3CC73

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cc7300
3CCU3 3CC73 1VQ53 3CCS3 1KQS2 1VQ93 1VQM3 3CC43 1KC84 3CPW2 1YJN3 1JJ22 1K8A4 1VQ43 3CME3 2OTL3 3G6E3 1KD14 3CMA3 3CCL3 1Q864 1VQ73 3G4S3 3CC23 1M1K4 3CCM3 3CXC2 1Q814 2QEX3 1YJ93 3CCR3 1VQL3 1VQ63 3G713 3OW22 3CCQ3 1YI23 1S723 1YIJ3 3CCV3 1K734 1YJW3 1Q824 1QVF2 2OTJ3 1K9M4 3CCJ3 1VQK3 1Q7Y4 1QVG2 1VQN3 1VQO3 1VQ83 1NJI4 1YIT3 1VQP3 3CD63 1N8R4 1W2B2 1YHQ3 3I563 1M904 3I553 3CCE3 2QA43
chains in the Genus database with same CATH superfamily
5AIGA 2WGQA 2SBLA 3KE7A 1DVCA 2E2UA 4LGQA 1TUHA 3LZAA 3WOEB 4RBNA 3A76A 2YX9A 3GWRA 1Q40A 1G02A 3F8XA 2MF7A 2GEXA 2RCDA 4R9KA 3ECFA 1FUWA 1FGOA 3JVCA 1X1WA 4GL6A 2CWVA 1VQL3 3STDA 5IERA 3WOFB 2W2CA 2W0QA 1Y4KA 1C54A 1ROAA 3CPOA 3Q90A 2F86B 3PXMA 5G1KA 1N9EA 2KXGA 1HYFA 3LOYA 3N54B 3VSYA 4FCMA 2BO9B 1IVVA 1TRPA 1U8CB 3K9MC 5G2GA 1BNGA 4NHFA 1VQP3 3AGNA 1B2UA 3HX8A 1TRQA 1RRLA 1LQMB 1N5PA 2IA7A 4BTXA 1BANA 1DMQA 1FGQA 5KP4A 3DY5A 3DH2A 3GZRA 1JNQA 2OTL3 3X3YA 1K8A4 1DVDA 1HZ1A 4HM5B 3X40A 1EQKA 1C7HA 2OWPA 1M9GA 2V1LA 3EF8A 4HM3B 4I4KA 3GZBA 2P0MA 5IG5A 1STFI 1ZGXA 1AQZA 1UUGB 3AHWA 1BRSA 1OF5A 4TX4A 1S723 1YIJ3 1BAOA 3S28A 1UCKA 1JZOA 1K28A 3NM7A 1CQSA 3F7XA 9RNTA 3NQZA 3WMDA 3M8CA 1T2IA 1UUVB 3EC9A 1M904 3MHEA 2D42A 3D79A 3UNLA 4EC6A 3UB1A 1VQ93 3PYJA 2CFWA 1BSAA 4CJNA 3CU3A 5KP3A 3T0UA 3EX9A 1TFOA 4FCJA 5ELJA 2H0HA 1OUNA 3S5CA 4KFEA 1MWRA 4JF8A 1A2KA 3KN4A 3OX9A 5AIFA 1B27A 5IENA 2ZL8A 1W4NA 2F56A 1Q9EA 2A15A 5IG3A 1WNHA 3EBTA 1I8VA 1JBTA 3J7Yd 3F14A 1BGSA 1PY3A 4N6TA 1RGCA 1QVG2 3U97A 3X3ZA 1SPUA 3OWSA 1R4CA 2RBIA 3FLJA 3GZXB 3HZPA 3EBYA 3ROBA 4HM7B 3OWYA 5IG0A 4FMBA 3CCE3 3N9HA 1T5YA 1AVLA 3LXUX 2HMMB 1RNBA 3ZG0A 1VQ43 1OHOA 4MMYB 4CPKA 1W5ZA 2W9PA 2CFDA 3B8LA 1QAFA 1RLSA 2CFGA 1BUJA 3A5EA 1DMNA 2ZDJA 4KFFA 7STDA 1RGEA 1X1XA 2GU1A 4G1MB 1B2SA 3IJEB 1NWWA 1YI23 4WHAA 1AR0A 1RGLA 3FG3A 2ZHXB 4WP5A 3CD63 4LEHA 1K41A 1HU9A 2P05A 1X1UA 5EVHA 3LT9A 1D6UA 1TFKA 4HVNA 1RTUA 1O7WB 2HMNB 2O9UX 2Z7AA 3ZG5A 5FGOA 2WO0A 2QIYA 1X1YA 5LC6A 3S27A 3LTAA 3RGAA 1IQXA 4MEIA 1JJ22 1NDOB 1GOUA 1OGXA 1Q42A 3RDEA 4ZM8A 1JZDA 1I2EA 1I0XA 1SARA 1I2GA 1A2VA 2CKFB 3RGRA 3S29A 1EUIC 2OOVC 1N8QA 4EV2A 1RN1A 2W56B 3CCQ3 1TTOA 1IU7A 3ER7A 3FCSB 3QK9A 4GSPA 4XBYA 3HI7A 4PEJA 3CCV3 1YJW3 4O3VA 3CNXA 1K9M4 1NB3I 1VQK3 2RGQA 2IUKA 1VQO3 4FMAA 1YIT3 1FZUA 4WFOA 1RGKA 4JRFA 1E97A 1BRGA 4BL3A 5EEOA 1GD3A 4K1VA 4LMIA 1BRKA 3K63A 1FYSA 1RCKA 5M1AA 2KF6A 3KCHA 3KIIA 1BRNL 2KF3A 1TIJA 2GEYA 1IVWA 3CME3 3X42A 1LNHA 1W6YA 3UL5A 3MYTA 1N9JA 1NO3A 3OWUA 1QAKA 1LVNA 2BHMA 2YFLB 3PS8A 3SX1A 3VGNA 3CXC2 3EHCA 3NBRA 3H51A 1YVBI 5KP1A 1RGAA 4N6MA 1VQN3 3EE1A 1B2ZA 1BNIA 4N6V0 5AI1A 5I97A 1FUSA 3G16A 4X2HA 5BIRA 1OHSA 1RN7A 1GS3A 3DGYA 5CF2A 3BU4A 2H0GA 4I5QA 1PU4A 4H3UA 3CC73 3N8BA 1EA2A 3SOAA 4ORLA 1IV9A 2GBWB 3B7CA 1UI7A 1UCIA 4WWUC 3CPW2 2QGUA 4KVHA 4L8OA 3L0RA 3LH4A 3GAXA 1G96A 4HM8B 3HIGA 3G4S3 1QMAA 4OVMA 3KZTA 3ZFZA 1LXEA 1D6ZA 5A0OB 2FNQA 1UDII 1JN5A 5D82A 4AKYA 1KSIA 2CFKA 2O3OA 1BSEA 5HGRA 4HBRA 1MWTA 2BT3A 2OOVA 2OTJ3 1LQGC 2BIRA 4NREA 4EYCA 1VQ83 2XFTA 1RNTA 1SQWA 2IY2A 2CHCA 4RNTA 1N8R4 1BU4A 3F40A 1QJGA 1SIIA 1UCJA 4GHOA 1MOLA 2OCTA 3K7CA 3LT8A 7RNTA 1YHQ3 1Q40B 2XF3A 4IIAA 2C4BA 2E2VA 2UX0A 2XGLA 1STDA 1JB2A 1RHLA 2CIUA 4N3VA 2IUJA 1RDSA 2CX1A 2Q07A 3JUPA 4K1UA 3CCL3 4HM2B 4Q53A 3LTBA 2B24B 2XH9A 3NXJA 3URPA 4J5GA 1KWIA 1WQLB 3JUQA 7GSPA 4HYZA 4KFDA 3F8HA 5DRVA 3WDGB 3BLZA 4HJLB 3GRDA 1A2PA 1NNVA 4MJDA 3B4OA 3CCJ3 2D1WA 2LQVA 2Z76A 2XR8B 4RZMA 1BSDA 4EV5A 2AADA 1B20A 3MG1A 3MWZA 1OCVA 2C11A 3DUKA 1EKMA 3LTCA 3NHXA 3SXXA 3EN8A 1VQQA 2XEPA 1I70A 1IVUA 2IYJA 3Q2PA 5CF1A 4HM4B 3FKAA 1FW7A 1PYLA 