4EYCA

Crystal structure of the cathelin-like domain of human cathelicidin ll-37 (hcld)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
103
Chain Sequence
GSHMQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Cathelicidin antimicrobial peptide
publication title Structural and Functional Analysis of the Pro-Domain of Human Cathelicidin, LL-37.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 103
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4eycA00
2CH9A 1NB5I 1WNHA 4N6LA 3KFQC 1MNLA 1ROAA 1STFI 4EYCA 4IT7A 1G96A 4N6V0 1N9JA 1CYUA 1LXEA 4N6TA 3PS8A 1TIJA 3Q2PA 2OCTA 1NB3I 4N6OB 3MWZA 4CCVA 1YVBI 1A90A 3UL6A 3PXMA 5EQLA 4LZIA 4N6MA 1R4CA 1N5PA 5A0OB 2KXGA 1FA3A 4N6NB 1N5HA 1DVCA 1PFPA 3LH4A 1DVDA 1IV9A 3QRDA 4TX4A 3S67A 1RN7A 3UL5A 3SVAA 1CYVA 5LC7A 1KWIA 1GD4A 1MOLA 4ZM8A 1A67A 3IMAB 4N6UA 1GD3A 3L0RA 2BO9B 5ELJA 5ELUA 3PYJA 2W9QA 3KSED 1M9GA 1CEWI 3K9MC 1FUWA 1IV7A 1EQKA 2W9PA 2O9UX 3NX0A 5LC6A 3GAXA
chains in the Genus database with same CATH superfamily
2RSXA 3X40A 4ORLA 4RNZA 2ML5A 2RBIA 3KFQC 4HVNA 5KP1A 3OWYA 1ROAA 1YVSA 1RN1A 4EYCA 4EC6A 1T2HA 3DY5A 2WO0A 3LYGA 2AADA 1BNIA 3BIRA 3EQQB 3NV0B 3CCE3 2P38A 2YX9A 1UDII 3RGAA 4KFEA 3CCS3 2XEPA 3FF2A 3NQZA 1CYUA 3EE1A 2KF4A 4FMAA 4MMXB 2QGUA 4RNYA 1FGMA 3I553 1FUTA 3X3XA 5JBSA 2CX1A 3CC23 5BU4A 3LTCA 3OX9A 1YI23 4RNTA 1V74A 3D5GA 5AIFA 1JZOA 1DE3A 2O3OA 2KAAA 3Q2PA 1I3FA 1BNGA 2OCTA 2Y73A 2RNTA 2Z7AA 4H3UA 1VQM3 3LMLA 1FGTA 3N9HA 1KQS2 1RRHA 3FLJA 1JKGB 4BU4A 1PYLA 3EB8A 1NJI4 1OHPA 3WDGB 1GYBA 3WOEB 2HOHA 4GB5A 1NU3A 1R4CA 1N5PA 2P09A 5A0OB 4K1VA 5STDA 6STDA 1JJ22 1BNRA 4FR9A 1GOYA 2XSOB 4JRFA 3JUNA 5AI1A 3WA2X 3OW22 2R4IA 1IDPA 1RGEA 2CW9A 3K5TA 4J9AA 3EN1B 1EUIC 1DVCA 1RSNA 2W04A 3LTBA 2UUGC 2YFJB 1M1K4 4K1UA 2F4YA 2P0MA 2MC8A 1QJGA 4HAAA 1W01A 2KRTA 6RNTA 2BNGA 3HK4A 5IG3A 1RDSA 2KF5A 4WYKA 2H0GA 1MWSA 5CXOA 3FCSB 3SX1A 1TRQA 1A2VA 1ISKA 1K9M4 3V98A 3VSYA 1AV4A 2RCDA 5LC7A 2F56A 3LTDA 2XH9A 5JPUA 1X1XA 1IYYA 4HM8B 1MWUA 1UGHI 2BHMA 1I8VA 1O7HB 3D9RA 1RCKA 4ILFA 3TDGA 3HIGA 4OK0A 2F5WA 3D79A 3IJEB 3LT9A 1IVUA 1X1WA 1FGOA 6GSPA 4WFOA 5KP4A 4HM4B 2HMLB 4BL3A 3IPTA 3KCHA 2GEXA 4KT3B 1IVXA 2HMOB 3B7CA 4MEIA 5ELJA 3ZG0A 3NQYA 1VQ43 2IY2A 4U13A 4HM6B 4HZ9B 4WP5A 5IW9A 4CPKA 2STDA 1JB2A 1W7CA 1M9GA 1RRLA 1W6YA 1DETA 4HKVB 1CEWI 3AMOA 3VGNA 3WMDA 2V1LA 3N8BA 3GWRA 1W6GA 3HOHA 1RNBA 4L8OA 1TP6A 1GOUA 2CFGA 5AIHA 4EXRA 2CC3A 3CU3A 5FGOA 3CMA3 3G16A 3N54B 5IG5A 1TFKA 5GSPA 2QIYA 2W9PA 3JUOA 1B2MA 3FH1A 3WA3A 3F9SA 3FG3A 1N9EA 1B2SA 2GEYA 4R80A 1ULIB 1QALA 3G8ZA 2D1WA 2F86B 4HM3B 5LC6A 1EG9B 3CCQ3 2XRXB 2BMOB 2E2TA 3GAXA 2I9WA 1BNJA 2GSPA 1RTUA 1IK3A 3A5EA 1D6ZA 1NB5I 3BU4A 3SYUA 1JB5A 2XFTA 1BSDA 2CHCA 4RZMA 1MNLA 4BTXA 4XB5A 5DRVA 1STFI 4LYLB 2W03A 5AIGA 1G0TA 4L7KA 3HI7A 2W56A 3X41A 2H0HA 1BRNL 1BRKA 3MPHA 1I2FA 3LXUX 4J5GA 3FZWA 4X2OA 3I0YA 1I2GA 1UUGB 1T5YA 2CWVA 1W02A 2GBWB 1YNVX 3T8UA 1HZ1A 2CWUA 1D6YA 4NREA 2JQ5A 3QK9A 1O7WB 3GZRA 1GMRA 2BIRA 2XSHB 1AY7A 3MHEA 4N6TA 1WMPA 1RHLA 3KIIA 3EN8A 5IENA 1UCKA 1NB3I 2E2UA 2P05A 4N6OB 3MWZA 5BVBA 2LYXA 3I563 1J2BA 4XM4A 2OTL3 2CFDA 4LZIA 4N6MA 1BRGA 3CPOA 2HMNB 4HZBB 1IQ8A 1FA3A 3PGBA 1UUWB 1UGIA 4N6NB 1RGFA 3RNTA 3D3LA 3CC73 1BU4A 1MWTA 1GMQA 3X3ZA 5AIIA 5HGRA 3PCSA 1BOXA 1BVIA 1SQWA 2RGQA 4KFFA 3T8NA 1BRIA 2C11A 4XBYA 5CLKA 1DVDA 4I5QA 3FF0A 3FG1A 1IV9A 1VQ83 9RNTA 3DXOA 5HOHA 1TU5A 3CCU3 3QRDA 5D81A 3S67A 3MG3A 1CYVA 3JUQA 4O8SA 3ZFZA 1KWIA 1GD4A 1MOLA 5CF1A 2L1SA 1GOVA 1OACA 4FMDA 4XBXA 5IF6A 3IMAB 3MSOA 3STDA 4R9LA 4R9KA 1HKXA 1HU9A 4J8TA 4BIRA 2GU3A 1STDA 1V57A 1R4YA 1QMAA 2FGTA 3H3HA 5I97A 1O7PB 4BTYA 2MF7A 2BT3A 3V99A 5AYSC 1GD3A 1AVLA 1AVKA 2OQEC 5CF2A 3NHXA 3PZWA 3DGNA 1B20A 5ELUA 1BSAA 1Q40B 1RGKA 2HMKB 2YFIB 