4EYCA

Crystal structure of the cathelin-like domain of human cathelicidin ll-37 (hcld)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
103
Chain Sequence
GSHMQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathelicidin antimicrobial peptide
publication title Structural and Functional Analysis of the Pro-Domain of Human Cathelicidin, LL-37.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 26
structure length 103
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4eycA00
1DVCA 2O9UX 5LC7A 4N6OB 4N6UA 3UL5A 2CH9A 1RN7A 3KSED 3PYJA 1IV7A 4LZIA 1CYVA 1FUWA 4N6TA 2W9QA 1MNLA 4EYCA 1LXEA 1YVBI 4IT7A 2W9PA 1TIJA 4N6MA 1NB3I 1G96A 3KFQC 1DVDA 1FA3A 5EQLA 2OCTA 3UL6A 1R4CA 3IMAB 1N5HA 4N6V0 3S67A 4ZM8A 5ELUA 1M9GA 3PXMA 4N6LA 1GD3A 1PFPA 4N6NB 1N9JA 1GD4A 1KWIA 3PS8A 1A90A 1ROAA 3SVAA 3MWZA 1N5PA 3L0RA 5ELJA 4CCVA 1CYUA 3NX0A 5LC6A 2KXGA 3QRDA 2BO9B 1EQKA 4TX4A 1CEWI 1NB5I 1IV9A 3GAXA 5A0OB 1STFI 1A67A 3LH4A 1MOLA 1WNHA 3K9MC 3Q2PA
chains in the Genus database with same CATH superfamily
4MMZB 1DVCA 2O9UX 2R41A 2WGQA 3WHOA 1YJW3 1GMPA 5IW9A 4LSOA 1VZZA 3I563 1RN7A 1JBRA 2W2CA 4FMAA 5RNTA 3LTDA 2C4BA 1LOVA 2JDIH 3BIRA 3FF2A 1UCIA 3S29A 3HZPA 1RHLA 1Q9EA 1V58A 2W9QA 1B27A 2GBXB 1O7NB 4O02B 2HMKB 4JRFA 1Y4KA 1M1K4 4CJNA 4IT7A 1EG9B 1OGZA 1RGGA 3ROBA 6GSPA 5IEOA 1RNTA 3RGRA 2W9PA 3STDA 1DMQA 1T2IA 3GZXB 4XBTA 5G1KA 5BU4A 3GSPA 3G16A 1TRPA 2GSPA 2JQ5A 1BRGA 1EKMA 1TFKA 1I3FA 2QIYA 3FG4A 3V92A 1NB3I 1NU3A 1G96A 3CCM3 5HOHA 4GB5A 3GZBA 1MWRA 1O7MB 2F5MA 3X3ZA 9RNTA 3CU3A 3EC9A 3JVCA 2CWUA 1JB4A 5EQLA 3UL6A 7STDA 1AQZA 3CCL3 1VQP3 1JRQA 1BAOA 1BNSA 4MMXB 3IMAB 1A2VA 3B4OA 1N5HA 8RNTA 3U97A 2QEX3 2XH9A 2WGOA 2C11A 3F7XA 4ZM8A 5ELUA 1R4YA 3HIGA 3Q90A 4XM4A 3B7CA 3EBYA 3OV4A 2GBWB 1OH0A 2F5WA 3B8LA 4GHOA 1GY6A 1Q864 1VQQA 5IERA 1RSNA 3X3XA 1PFPA 2HMNB 1ZGXA 4QWTA 3URPA 5HGRA 1M904 1BUJA 4K61A 1KQS2 1BRNL 1RGLA 4HM3B 5JPPA 1I2GA 2CK3H 1RDSA 1A2KA 4J9AA 4CPKA 1Q42A 3NBRA 2SARA 1W7CA 3LXUX 3CMA3 2BU4A 4XB5A 5D83A 3CC23 3PS8A 1YGWA 4R1KA 4HZ9B 3FCSB 3V98A 1ROAA 3D4AA 3WOFB 4HM6B 3MWZA 3DZLA 3SEDA 1BNGA 4IPBA 4RBNA 1KSIA 1VQO3 1AVKA 1W2ZA 1TFOA 4CCVA 1BSEA 1BNEA 3N9HA 3LT8A 3NX0A 1F8NA 4O2HA 5CXOA 3S5CA 3D5GA 1US1A 5LC6A 2KXGA 3WDGB 3QRDA 2W0QA 4HZBB 1UDII 2CKFB 3FZWA 1IQ8A 4HVNA 3E99A 4TX4A 2KF6A 3FLJA 1CQSA 4HKVB 4HAAA 4PEJA 1UUVB 1CEWI 3ZFZA 2ZA4A 7GSPA 2O3OA 2XSHB 2BHMA 1MGRA 1BNRA 3FH1A 3DH2A 1W6YA 1ULIB 3H3HA 4I4KA 5IG3A 3KCHA 4H61A 3PGBA 4XDVA 3I553 3CCE3 2CFKA 1B2MA 5TGNA 2ML5A 1BSAA 1LOYA 3IPTA 3DGLA 1IT7A 1JB5A 1UCJA 2IY2A 3SX1A 1GSPA 1NWWA 1OF5A 2Z76A 3DY5A 3LH4A 2E2VA 1T3BA 1JBTA 3CCR3 2HOHA 3EHCA 1LQGC 3UL5A 1B2XA 2BMRB 3NV0A 5IENA 2HMMB 3F7SA 2CIUA 1GOUA 3KSED 1LOWA 1L5GB 2ZDJA 1ROVA 4FMDA 4LYLB 1I2FA 4NREA 2D42A 3HI7A 5GSPA 1JKGB 1IV7A 4J5KA 4AKYA 4K90B 4LZIA 4BTXA 1RMSA 4N6TA 1K9M4 2OQEC 3CXC2 3OWYA 1MNLA 1BRJA 1V74A 2H0HA 5D81A 1QALA 3JUQA 1YVBI 3D79A 1OACA 3MG1A 2BNGA 1FUTA 1RGFA 1B21A 2CC3A 2RSXA 2V1LA 1SJWA 1JN5A 1JNQA 3CCV3 5CF1A 1VQ43 5AYRB 1TU5A 1TIJA 4HM1B 3T8NA 3NM2A 3WA2X 3ZG5A 3G6E3 1I0XA 5DRVA 2YFJB 2W6JH 3KZTA 3EQQB 1OUNA 1BANA 1IU7A 3KFQC 3LTBA 1B3SA 1Q7Y4 2UX0A 1DVDA 3CC43 2CG0A 5AEWB 3LMLA 2RNTA 1FA3A 3M8CA 1SARA 1W4NA 6RNTA 4K1UA 3LZAA 3DGNA 3BNDA 1SIIA 3LOYA 3TDGA 3UNLA 3UB1A 4R4KA 1VQ63 2ZL8A 3G713 1VQ83 2GU3A 1GMQA 1TP6A 1RGKA 3KN4A 1N8R4 1GMRA 1PY3A 2Z77A 1UGIA 4CDLA 1BNFA 1M9GA 1X1WA 2K54A 4N3VA 1IQYA 5D82A 3CD63 1AY7A 3GWRA 1C54A 3EJVA 5JPUA 1OGXA 1BRHA 4WP5A 1JJ22 1X1XA 1GD3A 4EV2A 1VQN3 2W56B 3HOHA 3KKGA 4X2HA 1QVG2 2KF5A 2XFTA 3WR2A 1X1UA 2F56A 4N6NB 4FCMA 1UGHI 3F14A 1HZ1A 4AEQA 3EB8A 3GRDA 1WQLB 3GZYB 3LT9A 1KWIA 3N8BA 1BU4A 3VSYA 4FMBA 5KP4A 3B4PA 4NHFA 4OK0A 1A90A 1FGMA 5EVHA 3SXXA 3AGNA 3SVAA 