2L4VA 5RNTA 4QWTA 2ML5A 3F9SA 4HOHA 1ISKA 3KSED 2R41A 3LTDA 3CCM3 1SIHA 1YJ93 1MWSA 1I2FA 3X41A 1TU5A 3OW22 1IDPA 1T2HA 1OH0A 4R1KA 2UGIA 5DREA 4MMXB 2MC8A 3DMCA 5AEWB 3H3HA 3V98A 1MGRA 1LNIA 2W56A 1WMNA 4XDVA 2K54A 2F5WA 2XRXB 1B2XA 5M19A 1RN4A 3B4PA 4AKZA 2XSHB 3SYUA 3I563 4N6LA 1GYBA 3WHOA 4HZ9B 2CG0A 4R80A 1E3RA 1W01A 4RNYA 1BNEA 3CCS3 3G8ZA 1CH0A 1BRJA 3MG2A 2BU4A 4BTYA 2YFIB 5FW5A 4HM0B 1Z1SA 3FF0A 4J5KA 3AGOA 1US1A 1CYVA 1UW1A 3TDGA 1VQ63 5AIHA 2OQEA 2W04A 1N5HA 1LOWA 4DKIA 1K734 2KCDA 6STDA 1OACA 3NUVA 2XSOB 3IMAB 2M7OA 1LRAA 1RRHA 3NX0A 2H0IA 5TGNA 2PZVA 2J8XB 5GSPA 4BTWA 2Y74A 4N6NB 2Z77A 3UJMA 2F99A 1W2B2 1GSPA 3LMLA 2L1SA 3G0KA 1BNRA 1RJOA 1V58A 3EB8A 1DE3A 5IG4A 1NJI4 1UGHI 2GBXB 3JUMA 1V74A 1MNLA 1VQ53 1MGWA 1BVIA 4LZIA 1ZS7A 1B21A 5HOHA 3WA2X 1CYUA 3CMA3 1Q864 1I3FA 1GMRA 3MG3A 1OGZA 2ML6A 2KRTA 2Z6BA 3D3LA 1QALA 3O8YA 4HZBB 4K90B 4EXRA 8RNTA 5IW9A 4OK0A 4N6UA 2HMJB 4AEQA 4WYKB 5JPUA 1Q814 3CCR3 3D9RA 3V99A 1BSCA 1SJWA 3DGMA 2GXFA 2BNGA 2WGOA 3FGYA 5ELUA 3X3XA 4XBTA 3T8UA 3HK4A 1NB5I 3Q1CA 1U5OA 2RFRA 3K0ZA 1UGIA 4BU4A 3HIIA 2P09A 1OHPA 3I0YA 1O7GB 3EQQB 3SVAA 1AY7A 1MWUA 1WMOA 1JKGB 3D5IA 4GB5A 5CXOA 4RNZA 1B3SA 3BIRA 3SLUA 3V92A 1KQS2 3CNMA 3IPTA 4FR9A 4IPBA 1DMMA 4KT3B 4FCZA 3G6E3 2HMKB 4U13A 1GOYA 1GY5A 3NV0B 1ROVA 1W00A 4HAAA 1JV2B 3MKIA 1TJDA 3AMOB 1EEJA 3E99A 3WODG 2QEX3 1BOXA 2P38A 3DM8A 4LSOA 4O2HA 1IT7A 4CDLA 1S5AA 2C10A 4XBXA 1QVF2 1IVXA 1IK3A 3KKGA 5BU4A 6GSPA 1IQYA 1T3BA 5LC7A 2CFLA 1F8NA 3BNDA 3D5GA 2GU3A 3DZLA 2E2TA 1PFPA 5BXQA 1HKXA 5EQLA 1IYYA 3PZWA 1AV4A 2BMOB 1YGEA 5CK6A 1RGGA 1BRIA 1FGMA 3F7SA 4L7KA 1JBRA 2JQ5A 4BIRA 1GOVA 4OUQA 1KD14 4HM1B 3JUNA 3BNCA 3NQYA 3MPHA 2OQEC 1W6CA 2F5MA 3MSOA 3CC23 4NPBA 1BRHA 3KFQC 2R4IA 1CEWI 1G0TA 2SARA 4K61A 1ULJB 3G713 3HOHA 2CC3A 1OPYA 2RSXA 1Q7HA 2WOFA 3U1WA 2W03A 3BNBA 4R9LA 3DXOA 3OV4A 5AYSC 2FGTA 3GSPA 2HOHA 2CWUA 1EG9B 3LYGA 2HMOB 2W6JH 4FMDA 1W02A 1AVKA 1UCLA 1I3IA 4ILFA 2YFJB 4J8TA 1TP6A 1GY6A 1WTHA 1YGWA 5IEOA 3SOYA 4CCVA 1ULIB 5JBSA 3CCU3 1VQM3 3CC43 4L8PA 3OXAA 3FSDA 1JBSA 1JN5B 1IT8A 2CK3H 5IEPA 1I0VA 4XB5A 3T8NA 2CW9A 1OF5B 4STDA 3FG1A 1O7HB 1RGHA 2KF4A 1M1K4 1RSNA 3DGLA 2KF5A 2PNCA 3D4AA 3SEDA 3JUOA 1FUTA 5IF6A 1VZZA 3BNEA 1DETA 2LYXA 1FGTA 5D81A 1O7NB 5CLKA 1V57A 4N6OB 1W7CA 3S67A 5AIIA 1RCLA 2STDA 3DGOA 2XFSA 3NBJA 4J9AA 2P0XA 1YVSA 2UUGC 1B2MA 4BL2A 3GZYB 1FGRA 1FA3A 1GMQA 5STDA 4MMZB 1YNVX 1GMPA 4EW5A 1GD4A 3VF1A 1BUQA 2F98A 1BSBA 2F4YA 3PCRA 1RGFA 2FXTA 4O8SA 2GSPA 4XM4A 3UL6A 1KC84 2BMQB 1R4YA 4IT7A 1UI8A 1RMSA 1DYUA 1JRQA 1NU3A 1VQ73 1BNSA 2K0MA 4FMCA 3RNTA 3EJVA 5AEUB 1IV7A 2IMJA 1LOXA 4X2OA 4O02B 3Q3FA 1BNFA 2CH9A 1IQ8A 2INXA 4HKVB 4WYKA 6RNTA 1JB5A 2WOHA 3BB9A 1Q824 1O7MB 1ASKA 1BIRA 1O7PB 2I9WA 4LYLB 1W6GA 4KZ1A 3NM2A 1M1XB 3DGNA 5BVBA 2JDIH 2HMLB 1GY7A 2XGNA 3ALAA 4H61A 5D83A 3FZWA 3I553 1UUWB 1LOYA 2AAEA 3PCSA 2B1XB 1LOVA 1BNJA 2CWTA 1JKGA 1L5GB 1YJN3 2K3DA 2ZA4A 5M18A 2CG1A 1ZX2A 2KAAA 8CHOA 3NBBA 2CX0A 5G1LA 1W2ZA 3FG4A 4HM6B 4R4KA 1D6YA 3EN1B 3QRDA 3NV0A 5AYRB 3FF2A 3WA3A 1ZO2A 1J2BA 2RNTA 1A67A 3AMOA 5JPPA 1JB4A 1E3VA 3WR2A 2Y73A 1A90A 4XDWA 1Q7Y4 3K5TA 1RKYA 2BMRB 1WMPA 3KSPA 4EBGA 2W9QA 3PGBA 3FH1A 3AHSA 2QA43
chains in the Genus database with same CATH topology