2ZA4A 4EBGA 4KZ1A 1DYUA 1WMOA 1FGRA 1X1YA 2IUKA 2UGIA 2SBLA 3DH2A 3K7CA 1VQK3 1UUVB 4LMIA 2KF6A 1ZGXA 3E99A 5G1KA 1BRHA 1SIHA 3FSDA 1G02A 1OH0A 4N3VA 2CFLA 3VF1A 1FUWA 2CG0A 1SJWA 4QWTA 1W4NA 3S28A 1MGRA 4FCZA 1BANA 3SOYA 3NM7A 1BUQA 2Y74A 5DREA 2CK3H 1I2EA 4FMBA 5RNTA 3DGLA 2O9UX 4NHFA 2K3DA 4L8PA 3BNBA 5G2GA 4HM1B 1VQ63 2XF3A 5M19A 1JB4A 1RJOA 3FGYA 3NX0A 3F40A 3GZXB 3EF8A 1YJ93 3MYTA 4LGQA 1T2IA 3JUPA 1I0XA 1RCLA 3ZG5A 1Q7Y4 4J5KA 1WNHA 2WGOA 4N6LA 2XFSA 4Q53A 3G713 3NUVA 1HYFA 1JN5A 3H51A 2Z6BA 1I0VA 1OGXA 2D42A 1O7NB 5JPPA 2IYJA 3KZTA 2ZDJA 1IU7A 1VQO3 3NXJA 1RGAA 3URPA 4AKZA 3OXAA 1W2ZA 4N6V0 3X42A 5CK6A 1KC84 1N9JA 1GS3A 1S5AA 3DMCA 1C7HA 3UNLA 3CCR3 2Q07A 1BAOA 1YGWA 8CHOA 1PY3A 1JV2B 3GZBA 3D5IA 4HYZA 1JBTA 2A15A 3O8YA 1YIJ3 1TIJA 2R41A 4X2HA 2BMQB 4WHAA 4HM7B 4WYKB 1RKYA 1M904 1W5ZA 1LNIA 1JBRA 1PU4A 1YVBI 1FW7A 1Z1SA 5EQLA 1DMMA 5IG0A 3NV0A 2IUJA 2J8XB 2KXGA 3UJMA 1EEJA 4GSPA 1OF5B 3T0UA 1YGEA 1E3RA 1FGQA 2OWPA 3GSPA 1IVWA 3BNCA 4MJDA 4OUQA 4IIAA 3CCJ3 2RFRA 3KN4A 4FMCA 4HM2B 2WGQA 3CCM3 1LQGC 1RN4A 1FUSA 3MG2A 4GL6A 1PFPA 2W0QA 4HBRA 3SXXA 3RGRA 2IA7A 3BB9A 1EKMA 4LSOA 1VQ93 2YFLB 1AQZA 1UI8A 2W2CA 5IERA 4R1KA 1LNHA 1B21A 1TTOA 2KCDA 1V58A 2Z77A 4XDWA 1K28A 4TX4A 1UCIA 3BNDA 1UCLA 1JKGA 1RN7A 3Q3FA 4PEJA 3SLUA 3UL5A 3OV4A 3WOFB 1VQP3 3CNMA 1N8R4 2LQVA 3J7Yd 2CFWA 1VZZA 1JBSA 4ZM8A 2C4BA 1DMNA 2F99A 1YIT3 1RGCA 1IQXA 1E97A 1D6UA 4KFDA 4BL2A 4BTWA 2L4VA 1FZUA 5AYRB 3B8LA 3SOAA 1VQ73 5IEPA 3EX9A 1CQSA 1VQN3 1T3BA 2K0MA 1NWWA 5EEOA 1UI7A 4O2HA 3AHSA 3L0RA 3B4OA 3FG4A 4R4KA 8RNTA 2GU1A 2XGNA 2BMRB 5IEOA 1US1A 1IQYA 1BNFA 1ASKA 1UCJA 2E2VA 1GY6A 3KKGA 5D82A 2FXTA 2SARA 1W6CA 3LZAA 5AEWB 5IG4A 1QVG2 3GZYB 1UW1A 1LOVA 1K41A 1WTHA 1B3SA 3S27A 1I70A 1EQKA 1SIIA 2WOFA 3OWUA 1DMQA 1NDOB 3OWSA 1RNTA 2W56B 1BSBA 1TUHA 4K61A 4WWUC 1OPYA 1Q42A 1LOWA 1BGSA 3DZLA 2OQEA 5BIRA 1K734 2M7OA 4DKIA 1Q7HA 3HIIA 2JDIH 4KVHA 3S29A 2OTJ3 3JUMA 4STDA 1KSIA 3DGOA 2CX0A 3RDEA 1BRJA 1TJDA 1Q864 1RGGA 2CWTA 1IT8A 2CH9A 1B2UA 2IMJA 3AHWA 1WQLB 1RLSA 1RMSA 3B4PA 4HM5B 1OCVA 3NBBA 1IT7A 1BSCA 3CME3 3G0KA 4XBTA 3EHCA 1B2XA 1LOYA 2P0XA 3V92A 1BNSA 4IT7A 3CXC2 1ZX2A 1LVNA 1Y4KA 3F14A 3NM2A 3Q90A 1LQMB 1QAKA 1BSEA 1G96A 2C10A 4FCMA 4I4KA 2CG1A 3CCV3 3Q1CA 3UB1A 2AAEA 2BU4A 1M1XB 3JVCA 1A2PA 1EA2A 1MGWA 5M18A 1WMNA 2QEX3 1VQ53 3D4AA 3EBYA 4JF8A 1GSPA 3G4S3 3CCL3 1LOXA 1LXEA 1W00A 3DGMA 1U5OA 3PS8A 3WHOA 2PZVA 1O7MB 1BIRA 3EC9A 3K63A 5BXQA 1GY7A 1QAFA 3SEDA 1I3IA 4EW5A 4AEQA 1SARA 1ULJB 1W2B2 4CCVA 3BLZA 3F7XA 3LT8A 2KF3A 3UL6A 1A90A 3PXMA 5D83A 1OF5A 2CFKA 3HZPA 5M1AA 1BRSA 4HOHA 7STDA 2W6JH 4O02B 1TFOA 5TGNA 2ML6A 4MMZB 1OHOA 1BNEA 2XGLA 1Q824 2K54A 1VQL3 1LRAA 1N5HA 3HX8A 3CD63 1RGLA 1K8A4 4NPBA 4O3VA 3U97A 3DGYA 3WR2A 3LH4A 3ECFA 3EBTA 2CKFB 1A2KA 1NNVA 1ZO2A 1TRPA 1GY5A 4HM0B 4AKYA 3MG1A 4K90B 4OVMA 1YJW3 1S723 1JRQA 4FCJA 2GBXB 3CC43 3S5CA 2B1XB 3WODG 3SVAA 3EJVA 3ER7A 3ROBA 4H61A 1RGHA 1ZS7A 1Q9EA 2CIUA 3LOYA 4RBNA 2INXA 3F8HA 5EVHA 1FYSA 7RNTA 1YHQ3 1JZDA 3DM8A 3F7SA 4MMYB 4XDVA 4GHOA 3CPW2 1A67A 1OHSA 1OGZA 2F98A 3F8XA 3DUKA 2QA43 4EV5A 4N6UA 1AR0A 3M8CA 1BUJA 3AGNA 4CDLA 2WOHA 3GRDA 5G1LA 7GSPA 2BO9B 3K0ZA 3KE7A 4EV2A 2PNCA 4G1MB 1VQQA 2B24B 3PCRA 3PYJA 2UX0A 2HMJB 2W9QA 3KSED 1F8NA 1OUNA 2FNQA 2GXFA 3A76A 1SPUA 3U1WA 4IPBA 3K9MC 3CNXA 1N8QA 2H0IA 1X1UA 3AMOB 3FKAA 4LEHA 3G6E3 1QVF2 1YJN3 1IV7A 3BNEA 1B2ZA 1ROVA 1JN5B 2Z76A 4CJNA 1KD14 3NBJA 1JNQA 2HMMB 3MKIA 1CH0A 1GMPA 1C54A 1NO3A 5AEUB 1IVVA 2OOVA 3LTAA 3NBRA 5KP3A 3ALAA 2XR8B 3X3YA 1U8CB 2ZHXB 1E3VA 1Q40A 3AGOA 3KSPA 4HJLB 1L5GB 2ZL8A 1MWRA 1O7GB 1Q814 2OOVC 5FW5A 2F5MA 1B27A
chains in the Genus database with same CATH topology