1O7WB 2IUJA 2LYXA 7RNTA 4FCZA 5AIGA 1STDA 4J5GA 2H0IA 3JUOA 4JF8A 1OHOA 2HMOB 1DYUA 1MGWA 3JUNA 1I2EA 2BO9B 2CHCA 1IVWA 1E3VA 4HM0B 4OUQA 1FGQA 5AIHA 6STDA 3I0YA 1W00A 4HBRA 4R80A 1B20A 3EF8A 1QAKA 2OTL3 1BVIA 3DUKA 4BU4A 3EE1A 3K63A 2K0MA 1OCVA 2P0XA 1PYLA 3FGYA 3N54B 2RGQA 4U13A 2GU1A 1NO3A 4EBGA 1BOXA 1I0VA 1MWSA 3WOEB 1DETA 1K28A 1HKXA 1BUQA 1Q40B 2KF3A 1K8A4 1IVUA 2Z7AA 4DKIA 2J8XB 1A67A 4MEIA 1MOLA 1RCLA 4KFFA 1QMAA 2Z6BA 2GEYA 5IF6A 1S723 1W2B2 1VQL3 5G2GA 4EC6A 5LC7A 2RBIA 1FGTA 2IMJA 4N6OB 3LYGA 4FCJA 1GOVA 3MG3A 4GSPA 3DGYA 2YFLB 1X1YA 2I9WA 3MYTA 4L7KA 3LTCA 5AI1A 2KRTA 3BNBA 5M19A 3CCU3 4WFOA 1B2ZA 1CYVA 3CCJ3 1CH0A 2L1SA 2HMJB 4KT3B 1TUHA 1RKYA 3VGNA 1Q824 3SOYA 2OQEA 4WYKB 1ZO2A 2XEPA 1SQWA 1K41A 5KP3A 4HM8B 1BNJA 1RNBA 2P09A 2XSOB 1AV4A 1EA2A 1LRAA 1O7GB 3MG2A 5BVBA 1GOYA 3AMOB 1GY7A 3G8ZA 4BTWA 1NJI4 1HYFA 2QGUA 1GY5A 1SPUA 1E97A 4HM2B 1ULJB 2GEXA 2XGLA 5CLKA 1GS3A 4WHAA 1U8CB 3A5EA 1DMNA 2XF3A 1DE3A 3X40A 2Y73A 1KC84 2AAEA 3NBJA 4I5QA 3S28A 4K1VA 3OW22 2WO0A 1RLSA 2OCTA 1TJDA 3MKIA 3MPHA 1R4CA 4RNTA 5IG5A 1EUIC 3O8YA 1ISKA 4L8OA 2KAAA 4XBXA 2OWPA 1I3IA 2A15A 4N6V0 2OOVC 4KZ1A 1Q7HA 2F86B 3D3LA 1W6CA 2IA7A 3FG3A 4N6LA 1N8QA 1Z1SA 5CK6A 2MC8A 4XBYA 3NBBA 4OVMA 3ALAA 2D1WA 4R9KA 3DGMA 2C10A 3AHSA 4ILFA 1C7HA 3MSOA 3T8UA 1LNHA 2BT3A 2RCDA 3A76A 5AYSC 2YFIB 1N9JA 1RCKA 4NPBA 1NNVA 1UCLA 2HMLB 1E3RA 4X2OA 2K3DA 4AKZA 3BNCA 2CFDA 3EX9A 2M7OA 2CW9A 1EEJA 1JKGA 1N5PA 3BB9A 3IJEB 3L0RA 5ELJA 5STDA 3WMDA 3OX9A 4MJDA 1B2SA 2KF4A 1TTOA 2KCDA 3OWSA 1BSCA 2PNCA 1RGAA 1KD14 3BNEA 1O7PB 2W04A 1CYUA 3KIIA 3G4S3 5BXQA 2AADA 3GZRA 5AIFA 1WMNA 1D6YA 1OHPA 3Q3FA 3V99A 1BGSA 3EN1B 1EQKA 3NM7A 3FSDA 1YNVX 1YI23 1N9EA 1ZS7A 2E2UA 2QA43 4HYZA 1YJN3 1BNIA 1AR0A 1UI8A 3AGOA 1WMOA 4RNZA 1RRLA 3SLUA 4STDA 3CCS3 3PCSA 3DM8A 1BRSA 2XR8B 2IUKA 2Y74A 2CFLA 3GAXA 3DXOA 3QK9A 1W01A 2OTJ3 1STFI 1FGRA 4H3UA 5JBSA 4BIRA 5G1LA 2R4IA 4FR9A 4O3VA 3X42A 2STDA 5BIRA 5KP1A 1NDOB 1WNHA 4J8TA 4MMYB 3K9MC 1BSDA 3VF1A 1OHSA 2CWVA 1I8VA 3DGOA 2GXFA 2WOHA 3OWUA 2P05A 1W6GA 1WTHA 1JZOA 3D5IA 3CPOA 5FW5A 4N6UA 4RZMA 1GYBA 1IT8A 2CH9A 5I97A 1V57A 3ECFA 3PYJA 3T0UA 4HM4B 1MWTA 1UCKA 3RDEA 1K734 1FZUA 2FXTA 4LMIA 3BU4A 2INXA 4LEHA 1YGEA 2CWTA 1VQ93 1A2PA 4EV5A 4HJLB 2MF7A 1VQ73 2W56A 1T5YA 1FUWA 3NQYA 3RNTA 2P0MA 3F8XA 1RTUA 8CHOA 4KVHA 1O7HB 4EYCA 1LXEA 1QAFA 1VQM3 2CFWA 3JUMA 1MWUA 1QJGA 5AIIA 2ZHXB 1RN4A 3EBTA 1G0TA 1VQK3 1T2HA 2ML6A 3KE7A 4HM5B 1LQMB 4GL6A 3BLZA 1JBSA 1RGCA 2XFSA 5IG0A 1RJOA 3H51A 1JV2B 2SBLA 4ORLA 1RN1A 3JUPA 1RRHA 2CX1A 3DMCA 3K0ZA 4N6MA 1FGOA 4G1MB 1YJ93 1IK3A 3F8HA 4HOHA 1OF5B 1BSBA 1YVSA 3CNXA 3X41A 2UGIA 2CG1A 5CF2A 4WWUC 2BMQB 2E2TA 2L4VA 1IDPA 3KSPA 1W5ZA 2CX0A 2BMOB 3WODG 1OPYA 3SOAA 2F98A 3CC73 2FGTA 3LTAA 4RNYA 3OXAA 3S27A 3NV0B 3CPW2 3S67A 1U5OA 1B2UA 3UJMA 1PU4A 3NXJA 3K7CA 1RGEA 3PXMA 2OOVA 1UUWB 3RGAA 2B1XB 1ASKA 1LVNA 3HIIA 4BL2A 3FKAA 2UUGC 3NQZA 1FYSA 4O8SA 1ZX2A 2B24B 1Q40A 1LNIA 3MHEA 1D6UA 1WMPA 2H0GA 3PCRA 1VQ53 1G02A 1FUSA 3ER7A 1S5AA 5EEOA 3EN8A 1Q814 3Q1CA 5FGOA 4BL3A 1M1XB 1JN5B 1IQXA 1GD4A 2PZVA 1JB2A 5M18A 2FNQA 1J2BA 2CFGA 3G0KA 1BRIA 3PZWA 3SYUA 1FW7A 2BIRA 5IEPA 1SIHA 3K5TA 2F4YA 1RGHA 3HK4A 4HM7B 3ZG0A 1IYYA 2P38A 1BIRA 3F9SA 3HX8A 4IIAA 3CCQ3 1IVXA 4KFDA 1QVF2 4Q53A 5M1AA 1UW1A 2YX9A 1UI7A 4BTYA 5DREA 4LGQA 4WYKA 1BRKA 1TRQA 3F40A 3AHWA 1W02A 4R9LA 3FF0A 5AEUB 3CME3 2W03A 2F99A 1DMMA 3WA3A 3J7Yd 1D6ZA 3U1WA 1JZDA 2Q07A 3AMOA 1HU9A 2LQVA 1I70A 1UUGB 2WOFA 5IG4A 3FG1A 2IYJA 3NHXA 1NB5I 4EW5A 1YHQ3 2XRXB 1IV9A 1LOXA 2RFRA 3CNMA 4FMCA 5A0OB 1AVLA 1YIJ3 4XDWA 1YIT3 3X3YA 4L8PA 1IVVA 4KFEA 3D9RA 3NUVA 2XGNA 4EXRA 3Q2PA
chains in the Genus database with same CATH topology
