  3X42 A;  3K9M C;  5AIH A;  2UX0 A;  1LQG C;  3EB8 A;  3CC7 3;  3OW2 2;  1VQM 3;  3NQZ A;  3FSD A;  3SX1 A;  1W6Y A;  1T5Y A;  4NHF A;  1RRH A;  2CFW A;  3EN1 B;  5EVH A;  1YVS A;  4R9L A;  1CYV A;  4KVH A;  3CCQ 3;  2C10 A;  1B2M A;  1E3R A;  4N6T A;  1G02 A;  1IVW A;  3CNX A;  4X2H A;  1GS3 A;  1V58 A;  1BNG A;  3NBR A;  1GY7 A;  4R1K A;  2IUK A;  3NX0 A;  6GSP A;  3E99 A;  3HX8 A;  3ZG0 A;  1BAO A;  5GSP A;  1K41 A;  1JB5 A;  5BXQ A;  1BIR A;  2HMJ B;  1Q40 B;  2E2V A;  3M8C A;  2ZL8 A;  3V92 A;  2F98 A;  1A2K A;  3Q90 A;  5CXO A;  4N6U A;  3NBB A;  1GD3 A;  3AMO A;  3EBY A;  3MG3 A;  4RZM A;  4WYK B;  5LC7 A;  1W2Z A;  1S72 3;  2UUG C;  2Z6B A;  3DMC A;  1BRH A;  3MYT A;  3UL6 A;  3X3Z A;  1UGI A;  3BNB A;  1T2H A;  3GZY B;  3KCH A;  3WA3 A;  1TFK A;  1WMP A;  2CFG A;  4HYZ A;  1BNJ A;  3ALA A;  1RGH A;  1RGK A;  4BTX A;  3I55 3;  1KD1 4;  1FYS A;  4L7K A;  4L8P A;  1U8C B;  1JN5 A;  1I2E A;  1NB3 I;  3D4A A;  3H51 A;  1SAR A;  2IA7 A;  3CU3 A;  5CF1 A;  3FCS B;  2WGO A;  1DMN A;  1EG9 B;  1AVL A;  1AV4 A;  4HZ9 B;  4LEH A;  4WP5 A;  1UI7 A;  1L5G B;  1RGF A;  1IT8 A;  2H0H A;  4EC6 A;  3CC4 3;  1J2B A;  4MMX B;  2CW9 A;  2QEX 3;  2AAD A;  4K1V A;  5AEU B;  2GSP A;  3AGN A;  4I5Q A;  1SPU A;  3K63 A;  2XGL A;  3PYJ A;  3RDE A;  1UCJ A;  1G0T A;  3SVA A;  3PGB A;  1FGO A;  3S29 A;  2Z76 A;  3F8X A;  2WOF A;  4FCJ A;  4MMY B;  3WA2 X;  1RNB A;  4HBR A;  4GB5 A;  5BU4 A;  2Y74 A;  1RMS A;  1WMO A;  3EHC A;  4IT7 A;  1D6U A;  1JB2 A;  2OQE C;  5D82 A;  1OPY A;  2CFK A;  3AHW A;  1BSE A;  5AEW B;  4BL3 A;  1BRJ A;  3DM8 A;  4AKZ A;  2F99 A;  3MG2 A;  1BAN A;  1YJW 3;  1SQW A;  4XB5 A;  1QVG 2;  3DGN A;  1BNE A;  1OF5 B;  3MPH A;  3FH1 A;  1GSP A;  3T0U A;  1BSD A;  3EBT A;  2Z77 A;  4TX4 A;  3A76 A;  2R41 A;  1OHO A;  5HOH A;  1MGW A;  3L0R A;  2E2T A;  3LTA A;  1YHQ 3;  2XSO B;  2HMO B;  2BU4 A;  3GAX A;  4BL2 A;  3T8U A;  1SII A;  1B2Z A;  2IY2 A;  1BRS A;  2YFL B;  8RNT A;  1I2G A;  1IVV A;  1QMA A;  2L4V A;  4GL6 A;  2RFR A;  2OOV A;  5IG5 A;  4FMA A;  1BRN L;  1FGT A;  3ECF A;  1A2V A;  2KF5 A;  4MJD A;  3NHX A;  4FCM A;  1W7C A;  2IMJ A;  3DY5 A;  3CCU 3;  1DYU A;  1BUQ A;  3HIG A;  3LOY A;  4J8T A;  2OTL 3;  1JKG A;  4H61 A;  2C11 A;  2BT3 