2RSXA 3X40A 4ORLA 4RNZA 2ML5A 5KP1A 3KFQC 4HVNA 3OWYA 1ROAA 4EYCA 4EC6A 3DY5A 2WO0A 3LYGA 3EQQB 3NV0B 3CCE3 2P38A 2YX9A 3RGAA 4KFEA 3CCS3 2XEPA 3FF2A 3NQZA 1CYUA 3EE1A 4FMAA 4MMXB 2QGUA 4RNYA 1FGMA 3I553 3X3XA 5JBSA 3CC23 3LTCA 3OX9A 1YI23 1V74A 5AIFA 2O3OA 3Q2PA 2OCTA 2Y73A 1VQM3 2Z7AA 4H3UA 1KQS2 3LMLA 1FGTA 3N9HA 1RRHA 3FLJA 1JKGB 3EB8A 1NJI4 1OHPA 3WDGB 1GYBA 3WOEB 4GB5A 1NU3A 1R4CA 1N5PA 2P09A 5A0OB 4K1VA 5STDA 6STDA 1JJ22 4FR9A 5AI1A 2XSOB 4JRFA 3JUNA 3WA2X 3OW22 2R4IA 1IDPA 2CW9A 3K5TA 4J9AA 3EN1B 1DVCA 3LTBA 2W04A 2YFJB 1M1K4 4K1UA 2P0MA 2MC8A 1QJGA 1W01A 2KRTA 2BNGA 3HK4A 5IG3A 4WYKA 5CXOA 3FCSB 3SX1A 1ISKA 1A2VA 1K9M4 3V98A 3VSYA 1AV4A 2RCDA 5LC7A 3LTDA 2XH9A 5JPUA 4HM8B 2BHMA 1O7HB 3D9RA 3TDGA 3HIGA 4OK0A 3LT9A 3IJEB 1IVUA 1FGOA 5KP4A 4WFOA 4HM4B 2HMLB 3IPTA 2GEXA 1IVXA 2HMOB 3B7CA 4MEIA 5ELJA 3NQYA 1VQ43 4U13A 4HM6B 4HZ9B 4WP5A 5IW9A 2STDA 1JB2A 1W7CA 1M9GA 1RRLA 1W6YA 4HKVB 1CEWI 3AMOA 3VGNA 3WMDA 2V1LA 3N8BA 3GWRA 1W6GA 4L8OA 1TP6A 5AIHA 2CFGA 4EXRA 3CMA3 2CC3A 3CU3A 5FGOA 3G16A 3N54B 5IG5A 1TFKA 2QIYA 2W9PA 3JUOA 3FH1A 3WA3A 3F9SA 3FG3A 1N9EA 2GEYA 4R80A 1ULIB 1QALA 3G8ZA 2D1WA 2F86B 4HM3B 5LC6A 1EG9B 3CCQ3 2XRXB 2BMOB 2E2TA 3GAXA 2I9WA 1IK3A 1D6ZA 1NB5I 1JB5A 2XFTA 2CHCA 4RZMA 1MNLA 4BTXA 4XB5A 5DRVA 1STFI 2W03A 5AIGA 4L7KA 3HI7A 2W56A 3X41A 3MPHA 3LXUX 3FZWA 4X2OA 3I0YA 1T5YA 2CWVA 1W02A 2GBWB 3T8UA 2CWUA 1D6YA 4NREA 2JQ5A 3QK9A 1O7WB 3GZRA 2XSHB 3MHEA 4N6TA 1WMPA 3KIIA 3EN8A 5IENA 1NB3I 2E2UA 2P05A 4N6OB 3MWZA 5BVBA 2LYXA 3I563 1J2BA 4XM4A 2OTL3 2CFDA 4LZIA 4N6MA 3CPOA 2HMNB 4HZBB 1IQ8A 1FA3A 3PGBA 1UUWB 4N6NB 3D3LA 3CC73 3X3ZA 5AIIA 5HGRA 3PCSA 4KFFA 1SQWA 2RGQA 3T8NA 2C11A 4XBYA 5CLKA 1DVDA 3FF0A 3FG1A 1IV9A 1VQ83 3DXOA 1TU5A 3CCU3 3QRDA 5D81A 3S67A 3MG3A 1CYVA 3JUQA 4O8SA 1KWIA 1GD4A 1MOLA 5CF1A 1OACA 4FMDA 4XBXA 5IF6A 3IMAB 3MSOA 3STDA 4R9LA 4R9KA 1HKXA 1HU9A 4J8TA 2GU3A 1STDA 2FGTA 3H3HA 1QMAA 5I97A 1O7PB 4BTYA 2MF7A 2BT3A 3V99A 5AYSC 1GD3A 1AVLA 1AVKA 2OQEC 5CF2A 3NHXA 3PZWA 3DGNA 4AKZA 5ELUA 1Q40B 2YFIB 2HMKB 4EBGA 4KZ1A 1DYUA 1WMOA 1FGRA 3K7CA 2SBLA 2IUKA 1VQK3 1UUVB 4LMIA 3E99A 1SIHA 3FSDA 1OH0A 4N3VA 2CFLA 3VF1A 1FUWA 2CG0A 1SJWA 4QWTA 1W4NA 3S28A 4FCZA 3SOYA 3NM7A 1BUQA 2Y74A 5DREA 2CK3H 4FMBA 3DGLA 2O9UX 4NHFA 4L8PA 3BNBA 5G2GA 4HM1B 1VQ63 2XF3A 1JB4A 1RJOA 3FGYA 3NX0A 3F40A 3GZXB 3EF8A 1YJ93 3MYTA 4LGQA 3JUPA 1Q7Y4 1WNHA 2WGOA 4N6LA 2XFSA 4Q53A 3G713 3NUVA 1JN5A 3H51A 2Z6BA 5JPPA 1OGXA 2D42A 1O7NB 3KZTA 2ZDJA 1IU7A 1VQO3 3NXJA 3OXAA 1W2ZA 4N6V0 3X42A 5CK6A 1KC84 1N9JA 1GS3A 1S5AA 3DMCA 1C7HA 3UNLA 3CCR3 2Q07A 8CHOA 1JV2B 3GZBA 4HYZA 2A15A 3O8YA 1YIJ3 1TIJA 4X2HA 2BMQB 4WHAA 4HM7B 4WYKB 1RKYA 1M904 1W5ZA 1PU4A 1YVBI 1Z1SA 5EQLA 1DMMA 5IG0A 3NV0A 2IUJA 2KXGA 3UJMA 1OF5B 3T0UA 1YGEA 1E3RA 1FGQA 2OWPA 1IVWA 3BNCA 4MJDA 4OUQA 4IIAA 3CCJ3 2RFRA 3KN4A 4FMCA 4HM2B 2WGQA 3CCM3 4GL6A 3MG2A 4HBRA 1PFPA 2W0QA 3SXXA 3RGRA 2IA7A 3BB9A 1EKMA 4LSOA 1VQ93 2YFLB 1UI8A 2W2CA 5IERA 4R1KA 1LNHA 2Z77A 2KCDA 4XDWA 1K28A 4TX4A 3BNDA 1JKGA 1RN7A 4PEJA 3SLUA 3UL5A 3OV4A 3WOFB 1VQP3 3CNMA 1N8R4 2LQVA 3J7Yd 2CFWA 1VZZA 4ZM8A 1DMNA 2F99A 1YIT3 1IQXA 1E97A 1D6UA 4KFDA 4BTWA 2L4VA 1VQ73 5AYRB 3B8LA 3SOAA 5IEPA 3EX9A 1CQSA 1VQN3 2K0MA 1NWWA 5EEOA 1UI7A 4O2HA 4R4KA 3L0RA 3B4OA 3FG4A 2GU1A 2XGNA 2BMRB 5IEOA 1US1A 1IQYA 1ASKA 3KKGA 2E2VA 1GY6A 5D82A 2FXTA 1W6CA 3LZAA 5AEWB 5IG4A 1QVG2 3GZYB 1UW1A 1K41A 1WTHA 3S27A 1EQKA 1SIIA 2WOFA 3OWUA 1DMQA 1NDOB 3OWSA 2W56B 4WWUC 1TUHA 4K61A 1OPYA 1Q42A 2OQEA 3DZLA 1K734 2M7OA 3HIIA 2JDIH 4KVHA 3S29A 2OTJ3 3JUMA 4STDA 1KSIA 3DGOA 3RDEA 1Q864 2CWTA 1IT8A 2CH9A 2IMJA 1WQLB 3B4PA 4HM5B 1OCVA 3NBBA 1IT7A 3CME3 3G0KA 4XBTA 3EHCA 2P0XA 3V92A 4IT7A 3CXC2 1ZX2A 1LVNA 1Y4KA 3F14A 3NM2A 3Q90A 1QAKA 1G96A 2C10A 4FCMA 4I4KA 2CG1A 3CCV3 3Q1CA 3UB1A 1M1XB 3JVCA 1EA2A 1WMNA 2QEX3 