4MMZB 1DVCA 2O9UX 2WGQA 1YJW3 5IW9A 4LSOA 1VZZA 3I563 1RN7A 2W2CA 4FMAA 3LTDA 2JDIH 3FF2A 3S29A 3HZPA 2W9QA 2GBXB 1O7NB 4O02B 2HMKB 4JRFA 1Y4KA 1M1K4 4IT7A 1EG9B 1OGZA 3ROBA 5IEOA 3RGRA 2W9PA 3STDA 1DMQA 3GZXB 4XBTA 3G16A 2JQ5A 1EKMA 1TFKA 2QIYA 3FG4A 3V92A 1NB3I 1NU3A 1G96A 3CCM3 4GB5A 3GZBA 1O7MB 3X3ZA 3CU3A 3EC9A 3JVCA 2CWUA 1JB4A 5EQLA 3UL6A 7STDA 3CCL3 1VQP3 1JRQA 4MMXB 3IMAB 1A2VA 3B4OA 1N5HA 3U97A 2QEX3 2XH9A 2WGOA 2C11A 3F7XA 4ZM8A 5ELUA 3HIGA 3Q90A 4XM4A 3B7CA 3EBYA 3OV4A 2GBWB 1OH0A 3B8LA 1Q864 1GY6A 5IERA 3X3XA 1PFPA 2HMNB 4QWTA 5HGRA 1M904 4K61A 1KQS2 4HM3B 5JPPA 2CK3H 1A2KA 4J9AA 1Q42A 3NBRA 1W7CA 3LXUX 3CMA3 4XB5A 5D83A 3CC23 3PS8A 4R1KA 4HZ9B 3FCSB 3V98A 1ROAA 3WOFB 4HM6B 3MWZA 3DZLA 3SEDA 4IPBA 4RBNA 1KSIA 1VQO3 1AVKA 1W2ZA 1TFOA 4CCVA 3N9HA 3NX0A 3LT8A 5CXOA 1F8NA 4O2HA 3WDGB 3S5CA 3CME3 1US1A 5LC6A 2KXGA 3QRDA 2W0QA 4HZBB 2CKFB 3FZWA 4HVNA 1IQ8A 3E99A 4TX4A 3FLJA 4HKVB 1CQSA 4PEJA 1UUVB 1CEWI 2O3OA 2XSHB 2BHMA 3FH1A 4I4KA 1W6YA 1ULIB 3H3HA 5IG3A 4H61A 3PGBA 4XDVA 3I553 3CCE3 2CFKA 5TGNA 2ML5A 3IPTA 3DGLA 1IT7A 1JB5A 3SX1A 1NWWA 1OF5A 2Z76A 3DY5A 3LH4A 2E2VA 3CCR3 3EHCA 3UL5A 2BMRB 3NV0A 5IENA 2HMMB 3F7SA 2CIUA 3KSED 1L5GB 2ZDJA 1ROVA 4FMDA 4NREA 2D42A 3HI7A 1JKGB 1IV7A 4AKYA 4K90B 4LZIA 4BTXA 4N6TA 1K9M4 2OQEC 3CXC2 3OWYA 1MNLA 1V74A 5D81A 1QALA 3JUQA 1YVBI 1OACA 3MG1A 2BNGA 2CC3A 2V1LA 2RSXA 3CCV3 1SJWA 1JNQA 1JN5A 1VQ43 5CF1A 5AYRB 1TU5A 1TIJA 4HM1B 3T8NA 3NM2A 3WA2X 3G6E3 5DRVA 2YFJB 2W6JH 3KZTA 3EQQB 1OUNA 3LTBA 1IU7A 3KFQC 1Q7Y4 2UX0A 1DVDA 3CC43 2CG0A 5AEWB 3LMLA 1FA3A 3M8CA 1W4NA 4K1UA 3LZAA 3DGNA 3BNDA 1SIIA 3LOYA 3TDGA 3UNLA 3UB1A 4R4KA 1VQ63 2ZL8A 3G713 1VQ83 2GU3A 1TP6A 3KN4A 1N8R4 2Z77A 4CDLA 3CD63 1M9GA 2K54A 4N3VA 1IQYA 5D82A 3GWRA 3EJVA 5JPUA 1OGXA 4WP5A 1JJ22 1GD3A 4EV2A 1VQN3 2W56B 3KKGA 4X2HA 1QVG2 2XFTA 4N6NB 4FCMA 3F14A 4AEQA 3EB8A 3GRDA 1WQLB 3GZYB 3LT9A 1KWIA 3N8BA 3VSYA 5KP4A 4FMBA 3B4PA 4NHFA 4OK0A 1A90A 1FGMA 5EVHA 3SXXA 3SVAA 1O7WB 2IUJA 2LYXA 4FCZA 5AIGA 1STDA 3JUOA 4JF8A 1OHOA 2HMOB 1DYUA 3JUNA 2BO9B 2CHCA 4OUQA 1IVWA 1E3VA 4HM0B 5AIHA 1FGQA 6STDA 3I0YA 1W00A 4HBRA 4R80A 3EF8A 1QAKA 2OTL3 3DUKA 3EE1A 3K63A 2K0MA 1OCVA 2P0XA 3FGYA 3N54B 2RGQA 4U13A 2GU1A 1NO3A 4EBGA 3WOEB 1K28A 1HKXA 1BUQA 1Q40B 1K8A4 1IVUA 2Z7AA 1A67A 4MEIA 1MOLA 4KFFA 1QMAA 2Z6BA 2GEYA 5IF6A 1S723 1W2B2 1VQL3 5G2GA 4EC6A 5LC7A 1FGTA 2IMJA 4N6OB 3LYGA 4FCJA 3MG3A 2YFLB 2I9WA 3MYTA 4L7KA 3LTCA 5AI1A 2KRTA 3BNBA 3CCU3 4WFOA 1CYVA 3CCJ3 2HMJB 1TUHA 1RKYA 3VGNA 1Q824 3SOYA 2OQEA 4WYKB 1ZO2A 2XEPA 1SQWA 1K41A 5KP3A 4HM8B 2P09A 2XSOB 1AV4A 1EA2A 1O7GB 3MG2A 5BVBA 3AMOB 1GY7A 3G8ZA 4BTWA 1NJI4 2QGUA 1GY5A 1SPUA 1E97A 4HM2B 1ULJB 2GEXA 2XGLA 5CLKA 1GS3A 4WHAA 1U8CB 1DMNA 2XF3A 3X40A 2Y73A 1KC84 3NBJA 3S28A 4K1VA 3OW22 2WO0A 2OCTA 3MKIA 3MPHA 1R4CA 5IG5A 3O8YA 1ISKA 4L8OA 4XBXA 2OWPA 2A15A 4N6V0 2OOVC 4KZ1A 2F86B 3D3LA 1W6CA 2IA7A 3FG3A 4N6LA 1N8QA 1Z1SA 5CK6A 2MC8A 4XBYA 3NBBA 4OVMA 3ALAA 2D1WA 4R9KA 3DGMA 2C10A 1C7HA 3MSOA 3T8UA 1LNHA 2BT3A 2RCDA 3A76A 5AYSC 2YFIB 1N9JA 2HMLB 1E3RA 4X2OA 4AKZA 3BNCA 2CFDA 3EX9A 2M7OA 2CW9A 1JKGA 1N5PA 3IJEB 3BB9A 3L0RA 5ELJA 5STDA 3WMDA 3OX9A 4MJDA 2KCDA 3OWSA 2PNCA 1KD14 1CYUA 3BNEA 1O7PB 2W04A 3KIIA 3G4S3 5BXQA 3GZRA 5AIFA 1WMNA 1D6YA 1OHPA 3V99A 3EN1B 1EQKA 3NM7A 3FSDA 1YI23 1N9EA 2E2UA 2QA43 4HYZA 1YJN3 1AR0A 1UI8A 1WMOA 4RNZA 1RRLA 3SLUA 4STDA 3CCS3 3PCSA 3DM8A 2Y74A 2XR8B 2IUKA 2CFLA 3GAXA 3DXOA 3QK9A 1W01A 2OTJ3 1STFI 1FGRA 4H3UA 5JBSA 2R4IA 4FR9A 4O3VA 3X42A 2STDA 5KP1A 1NDOB 1WNHA 4J8TA 4MMYB 3K9MC 3VF1A 1OHSA 2CWVA 3DGOA 2GXFA 2WOHA 3OWUA 2P05A 1W6GA 1WTHA 5FW5A 3CPOA 4N6UA 4RZMA 1GYBA 1IT8A 2CH9A 5I97A 3PYJA 3ECFA 3T0UA 4HM4B 3RDEA 1K734 2FXTA 4LMIA 2INXA 4LEHA 1YGEA 2CWTA 1VQ93 4EV5A 4HJLB 2MF7A 1VQ73 2W56A 1T5YA 1FUWA 3NQYA 2P0MA 3F8XA 