5AIGA 2WGQA 2SBLA 3KE7A 1DVCA 2E2UA 4LGQA 1TUHA 3LZAA 3WOEB 4RBNA 3A76A 2YX9A 3GWRA 1Q40A 3F8XA 2MF7A 2GEXA 2RCDA 4R9KA 3ECFA 1FUWA 1FGOA 3JVCA 1VQL3 4GL6A 2CWVA 3STDA 5IERA 3WOFB 2W2CA 2W0QA 1Y4KA 1ROAA 3CPOA 3Q90A 2F86B 3PXMA 3VSYA 1N9EA 2KXGA 3LOYA 3N54B 4FCMA 2BO9B 1IVVA 1U8CB 3K9MC 5G2GA 1VQP3 4NHFA 3HX8A 1RRLA 1N5PA 2IA7A 4BTXA 1DMQA 1FGQA 5KP4A 3DY5A 2OTL3 3GZRA 1JNQA 1DVDA 3X3YA 1K8A4 4HM5B 3X40A 1EQKA 1C7HA 2OWPA 1M9GA 2V1LA 3EF8A 4HM3B 4I4KA 3GZBA 2P0MA 5IG5A 1STFI 1OF5A 4TX4A 1S723 1YIJ3 3S28A 1K28A 3NM7A 1CQSA 3F7XA 3NQZA 3WMDA 3M8CA 1UUVB 3EC9A 1M904 3MHEA 2D42A 3UNLA 4EC6A 3UB1A 1VQ93 3PYJA 2CFWA 3CU3A 5KP3A 3T0UA 3EX9A 1TFOA 4FCJA 5ELJA 3S5CA 1OUNA 4KFEA 4JF8A 1A2KA 3KN4A 3OX9A 5AIFA 5IENA 2ZL8A 1W4NA 2A15A 5IG3A 1WNHA 3EBTA 3J7Yd 3F14A 4N6TA 1QVG2 3U97A 3X3ZA 1SPUA 3OWSA 1R4CA 3FLJA 3GZXB 3HZPA 3EBYA 3ROBA 4HM7B 3OWYA 5IG0A 4FMBA 3CCE3 3N9HA 1T5YA 1AVLA 3LXUX 2HMMB 1VQ43 1OHOA 4MMYB 1W5ZA 2W9PA 2CFDA 3B8LA 1QAFA 2CFGA 1DMNA 2ZDJA 4KFFA 7STDA 2GU1A 4G1MB 1YI23 3IJEB 1NWWA 4WHAA 1AR0A 3FG3A 4WP5A 3CD63 4LEHA 1K41A 1HU9A 2P05A 5EVHA 3LT9A 1D6UA 1TFKA 4HVNA 2HMNB 1O7WB 2O9UX 2Z7AA 5FGOA 2WO0A 2QIYA 5LC6A 3S27A 3LTAA 3RGAA 1IQXA 4MEIA 1JJ22 1NDOB 1OGXA 1Q42A 3RDEA 4ZM8A 1A2VA 2CKFB 3RGRA 3S29A 2OOVC 1N8QA 4EV2A 3CCQ3 2W56B 3ER7A 1IU7A 3FCSB 3QK9A 4XBYA 3CCV3 3HI7A 4PEJA 1YJW3 4O3VA 3CNXA 1K9M4 1NB3I 1VQK3 2RGQA 2IUKA 1VQO3 4FMAA 1YIT3 4WFOA 4JRFA 1E97A 5EEOA 1GD3A 4K1VA 4LMIA 3K63A 3KIIA 1TIJA 2GEYA 1IVWA 3CME3 3X42A 1LNHA 1W6YA 3UL5A 3MYTA 1N9JA 1NO3A 3OWUA 1QAKA 1LVNA 2BHMA 2YFLB 3PS8A 3SX1A 3VGNA 3CXC2 3EHCA 3NBRA 3H51A 1YVBI 5KP1A 4N6MA 1VQN3 3EE1A 5AI1A 4N6V0 5I97A 3G16A 4X2HA 1OHSA 1RN7A 1GS3A 5CF2A 1PU4A 4H3UA 3CC73 3N8BA 1EA2A 3SOAA 4ORLA 1IV9A 2GBWB 3B7CA 1UI7A 4WWUC 3CPW2 2QGUA 4KVHA 4L8OA 3L0RA 3LH4A 3GAXA 1G96A 4HM8B 3HIGA 3G4S3 1QMAA 4OVMA 3KZTA 5A0OB 1LXEA 1D6ZA 2FNQA 1JN5A 5D82A 4AKYA 1KSIA 2CFKA 2O3OA 5HGRA 4HBRA 2OOVA 2BT3A 2OTJ3 4NREA 4EYCA 1VQ83 2XFTA 1SQWA 2CHCA 1N8R4 3F40A 1QJGA 1SIIA 1YHQ3 1MOLA 2OCTA 3K7CA 3LT8A 1Q40B 2XF3A 4IIAA 2E2VA 2UX0A 2XGLA 1STDA 1JB2A 2CIUA 4N3VA 2IUJA 2Q07A 3JUPA 4K1UA 3CCL3 4HM2B 4Q53A 3LTBA 2B24B 2XH9A 3NXJA 1KWIA 1WQLB 3JUQA 4HYZA 4KFDA 3F8HA 5DRVA 3WDGB 3BLZA 4HJLB 3GRDA 4MJDA 3B4OA 3CCJ3 2D1WA 2LQVA 2Z76A 2XR8B 4RZMA 4EV5A 3MG1A 3MWZA 1OCVA 2C11A 3DUKA 1EKMA 3LTCA 3NHXA 3SXXA 3EN8A 2XEPA 1IVUA 3Q2PA 5CF1A 4HM4B 3FKAA 2L4VA 4QWTA 2ML5A 3F9SA 1ISKA 3KSED 3LTDA 3CCM3 1SIHA 1YJ93 3X41A 1TU5A 3OW22 1IDPA 4R1KA 1OH0A 5DREA 4MMXB 2MC8A 3DMCA 5AEWB 3H3HA 3V98A 2W56A 1WMNA 4XDVA 2K54A 2XRXB 3B4PA 4AKZA 2XSHB 3I563 4N6LA 1GYBA 4HZ9B 2CG0A 4R80A 1E3RA 1W01A 4RNYA 3CCS3 3G8ZA 3MG2A 4BTYA 2YFIB 5FW5A 4HM0B 1Z1SA 3FF0A 1US1A 1CYVA 1UW1A 3TDGA 1VQ63 5AIHA 2OQEA 2W04A 1N5HA 1K734 2KCDA 6STDA 1OACA 3NUVA 2XSOB 3IMAB 2M7OA 1RRHA 3NX0A 5TGNA 2PZVA 4BTWA 2Y74A 4N6NB 2Z77A 3UJMA 2F99A 1W2B2 3LMLA 3G0KA 1RJOA 3EB8A 5IG4A 1NJI4 2GBXB 3JUMA 1V74A 1MNLA 1VQ53 4LZIA 1CYUA 3WA2X 3CMA3 1Q864 3MG3A 1OGZA 2ML6A 2KRTA 2Z6BA 3D3LA 1QALA 3O8YA 4HZBB 4K90B 4EXRA 5IW9A 5JPUA 4OK0A 4N6UA 2HMJB 4AEQA 4WYKB 1Q814 3CCR3 3D9RA 3V99A 1SJWA 3DGMA 2GXFA 2BNGA 2WGOA 3FGYA 5ELUA 3X3XA 4XBTA 3T8UA 3HK4A 1NB5I 3Q1CA 1U5OA 2RFRA 3K0ZA 3HIIA 2P09A 1OHPA 3I0YA 1O7GB 3EQQB 3SVAA 5CXOA 4GB5A 1WMOA 1JKGB 4RNZA 3SLUA 3V92A 1KQS2 3CNMA 3IPTA 4FR9A 4IPBA 1DMMA 4FCZA 3G6E3 2HMKB 4U13A 1GY5A 3NV0B 1ROVA 1W00A 1JV2B 3MKIA 3AMOB 3E99A 3WODG 2QEX3 2P38A 3DM8A 4LSOA 4O2HA 1IT7A 4CDLA 1S5AA 2C10A 4XBXA 1QVF2 1IVXA 1IK3A 3KKGA 1IQYA 5LC7A 2CFLA 1F8NA 3BNDA 3DZLA 2GU3A 2E2TA 1PFPA 5BXQA 1HKXA 5EQLA 3PZWA 1AV4A 2BMOB 1YGEA 5CK6A 3F7SA 1FGMA 4L7KA 2JQ5A 4OUQA 1KD14 4HM1B 3JUNA 3BNCA 3NQYA 3MPHA 2OQEC 1W6CA 3MSOA 3CC23 3KFQC 2R4IA 1CEWI 4K61A 1ULJB 3G713 2CC3A 1OPYA 2RSXA 2WOFA 3U1WA 2W03A 3BNBA 4R9LA 3DXOA 3OV4A 5AYSC 2FGTA 2CWUA 1EG9B 3LYGA 2HMOB 2W6JH 4FMDA 1W02A 1AVKA 2YFJB 4J8TA 1TP6A 1GY6A 1WTHA 5IEOA 3SOYA 3CCU3 4CCVA 1ULIB 5JBSA 1VQM3 3CC43 4L8PA 3OXAA 3FSDA 1JN5B 1IT8A 2CK3H 5IEPA 4XB5A 3T8NA 2CW9A 1OF5B 4STDA 3FG1A 1O7HB 1M1K4 3DGLA 2PNCA 3SEDA 