1VQ53 3EBYA 4JF8A 3G4S3 3CCL3 1LOXA 1LXEA 1W00A 3DGMA 1U5OA 3PS8A 2PZVA 1O7MB 3EC9A 3K63A 5BXQA 1GY7A 1QAFA 3SEDA 4AEQA 1ULJB 1W2B2 4CCVA 3BLZA 3F7XA 3LT8A 1A90A 3UL6A 3PXMA 5D83A 1OF5A 2CFKA 3HZPA 7STDA 2W6JH 4O02B 1TFOA 5TGNA 2ML6A 4MMZB 1OHOA 2XGLA 1Q824 2K54A 1VQL3 1N5HA 3HX8A 3CD63 1K8A4 4O3VA 3U97A 3LH4A 3ECFA 3EBTA 2CKFB 1A2KA 1ZO2A 1GY5A 4HM0B 4AKYA 3MG1A 4K90B 4OVMA 1YJW3 1S723 1JRQA 4FCJA 2GBXB 3CC43 3S5CA 2B1XB 3WODG 3SVAA 3EJVA 3ER7A 3ROBA 4H61A 2CIUA 3LOYA 4RBNA 2INXA 3F8HA 5EVHA 1A67A 1YHQ3 3DM8A 4MMYB 3F7SA 4XDVA 3CPW2 1OHSA 1OGZA 2F98A 3F8XA 3DUKA 2QA43 4EV5A 4N6UA 1AR0A 3M8CA 4CDLA 2WOHA 3GRDA 2BO9B 3K0ZA 3KE7A 4EV2A 2PNCA 4G1MB 2B24B 3PCRA 3PYJA 2UX0A 2HMJB 2W9QA 3KSED 1F8NA 1OUNA 2GXFA 2FNQA 3A76A 1SPUA 3U1WA 4IPBA 3K9MC 3CNXA 1N8QA 3AMOB 3FKAA 4LEHA 3G6E3 1QVF2 1YJN3 1IV7A 3BNEA 1ROVA 2Z76A 1JN5B 1KD14 3NBJA 1JNQA 2HMMB 3MKIA 1NO3A 5AEUB 1IVVA 2OOVA 3LTAA 3NBRA 5KP3A 3ALAA 2XR8B 3X3YA 1U8CB 1E3VA 1Q40A 3KSPA 4HJLB 1L5GB 2ZL8A 1Q814 1O7GB 2OOVC 5FW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH9 A;  1NB5 I;  1WNH A;  4N6L A;  3KFQ C;  1MNL A;  1ROA A;  1STF I;  4EYC A;  4IT7 A;  1G96 A;  4N6V 0;  1N9J A;  1CYU A;  1LXE A;  4N6T A;  3PS8 A;  1TIJ A;  3Q2P A;  2OCT A;  1NB3 I;  4N6O B;  3MWZ A;  4CCV A;  1YVB I;  1A90 A;  3UL6 A;  3PXM A;  5EQL A;  4LZI A;  4N6M A;  1R4C A;  1N5P A;  5A0O B;  2KXG A;  1FA3 A;  4N6N B;  1N5H A;  1DVC A;  1PFP A;  3LH4 A;  1DVD A;  1IV9 A;  3QRD A;  4TX4 A;  3S67 A;  1RN7 A;  3UL5 A;  3SVA A;  1CYV A;  5LC7 A;  1KWI A;  1GD4 A;  1MOL A;  4ZM8 A;  1A67 A;  3IMA B;  4N6U A;  1GD3 A;  3L0R A;  2BO9 B;  5ELJ A;  5ELU A;  3PYJ A;  2W9Q A;  3KSE D;  1M9G A;  1CEW I;  3K9M C;  1FUW A;  1IV7 A;  1EQK A;  2W9P A;  2O9U X;  3NX0 A;  5LC6 A;  3GAX A; 
#chains in the Genus database with same CATH topology
 2RSX A;  3X40 A;  4ORL A;  4RNZ A;  2ML5 A;  2RBI A;  3KFQ C;  4HVN A;  5KP1 A;  3OWY A;  1ROA A;  1YVS A;  1RN1 A;  4EYC A;  4EC6 A;  1T2H A;  3DY5 A;  2WO0 A;  3LYG A;  2AAD A;  1BNI A;  3BIR A;  3EQQ B;  3NV0 B;  3CCE 3;  2P38 A;  2YX9 A;  1UDI I;  3RGA A;  4KFE A;  3CCS 3;  2XEP A;  3FF2 A;  3NQZ A;  1CYU A;  3EE1 A;  2KF4 A;  4FMA A;  4MMX B;  2QGU A;  4RNY A;  1FGM A;  3I55 3;  1FUT A;  3X3X A;  5JBS A;  2CX1 A;  3CC2 3;  5BU4 A;  3LTC A;  3OX9 A;  1YI2 3;  4RNT A;  1V74 A;  3D5G A;  5AIF A;  1JZO A;  1DE3 A;  2O3O A;  2KAA A;  3Q2P A;  1I3F A;  1BNG A;  2OCT A;  2Y73 A;  2RNT A;  2Z7A A;  4H3U A;  1VQM 3;  3LML A;  1FGT A;  3N9H A;  1KQS 2;  1RRH A;  3FLJ A;  1JKG B;  4BU4 A;  1PYL A;  3EB8 A;  1NJI 4;  1OHP A;  3WDG B;  1GYB A;  3WOE B;  2HOH A;  4GB5 A;  1NU3 A;  1R4C A;  1N5P A;  2P09 A;  5A0O B;  4K1V A;  5STD A;  6STD A;  1JJ2 2;  1BNR A;  4FR9 A;  1GOY A;  2XSO B;  4JRF A;  3JUN A;  5AI1 A;  3WA2 X;  3OW2 2;  2R4I A;  1IDP A;  1RGE A;  2CW9 A;  3K5T A;  4J9A A;  3EN1 B;  1EUI C;  1DVC A;  1RSN A;  2W04 A;  3LTB A;  2UUG C;  2YFJ B;  1M1K 4;  4K1U A;  2F4Y A;  2P0M A;  2MC8 A;  1QJG A;  4HAA A;  1W01 A;  2KRT A;  6RNT A;  2BNG A;  3HK4 A;  5IG3 A;  1RDS A;  2KF5 A;  4WYK A;  2H0G A;  1MWS A;  5CXO A;  3FCS B;  3SX1 A;  1TRQ A;  1A2V A;  1ISK A;  1K9M 4;  3V98 A;  3VSY A;  1AV4 A;  2RCD A;  5LC7 A;  2F56 A;  3LTD A;  2XH9 A;  5JPU A;  1X1X A;  1IYY A;  4HM8 B;  1MWU A;  1UGH I;  2BHM A;  1I8V A;  1O7H B;  3D9R A;  1RCK A;  4ILF A;  3TDG A;  3HIG A;  4OK0 A;  2F5W A;  3D79 A;  3IJE B;  3LT9 A;  1IVU A;  1X1W A;  1FGO A;  6GSP A;  4WFO A;  5KP4 A;  4HM4 B;  2HML B;  4BL3 A;  3IPT A;  3KCH A;  2GEX A;  4KT3 B;  1IVX A;  2HMO B;  3B7C A;  4MEI A;  5ELJ A;  3ZG0 A;  3NQY A;  1VQ4 3;  2IY2 A;  4U13 A;  4HM6 B;  4HZ9 B;  4WP5 A;  5IW9 A;  4CPK A;  2STD A;  1JB2 A;  1W7C A;  1M9G