4CCVA

Crystal structure of histidine-rich glycoprotein n2 domain reveals redox activity at an interdomain disulfide bridge: implications for the regulation of angiogenesis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
SPVLFDFIEDTEPFRKSADKALEVYKSESEAYASFRVDRVERVTRVKGGERTNYYVDFSVRNCSRSHFHRHPAFGFCRADLSFDVEASNLENPEDVIISCEVFNFEEHGNISGFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTIDINE-RICH GLYCOPROTEIN
publication title Crystal Structure of Histidine-Rich Glycoprotein N2 Domain Reveals Redox Activity at an Interdomain Disulfide Bridge: Implications for Angiogenic Regulation.
pubmed doi rcsb
molecule tags Blood clotting
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ccvA00
2W9PA 1N5PA 1NB5I 2O9UX 4N6V0 4N6MA 3UL5A 1EQKA 1FUWA 1KWIA 1GD3A 1DVDA 1YVBI 1MOLA 3KFQC 3K9MC 4N6NB 3MWZA 1CYVA 5LC7A 1G96A 1DVCA 3SVAA 1A67A 4TX4A 1IV9A 4IT7A 4CCVA 2CH9A 4LZIA 3PS8A 5EQLA 1TIJA 3PXMA 1WNHA 3S67A 5LC6A 1LXEA 3GAXA 2KXGA 1R4CA 3QRDA 1RN7A 3Q2PA 1MNLA 4EYCA 1IV7A 1NB3I 1N5HA 3L0RA 5ELUA 3IMAB 3PYJA 1CEWI 3UL6A 1M9GA 1CYUA 4N6LA 1FA3A 4N6OB 2BO9B 1A90A 5A0OB 3NX0A 4ZM8A 1GD4A 2W9QA 1ROAA 1PFPA 2OCTA 1STFI 1N9JA 3KSED 4N6TA 3LH4A 4N6UA 5ELJA
chains in the Genus database with same CATH superfamily
4WWUC 4J8TA 1N5PA 3URPA 4HM0B 4CPKA 1WMNA 4HVNA 4N6V0 5IW9A 1WMOA 3EE1A 2CG1A 3G16A 3X3YA 3DGLA 1W2B2 2P05A 4N6MA 3V92A 1VQ53 2ZA4A 1Q40A 3MG3A 1EQKA 4I4KA 4HBRA 5EVHA 1HU9A 3NBRA 4BTWA 4OVMA 4OUQA 2UX0A 5AI1A 1MWTA 1PYLA 2GSPA 3LTCA 2UGIA 1Q814 1O7GB 4L8OA 3HZPA 1ZO2A 2F4YA 6GSPA 4HZ9B 3CCL3 4HM2B 1UUVB 3SVAA 3DM8A 1JB5A 1OHSA 1OF5B 1BANA 1NWWA 1YGWA 2CKFB 3N9HA 4FCMA 3S27A 1BNEA 4MMYB 3BB9A 4TX4A 3X3ZA 5KP1A 3CMA3 1QAKA 1U5OA 1BNIA 2I9WA 1RNTA 2Z77A 3O8YA 3BNEA 3B4OA 5JPPA 4HM4B 5IG5A 3DGNA 4FMDA 4RNZA 1V74A 5G2GA 1RCLA 1ISKA 4RBNA 3MKIA 3A5EA 1SJWA 3DY5A 3MYTA 4O8SA 2MC8A 1RRLA 1IQYA 1KC84 4KFFA 2CWVA 4FMBA 3I553 4I5QA 1KSIA 2HMKB 2E2UA 1YJW3 3G6E3 1SARA 2B24B 2GEYA 3S67A 3SOYA 3FZWA 2IYJA 1N9EA 1RSNA 1JKGB 4RNYA 4AKYA 2R4IA 4LGQA 2E2TA 3BNCA 1QVG2 1I0XA 5IERA 5IG3A 1B3SA 2KRTA 2KXGA 4HAAA 1R4CA 3FSDA 3QRDA 1RN4A 1YIJ3 4R9KA 1QJGA 5G1KA 4BTYA 1LQMB 1BSAA 4LMIA 1JKGA 2JDIH 5M18A 1GYBA 1IV7A 1LOVA 3H51A 1UDII 3MG2A 5G1LA 1ULIB 1BRNL 1Q7HA 3UNLA 1NB3I 2A15A 1EKMA 1N5HA 1TUHA 3D3LA 2AADA 8CHOA 3L0RA 4HZBB 4BTXA 