8CHOA 4KVHA 1O7HB 4EYCA 1LXEA 1QAFA 1VQM3 2CFWA 3JUMA 1QJGA 5AIIA 3EBTA 1VQK3 2ML6A 3KE7A 4HM5B 4GL6A 3BLZA 2XFSA 5IG0A 1RJOA 3H51A 1JV2B 2SBLA 4ORLA 3JUPA 3K0ZA 1RRHA 3DMCA 4N6MA 1YJ93 1FGOA 4G1MB 1IK3A 3F8HA 1OF5B 3CNXA 3X41A 2CG1A 5CF2A 4WWUC 2BMQB 2E2TA 2L4VA 1IDPA 3KSPA 1W5ZA 2BMOB 3WODG 1OPYA 3SOAA 2F98A 3CC73 2FGTA 3LTAA 4RNYA 3OXAA 3S27A 3NV0B 3CPW2 3S67A 1U5OA 3UJMA 1PU4A 3NXJA 3K7CA 2OOVA 3PXMA 1UUWB 3RGAA 2B1XB 1ASKA 1LVNA 3HIIA 3FKAA 3NQZA 4O8SA 1ZX2A 2B24B 1Q40A 3MHEA 1D6UA 1WMPA 3PCRA 1VQ53 3ER7A 1S5AA 5EEOA 3EN8A 1Q814 3Q1CA 5FGOA 1M1XB 1JN5B 1IQXA 1GD4A 2PZVA 1JB2A 1J2BA 2FNQA 2CFGA 3G0KA 3PZWA 5IEPA 1SIHA 3K5TA 3HK4A 4HM7B 2P38A 3F9SA 3HX8A 4IIAA 3CCQ3 1IVXA 4KFDA 1QVF2 4Q53A 1UW1A 2YX9A 1UI7A 4BTYA 5DREA 4LGQA 4WYKA 3F40A 1W02A 4R9LA 3FF0A 5AEUB 2W03A 2F99A 1DMMA 3WA3A 3J7Yd 1D6ZA 3U1WA 2Q07A 3AMOA 1HU9A 2LQVA 5IG4A 2WOFA 3FG1A 3NHXA 1NB5I 1YHQ3 2XRXB 1IV9A 1LOXA 2RFRA 3CNMA 4FMCA 5A0OB 1AVLA 1YIJ3 4XDWA 1YIT3 3X3YA 4L8PA 1IVVA 4KFEA 3D9RA 3NUVA 2XGNA 4EXRA 3Q2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVC A;  2O9U X;  5LC7 A;  4N6O B;  4N6U A;  3UL5 A;  2CH9 A;  1RN7 A;  3KSE D;  3PYJ A;  1IV7 A;  4LZI A;  1CYV A;  1FUW A;  4N6T A;  2W9Q A;  1MNL A;  4EYC A;  1LXE A;  1YVB I;  4IT7 A;  2W9P A;  1TIJ A;  4N6M A;  1NB3 I;  1G96 A;  3KFQ C;  1DVD A;  1FA3 A;  5EQL A;  2OCT A;  3UL6 A;  1R4C A;  3IMA B;  1N5H A;  4N6V 0;  3S67 A;  4ZM8 A;  5ELU A;  1M9G A;  3PXM A;  4N6L A;  1GD3 A;  1PFP A;  4N6N B;  1N9J A;  1GD4 A;  1KWI A;  3PS8 A;  1A90 A;  1ROA A;  3SVA A;  3MWZ A;  1N5P A;  3L0R A;  5ELJ A;  4CCV A;  1CYU A;  3NX0 A;  5LC6 A;  2KXG A;  3QRD A;  2BO9 B;  1EQK A;  4TX4 A;  1CEW I;  1NB5 I;  1IV9 A;  3GAX A;  5A0O B;  1STF I;  1A67 A;  3LH4 A;  1MOL A;  1WNH A;  3K9M C;  3Q2P A; 
#chains in the Genus database with same CATH topology
 4MMZ B;  1DVC A;  2O9U X;  2R41 A;  2WGQ A;  3WHO A;  1YJW 3;  1GMP A;  5IW9 A;  4LSO A;  1VZZ A;  3I56 3;  1RN7 A;  1JBR A;  2W2C A;  4FMA A;  5RNT A;  3LTD A;  2C4B A;  1LOV A;  2JDI H;  3BIR A;  3FF2 A;  1UCI A;  3S29 A;  3HZP A;  1RHL A;  1Q9E A;  1V58 A;  2W9Q A;  1B27 A;  2GBX B;  1O7N B;  4O02 B;  2HMK B;  4JRF A;  1Y4K A;  1M1K 4;  4CJN A;  4IT7 A;  1EG9 B;  1OGZ A;  1RGG A;  3ROB A;  6GSP A;  5IEO A;  1RNT A;  3RGR A;  2W9P A;  3STD A;  1DMQ A;  1T2I A;  3GZX B;  4XBT A;  5G1K A;  5BU4 A;  3GSP A;  3G16 A;  1TRP A;  2GSP A;  2JQ5 A;  1BRG A;  1EKM A;  1TFK A;  1I3F A;  2QIY A;  3FG4 A;  3V92 A;  1NB3 I;  1NU3 A;  1G96 A;  3CCM 3;  5HOH A;  4GB5 A;  3GZB A;  1MWR A;  1O7M B;  2F5M A;  3X3Z A;  9RNT A;  3CU3 A;  3EC9 A;  3JVC A;  2CWU A;  1JB4 A;  5EQL A;  3UL6 A;  7STD A;  1AQZ A;  3CCL 3;  1VQP 3;  1JRQ A;  1BAO A;  1BNS A;  4MMX B;  3IMA B;  1A2V A;  3B4O A;  1N5H A;  8RNT A;  3U97 A;  2QEX 3;  2XH9 A;  2WGO A;  2C11 A;  3F7X A;  4ZM8 A;  5ELU A;  1R4Y A;  3HIG A;  3Q90 A;  4XM4 A;  3B7C A;  3EBY A;  3OV4 A;  2GBW B;  1OH0 A;  2F5W A;  3B8L A;  4GHO A;  1GY6 A;  1Q86 4;  1VQQ A;  5IER A;  1RSN A;  3X3X A;  1PFP A;  2HMN B;  1ZGX A;  4QWT A;  3URP A;  5HGR A;  1M90 4;  1BUJ A;  4K61 A;  1KQS 2;  1BRN L;  1RGL A;  4HM3 B;  5JPP A;  1I2G A;  2CK3 H;  1RDS A;  1A2K A;  4J9A A;  4CPK A;  1Q42 A;  3NBR A;  2SAR A;  1W7C A;  3LXU X;  3CMA 3;  2BU4 A;  4XB5 A;  5D83 A;  3CC2 3;  3PS8 A;  1YGW A;  4R1K A;  4HZ9 B;  3FCS B;  3V98 A;  1ROA A;  3D4A A;  3WOF B;  4HM6 B;  3MWZ A;  3DZL A;  3SED A;  1BNG A;  4IPB A;  4RBN A;  1KSI A;  1VQO 3;  1AVK A;  1W2Z A;  1TFO A;  4CCV A;  1BSE A;  1BNE A;  3N9H A;  3LT8 A;  3NX0 A;  1F8N A;  4O2H A;  5CXO A;  3S5C A;  3D5G A;  1US1 A;  5LC6 A;  2KXG A;  3WDG B;  3QRD A;  2W0Q A;  4HZB B;  1UDI I;  2CKF B;  3FZW A;  1IQ8 A;  4HVN A;  3E99 