A;  1RRL A;  1W6Y A;  1DET A;  4HKV B;  1CEW I;  3AMO A;  3VGN A;  3WMD A;  2V1L A;  3N8B A;  3GWR A;  1W6G A;  3HOH A;  1RNB A;  4L8O A;  1TP6 A;  1GOU A;  2CFG A;  5AIH A;  4EXR A;  2CC3 A;  3CU3 A;  5FGO A;  3CMA 3;  3G16 A;  3N54 B;  5IG5 A;  1TFK A;  5GSP A;  2QIY A;  2W9P A;  3JUO A;  1B2M A;  3FH1 A;  3WA3 A;  3F9S A;  3FG3 A;  1N9E A;  1B2S A;  2GEY A;  4R80 A;  1ULI B;  1QAL A;  3G8Z A;  2D1W A;  2F86 B;  4HM3 B;  5LC6 A;  1EG9 B;  3CCQ 3;  2XRX B;  2BMO B;  2E2T A;  3GAX A;  2I9W A;  1BNJ A;  2GSP A;  1RTU A;  1IK3 A;  3A5E A;  1D6Z A;  1NB5 I;  3BU4 A;  3SYU A;  1JB5 A;  2XFT A;  1BSD A;  2CHC A;  4RZM A;  1MNL A;  4BTX A;  4XB5 A;  5DRV A;  1STF I;  4LYL B;  2W03 A;  5AIG A;  1G0T A;  4L7K A;  3HI7 A;  2W56 A;  3X41 A;  2H0H A;  1BRN L;  1BRK A;  3MPH A;  1I2F A;  3LXU X;  4J5G A;  3FZW A;  4X2O A;  3I0Y A;  1I2G A;  1UUG B;  1T5Y A;  2CWV A;  1W02 A;  2GBW B;  1YNV X;  3T8U A;  1HZ1 A;  2CWU A;  1D6Y A;  4NRE A;  2JQ5 A;  3QK9 A;  1O7W B;  3GZR A;  1GMR A;  2BIR A;  2XSH B;  1AY7 A;  3MHE A;  4N6T A;  1WMP A;  1RHL A;  3KII A;  3EN8 A;  5IEN A;  1UCK A;  1NB3 I;  2E2U A;  2P05 A;  4N6O B;  3MWZ A;  5BVB A;  2LYX A;  3I56 3;  1J2B A;  4XM4 A;  2OTL 3;  2CFD A;  4LZI A;  4N6M A;  1BRG A;  3CPO A;  2HMN B;  4HZB B;  1IQ8 A;  1FA3 A;  3PGB A;  1UUW B;  1UGI A;  4N6N B;  1RGF A;  3RNT A;  3D3L A;  3CC7 3;  1BU4 A;  1MWT A;  1GMQ A;  3X3Z A;  5AII A;  5HGR A;  3PCS A;  1BOX A;  1BVI A;  1SQW A;  2RGQ A;  4KFF A;  3T8N A;  1BRI A;  2C11 A;  4XBY A;  5CLK A;  1DVD A;  4I5Q A;  3FF0 A;  3FG1 A;  1IV9 A;  1VQ8 3;  9RNT A;  3DXO A;  5HOH A;  1TU5 A;  3CCU 3;  3QRD A;  5D81 A;  3S67 A;  3MG3 A;  1CYV A;  3JUQ A;  4O8S A;  3ZFZ A;  1KWI A;  1GD4 A;  1MOL A;  5CF1 A;  2L1S A;  1GOV A;  1OAC A;  4FMD A;  4XBX A;  5IF6 A;  3IMA B;  3MSO A;  3STD A;  4R9L A;  4R9K A;  1HKX A;  1HU9 A;  4J8T A;  4BIR A;  2GU3 A;  1STD A;  1V57 A;  1R4Y A;  1QMA A;  2FGT A;  3H3H A;  5I97 A;  1O7P B;  4BTY A;  2MF7 A;  2BT3 A;  3V99 A;  5AYS C;  1GD3 A;  1AVL A;  1AVK A;  2OQE C;  5CF2 A;  3NHX A;  3PZW A;  3DGN A;  1B20 A;  5ELU A;  1BSA A;  1Q40 B;  1RGK A;  2HMK B;  2YFI B;  2ZA4 A;  4EBG A;  4KZ1 A;  1DYU A;  1WMO A;  1FGR A;  1X1Y A;  2IUK A;  2UGI A;  2SBL A;  3DH2 A;  3K7C A;  1VQK 3;  1UUV B;  4LMI A;  2KF6 A;  1ZGX A;  3E99 A;  5G1K A;  1BRH A;  1SIH A;  3FSD A;  1G02 A;  1OH0 A;  4N3V A;  2CFL A;  3VF1 A;  1FUW A;  2CG0 A;  1SJW A;  4QWT A;  1W4N A;  3S28 A;  1MGR A;  4FCZ A;  1BAN A;  3SOY A;  3NM7 A;  1BUQ A;  2Y74 A;  5DRE A;  2CK3 H;  1I2E A;  4FMB A;  5RNT A;  3DGL A;  2O9U X;  4NHF A;  2K3D A;  4L8P A;  3BNB A;  5G2G A;  4HM1 B;  1VQ6 3;  2XF3 A;  5M19 A;  1JB4 A;  1RJO A;  3FGY A;  3NX0 A;  3F40 A;  3GZX B;  3EF8 A;  1YJ9 3;  3MYT A;  4LGQ A;  1T2I A;  3JUP A;  1I0X A;  1RCL A;  3ZG5 A;  1Q7Y 4;  4J5K A;  1WNH A;  2WGO A;  4N6L A;  2XFS A;  4Q53 A;  3G71 3;  3NUV A;  1HYF A;  1JN5 A;  3H51 A;  2Z6B A;  1I0V A;  1OGX A;  2D42 A;  1O7N B;  5JPP A;  2IYJ A;  3KZT A;  2ZDJ A;  1IU7 A;  1VQO 3;  3NXJ A;  1RGA A;  3URP A;  4AKZ A;  3OXA A;  1W2Z A;  4N6V 0;  3X42 A;  5CK6 A;  1KC8 4;  1N9J A;  1GS3 A;  1S5A A;  3DMC A;  1C7H A;  3UNL A;  3CCR 3;  2Q07 A;  1BAO A;  1YGW A;  8CHO A;  1PY3 A;  1JV2 B;  3GZB A;  3D5I A;  4HYZ A;  1JBT A;  2A15 A;  3O8Y A;  1YIJ 3;  1TIJ A;  2R41 A;  4X2H A;  2BMQ B;  4WHA A;  4HM7 B;  4WYK B;  1RKY A;  1M90 4;  1W5Z A;  1LNI A;  1JBR A;  1PU4 A;  1YVB I;  1FW7 A;  1Z1S A;  5EQL A;  1DMM A;  5IG0 A;  3NV0 A;  2IUJ A;  2J8X B;  2KXG A;  3UJM A;  1EEJ A;  4GSP A;  1OF5 B;  3T0U A;  1YGE A;  1E3R A;  1FGQ A;  2OWP A;  3GSP A;  1IVW A;  3BNC A;  4MJD A;  4OUQ A;  4IIA A;  3CCJ 3;  2RFR A;  3KN4 A;  4FMC A;  4HM2 B;  