3HK4A 4XDVA 1O7MB 3PCSA 3IMAB 3B4PA 1JZOA 5AIHA 1LVNA 3CPW2 1I2GA 1VQM3 1WTHA 1A2KA 2OQEA 4N6LA 3VGNA 2J8XB 4FMCA 1M904 2F5WA 2W56B 2IUJA 4N6OB 1Q864 4FMAA 5AEWB 2BO9B 3A76A 2ML6A 2F56A 4WFOA 1BRHA 1X1YA 1OUNA 1YVSA 7RNTA 1HZ1A 4BL3A 2W9QA 1IQ8A 1JB4A 2HMMB 3CCR3 1BRKA 1ROAA 3I0YA 2GU1A 2OCTA 1AV4A 3WHOA 1W6YA 2KF5A 3FCSB 3Q90A 2C4BA 2W56A 3WR2A 3D9RA 4HM3B 2B1XB 1FGQA 1RGCA 1FZUA 1W6GA 2D42A 2LYXA 2OOVA 3V98A 1GMRA 2RBIA 2QIYA 4O02B 2BT3A 1BNRA 1RMSA 3CCS3 1NO3A 2YFIB 3MSOA 5ELJA 3NV0B 2FNQA 1D6YA 3GZRA 2AAEA 3KIIA 4EW5A 1NB5I 4ORLA 4GL6A 4HM7B 1SQWA 2O9UX 1B2ZA 2BMOB 3T0UA 3RNTA 3OX9A 3E99A 3UL5A 4GSPA 1JBRA 1GD3A 4GHOA 1DVDA 4EC6A 3SX1A 1GOYA 2CX1A 3NV0A 3CU3A 4AKZA 1MGRA 1RN1A 1S5AA 1JNQA 3EN1B 1X1XA 2GXFA 1FYSA 1CYVA 2XF3A 3MWZA 3HX8A 1B21A 4HM5B 1W00A 1BRJA 1B2SA 4L8PA 5BVBA 1I3IA 1I2FA 3CD63 1DMMA 1W2ZA 2IUKA 4K61A 3CCU3 1MWUA 3EC9A 2OQEC 4Q53A 2CHCA 5D81A 5M19A 2Y73A 3SLUA 3NBJA 4CCVA 3FF0A 4HOHA 2W6JH 3EHCA 3OWSA 1Y4KA 4H61A 4J9AA 2XSOB 1JB2A 1RCKA 1BNGA 1T2HA 4LZIA 3EX9A 3LMLA 2O3OA 2RGQA 4XBXA 3JUMA 1T5YA 3PZWA 1I70A 3F8XA 1FGRA 3PXMA 1DETA 1BOXA 2KF3A 1WQLB 2YX9A 3KE7A 5HGRA 2K0MA 2OOVC 1YJN3 5JBSA 4MMXB 2BHMA 2IY2A 3BU4A 5FGOA 3CCV3 5IEPA 1UI7A 1VQ63 1K8A4 1GMQA 3AGOA 1QVF2 1ROVA 3ZFZA 4XDWA 1OHOA 5LC6A 1CH0A 4R1KA 1YI23 2XEPA 4K1UA 1W02A 3FH1A 1IYYA 2W04A 3V99A 3WOEB 2CC3A 1LXEA 1BUQA 1S723 3GAXA 1STDA 1JRQA 2C11A 1UCJA 3Q2PA 3IPTA 3SYUA 1C54A 3T8UA 3CCM3 2H0GA 1B2MA 3MHEA 2IA7A 3N8BA 4HM8B 4EYCA 1OF5A 2IMJA 2KF6A 1OGZA 1IVXA 4XB5A 3PCRA 2XSHB 2Q07A 1RNBA 2XFSA 1YIT3 1A2VA 2BIRA 3HOHA 5AEUB 2XRXB 1B20A 3X42A 1E3VA 3CC73 1BSDA 1DMNA 2F86B 2YFJB 2CIUA 1W01A 1UCKA 5ELUA 3HIGA 3KZTA 3QK9A 1CEWI 7STDA 1ASKA 3NBBA 1O7WB 3ZG5A 1IU7A 1UUWB 3ZG0A 1IT8A 3JUPA 3DXOA 4U13A 2ZHXB 1N8R4 1MGWA 3VSYA 2ZDJA 1M1XB 2W03A 1K41A 2WOHA 4NPBA 5DRVA 3TDGA 5A0OB 2QEX3 2KAAA 3WMDA 3DMCA 5GSPA 5BU4A 1BRGA 3SEDA 1E3RA 1OGXA 4L7KA 1RDSA 4IPBA 1PFPA 3LTDA 3LYGA 3CC23 1HKXA 1STFI 2CK3H 3NM2A 1N9JA 2HMNB 3DH2A 1AVKA 1AQZA 1PY3A 2Y74A 4N6TA 1IVWA 1JZDA 3LT9A 3NHXA 3LH4A 3BNDA 5DREA 2CWTA 3BIRA 3K7CA 3PGBA 2W9PA 2HMJB 1JBTA 2GU3A 3LXUX 4R4KA 3ER7A 1UGIA 3NUVA 2CWUA 1FUWA 2V1LA 1AY7A 3LTAA 4XBTA 1K9M4 3DUKA 1MOLA 4KZ1A 3KFQC 4LSOA 4N6NB 3S28A 1DE3A 1IVVA 1EG9B 5KP4A 5RNTA 1B27A 1I2EA 3F40A 3U1WA 1LQGC 4CDLA 2BU4A 3LTBA 1VQN3 