A;  4TX4 A;  2KF6 A;  3FLJ A;  1CQS A;  4HKV B;  4HAA A;  4PEJ A;  1UUV B;  1CEW I;  3ZFZ A;  2ZA4 A;  7GSP A;  2O3O A;  2XSH B;  2BHM A;  1MGR A;  1BNR A;  3FH1 A;  3DH2 A;  1W6Y A;  1ULI B;  3H3H A;  4I4K A;  5IG3 A;  3KCH A;  4H61 A;  3PGB A;  4XDV A;  3I55 3;  3CCE 3;  2CFK A;  1B2M A;  5TGN A;  2ML5 A;  1BSA A;  1LOY A;  3IPT A;  3DGL A;  1IT7 A;  1JB5 A;  1UCJ A;  2IY2 A;  3SX1 A;  1GSP A;  1NWW A;  1OF5 A;  2Z76 A;  3DY5 A;  3LH4 A;  2E2V A;  1T3B A;  1JBT A;  3CCR 3;  2HOH A;  3EHC A;  1LQG C;  3UL5 A;  1B2X A;  2BMR B;  3NV0 A;  5IEN A;  2HMM B;  3F7S A;  2CIU A;  1GOU A;  3KSE D;  1LOW A;  1L5G B;  2ZDJ A;  1ROV A;  4FMD A;  4LYL B;  1I2F A;  4NRE A;  2D42 A;  3HI7 A;  5GSP A;  1JKG B;  1IV7 A;  4J5K A;  4AKY A;  4K90 B;  4LZI A;  4BTX A;  1RMS A;  4N6T A;  1K9M 4;  2OQE C;  3CXC 2;  3OWY A;  1MNL A;  1BRJ A;  1V74 A;  2H0H A;  5D81 A;  1QAL A;  3JUQ A;  1YVB I;  3D79 A;  1OAC A;  3MG1 A;  2BNG A;  1FUT A;  1RGF A;  1B21 A;  2CC3 A;  2RSX A;  2V1L A;  1SJW A;  1JN5 A;  1JNQ A;  3CCV 3;  5CF1 A;  1VQ4 3;  5AYR B;  1TU5 A;  1TIJ A;  4HM1 B;  3T8N A;  3NM2 A;  3WA2 X;  3ZG5 A;  3G6E 3;  1I0X A;  5DRV A;  2YFJ B;  2W6J H;  3KZT A;  3EQQ B;  1OUN A;  1BAN A;  1IU7 A;  3KFQ C;  3LTB A;  1B3S A;  1Q7Y 4;  2UX0 A;  1DVD A;  3CC4 3;  2CG0 A;  5AEW B;  3LML A;  2RNT A;  1FA3 A;  3M8C A;  1SAR A;  1W4N A;  6RNT A;  4K1U A;  3LZA A;  3DGN A;  3BND A;  1SII A;  3LOY A;  3TDG A;  3UNL A;  3UB1 A;  4R4K A;  1VQ6 3;  2ZL8 A;  3G71 3;  1VQ8 3;  2GU3 A;  1GMQ A;  1TP6 A;  1RGK A;  3KN4 A;  1N8R 4;  1GMR A;  1PY3 A;  2Z77 A;  1UGI A;  4CDL A;  1BNF A;  1M9G A;  1X1W A;  2K54 A;  4N3V A;  1IQY A;  5D82 A;  3CD6 3;  1AY7 A;  3GWR A;  1C54 A;  3EJV A;  5JPU A;  1OGX A;  1BRH A;  4WP5 A;  1JJ2 2;  1X1X A;  1GD3 A;  4EV2 A;  1VQN 3;  2W56 B;  3HOH A;  3KKG A;  4X2H A;  1QVG 2;  2KF5 A;  2XFT A;  3WR2 A;  1X1U A;  2F56 A;  4N6N B;  4FCM A;  1UGH I;  3F14 A;  1HZ1 A;  4AEQ A;  3EB8 A;  3GRD A;  1WQL B;  3GZY B;  3LT9 A;  1KWI A;  3N8B A;  1BU4 A;  3VSY A;  4FMB A;  5KP4 A;  3B4P A;  4NHF A;  4OK0 A;  1A90 A;  1FGM A;  5EVH A;  3SXX A;  3AGN A;  3SVA A;  1O7W B;  2IUJ A;  2LYX A;  7RNT A;  4FCZ A;  5AIG A;  1STD A;  4J5G A;  2H0I A;  3JUO A;  4JF8 A;  1OHO A;  2HMO B;  1DYU A;  1MGW A;  3JUN A;  1I2E A;  2BO9 B;  2CHC A;  1IVW A;  1E3V A;  4HM0 B;  4OUQ A;  1FGQ A;  5AIH A;  6STD A;  3I0Y A;  1W00 A;  4HBR A;  4R80 A;  1B20 A;  3EF8 A;  1QAK A;  2OTL 3;  1BVI A;  3DUK A;  4BU4 A;  3EE1 A;  3K63 A;  2K0M A;  1OCV A;  2P0X A;  1PYL A;  3FGY A;  3N54 B;  2RGQ A;  4U13 A;  2GU1 A;  1NO3 A;  4EBG A;  1BOX A;  1I0V A;  1MWS A;  3WOE B;  1DET A;  1K28 A;  1HKX A;  1BUQ A;  1Q40 B;  2KF3 A;  1K8A 4;  1IVU A;  2Z7A A;  4DKI A;  2J8X B;  1A67 A;  4MEI A;  1MOL A;  1RCL A;  4KFF A;  1QMA A;  2Z6B A;  2GEY A;  5IF6 A;  1S72 3;  1W2B 2;  1VQL 3;  5G2G A;  4EC6 A;  5LC7 A;  2RBI A;  1FGT A;  2IMJ A;  4N6O B;  3LYG A;  4FCJ A;  1GOV A;  3MG3 A;  4GSP A;  3DGY A;  2YFL B;  1X1Y A;  2I9W A;  3MYT A;  4L7K A;  3LTC A;  5AI1 A;  2KRT A;  3BNB A;  5M19 A;  3CCU 3;  4WFO A;  1B2Z A;  1CYV A;  3CCJ 3;  1CH0 A;  2L1S A;  2HMJ B;  4KT3 B;  1TUH A;  1RKY A;  3VGN A;  1Q82 4;  3SOY A;  2OQE A;  4WYK B;  1ZO2 A;  2XEP A;  1SQW A;  1K41 A;  5KP3 A;  4HM8 B;  1BNJ A;  1RNB A;  2P09 A;  2XSO B;  1AV4 A;  1EA2 A;  1LRA A;  1O7G B;  3MG2 A;  5BVB A;  1GOY A;  3AMO B;  1GY7 A;  3G8Z A;  4BTW A;  1NJI 4;  1HYF A;  2QGU A;  1GY5 A;  1SPU A;  1E97 A;  4HM2 B;  1ULJ B;  2GEX A;  2XGL A;  5CLK A;  1GS3 A;  4WHA A;  1U8C B;  3A5E A;  1DMN A;  2XF3 A;  1DE3 A;  3X40 A;  2Y73 A;  1KC8 4;  2AAE A;  3NBJ A;  4I5Q A;  3S28 A;  4K1V A;  3OW2 2;  2WO0 A;  1RLS A;  2OCT A;  1TJD A;  3MKI A;  3MPH