2WGQ A;  3CCM 3;  1LQG C;  1RN4 A;  1FUS A;  3MG2 A;  4GL6 A;  1PFP A;  2W0Q A;  4HBR A;  3SXX A;  3RGR A;  2IA7 A;  3BB9 A;  1EKM A;  4LSO A;  1VQ9 3;  2YFL B;  1AQZ A;  1UI8 A;  2W2C A;  5IER A;  4R1K A;  1LNH A;  1B21 A;  1TTO A;  2KCD A;  1V58 A;  2Z77 A;  4XDW A;  1K28 A;  4TX4 A;  1UCI A;  3BND A;  1UCL A;  1JKG A;  1RN7 A;  3Q3F A;  4PEJ A;  3SLU A;  3UL5 A;  3OV4 A;  3WOF B;  1VQP 3;  3CNM A;  1N8R 4;  2LQV A;  3J7Y d;  2CFW A;  1VZZ A;  1JBS A;  4ZM8 A;  2C4B A;  1DMN A;  2F99 A;  1YIT 3;  1RGC A;  1IQX A;  1E97 A;  1D6U A;  4KFD A;  4BL2 A;  4BTW A;  2L4V A;  1FZU A;  5AYR B;  3B8L A;  3SOA A;  1VQ7 3;  5IEP A;  3EX9 A;  1CQS A;  1VQN 3;  1T3B A;  2K0M A;  1NWW A;  5EEO A;  1UI7 A;  4O2H A;  3AHS A;  3L0R A;  3B4O A;  3FG4 A;  4R4K A;  8RNT A;  2GU1 A;  2XGN A;  2BMR B;  5IEO A;  1US1 A;  1IQY A;  1BNF A;  1ASK A;  1UCJ A;  2E2V A;  1GY6 A;  3KKG A;  5D82 A;  2FXT A;  2SAR A;  1W6C A;  3LZA A;  5AEW B;  5IG4 A;  1QVG 2;  3GZY B;  1UW1 A;  1LOV A;  1K41 A;  1WTH A;  1B3S A;  3S27 A;  1I70 A;  1EQK A;  1SII A;  2WOF A;  3OWU A;  1DMQ A;  1NDO B;  3OWS A;  1RNT A;  2W56 B;  1BSB A;  1TUH A;  4K61 A;  4WWU C;  1OPY A;  1Q42 A;  1LOW A;  1BGS A;  3DZL A;  2OQE A;  5BIR A;  1K73 4;  2M7O A;  4DKI A;  1Q7H A;  3HII A;  2JDI H;  4KVH A;  3S29 A;  2OTJ 3;  3JUM A;  4STD A;  1KSI A;  3DGO A;  2CX0 A;  3RDE A;  1BRJ A;  1TJD A;  1Q86 4;  1RGG A;  2CWT A;  1IT8 A;  2CH9 A;  1B2U A;  2IMJ A;  3AHW A;  1WQL B;  1RLS A;  1RMS A;  3B4P A;  4HM5 B;  1OCV A;  3NBB A;  1IT7 A;  1BSC A;  3CME 3;  3G0K A;  4XBT A;  3EHC A;  1B2X A;  1LOY A;  2P0X A;  3V92 A;  1BNS A;  4IT7 A;  3CXC 2;  1ZX2 A;  1LVN A;  1Y4K A;  3F14 A;  3NM2 A;  3Q90 A;  1LQM B;  1QAK A;  1BSE A;  1G96 A;  2C10 A;  4FCM A;  4I4K A;  2CG1 A;  3CCV 3;  3Q1C A;  3UB1 A;  2AAE A;  2BU4 A;  1M1X B;  3JVC A;  1A2P A;  1EA2 A;  1MGW A;  5M18 A;  1WMN A;  2QEX 3;  1VQ5 3;  3D4A A;  3EBY A;  4JF8 A;  1GSP A;  3G4S 3;  3CCL 3;  1LOX A;  1LXE A;  1W00 A;  3DGM A;  1U5O A;  3PS8 A;  3WHO A;  2PZV A;  1O7M B;  1BIR A;  3EC9 A;  3K63 A;  5BXQ A;  1GY7 A;  1QAF A;  3SED A;  1I3I A;  4EW5 A;  4AEQ A;  1SAR A;  1ULJ B;  1W2B 2;  4CCV A;  3BLZ A;  3F7X A;  3LT8 A;  2KF3 A;  3UL6 A;  1A90 A;  3PXM A;  5D83 A;  1OF5 A;  2CFK A;  3HZP A;  5M1A A;  1BRS A;  4HOH A;  7STD A;  2W6J H;  4O02 B;  1TFO A;  5TGN A;  2ML6 A;  4MMZ B;  1OHO A;  1BNE A;  2XGL A;  1Q82 4;  2K54 A;  1VQL 3;  1LRA A;  1N5H A;  3HX8 A;  3CD6 3;  1RGL A;  1K8A 4;  4NPB A;  4O3V A;  3U97 A;  3DGY A;  3WR2 A;  3LH4 A;  3ECF A;  3EBT A;  2CKF B;  1A2K A;  1NNV A;  1ZO2 A;  1TRP A;  1GY5 A;  4HM0 B;  4AKY A;  3MG1 A;  4K90 B;  4OVM A;  1YJW 3;  1S72 3;  1JRQ A;  4FCJ A;  2GBX B;  3CC4 3;  3S5C A;  2B1X B;  3WOD G;  3SVA A;  3EJV A;  3ER7 A;  3ROB A;  4H61 A;  1RGH A;  1ZS7 A;  1Q9E A;  2CIU A;  3LOY A;  4RBN A;  2INX A;  3F8H A;  5EVH A;  1FYS A;  7RNT A;  1YHQ 3;  1JZD A;  3DM8 A;  3F7S A;  4MMY B;  4XDV A;  4GHO A;  3CPW 2;  1A67 A;  1OHS A;  1OGZ A;  2F98 A;  3F8X A;  3DUK A;  2QA4 3;  4EV5 A;  4N6U A;  1AR0 A;  3M8C A;  1BUJ A;  3AGN A;  4CDL A;  2WOH A;  3GRD A;  5G1L A;  7GSP A;  2BO9 B;  3K0Z A;  3KE7 A;  4EV2 A;  2PNC A;  4G1M B;  1VQQ A;  2B24 B;  3PCR A;  3PYJ A;  2UX0 A;  2HMJ B;  2W9Q A;  3KSE D;  1F8N A;  1OUN A;  2FNQ A;  2GXF A;  3A76 A;  1SPU A;  3U1W A;  4IPB A;  3K9M C;  3CNX A;  1N8Q A;  2H0I A;  1X1U A;  3AMO B;  3FKA A;  4LEH A;  3G6E 3;  1QVF 2;  1YJN 3;  1IV7 A;  3BNE A;  1B2Z A;  1ROV A;  1JN5 B;  2Z76 A;  4CJN A;  1KD1 4;  3NBJ A;  1JNQ A;  2HMM B;  3MKI A;  1CH0 A;  1GMP A;  1C54 A;  1NO3 A;  5AEU B;  1IVV A;  2OOV A;  3LTA A;  3NBR A;  5KP3 A;  3ALA A;  2XR8 B;  3X3Y A;  1U8C B;  2ZHX B;  1E3V A;  1Q40 A;  3AGO A;  3KSP A;  4HJL B;  1L5G B;  2ZL8 A;  1MWR A;  1O7G B;  1Q81 4;  2OOV C;  5FW5 A;  2F5M A;  1B27 A; 