4HYZA 3G8ZA 3K63A 3CME3 1RGLA 5LC7A 2MF7A 3CC43 3FLJA 4STDA 1L5GB 5BXQA 1UCLA 5TGNA 4OK0A 3AMOB 1B2XA 3G4S3 1V58A 2E2VA 2OTJ3 1V57A 2GEXA 3EBYA 2W2CA 3NQYA 1IQXA 1K28A 1DYUA 1LNIA 1W6CA 1IV9A 4KFEA 2PZVA 1Q7Y4 4IT7A 2CG0A 2UUGC 2CH9A 2WO0A 3DGMA 4JRFA 4PEJA 4RNTA 1BUJA 3JUNA 4AEQA 1BSCA 3AMOA 3HI7A 2CFLA 1F8NA 1RJOA 1US1A 3FG4A 1DMQA 3PS8A 1RRHA 1B2UA 1TIJA 3F8HA 2H0IA 1JN5B 1MWSA 2INXA 4RZMA 4X2OA 4BL2A 2BMQB 3F7SA 4R80A 3I563 5D82A 3DZLA 1LRAA 3DGOA 1WNHA 3WA2X 3Q3FA 4CJNA 1J2BA 3NM7A 4K1VA 1YHQ3 2BMRB 1NJI4 1ULJB 4N3VA 1RTUA 3FG3A 1TU5A 1JN5A 1NDOB 3OWUA 4GB5A 1Q42A 3AHSA 1GSPA 3FKAA 4IIAA 5KP3A 1TFKA 2BNGA 3RGAA 2CFWA 1RGFA 3ROBA 4EBGA 5CF1A 3NXJA 5EEOA 6STDA 1EUIC 2STDA 3D4AA 4O2HA 4XBYA 3X41A 1VZZA 2SBLA 1BVIA 1O7HB 4HJLB 5D83A 5FW5A 1MNLA 1UW1A 1WMPA 5AIGA 5STDA 4LYLB 2L4VA 1FGMA 5JPUA 3EBTA 3Q1CA 3LZAA 1LOXA 1BSBA 1Q9EA 3RGRA 1KD14 3KN4A 1EEJA 1LOWA 2XH9A 3JUOA 1FW7A 3DGYA 3K5TA 1Q40B 4K90B 2R41A 2L1SA 3PYJA 5AYRB 1AR0A 2K3DA 3CXC2 1VQQA 3RDEA 3AHWA 1FGTA 1CYUA 1TJDA 3B8LA 1K734 2PNCA 1NNVA 1GOVA 4J5GA 3S5CA 1YGEA 1IT7A 1QMAA 1TRQA 5CF2A 1A90A 3BLZA 2P09A 2RCDA 2Z6BA 1JV2B 3CNXA 3FF2A 1W4NA 2RSXA 1AVLA 1FGOA 3EJVA 2F99A 2P38A 3EN8A 3CNMA 3WOFB 1O7PB 3WDGB 1LNHA 2C10A 1OH0A 2HMOB 2XFTA 3HIIA 4G1MB 1UCIA 2QGUA 3KSED 1MWRA 4HM1B 3X40A 1VQP3 1T3BA 1TTOA 2JQ5A 3MPHA 1QAFA 4XM4A 3BNBA 1G02A 5CK6A 2GBXB 2WGQA 4N6UA 3B7CA 1IVUA 2Z7AA 4MMZB 3CCJ3 1ZX2A 1FUSA 2HOHA 3KCHA 4KVHA 1I3FA 2XGLA 3LT8A 3NQZA 3F9SA 5IG4A 2CFGA 2F5MA 4O3VA 4EXRA 5IF6A 1KWIA 3JVCA 1RGAA 3J7Yd 1E97A 2CFKA 3GZXB 1BAOA 1I8VA 1TFOA 1YVBI 1SPUA 4WP5A 3GWRA 3F14A 3VF1A 3K9MC 3X3XA 1U8CB 1ZGXA 5CLKA 3STDA 5IG0A 1HYFA 3KSPA 1BU4A 1GY6A 1RGGA 2W0QA 4FR9A 1GS3A 1O7NB 2CFDA 4HKVB 1BNSA 5IEOA 5I97A 2WGOA 1G96A 4HM6B 1DVCA 1RKYA 1G0TA 1IDPA 1GMPA 1RHLA 1SIHA 2GBWB 2RNTA 4JF8A 1A67A 1Q824 4KFDA 4WYKB 3KKGA 2LQVA 2K54A 3GZYB 1W7CA 2ML5A 3SXXA 3LOYA 4FCZA 3WODG 1RLSA 1JBSA 1BIRA 1KQS2 1BSEA 3CPOA 3D79A 5EQLA 1N8QA 2KCDA 5HOHA 2SARA 1UI8A 1D6ZA 4FCJA 3G713 4WYKA 3UJMA 3H3HA 3GSPA 4NHFA 7GSPA 3OV4A 1GY5A 3EF8A 3GRDA 5AYSC 1BNJA 1RGKA 3EQQB 3N54B 1GY7A 5AIFA 1D6UA 4EV5A 1NU3A 3ALAA 1A2PA 4J5KA 1OPYA 2CW9A 3ECFA 2QA43 1VQ83 3UB1A 3CCE3 3U97A 5IENA 2H0HA 2OTL3 1ZS7A 2YFLB 2P0MA 1PU4A 2ZL8A 1YNVX 1RN7A 2CX0A 3D5GA 3D5IA 1RGEA 3G0KA 3MG1A 3CCQ3 1T2IA 2Z76A 