A;  1R4C A;  4RNT A;  5IG5 A;  1EUI C;  3O8Y A;  1ISK A;  4L8O A;  2KAA A;  4XBX A;  2OWP A;  1I3I A;  2A15 A;  4N6V 0;  2OOV C;  4KZ1 A;  1Q7H A;  2F86 B;  3D3L A;  1W6C A;  2IA7 A;  3FG3 A;  4N6L A;  1N8Q A;  1Z1S A;  5CK6 A;  2MC8 A;  4XBY A;  3NBB A;  4OVM A;  3ALA A;  2D1W A;  4R9K A;  3DGM A;  2C10 A;  3AHS A;  4ILF A;  1C7H A;  3MSO A;  3T8U A;  1LNH A;  2BT3 A;  2RCD A;  3A76 A;  5AYS C;  2YFI B;  1N9J A;  1RCK A;  4NPB A;  1NNV A;  1UCL A;  2HML B;  1E3R A;  4X2O A;  2K3D A;  4AKZ A;  3BNC A;  2CFD A;  3EX9 A;  2M7O A;  2CW9 A;  1EEJ A;  1JKG A;  1N5P A;  3BB9 A;  3IJE B;  3L0R A;  5ELJ A;  5STD A;  3WMD A;  3OX9 A;  4MJD A;  1B2S A;  2KF4 A;  1TTO A;  2KCD A;  3OWS A;  1BSC A;  2PNC A;  1RGA A;  1KD1 4;  3BNE A;  1O7P B;  2W04 A;  1CYU A;  3KII A;  3G4S 3;  5BXQ A;  2AAD A;  3GZR A;  5AIF A;  1WMN A;  1D6Y A;  1OHP A;  3Q3F A;  3V99 A;  1BGS A;  3EN1 B;  1EQK A;  3NM7 A;  3FSD A;  1YNV X;  1YI2 3;  1N9E A;  1ZS7 A;  2E2U A;  2QA4 3;  4HYZ A;  1YJN 3;  1BNI A;  1AR0 A;  1UI8 A;  3AGO A;  1WMO A;  4RNZ A;  1RRL A;  3SLU A;  4STD A;  3CCS 3;  3PCS A;  3DM8 A;  1BRS A;  2XR8 B;  2IUK A;  2Y74 A;  2CFL A;  3GAX A;  3DXO A;  3QK9 A;  1W01 A;  2OTJ 3;  1STF I;  1FGR A;  4H3U A;  5JBS A;  4BIR A;  5G1L A;  2R4I A;  4FR9 A;  4O3V A;  3X42 A;  2STD A;  5BIR A;  5KP1 A;  1NDO B;  1WNH A;  4J8T A;  4MMY B;  3K9M C;  1BSD A;  3VF1 A;  1OHS A;  2CWV A;  1I8V A;  3DGO A;  2GXF A;  2WOH A;  3OWU A;  2P05 A;  1W6G A;  1WTH A;  1JZO A;  3D5I A;  3CPO A;  5FW5 A;  4N6U A;  4RZM A;  1GYB A;  1IT8 A;  2CH9 A;  5I97 A;  1V57 A;  3ECF A;  3PYJ A;  3T0U A;  4HM4 B;  1MWT A;  1UCK A;  3RDE A;  1K73 4;  1FZU A;  2FXT A;  4LMI A;  3BU4 A;  2INX A;  4LEH A;  1YGE A;  2CWT A;  1VQ9 3;  1A2P A;  4EV5 A;  4HJL B;  2MF7 A;  1VQ7 3;  2W56 A;  1T5Y A;  1FUW A;  3NQY A;  3RNT A;  2P0M A;  3F8X A;  1RTU A;  8CHO A;  4KVH A;  1O7H B;  4EYC A;  1LXE A;  1QAF A;  1VQM 3;  2CFW A;  3JUM A;  1MWU A;  1QJG A;  5AII A;  2ZHX B;  1RN4 A;  3EBT A;  1G0T A;  1VQK 3;  1T2H A;  2ML6 A;  3KE7 A;  4HM5 B;  1LQM B;  4GL6 A;  3BLZ A;  1JBS A;  1RGC A;  2XFS A;  5IG0 A;  1RJO A;  3H51 A;  1JV2 B;  2SBL A;  4ORL A;  1RN1 A;  3JUP A;  1RRH A;  2CX1 A;  3DMC A;  3K0Z A;  4N6M A;  1FGO A;  4G1M B;  1YJ9 3;  1IK3 A;  3F8H A;  4HOH A;  1OF5 B;  1BSB A;  1YVS A;  3CNX A;  3X41 A;  2UGI A;  2CG1 A;  5CF2 A;  4WWU C;  2BMQ B;  2E2T A;  2L4V A;  1IDP A;  3KSP A;  1W5Z A;  2CX0 A;  2BMO B;  3WOD G;  1OPY A;  3SOA A;  2F98 A;  3CC7 3;  2FGT A;  3LTA A;  4RNY A;  3OXA A;  3S27 A;  3NV0 B;  3CPW 2;  3S67 A;  1U5O A;  1B2U A;  3UJM A;  1PU4 A;  3NXJ A;  3K7C A;  1RGE A;  3PXM A;  2OOV A;  1UUW B;  3RGA A;  2B1X B;  1ASK A;  1LVN A;  3HII A;  4BL2 A;  3FKA A;  2UUG C;  3NQZ A;  1FYS A;  4O8S A;  1ZX2 A;  2B24 B;  1Q40 A;  1LNI A;  3MHE A;  1D6U A;  1WMP A;  2H0G A;  3PCR A;  1VQ5 3;  1G02 A;  1FUS A;  3ER7 A;  1S5A A;  5EEO A;  3EN8 A;  1Q81 4;  3Q1C A;  5FGO A;  4BL3 A;  1M1X B;  1JN5 B;  1IQX A;  1GD4 A;  2PZV A;  1JB2 A;  5M18 A;  2FNQ A;  1J2B A;  2CFG A;  3G0K A;  1BRI A;  3PZW A;  3SYU A;  1FW7 A;  2BIR A;  5IEP A;  1SIH A;  3K5T A;  2F4Y A;  1RGH A;  3HK4 A;  4HM7 B;  3ZG0 A;  1IYY A;  2P38 A;  1BIR A;  3F9S A;  3HX8 A;  4IIA A;  3CCQ 3;  1IVX A;  4KFD A;  1QVF 2;  4Q53 A;  5M1A A;  1UW1 A;  2YX9 A;  1UI7 A;  4BTY A;  5DRE A;  4LGQ A;  4WYK A;  1BRK A;  1TRQ A;  3F40 A;  3AHW A;  1W02 A;  4R9L A;  3FF0 A;  5AEU B;  3CME 3;  2W03 A;  2F99 A;  1DMM A;  3WA3 A;  3J7Y d;  1D6Z A;  3U1W A;  1JZD A;  2Q07 A;  3AMO A;  1HU9 A;  2LQV A;  1I70 A;  1UUG B;  2WOF A;  5IG4 A;  3FG1 A;  2IYJ A;  3NHX A;  1NB5 I;  4EW5 A;  1YHQ 3;  2XRX B;  1IV9 A;  1LOX A;  2RFR A;  3CNM A;  4FMC A;  5A0O B;  1AVL A;  1YIJ 3;  4XDW A;  1YIT 3;  3X3Y A;  4L8P A;  1IVV A;  4KFE A;  3D9R A;  3NUV A;  2XGN A;  4EXR A;  3Q2P A; 