A;  1BSB A;  1ZO2 A;  1NNV A;  4JRF A;  3RNT A;  1K73 4;  1FUW A;  3D79 A;  4J9A A;  2W6J H;  1VQ5 3;  1BSA A;  2BIR A;  2F5W A;  1GMQ A;  1I0V A;  3PCS A;  1GYB A;  1W4N A;  1WTH A;  3DZL A;  3S27 A;  5RNT A;  2YFI B;  5JBS A;  1VQ6 3;  1FUT A;  3EN8 A;  3FF2 A;  1QAL A;  3B4O A;  2ZDJ A;  3QK9 A;  4FMB A;  3OXA A;  4WHA A;  1LNH A;  2XGN A;  1MNL A;  3OWY A;  5CLK A;  5IG4 A;  1B21 A;  1Q82 4;  1N9E A;  2CH9 A;  2K0M A;  1CQS A;  3NV0 A;  3BIR A;  1F8N A;  1NWW A;  5AIG A;  4HJL B;  4FMC A;  1YJN 3;  1OGX A;  1X1U A;  1IK3 A;  1BNS A;  2F86 B;  1GY6 A;  2CWT A;  1W6C A;  2XSH B;  1B27 A;  3B4P A;  3DGO A;  3EE1 A;  3FZW A;  4LSO A;  1RGE A;  4N6V 0;  4EV2 A;  1W6G A;  3F8H A;  3G4S 3;  4ILF A;  3LTC A;  2GBX B;  1W2B 2;  1Q86 4;  5CF2 A;  3DGL A;  4EXR A;  1O7G B;  4O3V A;  4O8S A;  2AAE A;  1I3I A;  1O7H B;  3ZFZ A;  4NPB A;  4EV5 A;  3DXO A;  1ZX2 A;  1ZGX A;  2OWP A;  2MF7 A;  5BVB A;  1OH0 A;  3CNM A;  1A2P A;  1YIJ 3;  2RGQ A;  2Z7A A;  1IV9 A;  5CK6 A;  1D6Z A;  1IU7 A;  1VQK 3;  2P05 A;  1V74 A;  4R80 A;  3FGY A;  1RN7 A;  1RHL A;  2CHC A;  2J8X B;  3B8L A;  5AYR B;  4BU4 A;  1VQ8 3;  4EW5 A;  1UCK A;  2H0I A;  3LML A;  2V1L A;  2RSX A;  3LXU X;  1DMQ A;  1BNI A;  1MGR A;  4OK0 A;  3S28 A;  3LZA A;  3F7S A;  4K1U A;  3MWZ A;  3K0Z A;  1W01 A;  1TTO A;  3SLU A;  1UUW B;  5D83 A;  2CFL A;  2RNT A;  4FR9 A;  4L8O A;  5LC6 A;  1ZS7 A;  4LZI A;  4X2O A;  3DGM A;  3IMA B;  4HM2 B;  3URP A;  2XRX B;  4EYC A;  3V98 A;  2F56 A;  1Z1S A;  1BVI A;  1LOV A;  2RCD A;  2W56 A;  3OX9 A;  1I3F A;  1N8R 4;  1OCV A;  2GBW B;  3BNE A;  3JUP A;  1NO3 A;  3FF0 A;  1DMM A;  1E97 A;  1OGZ A;  1C7H A;  1JJ2 2;  3G71 3;  1RJO A;  1OHP A;  3V99 A;  4CDL A;  4R4K A;  3HI7 A;  5DRV A;  3ROB A;  1ROA A;  3WR2 A;  2FXT A;  4WWU C;  3U97 A;  5IG3 A;  4RNT A;  3BNC A;  1YIT 3;  2KF6 A;  3CCE 3;  3SXX A;  1UCL A;  2I9W A;  3GZR A;  2KF4 A;  4CCV A;  1U5O A;  1IT7 A;  3UL5 A;  3EJV A;  2STD A;  1PY3 A;  1M90 4;  1B2U A;  2OTJ 3;  1TRP A;  4XBX A;  5IEN A;  4I4K A;  2CWU A;  3NUV A;  3CPW 2;  4IPB A;  4NRE A;  1VQQ A;  1M1K 4;  1PYL A;  2GU3 A;  2QA4 3;  2WO0 A;  3I56 3;  2A15 A;  2W9Q A;  1WQL B;  1YI2 3;  1TIJ A;  2YX9 A;  1RRL A;  1YGW A;  4XBT A;  5G2G A;  3RGR A;  3G0K