1CQSA 4DKIA 2P0XA 3M8CA 1QALA 4MEIA 1RGHA 1OHPA 2FGTA 1Z1SA 2WOFA 1BNFA 2XGNA 3FG1A 1X1UA 3K0ZA 1VQK3 3T8NA 1VQ73 2KF4A 1GOUA 4WHAA 1X1WA 3F7XA 1BRSA 9RNTA 3FGYA 1SIIA 1FUTA 3OWYA 4EV2A 1YJ93 2OWPA 3OXAA 3UL6A 1JJ22 1M9GA 3JUQA 4MJDA 1TP6A 1M1K4 5CXOA 1VQL3 1VQ93 3IJEB 1VQ43 1FA3A 1OCVA 2RFRA 1BRIA 4LEHA 3OW22 8RNTA 4KT3B 1OACA 2M7OA 6RNTA 3NX0A 4ZM8A 1GD4A 2F98A 4ILFA 2HMLB 3S29A 1VQO3 4BU4A 2D1WA 4NREA 3GZBA 1LOYA 4H3UA 3AGNA 1C7HA 5AIIA 5BIRA 3WA3A 5M1AA 1W5ZA 1IK3A 1R4YA 1BGSA 4QWTA 1UGHI 4R9LA 1I0VA 3SOAA 2FXTA 4X2HA 2XR8B 1TRPA 1EA2A 1UUGB 4BIRA 3EB8A
chains in the Genus database with same CATH topology
4WWUC 4J8TA 1N5PA 4HM0B 1WMNA 4HVNA 4N6V0 5IW9A 1WMOA 3EE1A 2CG1A 3G16A 3X3YA 3DGLA 1W2B2 2P05A 4N6MA 3V92A 1VQ53 1EQKA 1Q40A 3MG3A 4I4KA 4HBRA 5EVHA 1HU9A 3NBRA 4BTWA 4OVMA 4OUQA 2UX0A 5AI1A 3LTCA 1Q814 1O7GB 4L8OA 3HZPA 1ZO2A 4HZ9B 3CCL3 4HM2B 1UUVB 3SVAA 3DM8A 1JB5A 1OHSA 1OF5B 1NWWA 3N9HA 4FCMA 2CKFB 3S27A 4MMYB 4TX4A 3BB9A 3X3ZA 5KP1A 3CMA3 1QAKA 1U5OA 2I9WA 2Z77A 3O8YA 3BNEA 3B4OA 5JPPA 4HM4B 5IG5A 3DGNA 4FMDA 4RNZA 1V74A 5G2GA 1ISKA 4RBNA 3MKIA 1SJWA 3DY5A 3MYTA 4O8SA 2MC8A 1RRLA 1IQYA 1KC84 4KFFA 2CWVA 4FMBA 3I553 1KSIA 2HMKB 2E2UA 1YJW3 3G6E3 2B24B 2GEYA 3S67A 3SOYA 3FZWA 1N9EA 1JKGB 4RNYA 4AKYA 2R4IA 4LGQA 2E2TA 3BNCA 1QVG2 5IERA 5IG3A 2KRTA 2KXGA 1R4CA 3FSDA 3QRDA 1YIJ3 4R9KA 1QJGA 4BTYA 4LMIA 1JKGA 2JDIH 1GYBA 1IV7A 3H51A 3MG2A 1ULIB 3UNLA 1NB3I 1EKMA 1N5HA 1TUHA 2A15A 3D3LA 8CHOA 3L0RA 4HZBB 4BTXA 3HK4A 4XDVA 1O7MB 3PCSA 3IMAB 3B4PA 5AIHA 1LVNA 3CPW2 1VQM3 1WTHA 1A2KA 2OQEA 4N6LA 3VGNA 4FMCA 1M904 2W56B 2IUJA 4N6OB 1Q864 4FMAA 5AEWB 2BO9B 3A76A 2ML6A 4WFOA 1OUNA 3CCR3 2W9QA 1IQ8A 1JB4A 2HMMB 3I0YA 1ROAA 2GU1A 2OCTA 1AV4A 1W6YA 3FCSB 3Q90A 2W56A 3D9RA 4HM3B 2B1XB 1FGQA 1W6GA 2D42A 2LYXA 2OOVA 3V98A 2QIYA 4O02B 2BT3A 3CCS3 1NO3A 2YFIB 3MSOA 5ELJA 3NV0B 2FNQA 1D6YA 3GZRA 3KIIA 1NB5I 4ORLA 4GL6A 4HM7B 1SQWA 2O9UX 2BMOB 3T0UA 3OX9A 3E99A 3UL5A 1GD3A 1DVDA 4EC6A 3SX1A 3NV0A 3CU3A 4AKZA 1S5AA 1JNQA 3EN1B 2GXFA 3MWZA 1CYVA 2XF3A 3HX8A 4HM5B 1W00A 4L8PA 5BVBA 3CD63 1DMMA 1W2ZA 2IUKA 4K61A 3CCU3 3EC9A 2OQEC 4Q53A 2CHCA 5D81A 2Y73A 3SLUA 3NBJA 4CCVA 3FF0A 2W6JH 3EHCA 3OWSA 1Y4KA 4H61A 4J9AA 2XSOB 1JB2A 4LZIA 3EX9A 3LMLA 2O3OA 2RGQA 4XBXA 3JUMA 1T5YA 3PZWA 3F8XA 1FGRA 3PXMA 5HGRA 3KE7A 1WQLB 2YX9A 