#chains in the Genus database with same CATH homology
 4MMZ B;  1DVC A;  2O9U X;  2WGQ A;  1YJW 3;  5IW9 A;  4LSO A;  1VZZ A;  3I56 3;  1RN7 A;  2W2C A;  4FMA A;  3LTD A;  2JDI H;  3FF2 A;  3S29 A;  3HZP A;  2W9Q A;  2GBX B;  1O7N B;  4O02 B;  2HMK B;  4JRF A;  1Y4K A;  1M1K 4;  4IT7 A;  1EG9 B;  1OGZ A;  3ROB A;  5IEO A;  3RGR A;  2W9P A;  3STD A;  1DMQ A;  3GZX B;  4XBT A;  3G16 A;  2JQ5 A;  1EKM A;  1TFK A;  2QIY A;  3FG4 A;  3V92 A;  1NB3 I;  1NU3 A;  1G96 A;  3CCM 3;  4GB5 A;  3GZB A;  1O7M B;  3X3Z A;  3CU3 A;  3EC9 A;  3JVC A;  2CWU A;  1JB4 A;  5EQL A;  3UL6 A;  7STD A;  3CCL 3;  1VQP 3;  1JRQ A;  4MMX B;  3IMA B;  1A2V A;  3B4O A;  1N5H A;  3U97 A;  2QEX 3;  2XH9 A;  2WGO A;  2C11 A;  3F7X A;  4ZM8 A;  5ELU A;  3HIG A;  3Q90 A;  4XM4 A;  3B7C A;  3EBY A;  3OV4 A;  2GBW B;  1OH0 A;  3B8L A;  1Q86 4;  1GY6 A;  5IER A;  3X3X A;  1PFP A;  2HMN B;  4QWT A;  5HGR A;  1M90 4;  4K61 A;  1KQS 2;  4HM3 B;  5JPP A;  2CK3 H;  1A2K A;  4J9A A;  1Q42 A;  3NBR A;  1W7C A;  3LXU X;  3CMA 3;  4XB5 A;  5D83 A;  3CC2 3;  3PS8 A;  4R1K A;  4HZ9 B;  3FCS B;  3V98 A;  1ROA A;  3WOF B;  4HM6 B;  3MWZ A;  3DZL A;  3SED A;  4IPB A;  4RBN A;  1KSI A;  1VQO 3;  1AVK A;  1W2Z A;  1TFO A;  4CCV A;  3N9H A;  3NX0 A;  3LT8 A;  5CXO A;  1F8N A;  4O2H A;  3WDG B;  3S5C A;  3CME 3;  1US1 A;  5LC6 A;  2KXG A;  3QRD A;  2W0Q A;  4HZB B;  2CKF B;  3FZW A;  4HVN A;  1IQ8 A;  3E99 A;  4TX4 A;  3FLJ A;  4HKV B;  1CQS A;  4PEJ A;  1UUV B;  1CEW I;  2O3O A;  2XSH B;  2BHM A;  3FH1 A;  4I4K A;  1W6Y A;  1ULI B;  3H3H A;  5IG3 A;  4H61 A;  3PGB A;  4XDV A;  3I55 3;  3CCE 3;  2CFK A;  5TGN A;  2ML5 A;  3IPT A;  3DGL A;  1IT7 A;  1JB5 A;  3SX1 A;  1NWW A;  1OF5 A;  2Z76 A;  3DY5 A;  3LH4 A;  2E2V A;  3CCR 3;  3EHC A;  3UL5 A;  2BMR B;  3NV0 A;  5IEN A;  2HMM B;  3F7S A;  2CIU A;  3KSE D;  1L5G B;  2ZDJ A;  1ROV A;  4FMD A;  4NRE A;  2D42 A;  3HI7 A;  1JKG B;  1IV7 A;  4AKY A;  4K90 B;  4LZI A;  4BTX A;  4N6T A;  1K9M 4;  2OQE C;  3CXC 2;  3OWY A;  1MNL A;  1V74 A;  5D81 A;  1QAL A;  3JUQ A;  1YVB I;  1OAC A;  3MG1 A;  2BNG A;  2CC3 A;  2V1L A;  2RSX A;  3CCV 3;  1SJW A;  1JNQ A;  1JN5 A;  1VQ4 3;  5CF1 A;  5AYR B;  1TU5 A;  1TIJ A;  4HM1 B;  3T8N A;  3NM2 A;  3WA2 X;  3G6E 3;  5DRV A;  2YFJ B;  2W6J H;  3KZT A;  3EQQ B;  1OUN A;  3LTB A;  1IU7 A;  3KFQ C;  1Q7Y 4;  2UX0 A;  1DVD A;  3CC4 3;  2CG0 A;  5AEW B;  3LML A;  1FA3 A;  3M8C A;  1W4N A;  4K1U A;  3LZA A;  3DGN A;  3BND A;  1SII A;  3LOY A;  3TDG A;  3UNL A;  3UB1 A;  4R4K A;  1VQ6 3;  2ZL8 A;  3G71 3;  1VQ8 3;  2GU3 A;  1TP6 A;  3KN4 A;  1N8R 4;  2Z77 A;  4CDL A;  3CD6 3;  1M9G A;  2K54 A;  4N3V A;  1IQY A;  5D82 A;  3GWR A;  3EJV A;  5JPU A;  1OGX A;  4WP5 A;  1JJ2 2;  1GD3 A;  4EV2 A;  1VQN 3;  2W56 B;  3KKG A;  4X2H A;  1QVG 2;  2XFT A;  4N6N B;  4FCM A;  3F14 A;  4AEQ A;  3EB8 A;  3GRD A;  1WQL B;  3GZY B;  3LT9 A;  1KWI A;  3N8B A;  3VSY A;  5KP4 A;  4FMB A;  3B4P A;  4NHF A;  4OK0 A;  1A90 A;  1FGM A;  5EVH A;  3SXX A;  3SVA A;  1O7W B;  2IUJ A;  2LYX A;  4FCZ A;  5AIG A;  1STD A;  3JUO A;  4JF8 A;  1OHO A;  2HMO B;  1DYU A;  3JUN A;  2BO9 B;  2CHC A;  4OUQ A;  1IVW A;  1E3V A;  4HM0 B;  5AIH A;  1FGQ A;  6STD A;  3I0Y A;  1W00 A;  4HBR A;  4R80 A;  3EF8 A;  1QAK A;  2OTL 3;  3DUK A;  3EE1 A;  3K63 A;  2K0M A;  1OCV A;  2P0X A;  3FGY A;  3N54 B;  2RGQ A;  4U13 A;  2GU1 A;  1NO3 A;  4EBG A;  3WOE B;  1K28 A;  1HKX A;  1BUQ A;  1Q40 B;  1K8A 4;  1IVU A;  2Z7A A;  1A67 A;  4MEI A;  1MOL A;  4KFF A;  1QMA A;  2Z6B A;  2GEY A;  5IF6 A;  1S72 3;  1W2B 2;  1VQL 3;  5G2G A;  4EC6 A;  5LC7 A;  1FGT A;  