A;  4BTY A;  3PCR A;  1Q7H A;  4CPK A;  3OV4 A;  1UW1 A;  1RKY A;  1D6Y A;  1FGM A;  3VSY A;  1UUV B;  1JB4 A;  3S67 A;  2P0X A;  1M9G A;  3X41 A;  1US1 A;  3KSP A;  3Q3F A;  2CKF B;  1LOX A;  1WNH A;  3IJE B;  3CCL 3;  1VQN 3;  2JQ5 A;  2GEX A;  2WGQ A;  1RGA A;  1LOW A;  4PEJ A;  1O7P B;  3CC2 3;  4KFD A;  1EQK A;  1JBR A;  5IW9 A;  4IIA A;  3AGO A;  1MWS A;  3KE7 A;  3F14 A;  4HM4 B;  3K5T A;  3G6E 3;  1FW7 A;  2INX A;  1Q81 4;  5KP4 A;  3KFQ C;  1TU5 A;  1LOY A;  3ZG5 A;  4ZM8 A;  1RN4 A;  3MKI A;  1RDS A;  2F5M A;  3JUO A;  4LGQ A;  1Q40 A;  5IF6 A;  1KWI A;  3LH4 A;  3CCS 3;  1OUN A;  3LTD A;  3S5C A;  1EUI C;  4HKV B;  1JV2 B;  1Q7Y 4;  4R9K A;  1QAF A;  1IQ8 A;  2WOH A;  1UDI I;  2Y73 A;  4N6O B;  3D9R A;  1BU4 A;  4WYK A;  1B3S A;  2OOV C;  2W9P A;  3WHO A;  1AVK A;  1N9J A;  1OAC A;  4WFO A;  3DH2 A;  3WOD G;  1HKX A;  3VF1 A;  1TJD A;  2D42 A;  1EKM A;  1EA2 A;  3D5G A;  2SAR A;  3HII A;  3MSO A;  3N54 B;  1TP6 A;  1CYU A;  3BLZ A;  3KII A;  1E3V A;  1M1X B;  3HOH A;  2IUJ A;  5EQL A;  2CG0 A;  1Q42 A;  1K8A 4;  5KP1 A;  1KC8 4;  1NJI 4;  1BNF A;  1CEW I;  3AMO B;  5AII A;  5IEO A;  1VQO 3;  1TUH A;  4J5K A;  1X1X A;  1I2F A;  2H0G A;  4AEQ A;  1W5Z A;  4MEI A;  1GY5 A;  1LXE A;  3EQQ B;  1I0X A;  2BHM A;  1GMP A;  4LMI A;  1N5P A;  4XM4 A;  3SOA A;  1NU3 A;  1T3B A;  1PU4 A;  3TDG A;  4HM1 B;  1BRG A;  1JN5 B;  3ER7 A;  1ULJ B;  6STD A;  1A90 A;  1AR0 A;  3Q1C A;  4HM7 B;  1BSC A;  2HMN B;  5FW5 A;  2CIU A;  3FKA A;  1DET A;  3BU4 A;  1SIH A;  3MG1 A;  4GHO A;  1RGG A;  1IQX A;  1RLS A;  1STF I;  3CCJ 3;  2BNG A;  1O7W B;  1BGS A;  1UGH I;  1IVX A;  3HK4 A;  1FA3 A;  2RBI A;  3BB9 A;  1WMN A;  1UI8 A;  4U13 A;  3GZB A; 
#chains in the Genus database with same CATH homology
 2O3O A;  3GRD A;  4OUQ A;  3GWR A;  1OF5 A;  2QGU A;  1KSI A;  1S5A A;  3GZX B;  2K54 A;  2LYX A;  4H3U A;  5A0O B;  4Q53 A;  3QRD A;  2QIY A;  3EC9 A;  4HVN A;  2O9U X;  4BTW A;  2PZV A;  3PXM A;  4O2H A;  1N5H A;  5IG0 A;  2HMM B;  3J7Y d;  1VQL 3;  2XFS A;  3EX9 A;  4K90 B;  4N6M A;  4N6L A;  3O8Y A;  1DVC A;  2W04 A;  3DUK A;  5ELJ A;  1Y4K A;  3LT9 A;  4N3V A;  3CCV 3;  3LYG A;  2YFJ B;  3MHE A;  3KN4 A;  2CK3 H;  1FGR A;  1QAK A;  3OWS A;  3CCR 3;  3WMD A;  