3JUOA 5IF6A 1VZZA 3BNEA 2LYXA 1FGTA 5D81A 1O7NB 5CLKA 4N6OB 3S67A 1W7CA 5AIIA 2STDA 3DGOA 2XFSA 3NBJA 4J9AA 2P0XA 1FA3A 3GZYB 1FGRA 5STDA 4MMZB 1GD4A 3VF1A 1BUQA 2F98A 4O8SA 3PCRA 2FXTA 4XM4A 3UL6A 1KC84 2BMQB 4IT7A 1UI8A 1DYUA 1JRQA 1NU3A 1VQ73 2K0MA 4FMCA 3EJVA 5AEUB 1IV7A 2IMJA 1LOXA 4X2OA 4O02B 2CH9A 1IQ8A 2INXA 4HKVB 4WYKA 1Q824 1JB5A 2WOHA 3BB9A 1O7MB 1ASKA 1O7PB 2I9WA 1W6GA 4KZ1A 3NM2A 1M1XB 3DGNA 5BVBA 2JDIH 2HMLB 1GY7A 2XGNA 3ALAA 4H61A 5D83A 3FZWA 3I553 1UUWB 3PCSA 2B1XB 1L5GB 2CWTA 1JKGA 1YJN3 2CG1A 1ZX2A 8CHOA 3NBBA 1W2ZA 3FG4A 4HM6B 4R4KA 1D6YA 3EN1B 3QRDA 3NV0A 5AYRB 3FF2A 3WA3A 1ZO2A 1J2BA 1A67A 3AMOA 5JPPA 1JB4A 1E3VA 2Y73A 1A90A 4XDWA 1Q7Y4 3K5TA 1RKYA 2BMRB 1WMPA 3KSPA 4EBGA 2W9QA 3PGBA 3FH1A 2QA43
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU 3;  3CC7 3;  1VQ5 3;  3CCS 3;  1KQS 2;  1VQ9 3;  1VQM 3;  3CC4 3;  1KC8 4;  3CPW 2;  1YJN 3;  1JJ2 2;  1K8A 4;  1VQ4 3;  3CME 3;  2OTL 3;  3G6E 3;  1KD1 4;  3CMA 3;  3CCL 3;  1Q86 4;  1VQ7 3;  3G4S 3;  3CC2 3;  1M1K 4;  3CCM 3;  3CXC 2;  1Q81 4;  2QEX 3;  1YJ9 3;  3CCR 3;  1VQL 3;  1VQ6 3;  3G71 3;  3OW2 2;  3CCQ 3;  1YI2 3;  1S72 3;  1YIJ 3;  3CCV 3;  1K73 4;  1YJW 3;  1Q82 4;  1QVF 2;  2OTJ 3;  1K9M 4;  3CCJ 3;  1VQK 3;  1Q7Y 4;  1QVG 2;  1VQN 3;  1VQO 3;  1VQ8 3;  1NJI 4;  1YIT 3;  1VQP 3;  3CD6 3;  1N8R 4;  1W2B 2;  1YHQ 3;  3I56 3;  1M90 4;  3I55 3;  3CCE 3;  2QA4 3; 
#chains in the Genus database with same CATH topology
 5AIG A;  2WGQ A;  2SBL A;  3KE7 A;  1DVC A;  2E2U A;  4LGQ A;  1TUH A;  3LZA A;  3WOE B;  4RBN A;  3A76 A;  2YX9 A;  3GWR A;  1Q40 A;  1G02 A;  3F8X A;  2MF7 A;  2GEX A;  2RCD A;  4R9K A;  3ECF A;  1FUW A;  1FGO A;  3JVC A;  1X1W A;  4GL6 A;  2CWV A;  1VQL 3;  3STD A;  5IER A;  3WOF B;  2W2C A;  2W0Q A;  1Y4K A;  1C54 A;  1ROA A;  3CPO A;  3Q90 A;  2F86 B;  3PXM A;  5G1K A;  1N9E A;  2KXG A;  1HYF A;  3LOY A;  3N54 B;  3VSY A;  4FCM A;  2BO9 B;  1IVV A;  1TRP A;  1U8C B;  3K9M C;  5G2G A;  1BNG A;  4NHF A;  1VQP 3;  3AGN A;  1B2U A;  3HX8 A;  1TRQ A;  1RRL A;  1LQM B;  1N5P A;  2IA7 A;  4BTX A;  1BAN A;  1DMQ A;  1FGQ A;  5KP4 A;  3DY5 A;  3DH2 A;  3GZR A;  1JNQ A;  2OTL 3;  3X3Y A;  1K8A 4;  1DVD A;  1HZ1 A;  4HM5 B;  3X40 A;  1EQK A;  1C7H A;  2OWP A;  1M9G A;  2V1L A;  3EF8 A;  4HM3 B;  4I4K A;  3GZB A;  2P0M A;  5IG5 A;  1STF I;  1ZGX A;  1AQZ A;  1UUG B;  3AHW A;  1BRS A;  1OF5 A;  4TX4 A;  1S72 3;  1YIJ 3;  1BAO A;  3S28 A;  1UCK A;  1JZO A;  1K28 A;  3NM7 A;  1CQS A;  3F7X A;  9RNT A;  3NQZ A;  3WMD A;  3M8C A;  1T2I A;  1UUV B;  3EC9 A;  1M90 4;  3MHE A;  2D42 A;  3D79 A;  3UNL A;  4EC6 A;  3UB1 A;  1VQ9 3;  3PYJ A;  2CFW A;  1BSA A;  4CJN A;  3CU3 A;  5KP3 A;  3T0U A;  3EX9 A;  1TFO A;  4FCJ A;  5ELJ A;  2H0H A;  1OUN A;  3S5C A;  4KFE A;  1MWR A;  4JF8 A;  1A2K A;  3KN4 A;  3OX9 A;  5AIF A;  1B27 A;  5IEN A;  2ZL8 A;  1W4N A;  2F56 A;  1Q9E A;  2A15 A;  5IG3 A;  1WNH A;  3EBT A;  1I8V A;  1JBT A;  3J7Y d;  3F14 A;  1BGS A;  1PY3 A;  4N6T A;  1RGC A;  1QVG 2;  3U97 A;  3X3Z A;  1SPU A;  3OWS A;  1R4C A;  2RBI A;  3FLJ A;  3GZX B;  3HZP A;  3EBY A;  3ROB A;  4HM7 B;  3OWY A;  5IG0 A;  4FMB A;  3CCE 3;  3N9H A;  1T5Y A;  1AVL A;  3LXU X;  2HMM B;  1RNB A;  3ZG0 A;  1VQ4 3;  1OHO A;  4MMY B;  4CPK A;  1W5Z A;  2W9P A;  2CFD A;  3B8L A;  1QAF A;  1RLS A;  2CFG A;  1BUJ A;  3A5E A;  1DMN A;  2ZDJ A;  4KFF A;  7STD A;  1RGE A;  1X1X A;  2GU1 A;  4G1M B;  1B2S A;  3IJE B;  1NWW A;  1YI2 3;  4WHA A;  1AR0 A;  1RGL A;  3FG3 A;  2ZHX B;  4WP5 A;  3CD6 3;  4LEH A;  1K41 A;  1HU9 A;  2P05 A;  1X1U A;  5EVH A;  3LT9 A;  1D6U A;  1TFK A;  4HVN A;  1RTU A;  1O7W B;  2HMN B;  