1YJN3 2K0MA 2OOVC 5JBSA 4MMXB 2BHMA 5FGOA 3CCV3 5IEPA 1UI7A 1VQ63 1K8A4 1QVF2 1ROVA 4XDWA 1OHOA 5LC6A 4R1KA 1YI23 2XEPA 4K1UA 1W02A 3FH1A 2W04A 3V99A 3WOEB 2CC3A 1LXEA 1BUQA 3GAXA 1STDA 1JRQA 2C11A 3Q2PA 3IPTA 3T8UA 3CCM3 3MHEA 2IA7A 3N8BA 4HM8B 4EYCA 1OF5A 2IMJA 1OGZA 1IVXA 4XB5A 3PCRA 2XSHB 2Q07A 2XFSA 1YIT3 1A2VA 5AEUB 2XRXB 3X42A 1E3VA 3CC73 1DMNA 2F86B 2YFJB 2CIUA 1W01A 5ELUA 3HIGA 3KZTA 3QK9A 1CEWI 7STDA 1ASKA 3NBBA 1O7WB 1IU7A 1UUWB 1IT8A 3JUPA 3DXOA 4U13A 1N8R4 3VSYA 2ZDJA 1M1XB 2W03A 1K41A 2WOHA 5DRVA 5A0OB 3TDGA 2QEX3 3WMDA 3DMCA 3SEDA 1E3RA 1OGXA 4L7KA 4IPBA 1PFPA 3LTDA 3LYGA 3CC23 1HKXA 1STFI 2CK3H 3NM2A 1N9JA 2HMNB 1AVKA 2Y74A 4N6TA 1IVWA 3LT9A 3NHXA 3LH4A 3BNDA 5DREA 2CWTA 3K7CA 3PGBA 2W9PA 2HMJB 2GU3A 3LXUX 4R4KA 3ER7A 3NUVA 2CWUA 1FUWA 2V1LA 3LTAA 4XBTA 1K9M4 3DUKA 1MOLA 4KZ1A 3KFQC 4LSOA 4N6NB 3S28A 1IVVA 1EG9B 5KP4A 3F40A 3U1WA 4CDLA 3LTBA 4HYZA 3G8ZA 3K63A 3CME3 5LC7A 2MF7A 3CC43 3FLJA 4STDA 1L5GB 5BXQA 5TGNA 4OK0A 3AMOB 3G4S3 2E2VA 2OTJ3 2GEXA 3EBYA 2W2CA 3NQYA 1IQXA 1K28A 1DYUA 1W6CA 1IV9A 4KFEA 2PZVA 1Q7Y4 4IT7A 2CG0A 2CH9A 2WO0A 3DGMA 4JRFA 4PEJA 3JUNA 4AEQA 3AMOA 3HI7A 2CFLA 1F8NA 1RJOA 1US1A 3FG4A 1DMQA 3PS8A 1RRHA 1TIJA 3F8HA 1JN5B 2INXA 4RZMA 4X2OA 2BMQB 3F7SA 4R80A 3I563 5D82A 3DZLA 3DGOA 1WNHA 3WA2X 1J2BA 3NM7A 4K1VA 1YHQ3 2BMRB 1ULJB 4N3VA 3FG3A 1TU5A 1JN5A 1NDOB 3OWUA 4GB5A 1Q42A 3FKAA 4IIAA 5KP3A 1TFKA 2BNGA 3RGAA 2CFWA 3ROBA 4EBGA 5CF1A 3NXJA 5EEOA 6STDA 2STDA 3X41A 4O2HA 4XBYA 1S723 1VQN3 1VZZA 2SBLA 4HJLB 1O7HB 5D83A 5FW5A 1MNLA 1UW1A 1WMPA 5AIGA 5STDA 2L4VA 1FGMA 5JPUA 3EBTA 3Q1CA 3LZAA 1LOXA 3RGRA 1KD14 3KN4A 2XH9A 3JUOA 3K5TA 1Q40B 4K90B 3PYJA 5AYRB 1AR0A 3CXC2 3RDEA 1FGTA 1CYUA 3B8LA 1K734 2PNCA 3S5CA 1YGEA 1IT7A 1QMAA 5CF2A 1A90A 3BLZA 2P09A 2RCDA 2Z6BA 1JV2B 3CNXA 3FF2A 1W4NA 2RSXA 1AVLA 1FGOA 3EJVA 2F99A 2P38A 3EN8A 3CNMA 3WOFB 1O7PB 3WDGB 1LNHA 2HMOB 2XFTA 1OH0A 2C10A 3HIIA 4G1MB 2QGUA 3KSED 3X40A 4HM1B 1VQP3 3MPHA 4XM4A 2JQ5A 1QAFA 3BNBA 5CK6A 2GBXB 2WGQA 4N6UA 3B7CA 2Z7AA 1IVUA 4MMZB 3CCJ3 1ZX2A 4KVHA 3LT8A 2XGLA 3NQZA 3F9SA 5IG4A 2CFGA 4EXRA 4O3VA 5IF6A 1KWIA 3JVCA 3J7Yd 1E97A 2CFKA 3GZXB 1TFOA 4WP5A 1YVBI 1SPUA 3GWRA 3F14A 3VF1A 3K9MC 3X3XA 1U8CB 5CLKA 3STDA 5IG0A 3KSPA 1GY6A 2W0QA 4FR9A 1GS3A 1O7NB 2CFDA 4HKVB 5IEOA 5I97A 2WGOA 1G96A 4HM6B 1DVCA 1RKYA 1IDPA 1SIHA 