3B7C A;  3CXC 2;  2XH9 A;  3NM2 A;  1N8Q A;  3PZW A;  7STD A;  5ELU A;  1ROV A;  5D81 A;  3FG4 A;  2CFD A;  5STD A;  2P09 A;  1IDP A;  3H3H A;  1LVN A;  1JNQ A;  5KP3 A;  1JKG B;  2BMR B;  3CME 3;  4RBN A;  4OVM A;  3X3Y A;  3UJM A;  1QJG A;  4HM3 B;  1VZZ A;  5HGR A;  4AKY A;  3UNL A;  2JDI H;  3LT8 A;  2CG1 A;  3VGN A;  2KXG A;  4FMD A;  5IEP A;  4ORL A;  1VQ7 3;  2XF3 A;  1VQ4 3;  1ISK A;  3NXJ A;  3N8B A;  2W03 A;  2FGT A;  3SED A;  2P38 A;  4RNY A;  3JUN A;  1YGE A;  1O7N B;  4HM8 B;  3F7X A;  4XDW A;  2D1W A;  3JVC A;  3OWU A;  5AI1 A;  3K7C A;  4K61 A;  1YVB I;  3I0Y A;  3KSE D;  3KKG A;  5JPU A;  2BO9 B;  3NV0 B;  3UB1 A;  3FLJ A;  2XFT A;  1KQS 2;  1W02 A;  2B1X B;  3WOE B;  3KZT A;  1QVF 2;  1DVD A;  1R4C A;  3G8Z A;  4JF8 A;  2OQE A;  4MMZ B;  4HZB B;  2FNQ A;  2M7O A;  3PS8 A;  4XBY A;  1ULI B;  1K9M 4;  2CC3 A;  2ML5 A;  4KFE A;  3CD6 3;  3LTB A;  2LQV A;  4STD A;  1PFP A;  2CWV A;  5IER A;  2MC8 A;  1K28 A;  1A67 A;  3G16 A;  4EBG A;  2XR8 B;  3EF8 A;  8CHO A;  4O02 B;  1ASK A;  5EEO A;  2W0Q A;  5FGO A;  2GXF A;  2HML B;  2GEY A;  3N9H A;  2W2C A;  1GD4 A;  3JUM A;  1HU9 A;  1TFO A;  5TGN A;  4G1M B;  5AYS C;  2E2U A;  1O7M B;  3WOF B;  1MOL A;  3NBJ A;  3NM7 A;  2KRT A;  3NQY A;  2PNC A;  3CMA 3;  1SJW A;  3CCM 3;  1VQ9 3;  2GU1 A;  3WDG B;  4QWT A;  2BMQ B;  2ML6 A;  3CPO A;  3FG1 A;  3STD A;  2W56 B;  3D3L A;  1G96 A;  4RNZ A;  1W00 A;  2KCD A;  3FG3 A;  3RGA A;  2BMO B;  2Q07 A;  2XEP A;  3BND A;  1IVU A;  1IV7 A;  1STD A;  1OHS A;  4FCZ A;  2R4I A;  4HM6 B;  4HM5 B;  2SBL A;  3X40 A;  1FGQ A;  5I97 A;  2OCT A;  5DRE A;  3T8N A;  1YJ9 3;  3SOY A;  3F40 A;  1JRQ A;  1IQY A;  1NDO B;  3JUQ A;  2B24 B;  3HZP A;  2P0M A;  4XDV A;  3IPT A;  3F9S A;  4N6N B;  1NB5 I;  2HMK B;  5JPP A;  4KZ1 A;  1VQP 3;  5AIF A;  3U1W A;  3X3X A;  3Q2P A;  4HM0 B;  4KFF A;  3X42 A;  3K9M C;  5AIH A;  2UX0 A;  3EB8 A;  3CC7 3;  3OW2 2;  1VQM 3;  3NQZ A;  3FSD A;  3SX1 A;  1W6Y A;  1T5Y A;  4NHF A;  1RRH A;  2CFW A;  3EN1 B;  5EVH A;  4R9L A;  1CYV A;  4KVH A;  3CCQ 3;  2C10 A;  1E3R A;  4N6T A;  1IVW A;  3CNX A;  4X2H A;  1GS3 A;  3NBR A;  1GY7 A;  4R1K A;  2IUK A;  3NX0 A;  3E99 A;  3HX8 A;  1K41 A;  1JB5 A;  5BXQ A;  2HMJ B;  1Q40 B;  2E2V A;  3M8C A;  