2O9U X;  2Z7A A;  3ZG5 A;  5FGO A;  2WO0 A;  2QIY A;  1X1Y A;  5LC6 A;  3S27 A;  3LTA A;  3RGA A;  1IQX A;  4MEI A;  1JJ2 2;  1NDO B;  1GOU A;  1OGX A;  1Q42 A;  3RDE A;  4ZM8 A;  1JZD A;  1I2E A;  1I0X A;  1SAR A;  1I2G A;  1A2V A;  2CKF B;  3RGR A;  3S29 A;  1EUI C;  2OOV C;  1N8Q A;  4EV2 A;  1RN1 A;  2W56 B;  3CCQ 3;  1TTO A;  1IU7 A;  3ER7 A;  3FCS B;  3QK9 A;  4GSP A;  4XBY A;  3HI7 A;  4PEJ A;  3CCV 3;  1YJW 3;  4O3V A;  3CNX A;  1K9M 4;  1NB3 I;  1VQK 3;  2RGQ A;  2IUK A;  1VQO 3;  4FMA A;  1YIT 3;  1FZU A;  4WFO A;  1RGK A;  4JRF A;  1E97 A;  1BRG A;  4BL3 A;  5EEO A;  1GD3 A;  4K1V A;  4LMI A;  1BRK A;  3K63 A;  1FYS A;  1RCK A;  5M1A A;  2KF6 A;  3KCH A;  3KII A;  1BRN L;  2KF3 A;  1TIJ A;  2GEY A;  1IVW A;  3CME 3;  3X42 A;  1LNH A;  1W6Y A;  3UL5 A;  3MYT A;  1N9J A;  1NO3 A;  3OWU A;  1QAK A;  1LVN A;  2BHM A;  2YFL B;  3PS8 A;  3SX1 A;  3VGN A;  3CXC 2;  3EHC A;  3NBR A;  3H51 A;  1YVB I;  5KP1 A;  1RGA A;  4N6M A;  1VQN 3;  3EE1 A;  1B2Z A;  1BNI A;  4N6V 0;  5AI1 A;  5I97 A;  1FUS A;  3G16 A;  4X2H A;  5BIR A;  1OHS A;  1RN7 A;  1GS3 A;  3DGY A;  5CF2 A;  3BU4 A;  2H0G A;  4I5Q A;  1PU4 A;  4H3U A;  3CC7 3;  3N8B A;  1EA2 A;  3SOA A;  4ORL A;  1IV9 A;  2GBW B;  3B7C A;  1UI7 A;  1UCI A;  4WWU C;  3CPW 2;  2QGU A;  4KVH A;  4L8O A;  3L0R A;  3LH4 A;  3GAX A;  1G96 A;  4HM8 B;  3HIG A;  3G4S 3;  1QMA A;  4OVM A;  3KZT A;  3ZFZ A;  1LXE A;  1D6Z A;  5A0O B;  2FNQ A;  1UDI I;  1JN5 A;  5D82 A;  4AKY A;  1KSI A;  2CFK A;  2O3O A;  1BSE A;  5HGR A;  4HBR A;  1MWT A;  2BT3 A;  2OOV A;  2OTJ 3;  1LQG C;  2BIR A;  4NRE A;  4EYC A;  1VQ8 3;  2XFT A;  1RNT A;  1SQW A;  2IY2 A;  2CHC A;  4RNT A;  1N8R 4;  1BU4 A;  3F40 A;  1QJG A;  1SII A;  1UCJ A;  4GHO A;  1MOL A;  2OCT A;  3K7C A;  3LT8 A;  7RNT A;  1YHQ 3;  1Q40 B;  2XF3 A;  4IIA A;  2C4B A;  2E2V A;  2UX0 A;  2XGL A;  1STD A;  1JB2 A;  1RHL A;  2CIU A;  4N3V A;  2IUJ A;  1RDS A;  2CX1 A;  2Q07 A;  3JUP A;  4K1U A;  3CCL 3;  4HM2 B;  4Q53 A;  3LTB A;  2B24 B;  2XH9 A;  3NXJ A;  3URP A;  4J5G A;  1KWI A;  1WQL B;  3JUQ A;  7GSP A;  4HYZ A;  4KFD A;  3F8H A;  5DRV A;  3WDG B;  3BLZ A;  4HJL B;  3GRD A;  1A2P A;  1NNV A;  4MJD A;  3B4O A;  3CCJ 3;  2D1W A;  2LQV A;  2Z76 A;  2XR8 B;  4RZM A;  1BSD A;  4EV5 A;  2AAD A;  1B20 A;  3MG1 A;  3MWZ A;  1OCV A;  2C11 A;  3DUK A;  1EKM A;  3LTC A;  3NHX A;  3SXX A;  3EN8 A;  1VQQ A;  2XEP A;  1I70 A;  1IVU A;  2IYJ A;  3Q2P A;  5CF1 A;  4HM4 B;  3FKA A;  1FW7 A;  1PYL A;  2L4V A;  5RNT A;  4QWT A;  2ML5 A;  3F9S A;  4HOH A;  1ISK A;  3KSE D;  2R41 A;  3LTD A;  3CCM 3;  1SIH A;  1YJ9 3;  1MWS A;  1I2F A;  3X41 A;  1TU5 A;  3OW2 2;  1IDP A;  1T2H A;  1OH0 A;  4R1K A;  2UGI A;  5DRE A;  4MMX B;  2MC8 A;  3DMC A;  5AEW B;  3H3H A;  3V98 A;  1MGR A;  1LNI A;  2W56 A;  1WMN A;  4XDV A;  2K54 A;  2F5W A;  2XRX B;  1B2X A;  5M19 A;  1RN4 A;  3B4P A;  4AKZ A;  2XSH B;  3SYU A;  3I56 3;  4N6L A;  1GYB A;  3WHO A;  4HZ9 B;  2CG0 A;  4R80 A;  1E3R A;  1W01 A;  4RNY A;  1BNE A;  3CCS 3;  3G8Z A;  1CH0 A;  1BRJ A;  3MG2 A;  2BU4 A;  4BTY A;  2YFI B;  5FW5 A;  4HM0 B;  1Z1S A;  3FF0 A;  4J5K A;  3AGO A;  1US1 A;  1CYV A;  1UW1 A;  3TDG A;  1VQ6 3;  5AIH A;  2OQE A;  2W04 A;  1N5H A;  1LOW A;  4DKI A;  1K73 4;  2KCD A;  6STD A;  1OAC A;  3NUV A;  2XSO B;  3IMA B;  2M7O A;  1LRA A;  1RRH A;  3NX0 A;  2H0I A;  5TGN A;  2PZV A;  2J8X B;  5GSP A;  4BTW A;  2Y74 A;  4N6N B;  2Z77 A;  3UJM A;  2F99 A;  1W2B 2;  1GSP A;  3LML A;  2L1S A;  3G0K A;  1BNR A;  1RJO A;  1V58 A;  3EB8 A;  1DE3 A;  5IG4 A;  1NJI 4;  1UGH I;  2GBX B;  3JUM A;  1V74 A;  1MNL A;  1VQ5 3;  1MGW A;  1BVI A;  4LZI