#chains in the Genus database with same CATH homology
 2RSX A;  3X40 A;  4ORL A;  4RNZ A;  2ML5 A;  5KP1 A;  3KFQ C;  4HVN A;  3OWY A;  1ROA A;  4EYC A;  4EC6 A;  3DY5 A;  2WO0 A;  3LYG A;  3EQQ B;  3NV0 B;  3CCE 3;  2P38 A;  2YX9 A;  3RGA A;  4KFE A;  3CCS 3;  2XEP A;  3FF2 A;  3NQZ A;  1CYU A;  3EE1 A;  4FMA A;  4MMX B;  2QGU A;  4RNY A;  1FGM A;  3I55 3;  3X3X A;  5JBS A;  3CC2 3;  3LTC A;  3OX9 A;  1YI2 3;  1V74 A;  5AIF A;  2O3O A;  3Q2P A;  2OCT A;  2Y73 A;  1VQM 3;  2Z7A A;  4H3U A;  1KQS 2;  3LML A;  1FGT A;  3N9H A;  1RRH A;  3FLJ A;  1JKG B;  3EB8 A;  1NJI 4;  1OHP A;  3WDG B;  1GYB A;  3WOE B;  4GB5 A;  1NU3 A;  1R4C A;  1N5P A;  2P09 A;  5A0O B;  4K1V A;  5STD A;  6STD A;  1JJ2 2;  4FR9 A;  5AI1 A;  2XSO B;  4JRF A;  3JUN A;  3WA2 X;  3OW2 2;  2R4I A;  1IDP A;  2CW9 A;  3K5T A;  4J9A A;  3EN1 B;  1DVC A;  3LTB A;  2W04 A;  2YFJ B;  1M1K 4;  4K1U A;  2P0M A;  2MC8 A;  1QJG A;  1W01 A;  2KRT A;  2BNG A;  3HK4 A;  5IG3 A;  4WYK A;  5CXO A;  3FCS B;  3SX1 A;  1ISK A;  1A2V A;  1K9M 4;  3V98 A;  3VSY A;  1AV4 A;  2RCD A;  5LC7 A;  3LTD A;  2XH9 A;  5JPU A;  4HM8 B;  2BHM A;  1O7H B;  3D9R A;  3TDG A;  3HIG A;  4OK0 A;  3LT9 A;  3IJE B;  1IVU A;  1FGO A;  5KP4 A;  4WFO A;  4HM4 B;  2HML B;  3IPT A;  2GEX A;  1IVX A;  2HMO B;  3B7C A;  4MEI A;  5ELJ A;  3NQY A;  1VQ4 3;  4U13 A;  4HM6 B;  4HZ9 B;  4WP5 A;  5IW9 A;  2STD A;  1JB2 A;  1W7C A;  1M9G A;  1RRL A;  1W6Y A;  4HKV B;  1CEW I;  3AMO A;  3VGN A;  3WMD A;  2V1L A;  3N8B A;  3GWR A;  1W6G A;  4L8O A;  1TP6 A;  5AIH A;  2CFG A;  4EXR A;  3CMA 3;  2CC3 A;  3CU3 A;  5FGO A;  3G16 A;  3N54 B;  5IG5 A;  1TFK A;  2QIY A;  2W9P A;  3JUO A;  3FH1 A;  3WA3 A;  3F9S A;  3FG3 A;  1N9E A;  2GEY A;  4R80 A;  1ULI B;  1QAL A;  3G8Z A;  2D1W A;  2F86 B;  4HM3 B;  5LC6 A;  1EG9 B;  3CCQ 3;  2XRX B;  2BMO B;  2E2T A;  3GAX A;  2I9W A;  1IK3 A;  1D6Z A;  1NB5 I;  1JB5 A;  2XFT A;  2CHC A;  4RZM A;  1MNL A;  4BTX A;  4XB5 A;  5DRV A;  1STF I;  2W03 A;  5AIG A;  4L7K A;  3HI7 A;  2W56 A;  3X41 A;  3MPH A;  3LXU X;  3FZW A;  4X2O A;  3I0Y A;  1T5Y A;  2CWV A;  1W02 A;  2GBW B;  3T8U A;  2CWU A;  1D6Y A;  4NRE A;  2JQ5 A;  3QK9 A;  1O7W B;  3GZR A;  2XSH B;  3MHE A;  4N6T A;  1WMP A;  3KII A;  3EN8 A;  5IEN A;  1NB3 I;  2E2U A;  2P05 A;  4N6O B;  3MWZ A;  5BVB A;  2LYX A;  3I56 3;  1J2B A;  4XM4 A;  2OTL 3;  2CFD A;  4LZI A;  4N6M A;  3CPO A;  2HMN B;  4HZB B;  1IQ8 A;  1FA3 A;  3PGB A;  1UUW B;  4N6N B;  3D3L A;  3CC7 3;  3X3Z A;  5AII A;  5HGR A;  3PCS A;  4KFF A;  1SQW A;  2RGQ A;  3T8N A;  2C11 A;  4XBY A;  5CLK A;  1DVD A;  3FF0 A;  3FG1 A;  1IV9 A;  1VQ8 3;  3DXO A;  1TU5 A;  3CCU 3;  3QRD A;  5D81 A;  3S67 A;  3MG3 A;  1CYV A;  3JUQ A;  4O8S A;  1KWI A;  1GD4 A;  1MOL A;  5CF1 A;  1OAC A;  4FMD A;  4XBX A;  5IF6 A;  3IMA B;  3MSO A;  3STD A;  4R9L A;  4R9K A;  1HKX A;  1HU9 A;  4J8T A;  2GU3 A;  1STD A;  2FGT A;  3H3H A;  1QMA A;  5I97 A;  1O7P B;  4BTY A;  2MF7 A;  2BT3 A;  3V99 A;  5AYS C;  1GD3 A;  1AVL A;  1AVK A;  2OQE C;  5CF2 A;  3NHX A;  3PZW A;  3DGN A;  4AKZ A;  5ELU A;  1Q40 B;  2YFI B;  2HMK B;  4EBG A;  4KZ1 A;  1DYU A;  1WMO A;  1FGR A;  3K7C A;  2SBL A;  2IUK A;  1VQK 3;  1UUV B;  4LMI A;  3E99 A;  1SIH A;  3FSD A;  1OH0 A;  4N3V A;  2CFL A;  3VF1 A;  1FUW A;  2CG0 A;  1SJW A;  4QWT A;  1W4N A;  3S28 A;  4FCZ A;  3SOY A;  3NM7 A;  1BUQ A;  2Y74 A;  5DRE A;  2CK3 H;  4FMB A;  3DGL A;  2O9U X;  4NHF A;  4L8P A;  3BNB A;  5G2G A;  4HM1 B;  1VQ6 3;  2XF3 A;  1JB4 A;  1RJO A;  3FGY A;  3NX0 A;  3F40 A;  3GZX B;  3EF8 A;  1YJ9 3;  3MYT A;  4LGQ A;  3JUP A;  1Q7Y 4;  