2ZL8 A;  3V92 A;  2F98 A;  1A2K A;  3Q90 A;  5CXO A;  4N6U A;  3NBB A;  1GD3 A;  3AMO A;  3EBY A;  3MG3 A;  4RZM A;  4WYK B;  5LC7 A;  1W2Z A;  1S72 3;  2Z6B A;  3DMC A;  3X3Z A;  3MYT A;  3UL6 A;  3BNB A;  3GZY B;  3WA3 A;  1TFK A;  1WMP A;  2CFG A;  4HYZ A;  4BTX A;  3ALA A;  3I55 3;  1KD1 4;  4L7K A;  4L8P A;  1U8C B;  1JN5 A;  1NB3 I;  3H51 A;  2IA7 A;  3CU3 A;  5CF1 A;  3FCS B;  2WGO A;  1DMN A;  1EG9 B;  1AVL A;  1AV4 A;  4HZ9 B;  4LEH A;  4WP5 A;  1UI7 A;  1L5G B;  1IT8 A;  4EC6 A;  1J2B A;  3CC4 3;  4MMX B;  2CW9 A;  2QEX 3;  4K1V A;  5AEU B;  1SPU A;  3K63 A;  2XGL A;  3PYJ A;  3RDE A;  3SVA A;  3PGB A;  1FGO A;  3S29 A;  2Z76 A;  3F8X A;  2WOF A;  4FCJ A;  4MMY B;  3WA2 X;  4HBR A;  4GB5 A;  2Y74 A;  1WMO A;  3EHC A;  4IT7 A;  1D6U A;  1JB2 A;  2OQE C;  5D82 A;  1OPY A;  2CFK A;  5AEW B;  3DM8 A;  4AKZ A;  2F99 A;  3MG2 A;  1QVG 2;  1SQW A;  4XB5 A;  3DGN A;  1OF5 B;  3MPH A;  3FH1 A;  3T0U A;  3EBT A;  2Z77 A;  4TX4 A;  3A76 A;  1OHO A;  3L0R A;  2E2T A;  3LTA A;  1YHQ 3;  2XSO B;  2HMO B;  3GAX A;  3T8U A;  1SII A;  2YFL B;  1IVV A;  1QMA A;  2L4V A;  4GL6 A;  2RFR A;  2OOV A;  5IG5 A;  4FMA A;  1FGT A;  3ECF A;  1A2V A;  4MJD A;  3NHX A;  4FCM A;  1W7C A;  2IMJ A;  3DY5 A;  3CCU 3;  1DYU A;  1BUQ A;  3HIG A;  3LOY A;  4J8T A;  2OTL 3;  1JKG A;  4H61 A;  2C11 A;  2BT3 A;  1ZO2 A;  4JRF A;  1K73 4;  1FUW A;  4J9A A;  2W6J H;  1VQ5 3;  3PCS A;  1GYB A;  1W4N A;  1WTH A;  3DZL A;  3S27 A;  2YFI B;  5JBS A;  1VQ6 3;  3EN8 A;  3FF2 A;  1QAL A;  3B4O A;  2ZDJ A;  3QK9 A;  4FMB A;  3OXA A;  4WHA A;  1LNH A;  2XGN A;  1MNL A;  3OWY A;  5CLK A;  5IG4 A;  1Q82 4;  1N9E A;  2CH9 A;  2K0M A;  1CQS A;  3NV0 A;  1F8N A;  1NWW A;  5AIG A;  4HJL B;  4FMC A;  1YJN 3;  1OGX A;  1IK3 A;  2F86 B;  1GY6 A;  2CWT A;  1W6C A;  2XSH B;  3B4P A;  3DGO A;  3EE1 A;  4LSO A;  3FZW A;  4N6V 0;  4EV2 A;  1W6G A;  3F8H A;  3G4S 3;  1W2B 2;  3LTC A;  2GBX B;  1Q86 4;  5CF2 A;  3DGL A;  4EXR A;  1O7G B;  4O3V A;  4O8S A;  1O7H B;  4EV5 A;  3DXO A;  1ZX2 A;  2OWP A;  2MF7 A;  5BVB A;  1OH0 A;  3CNM A;  1YIJ 3;  2RGQ A;  2Z7A A;  1IV9 A;  5CK6 A;  1D6Z A;  1IU7 A;  1VQK 3;  2P05 A;  1V74 A;  4R80 A;  3FGY A;  1RN7 A;  2CHC A;  3B8L A;  5AYR B;  1VQ8 3;  3LML A;  2V1L