A;  1ZS7 A;  1B21 A;  5HOH A;  3WA2 X;  1CYU A;  3CMA 3;  1Q86 4;  1I3F A;  1GMR A;  3MG3 A;  1OGZ A;  2ML6 A;  2KRT A;  2Z6B A;  3D3L A;  1QAL A;  3O8Y A;  4HZB B;  4K90 B;  4EXR A;  8RNT A;  5IW9 A;  4OK0 A;  4N6U A;  2HMJ B;  4AEQ A;  4WYK B;  5JPU A;  1Q81 4;  3CCR 3;  3D9R A;  3V99 A;  1BSC A;  1SJW A;  3DGM A;  2GXF A;  2BNG A;  2WGO A;  3FGY A;  5ELU A;  3X3X A;  4XBT A;  3T8U A;  3HK4 A;  1NB5 I;  3Q1C A;  1U5O A;  2RFR A;  3K0Z A;  1UGI A;  4BU4 A;  3HII A;  2P09 A;  1OHP A;  3I0Y A;  1O7G B;  3EQQ B;  3SVA A;  1AY7 A;  1MWU A;  1WMO A;  1JKG B;  3D5I A;  4GB5 A;  5CXO A;  4RNZ A;  1B3S A;  3BIR A;  3SLU A;  3V92 A;  1KQS 2;  3CNM A;  3IPT A;  4FR9 A;  4IPB A;  1DMM A;  4KT3 B;  4FCZ A;  3G6E 3;  2HMK B;  4U13 A;  1GOY A;  1GY5 A;  3NV0 B;  1ROV A;  1W00 A;  4HAA A;  1JV2 B;  3MKI A;  1TJD A;  3AMO B;  1EEJ A;  3E99 A;  3WOD G;  2QEX 3;  1BOX A;  2P38 A;  3DM8 A;  4LSO A;  4O2H A;  1IT7 A;  4CDL A;  1S5A A;  2C10 A;  4XBX A;  1QVF 2;  1IVX A;  1IK3 A;  3KKG A;  5BU4 A;  6GSP A;  1IQY A;  1T3B A;  5LC7 A;  2CFL A;  1F8N A;  3BND A;  3D5G A;  2GU3 A;  3DZL A;  2E2T A;  1PFP A;  5BXQ A;  1HKX A;  5EQL A;  1IYY A;  3PZW A;  1AV4 A;  2BMO B;  1YGE A;  5CK6 A;  1RGG A;  1BRI A;  1FGM A;  3F7S A;  4L7K A;  1JBR A;  2JQ5 A;  4BIR A;  1GOV A;  4OUQ A;  1KD1 4;  4HM1 B;  3JUN A;  3BNC A;  3NQY A;  3MPH A;  2OQE C;  1W6C A;  2F5M A;  3MSO A;  3CC2 3;  4NPB A;  1BRH A;  3KFQ C;  2R4I A;  1CEW I;  1G0T A;  2SAR A;  4K61 A;  1ULJ B;  3G71 3;  3HOH A;  2CC3 A;  1OPY A;  2RSX A;  1Q7H A;  2WOF A;  3U1W A;  2W03 A;  3BNB A;  4R9L A;  3DXO A;  3OV4 A;  5AYS C;  2FGT A;  3GSP A;  2HOH A;  2CWU A;  1EG9 B;  3LYG A;  2HMO B;  2W6J H;  4FMD A;  1W02 A;  1AVK A;  1UCL A;  1I3I A;  4ILF A;  2YFJ B;  4J8T A;  1TP6 A;  1GY6 A;  1WTH A;  1YGW A;  5IEO A;  3SOY A;  4CCV A;  1ULI B;  5JBS A;  3CCU 3;  1VQM 3;  3CC4 3;  4L8P A;  3OXA A;  3FSD A;  1JBS A;  1JN5 B;  1IT8 A;  2CK3 H;  5IEP A;  1I0V A;  4XB5 A;  3T8N A;  2CW9 A;  1OF5 B;  4STD A;  3FG1 A;  1O7H B;  1RGH A;  2KF4 A;  1M1K 4;  1RSN A;  3DGL A;  2KF5 A;  2PNC A;  3D4A A;  3SED A;  3JUO A;  1FUT A;  5IF6 A;  1VZZ A;  3BNE A;  1DET A;  2LYX A;  1FGT A;  5D81 A;  1O7N B;  5CLK A;  1V57 A;  4N6O B;  1W7C A;  3S67 A;  5AII A;  1RCL A;  2STD A;  3DGO A;  2XFS A;  3NBJ A;  4J9A A;  2P0X A;  1YVS A;  2UUG C;  1B2M A;  4BL2 A;  3GZY B;  1FGR A;  1FA3 A;  1GMQ A;  5STD A;  4MMZ B;  1YNV X;  1GMP A;  4EW5 A;  1GD4 A;  3VF1 A;  1BUQ A;  2F98 A;  1BSB A;  2F4Y A;  3PCR A;  1RGF A;  2FXT A;  4O8S A;  2GSP A;  4XM4 A;  3UL6 A;  1KC8 4;  2BMQ B;  1R4Y A;  4IT7 A;  1UI8 A;  1RMS A;  1DYU A;  1JRQ A;  1NU3 A;  1VQ7 3;  1BNS A;  2K0M A;  4FMC A;  3RNT A;  3EJV A;  5AEU B;  1IV7 A;  2IMJ A;  1LOX A;  4X2O A;  4O02 B;  3Q3F A;  1BNF A;  2CH9 A;  1IQ8 A;  2INX A;  4HKV B;  4WYK A;  6RNT A;  1JB5 A;  2WOH A;  3BB9 A;  1Q82 4;  1O7M B;  1ASK A;  1BIR A;  1O7P B;  2I9W A;  4LYL B;  1W6G A;  4KZ1 A;  3NM2 A;  1M1X B;  3DGN A;  5BVB A;  2JDI H;  2HML B;  1GY7 A;  2XGN A;  3ALA A;  4H61 A;  5D83 A;  3FZW A;  3I55 3;  1UUW B;  1LOY A;  2AAE A;  3PCS A;  2B1X B;  1LOV A;  1BNJ A;  2CWT A;  1JKG A;  1L5G B;  1YJN 3;  2K3D A;  2ZA4 A;  5M18 A;  2CG1 A;  1ZX2 A;  2KAA A;  8CHO A;  3NBB A;  2CX0 A;  5G1L A;  1W2Z A;  3FG4 A;  4HM6 B;  4R4K A;  1D6Y A;  3EN1 B;  3QRD A;  3NV0 A;  5AYR B;  3FF2 A;  3WA3 A;  1ZO2 A;  1J2B A;  2RNT A;  1A67 A;  3AMO A;  5JPP A;  1JB4 A;  1E3V A;  3WR2 A;  2Y73 A;  1A90 A;  4XDW A;  1Q7Y 4;  3K5T A;  1RKY A;  2BMR B;  1WMP A;  3KSP A;  4EBG A;  2W9Q A;  3PGB A;  3FH1 A;  3AHS A;  2QA4 3; 
#chains in the Genus database with same CATH homology