2IMJ A;  4N6O B;  3LYG A;  4FCJ A;  3MG3 A;  2YFL B;  2I9W A;  3MYT A;  4L7K A;  3LTC A;  5AI1 A;  2KRT A;  3BNB A;  3CCU 3;  4WFO A;  1CYV A;  3CCJ 3;  2HMJ B;  1TUH A;  1RKY A;  3VGN A;  1Q82 4;  3SOY A;  2OQE A;  4WYK B;  1ZO2 A;  2XEP A;  1SQW A;  1K41 A;  5KP3 A;  4HM8 B;  2P09 A;  2XSO B;  1AV4 A;  1EA2 A;  1O7G B;  3MG2 A;  5BVB A;  3AMO B;  1GY7 A;  3G8Z A;  4BTW A;  1NJI 4;  2QGU A;  1GY5 A;  1SPU A;  1E97 A;  4HM2 B;  1ULJ B;  2GEX A;  2XGL A;  5CLK A;  1GS3 A;  4WHA A;  1U8C B;  1DMN A;  2XF3 A;  3X40 A;  2Y73 A;  1KC8 4;  3NBJ A;  3S28 A;  4K1V A;  3OW2 2;  2WO0 A;  2OCT A;  3MKI A;  3MPH A;  1R4C A;  5IG5 A;  3O8Y A;  1ISK A;  4L8O A;  4XBX A;  2OWP A;  2A15 A;  4N6V 0;  2OOV C;  4KZ1 A;  2F86 B;  3D3L A;  1W6C A;  2IA7 A;  3FG3 A;  4N6L A;  1N8Q A;  1Z1S A;  5CK6 A;  2MC8 A;  4XBY A;  3NBB A;  4OVM A;  3ALA A;  2D1W A;  4R9K A;  3DGM A;  2C10 A;  1C7H A;  3MSO A;  3T8U A;  1LNH A;  2BT3 A;  2RCD A;  3A76 A;  5AYS C;  2YFI B;  1N9J A;  2HML B;  1E3R A;  4X2O A;  4AKZ A;  3BNC A;  2CFD A;  3EX9 A;  2M7O A;  2CW9 A;  1JKG A;  1N5P A;  3IJE B;  3BB9 A;  3L0R A;  5ELJ A;  5STD A;  3WMD A;  3OX9 A;  4MJD A;  2KCD A;  3OWS A;  2PNC A;  1KD1 4;  1CYU A;  3BNE A;  1O7P B;  2W04 A;  3KII A;  3G4S 3;  5BXQ A;  3GZR A;  5AIF A;  1WMN A;  1D6Y A;  1OHP A;  3V99 A;  3EN1 B;  1EQK A;  3NM7 A;  3FSD A;  1YI2 3;  1N9E A;  2E2U A;  2QA4 3;  4HYZ A;  1YJN 3;  1AR0 A;  1UI8 A;  1WMO A;  4RNZ A;  1RRL A;  3SLU A;  4STD A;  3CCS 3;  3PCS A;  3DM8 A;  2Y74 A;  2XR8 B;  2IUK A;  2CFL A;  3GAX A;  3DXO A;  3QK9 A;  1W01 A;  2OTJ 3;  1STF I;  1FGR A;  4H3U A;  5JBS A;  2R4I A;  4FR9 A;  4O3V A;  3X42 A;  2STD A;  5KP1 A;  1NDO B;  1WNH A;  4J8T A;  4MMY B;  3K9M C;  3VF1 A;  1OHS A;  2CWV A;  3DGO A;  2GXF A;  2WOH A;  3OWU A;  2P05 A;  1W6G A;  1WTH A;  5FW5 A;  3CPO A;  4N6U A;  4RZM A;  1GYB A;  1IT8 A;  2CH9 A;  5I97 A;  3PYJ A;  3ECF A;  3T0U A;  4HM4 B;  3RDE A;  1K73 4;  2FXT A;  4LMI A;  2INX A;  4LEH A;  1YGE A;  2CWT A;  1VQ9 3;  4EV5 A;  4HJL B;  2MF7 A;  1VQ7 3;  2W56 A;  1T5Y A;  1FUW A;  3NQY A;  2P0M A;  3F8X A;  8CHO A;  4KVH A;  1O7H B;  4EYC A;  1LXE A;  1QAF A;  1VQM 3;  2CFW A;  3JUM A;  1QJG A;  5AII A;  3EBT A;  1VQK 3;  2ML6 A;  3KE7 A;  4HM5 B;  4GL6 A;  3BLZ A;  2XFS A;  5IG0 A;  1RJO A;  3H51 A;  1JV2 B;  2SBL A;  4ORL A;  3JUP A;  3K0Z A;  1RRH A;  3DMC A;  4N6M A;  1YJ9 3;  1FGO A;  4G1M B;  1IK3 A;  3F8H A;  1OF5 B;  3CNX A;  3X41 A;  2CG1 A;  5CF2 A;  4WWU C;  2BMQ B;  2E2T A;  2L4V A;  1IDP A;  3KSP A;  1W5Z A;  2BMO B;  3WOD G;  1OPY A;  3SOA A;  2F98 A;  3CC7 3;  2FGT A;  3LTA A;  4RNY A;  3OXA A;  3S27 A;  3NV0 B;  3CPW 2;  3S67 A;  1U5O A;  3UJM A;  1PU4 A;  3NXJ A;  3K7C A;  2OOV A;  3PXM A;  1UUW B;  3RGA A;  2B1X B;  1ASK A;  1LVN A;  3HII A;  3FKA A;  3NQZ A;  4O8S A;  1ZX2 A;  2B24 B;  1Q40 A;  3MHE A;  1D6U A;  1WMP A;  3PCR A;  1VQ5 3;  3ER7 A;  1S5A A;  5EEO A;  3EN8 A;  1Q81 4;  3Q1C A;  5FGO A;  1M1X B;  1JN5 B;  1IQX A;  1GD4 A;  2PZV A;  1JB2 A;  1J2B A;  2FNQ A;  2CFG A;  3G0K A;  3PZW A;  5IEP A;  1SIH A;  3K5T A;  3HK4 A;  4HM7 B;  2P38 A;  3F9S A;  3HX8 A;  4IIA A;  3CCQ 3;  1IVX A;  4KFD A;  1QVF 2;  4Q53 A;  1UW1 A;  2YX9 A;  1UI7 A;  4BTY A;  5DRE A;  4LGQ A;  4WYK A;  3F40 A;  1W02 A;  4R9L A;  3FF0 A;  5AEU B;  2W03 A;  2F99 A;  1DMM A;  3WA3 A;  3J7Y d;  1D6Z A;  3U1W A;  2Q07 A;  3AMO A;  1HU9 A;  2LQV A;  5IG4 A;  2WOF A;  3FG1 A;  3NHX A;  1NB5 I;  1YHQ 3;  2XRX B;  1IV9 A;  1LOX A;  2RFR A;  3CNM A;  4FMC A;  5A0O B;  1AVL A;  1YIJ 3;  4XDW A;  1YIT 3;  3X3Y A;  4L8P A;  1IVV A;  4KFE A;  3D9R A;  3NUV A;  2XGN A;  4EXR A;  3Q2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...