A;  2RSX A;  3LXU X;  1DMQ A;  4OK0 A;  3S28 A;  3LZA A;  3F7S A;  4K1U A;  3MWZ A;  3K0Z A;  1W01 A;  3SLU A;  1UUW B;  5D83 A;  2CFL A;  4FR9 A;  4L8O A;  5LC6 A;  4LZI A;  4X2O A;  3DGM A;  3IMA B;  4HM2 B;  4EYC A;  2XRX B;  3V98 A;  1Z1S A;  2RCD A;  2W56 A;  3OX9 A;  1N8R 4;  1OCV A;  2GBW B;  3BNE A;  3JUP A;  1NO3 A;  3FF0 A;  1DMM A;  1E97 A;  1OGZ A;  1C7H A;  1JJ2 2;  3G71 3;  1RJO A;  1OHP A;  3V99 A;  4CDL A;  4R4K A;  3HI7 A;  5DRV A;  3ROB A;  1ROA A;  2FXT A;  4WWU C;  3U97 A;  5IG3 A;  3BNC A;  1YIT 3;  3CCE 3;  3SXX A;  2I9W A;  3GZR A;  4CCV A;  1U5O A;  1IT7 A;  3UL5 A;  3EJV A;  2STD A;  1M90 4;  2OTJ 3;  4XBX A;  5IEN A;  4I4K A;  2CWU A;  3NUV A;  3CPW 2;  4IPB A;  4NRE A;  1M1K 4;  2GU3 A;  2QA4 3;  2WO0 A;  3I56 3;  2A15 A;  2W9Q A;  1WQL B;  1YI2 3;  1TIJ A;  2YX9 A;  1RRL A;  4XBT A;  5G2G A;  3RGR A;  3G0K A;  4BTY A;  3PCR A;  3OV4 A;  1UW1 A;  1RKY A;  1D6Y A;  1FGM A;  3VSY A;  1UUV B;  1JB4 A;  3S67 A;  2P0X A;  1M9G A;  3X41 A;  1US1 A;  3KSP A;  2CKF B;  1LOX A;  1WNH A;  3IJE B;  3CCL 3;  1VQN 3;  2JQ5 A;  2GEX A;  2WGQ A;  4PEJ A;  1O7P B;  3CC2 3;  4KFD A;  1EQK A;  5IW9 A;  4IIA A;  3KE7 A;  3F14 A;  4HM4 B;  3K5T A;  3G6E 3;  2INX A;  1Q81 4;  5KP4 A;  3KFQ C;  1TU5 A;  4ZM8 A;  3MKI A;  3JUO A;  4LGQ A;  1Q40 A;  5IF6 A;  1KWI A;  3LH4 A;  3CCS 3;  1OUN A;  3LTD A;  3S5C A;  4HKV B;  1JV2 B;  1Q7Y 4;  4R9K A;  1QAF A;  1IQ8 A;  2WOH A;  2Y73 A;  4N6O B;  3D9R A;  4WYK A;  1YJW 3;  2OOV C;  2W9P A;  1AVK A;  1N9J A;  1OAC A;  4WFO A;  3WOD G;  1HKX A;  3VF1 A;  2D42 A;  1EKM A;  1EA2 A;  3HII A;  3MSO A;  3N54 B;  1TP6 A;  1CYU A;  3BLZ A;  3KII A;  1E3V A;  1M1X B;  2IUJ A;  5EQL A;  2CG0 A;  1Q42 A;  1K8A 4;  5KP1 A;  1KC8 4;  1NJI 4;  1CEW I;  3AMO B;  5AII A;  5IEO A;  1VQO 3;  1TUH A;  4AEQ A;  1W5Z A;  4MEI A;  1GY5 A;  1LXE A;  3EQQ B;  2BHM A;  4LMI A;  1N5P A;  4XM4 A;  3SOA A;  1NU3 A;  1PU4 A;  3TDG A;  4HM1 B;  1JN5 B;  3ER7 A;  1ULJ B;  6STD A;  1A90 A;  1AR0 A;  3Q1C A;  4HM7 B;  2HMN B;  5FW5 A;  2CIU A;  3FKA A;  3MG1 A;  1SIH A;  1IQX A;  1STF I;  3CCJ 3;  2BNG A;  1O7W B;  1IVX A;  3HK4 A;  1FA3 A;  3BB9 A;  1WMN A;  1UI8 A;  4U13 A;  3GZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...