 5AIG A;  2WGQ A;  2SBL A;  3KE7 A;  1DVC A;  2E2U A;  4LGQ A;  1TUH A;  3LZA A;  3WOE B;  4RBN A;  3A76 A;  2YX9 A;  3GWR A;  1Q40 A;  3F8X A;  2MF7 A;  2GEX A;  2RCD A;  4R9K A;  3ECF A;  1FUW A;  1FGO A;  3JVC A;  1VQL 3;  4GL6 A;  2CWV A;  3STD A;  5IER A;  3WOF B;  2W2C A;  2W0Q A;  1Y4K A;  1ROA A;  3CPO A;  3Q90 A;  2F86 B;  3PXM A;  3VSY A;  1N9E A;  2KXG A;  3LOY A;  3N54 B;  4FCM A;  2BO9 B;  1IVV A;  1U8C B;  3K9M C;  5G2G A;  1VQP 3;  4NHF A;  3HX8 A;  1RRL A;  1N5P A;  2IA7 A;  4BTX A;  1DMQ A;  1FGQ A;  5KP4 A;  3DY5 A;  2OTL 3;  3GZR A;  1JNQ A;  1DVD A;  3X3Y A;  1K8A 4;  4HM5 B;  3X40 A;  1EQK A;  1C7H A;  2OWP A;  1M9G A;  2V1L A;  3EF8 A;  4HM3 B;  4I4K A;  3GZB A;  2P0M A;  5IG5 A;  1STF I;  1OF5 A;  4TX4 A;  1S72 3;  1YIJ 3;  3S28 A;  1K28 A;  3NM7 A;  1CQS A;  3F7X A;  3NQZ A;  3WMD A;  3M8C A;  1UUV B;  3EC9 A;  1M90 4;  3MHE A;  2D42 A;  3UNL A;  4EC6 A;  3UB1 A;  1VQ9 3;  3PYJ A;  2CFW A;  3CU3 A;  5KP3 A;  3T0U A;  3EX9 A;  1TFO A;  4FCJ A;  5ELJ A;  3S5C A;  1OUN A;  4KFE A;  4JF8 A;  1A2K A;  3KN4 A;  3OX9 A;  5AIF A;  5IEN A;  2ZL8 A;  1W4N A;  2A15 A;  5IG3 A;  1WNH A;  3EBT A;  3J7Y d;  3F14 A;  4N6T A;  1QVG 2;  3U97 A;  3X3Z A;  1SPU A;  3OWS A;  1R4C A;  3FLJ A;  3GZX B;  3HZP A;  3EBY A;  3ROB A;  4HM7 B;  3OWY A;  5IG0 A;  4FMB A;  3CCE 3;  3N9H A;  1T5Y A;  1AVL A;  3LXU X;  2HMM B;  1VQ4 3;  1OHO A;  4MMY B;  1W5Z A;  2W9P A;  2CFD A;  3B8L A;  1QAF A;  2CFG A;  1DMN A;  2ZDJ A;  4KFF A;  7STD A;  2GU1 A;  4G1M B;  1YI2 3;  3IJE B;  1NWW A;  4WHA A;  1AR0 A;  3FG3 A;  4WP5 A;  3CD6 3;  4LEH A;  1K41 A;  1HU9 A;  2P05 A;  5EVH A;  3LT9 A;  1D6U A;  1TFK A;  4HVN A;  2HMN B;  1O7W B;  2O9U X;  2Z7A A;  5FGO A;  2WO0 A;  2QIY A;  5LC6 A;  3S27 A;  3LTA A;  3RGA A;  1IQX A;  4MEI A;  1JJ2 2;  1NDO B;  1OGX A;  1Q42 A;  3RDE A;  4ZM8 A;  1A2V A;  2CKF B;  3RGR A;  3S29 A;  2OOV C;  1N8Q A;  4EV2 A;  3CCQ 3;  2W56 B;  3ER7 A;  1IU7 A;  3FCS B;  3QK9 A;  4XBY A;  3CCV 3;  3HI7 A;  4PEJ A;  1YJW 3;  4O3V A;  3CNX A;  1K9M 4;  1NB3 I;  1VQK 3;  2RGQ A;  2IUK A;  1VQO 3;  4FMA A;  1YIT 3;  4WFO A;  4JRF A;  1E97 A;  5EEO A;  1GD3 A;  4K1V A;  4LMI A;  3K63 A;  3KII A;  1TIJ A;  2GEY A;  1IVW A;  3CME 3;  3X42 A;  1LNH A;  1W6Y A;  3UL5 A;  3MYT A;  1N9J A;  1NO3 A;  3OWU A;  1QAK A;  1LVN A;  2BHM A;  2YFL B;  3PS8 A;  3SX1 A;  3VGN A;  3CXC 2;  3EHC A;  3NBR A;  3H51 A;  1YVB I;  5KP1 A;  4N6M A;  1VQN 3;  3EE1 A;  5AI1 A;  4N6V 0;  5I97 A;  3G16 A;  4X2H A;  1OHS A;  1RN7 A;  1GS3 A;  5CF2 A;  1PU4 A;  4H3U A;  3CC7 3;  3N8B A;  1EA2 A;  3SOA A;  4ORL A;  1IV9 A;  2GBW B;  3B7C A;  1UI7 A;  4WWU C;  3CPW 2;  2QGU A;  4KVH A;  4L8O A;  3L0R A;  3LH4 A;  3GAX A;  1G96 A;  4HM8 B;  3HIG A;  3G4S 3;  1QMA A;  4OVM A;  3KZT A;  5A0O B;  1LXE A;  1D6Z A;  2FNQ A;  1JN5 A;  5D82 A;  4AKY A;  1KSI A;  2CFK A;  2O3O A;  5HGR A;  4HBR A;  2OOV A;  2BT3 A;  2OTJ 3;  4NRE A;  4EYC A;  1VQ8 3;  2XFT A;  1SQW A;  2CHC A;  1N8R 4;  3F40 A;  1QJG A;  1SII A;  1YHQ 3;  1MOL A;  2OCT A;  3K7C A;  3LT8 A;  1Q40 B;  2XF3 A;  4IIA A;  2E2V A;  2UX0 A;  2XGL A;  1STD A;  1JB2 A;  2CIU A;  4N3V A;  2IUJ A;  2Q07 A;  3JUP A;  4K1U A;  3CCL 3;  4HM2 B;  4Q53 A;  3LTB A;  2B24 B;  2XH9 A;  3NXJ A;  1KWI A;  1WQL B;  3JUQ A;  4HYZ A;  4KFD A;  3F8H A;  5DRV A;  3WDG B;  3BLZ A;  4HJL B;  3GRD A;  4MJD A;  3B4O A;  3CCJ 3;  2D1W A;  2LQV A;  2Z76 A;  2XR8 B;  4RZM A;  4EV5 A;  3MG1 A;  3MWZ A;  1OCV A;  2C11 A;  3DUK A;  1EKM A;  3LTC A;  3NHX A;  3SXX A;  3EN8 A;  2XEP A;  1IVU A;  3Q2P A;  5CF1 A;  4HM4 B;  3FKA A;  2L4V A;  4QWT A;  2ML5 