2GBWB 4JF8A 1A67A 1Q824 4KFDA 4WYKB 3KKGA 2LQVA 2K54A 3GZYB 1W7CA 2ML5A 3SXXA 3LOYA 4FCZA 3WODG 1KQS2 3CPOA 5EQLA 1N8QA 2KCDA 4FCJA 1UI8A 1D6ZA 3G713 4WYKA 3UJMA 3H3HA 4NHFA 3OV4A 1GY5A 3EF8A 3GRDA 5AYSC 3EQQB 3N54B 1GY7A 5AIFA 1D6UA 4EV5A 1NU3A 3ALAA 1OPYA 2CW9A 3ECFA 2QA43 1VQ83 3UB1A 3CCE3 3U97A 5IENA 2OTL3 2YFLB 2P0MA 1PU4A 2ZL8A 3G0KA 1RN7A 3CCQ3 3MG1A 2Z76A 1CQSA 2P0XA 3M8CA 1QALA 4MEIA 1OHPA 2FGTA 1Z1SA 2WOFA 2XGNA 3FG1A 1VQ73 3K0ZA 1VQK3 3T8NA 4WHAA 3F7XA 3FGYA 1SIIA 3OWYA 4EV2A 1YJ93 2OWPA 3OXAA 3UL6A 1JJ22 1M9GA 3JUQA 4MJDA 1TP6A 1M1K4 5CXOA 1VQL3 1VQ93 3IJEB 1VQ43 1FA3A 1OCVA 2RFRA 4LEHA 3OW22 1OACA 2M7OA 3NX0A 4ZM8A 1GD4A 2F98A 2HMLB 3S29A 1VQO3 2D1WA 4NREA 3GZBA 4H3UA 1C7HA 5AIIA 3WA3A 1W5ZA 1IK3A 4QWTA 3SOAA 4R9LA 2FXTA 4X2HA 2XR8B 1EA2A 1NJI4 3EB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9P A;  1N5P A;  1NB5 I;  2O9U X;  4N6V 0;  4N6M A;  3UL5 A;  1EQK A;  1FUW A;  1KWI A;  1GD3 A;  1DVD A;  1YVB I;  1MOL A;  3KFQ C;  3K9M C;  4N6N B;  3MWZ A;  1CYV A;  5LC7 A;  1G96 A;  1DVC A;  3SVA A;  1A67 A;  4TX4 A;  1IV9 A;  4IT7 A;  4CCV A;  2CH9 A;  4LZI A;  3PS8 A;  5EQL A;  1TIJ A;  3PXM A;  1WNH A;  3S67 A;  5LC6 A;  1LXE A;  3GAX A;  2KXG A;  1R4C A;  3QRD A;  1RN7 A;  3Q2P A;  1MNL A;  4EYC A;  1IV7 A;  1NB3 I;  1N5H A;  3L0R A;  5ELU A;  3IMA B;  3PYJ A;  1CEW I;  3UL6 A;  1M9G A;  1CYU A;  4N6L A;  1FA3 A;  4N6O B;  2BO9 B;  1A90 A;  5A0O B;  3NX0 A;  4ZM8 A;  1GD4 A;  2W9Q A;  1ROA A;  1PFP A;  2OCT A;  1STF I;  1N9J A;  3KSE D;  4N6T A;  3LH4 A;  4N6U A;  5ELJ A; 
#chains in the Genus database with same CATH topology
 4WWU C;  4J8T A;  1N5P A;  3URP A;  4HM0 B;  4CPK A;  1WMN A;  4HVN A;  4N6V 0;  5IW9 A;  1WMO A;  3EE1 A;  2CG1 A;  3G16 A;  3X3Y A;  3DGL A;  1W2B 2;  2P05 A;  4N6M A;  3V92 A;  1VQ5 3;  2ZA4 A;  1Q40 A;  3MG3 A;  1EQK A;  4I4K A;  4HBR A;  5EVH A;  1HU9 A;  3NBR A;  4BTW A;  4OVM A;  4OUQ A;  2UX0 A;  5AI1 A;  1MWT A;  1PYL A;  2GSP A;  3LTC A;  2UGI A;  1Q81 4;  1O7G B;  4L8O A;  3HZP A;  1ZO2 A;  2F4Y A;  6GSP A;  4HZ9 B;  3CCL 3;  4HM2 B;  1UUV B;  3SVA A;  3DM8 A;  1JB5 A;  1OHS A;  1OF5 B;  1BAN A;  1NWW A;  1YGW A;  2CKF B;  3N9H A;  4FCM A;  3S27 A;  1BNE A;  4MMY B;  3BB9 A;  4TX4 A;  3X3Z A;  5KP1 A;  3CMA 3;  1QAK A;  1U5O A;  1BNI A;  2I9W A;  1RNT