1WNH A;  2WGO A;  4N6L A;  2XFS A;  4Q53 A;  3G71 3;  3NUV A;  1JN5 A;  3H51 A;  2Z6B A;  5JPP A;  1OGX A;  2D42 A;  1O7N B;  3KZT A;  2ZDJ A;  1IU7 A;  1VQO 3;  3NXJ A;  3OXA A;  1W2Z A;  4N6V 0;  3X42 A;  5CK6 A;  1KC8 4;  1N9J A;  1GS3 A;  1S5A A;  3DMC A;  1C7H A;  3UNL A;  3CCR 3;  2Q07 A;  8CHO A;  1JV2 B;  3GZB A;  4HYZ A;  2A15 A;  3O8Y A;  1YIJ 3;  1TIJ A;  4X2H A;  2BMQ B;  4WHA A;  4HM7 B;  4WYK B;  1RKY A;  1M90 4;  1W5Z A;  1PU4 A;  1YVB I;  1Z1S A;  5EQL A;  1DMM A;  5IG0 A;  3NV0 A;  2IUJ A;  2KXG A;  3UJM A;  1OF5 B;  3T0U A;  1YGE A;  1E3R A;  1FGQ A;  2OWP A;  1IVW A;  3BNC A;  4MJD A;  4OUQ A;  4IIA A;  3CCJ 3;  2RFR A;  3KN4 A;  4FMC A;  4HM2 B;  2WGQ A;  3CCM 3;  4GL6 A;  3MG2 A;  4HBR A;  1PFP A;  2W0Q A;  3SXX A;  3RGR A;  2IA7 A;  3BB9 A;  1EKM A;  4LSO A;  1VQ9 3;  2YFL B;  1UI8 A;  2W2C A;  5IER A;  4R1K A;  1LNH A;  2Z77 A;  2KCD A;  4XDW A;  1K28 A;  4TX4 A;  3BND A;  1JKG A;  1RN7 A;  4PEJ A;  3SLU A;  3UL5 A;  3OV4 A;  3WOF B;  1VQP 3;  3CNM A;  1N8R 4;  2LQV A;  3J7Y d;  2CFW A;  1VZZ A;  4ZM8 A;  1DMN A;  2F99 A;  1YIT 3;  1IQX A;  1E97 A;  1D6U A;  4KFD A;  4BTW A;  2L4V A;  1VQ7 3;  5AYR B;  3B8L A;  3SOA A;  5IEP A;  3EX9 A;  1CQS A;  1VQN 3;  2K0M A;  1NWW A;  5EEO A;  1UI7 A;  4O2H A;  4R4K A;  3L0R A;  3B4O A;  3FG4 A;  2GU1 A;  2XGN A;  2BMR B;  5IEO A;  1US1 A;  1IQY A;  1ASK A;  3KKG A;  2E2V A;  1GY6 A;  5D82 A;  2FXT A;  1W6C A;  3LZA A;  5AEW B;  5IG4 A;  1QVG 2;  3GZY B;  1UW1 A;  1K41 A;  1WTH A;  3S27 A;  1EQK A;  1SII A;  2WOF A;  3OWU A;  1DMQ A;  1NDO B;  3OWS A;  2W56 B;  4WWU C;  1TUH A;  4K61 A;  1OPY A;  1Q42 A;  2OQE A;  3DZL A;  1K73 4;  2M7O A;  3HII A;  2JDI H;  4KVH A;  3S29 A;  2OTJ 3;  3JUM A;  4STD A;  1KSI A;  3DGO A;  3RDE A;  1Q86 4;  2CWT A;  1IT8 A;  2CH9 A;  2IMJ A;  1WQL B;  3B4P A;  4HM5 B;  1OCV A;  3NBB A;  1IT7 A;  3CME 3;  3G0K A;  4XBT A;  3EHC A;  2P0X A;  3V92 A;  4IT7 A;  3CXC 2;  1ZX2 A;  1LVN A;  1Y4K A;  3F14 A;  3NM2 A;  3Q90 A;  1QAK A;  1G96 A;  2C10 A;  4FCM A;  4I4K A;  2CG1 A;  3CCV 3;  3Q1C A;  3UB1 A;  1M1X B;  3JVC A;  1EA2 A;  1WMN A;  2QEX 3;  1VQ5 3;  3EBY A;  4JF8 A;  3G4S 3;  3CCL 3;  1LOX A;  1LXE A;  1W00 A;  3DGM A;  1U5O A;  3PS8 A;  2PZV A;  1O7M B;  3EC9 A;  3K63 A;  5BXQ A;  1GY7 A;  1QAF A;  3SED A;  4AEQ A;  1ULJ B;  1W2B 2;  4CCV A;  3BLZ A;  3F7X A;  3LT8 A;  1A90 A;  3UL6 A;  3PXM A;  5D83 A;  1OF5 A;  2CFK A;  3HZP A;  7STD A;  2W6J H;  4O02 B;  1TFO A;  5TGN A;  2ML6 A;  4MMZ B;  1OHO A;  2XGL A;  1Q82 4;  2K54 A;  1VQL 3;  1N5H A;  3HX8 A;  3CD6 3;  1K8A 4;  4O3V A;  3U97 A;  3LH4 A;  3ECF A;  3EBT A;  2CKF B;  1A2K A;  1ZO2 A;  1GY5 A;  4HM0 B;  4AKY A;  3MG1 A;  4K90 B;  4OVM A;  1YJW 3;  1S72 3;  1JRQ A;  4FCJ A;  2GBX B;  3CC4 3;  3S5C A;  2B1X B;  3WOD G;  3SVA A;  3EJV A;  3ER7 A;  3ROB A;  4H61 A;  2CIU A;  3LOY A;  4RBN A;  2INX A;  3F8H A;  5EVH A;  1A67 A;  1YHQ 3;  3DM8 A;  4MMY B;  3F7S A;  4XDV A;  3CPW 2;  1OHS A;  1OGZ A;  2F98 A;  3F8X A;  3DUK A;  2QA4 3;  4EV5 A;  4N6U A;  1AR0 A;  3M8C A;  4CDL A;  2WOH A;  3GRD A;  2BO9 B;  3K0Z A;  3KE7 A;  4EV2 A;  2PNC A;  4G1M B;  2B24 B;  3PCR A;  3PYJ A;  2UX0 A;  2HMJ B;  2W9Q A;  3KSE D;  1F8N A;  1OUN A;  2GXF A;  2FNQ A;  3A76 A;  1SPU A;  3U1W A;  4IPB A;  3K9M C;  3CNX A;  1N8Q A;  3AMO B;  3FKA A;  4LEH A;  3G6E 3;  1QVF 2;  1YJN 3;  1IV7 A;  3BNE A;  1ROV A;  2Z76 A;  1JN5 B;  1KD1 4;  3NBJ A;  1JNQ A;  2HMM B;  3MKI A;  1NO3 A;  5AEU B;  1IVV A;  2OOV A;  3LTA A;  3NBR A;  5KP3 A;  3ALA A;  2XR8 B;  3X3Y A;  1U8C B;  1E3V A;  1Q40 A;  3KSP A;  4HJL B;  1L5G B;  2ZL8 A;  1Q81 4;  1O7G B;  2OOV C;  5FW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...