A;  3F9S A;  1ISK A;  3KSE D;  3LTD A;  3CCM 3;  1SIH A;  1YJ9 3;  3X41 A;  1TU5 A;  3OW2 2;  1IDP A;  4R1K A;  1OH0 A;  5DRE A;  4MMX B;  2MC8 A;  3DMC A;  5AEW B;  3H3H A;  3V98 A;  2W56 A;  1WMN A;  4XDV A;  2K54 A;  2XRX B;  3B4P A;  4AKZ A;  2XSH B;  3I56 3;  4N6L A;  1GYB A;  4HZ9 B;  2CG0 A;  4R80 A;  1E3R A;  1W01 A;  4RNY A;  3CCS 3;  3G8Z A;  3MG2 A;  4BTY A;  2YFI B;  5FW5 A;  4HM0 B;  1Z1S A;  3FF0 A;  1US1 A;  1CYV A;  1UW1 A;  3TDG A;  1VQ6 3;  5AIH A;  2OQE A;  2W04 A;  1N5H A;  1K73 4;  2KCD A;  6STD A;  1OAC A;  3NUV A;  2XSO B;  3IMA B;  2M7O A;  1RRH A;  3NX0 A;  5TGN A;  2PZV A;  4BTW A;  2Y74 A;  4N6N B;  2Z77 A;  3UJM A;  2F99 A;  1W2B 2;  3LML A;  3G0K A;  1RJO A;  3EB8 A;  5IG4 A;  1NJI 4;  2GBX B;  3JUM A;  1V74 A;  1MNL A;  1VQ5 3;  4LZI A;  1CYU A;  3WA2 X;  3CMA 3;  1Q86 4;  3MG3 A;  1OGZ A;  2ML6 A;  2KRT A;  2Z6B A;  3D3L A;  1QAL A;  3O8Y A;  4HZB B;  4K90 B;  4EXR A;  5IW9 A;  5JPU A;  4OK0 A;  4N6U A;  2HMJ B;  4AEQ A;  4WYK B;  1Q81 4;  3CCR 3;  3D9R A;  3V99 A;  1SJW A;  3DGM A;  2GXF A;  2BNG A;  2WGO A;  3FGY A;  5ELU A;  3X3X A;  4XBT A;  3T8U A;  3HK4 A;  1NB5 I;  3Q1C A;  1U5O A;  2RFR A;  3K0Z A;  3HII A;  2P09 A;  1OHP A;  3I0Y A;  1O7G B;  3EQQ B;  3SVA A;  5CXO A;  4GB5 A;  1WMO A;  1JKG B;  4RNZ A;  3SLU A;  3V92 A;  1KQS 2;  3CNM A;  3IPT A;  4FR9 A;  4IPB A;  1DMM A;  4FCZ A;  3G6E 3;  2HMK B;  4U13 A;  1GY5 A;  3NV0 B;  1ROV A;  1W00 A;  1JV2 B;  3MKI A;  3AMO B;  3E99 A;  3WOD G;  2QEX 3;  2P38 A;  3DM8 A;  4LSO A;  4O2H A;  1IT7 A;  4CDL A;  1S5A A;  2C10 A;  4XBX A;  1QVF 2;  1IVX A;  1IK3 A;  3KKG A;  1IQY A;  5LC7 A;  2CFL A;  1F8N A;  3BND A;  3DZL A;  2GU3 A;  2E2T A;  1PFP A;  5BXQ A;  1HKX A;  5EQL A;  3PZW A;  1AV4 A;  2BMO B;  1YGE A;  5CK6 A;  3F7S A;  1FGM A;  4L7K A;  2JQ5 A;  4OUQ A;  1KD1 4;  4HM1 B;  3JUN A;  3BNC A;  3NQY A;  3MPH A;  2OQE C;  1W6C A;  3MSO A;  3CC2 3;  3KFQ C;  2R4I A;  1CEW I;  4K61 A;  1ULJ B;  3G71 3;  2CC3 A;  1OPY A;  2RSX A;  2WOF A;  3U1W A;  2W03 A;  3BNB A;  4R9L A;  3DXO A;  3OV4 A;  5AYS C;  2FGT A;  2CWU A;  1EG9 B;  3LYG A;  2HMO B;  2W6J H;  4FMD A;  1W02 A;  1AVK A;  2YFJ B;  4J8T A;  1TP6 A;  1GY6 A;  1WTH A;  5IEO A;  3SOY A;  3CCU 3;  4CCV A;  1ULI B;  5JBS A;  1VQM 3;  3CC4 3;  4L8P A;  3OXA A;  3FSD A;  1JN5 B;  1IT8 A;  2CK3 H;  5IEP A;  4XB5 A;  3T8N A;  2CW9 A;  1OF5 B;  4STD A;  3FG1 A;  1O7H B;  1M1K 4;  3DGL A;  2PNC A;  3SED A;  3JUO A;  5IF6 A;  1VZZ A;  3BNE A;  2LYX A;  1FGT A;  5D81 A;  1O7N B;  5CLK A;  4N6O B;  3S67 A;  1W7C A;  5AII A;  2STD A;  3DGO A;  2XFS A;  3NBJ A;  4J9A A;  2P0X A;  1FA3 A;  3GZY B;  1FGR A;  5STD A;  4MMZ B;  1GD4 A;  3VF1 A;  1BUQ A;  2F98 A;  4O8S A;  3PCR A;  2FXT A;  4XM4 A;  3UL6 A;  1KC8 4;  2BMQ B;  4IT7 A;  1UI8 A;  1DYU A;  1JRQ A;  1NU3 A;  1VQ7 3;  2K0M A;  4FMC A;  3EJV A;  5AEU B;  1IV7 A;  2IMJ A;  1LOX A;  4X2O A;  4O02 B;  2CH9 A;  1IQ8 A;  2INX A;  4HKV B;  4WYK A;  1Q82 4;  1JB5 A;  2WOH A;  3BB9 A;  1O7M B;  1ASK A;  1O7P B;  2I9W A;  1W6G A;  4KZ1 A;  3NM2 A;  1M1X B;  3DGN A;  5BVB A;  2JDI H;  2HML B;  1GY7 A;  2XGN A;  3ALA A;  4H61 A;  5D83 A;  3FZW A;  3I55 3;  1UUW B;  3PCS A;  2B1X B;  1L5G B;  2CWT A;  1JKG A;  1YJN 3;  2CG1 A;  1ZX2 A;  8CHO A;  3NBB A;  1W2Z A;  3FG4 A;  4HM6 B;  4R4K A;  1D6Y A;  3EN1 B;  3QRD A;  3NV0 A;  5AYR B;  3FF2 A;  3WA3 A;  1ZO2 A;  1J2B A;  1A67 A;  3AMO A;  5JPP A;  1JB4 A;  1E3V A;  2Y73 A;  1A90 A;  4XDW A;  1Q7Y 4;  3K5T A;  1RKY A;  2BMR B;  1WMP A;  3KSP A;  4EBG A;  2W9Q A;  3PGB A;  3FH1 A;  2QA4 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...