A;  2Z77 A;  3O8Y A;  3BNE A;  3B4O A;  5JPP A;  4HM4 B;  5IG5 A;  3DGN A;  4FMD A;  4RNZ A;  1V74 A;  5G2G A;  1RCL A;  1ISK A;  4RBN A;  3MKI A;  3A5E A;  1SJW A;  3DY5 A;  3MYT A;  4O8S A;  2MC8 A;  1RRL A;  1IQY A;  1KC8 4;  4KFF A;  2CWV A;  4FMB A;  3I55 3;  4I5Q A;  1KSI A;  2HMK B;  2E2U A;  1YJW 3;  3G6E 3;  1SAR A;  2B24 B;  2GEY A;  3S67 A;  3SOY A;  3FZW A;  2IYJ A;  1N9E A;  1RSN A;  1JKG B;  4RNY A;  4AKY A;  2R4I A;  4LGQ A;  2E2T A;  3BNC A;  1QVG 2;  1I0X A;  5IER A;  5IG3 A;  1B3S A;  2KRT A;  2KXG A;  4HAA A;  1R4C A;  3FSD A;  3QRD A;  1RN4 A;  1YIJ 3;  4R9K A;  1QJG A;  5G1K A;  4BTY A;  1LQM B;  1BSA A;  4LMI A;  1JKG A;  2JDI H;  5M18 A;  1GYB A;  1IV7 A;  1LOV A;  3H51 A;  1UDI I;  3MG2 A;  5G1L A;  1ULI B;  1BRN L;  1Q7H A;  3UNL A;  1NB3 I;  2A15 A;  1EKM A;  1N5H A;  1TUH A;  3D3L A;  2AAD A;  8CHO A;  3L0R A;  4HZB B;  4BTX A;  3HK4 A;  4XDV A;  1O7M B;  3PCS A;  3IMA B;  3B4P A;  1JZO A;  5AIH A;  1LVN A;  3CPW 2;  1I2G A;  1VQM 3;  1WTH A;  1A2K A;  2OQE A;  4N6L A;  3VGN A;  2J8X B;  4FMC A;  1M90 4;  2F5W A;  2W56 B;  2IUJ A;  4N6O B;  1Q86 4;  4FMA A;  5AEW B;  2BO9 B;  3A76 A;  2ML6 A;  2F56 A;  4WFO A;  1BRH A;  1X1Y A;  1OUN A;  1YVS A;  7RNT A;  1HZ1 A;  4BL3 A;  2W9Q A;  1IQ8 A;  1JB4 A;  2HMM B;  3CCR 3;  1BRK A;  1ROA A;  3I0Y A;  2GU1 A;  2OCT A;  1AV4 A;  3WHO A;  1W6Y A;  2KF5 A;  3FCS B;  3Q90 A;  2C4B A;  2W56 A;  3WR2 A;  3D9R A;  4HM3 B;  2B1X B;  1FGQ A;  1RGC A;  1FZU A;  1W6G A;  2D42 A;  2LYX A;  2OOV A;  3V98 A;  1GMR A;  2RBI A;  2QIY A;  4O02 B;  2BT3 A;  1BNR A;  1RMS A;  3CCS 3;  1NO3 A;  2YFI B;  3MSO A;  5ELJ A;  3NV0 B;  2FNQ A;  1D6Y A;  3GZR A;  2AAE A;  3KII A;  4EW5 A;  1NB5 I;  4ORL A;  4GL6 A;  4HM7 B;  1SQW A;  2O9U X;  1B2Z A;  2BMO B;  3T0U A;  3RNT A;  3OX9 A;  3E99 A;  3UL5 A;  4GSP A;  1JBR A;  1GD3 A;  4GHO A;  1DVD A;  4EC6 A;  3SX1 A;  1GOY A;  2CX1 A;  3NV0 A;  3CU3 A;  4AKZ A;  1MGR A;  1RN1 A;  1S5A A;  1JNQ A;  3EN1 B;  1X1X A;  2GXF A;  1FYS A;  1CYV A;  2XF3 A;  3MWZ A;  3HX8 A;  1B21 A;  4HM5 B;  1W00 A;  1BRJ A;  1B2S A;  4L8P A;  5BVB A;  1I3I A;  1I2F A;  3CD6 3;  1DMM A;  1W2Z A;  2IUK A;  4K61 A;  3CCU 3;  1MWU A;  3EC9 A;  2OQE C;  4Q53 A;  2CHC A;  5D81 A;  5M19 A;  2Y73 A;  3SLU A;  3NBJ A;  4CCV A;  3FF0 A;  4HOH A;  2W6J H;  3EHC A;  3OWS A;  1Y4K A;  4H61 A;  4J9A A;  2XSO B;  1JB2 A;  1RCK A;  1BNG A;  1T2H A;  4LZI A;  3EX9 A;  3LML A;  2O3O A;  2RGQ A;  4XBX A;  3JUM A;  1T5Y A;  3PZW A;  1I70 A;  3F8X A;  1FGR A;  3PXM A;  1DET A;  1BOX A;  2KF3 A;  1WQL B;  2YX9 A;  3KE7 A;  5HGR A;  2K0M A;  2OOV C;  1YJN 3;  5JBS A;  4MMX B;  2BHM A;  2IY2 A;  3BU4 A;  5FGO A;  3CCV 3;  5IEP A;  1UI7 A;  1VQ6 3;  1K8A 4;  1GMQ A;  3AGO A;  1QVF 2;  1ROV A;  3ZFZ A;  4XDW A;  1OHO A;  5LC6 A;  1CH0 A;  4R1K A;  1YI2 3;  2XEP A;  4K1U A;  1W02 A;  3FH1 A;  1IYY A;  2W04 A;  3V99 A;  3WOE B;  2CC3 A;  1LXE A;  1BUQ A;  1S72 3;  3GAX A;  1STD A;  1JRQ A;  2C11 A;  1UCJ A;  3Q2P A;  3IPT A;  3SYU A;  1C54 A;  3T8U A;  3CCM 3;  2H0G A;  1B2M A;  3MHE A;  2IA7 A;  3N8B A;  4HM8 B;  4EYC A;  1OF5 A;  2IMJ A;  2KF6 A;  1OGZ A;  1IVX A;  4XB5 A;  3PCR A;  2XSH B;  2Q07 A;  1RNB A;  2XFS A;  1YIT 3;  1A2V A;  2BIR A;  3HOH A;  5AEU B;  2XRX B;  1B20 A;  3X42 A;  1E3V A;  3CC7 3;  1BSD A;  1DMN A;  2F86 B;  2YFJ B;  2CIU A;  1W01 A;  1UCK A;  5ELU A;  3HIG A;  3KZT A;  3QK9 A;  1CEW I;  7STD A;  1ASK A;  3NBB A;  1O7W B;  3ZG5 A;  1IU7 A;  1UUW B;  3ZG0 A;  1IT8 A;  3JUP A;  3DXO A;  4U13 A;  2ZHX B;  1N8R 4;  1MGW A;  3VSY A;  2ZDJ A;  1M1X B;  2W03 A;  1K41 A;  2WOH A;  4NPB A;  5DRV A;  3TDG A;  5A0O B;  2QEX 3;  2KAA A;  3WMD A;  3DMC A;  5GSP A;  5BU4 A;  1BRG A;  3SED A;  1E3R A;  1OGX A;  4L7K A;  1RDS A;  4IPB A;  1PFP A;  3LTD A;  3LYG A;  3CC2 3;  1HKX A;  1STF I;  2CK3 H;  3NM2 A;  1N9J A;  2HMN B;  3DH2 A;  1AVK A;  1AQZ A;  1PY3 A;  2Y74 A;  4N6T A;  1IVW A;  1JZD A;  3LT9 A;  3NHX A;  3LH4 A;  3BND A;  5DRE A;  2CWT A;  3BIR A;  3K7C A;  3PGB A;  2W9P A;  2HMJ B;  1JBT A;  2GU3 A;  3LXU X;  4R4K A;  3ER7 A;  1UGI A;  3NUV A;  2CWU A;  1FUW A;  2V1L A;  1AY7 A;  3LTA A;  4XBT A;  1K9M 4;  3DUK A;  1MOL A;  4KZ1 A;  3KFQ C;  4LSO A;  4N6N B;  3S28 A;  1DE3 A;  1IVV A;  1EG9 B;  5KP4 A;  5RNT A;  1B27 A;  1I2E A;  3F40 A;  3U1W A;  1LQG C;  4CDL A;  2BU4 A;  3LTB A;  1VQN 3;  4HYZ A;  3G8Z A;  3K63 A;  3CME 3;  1RGL A;  5LC7 A;  2MF7 A;  3CC4 3;  3FLJ A;  4STD A;  1L5G B;  5BXQ A;  1UCL A;  5TGN A;  4OK0 A;  3AMO B;  1B2X A;  3G4S 3;  1V58 A;  2E2V A;  2OTJ 3;  1V57 A;  2GEX A;  3EBY A;  2W2C A;  3NQY A;  1IQX A;  1K28 A;  1DYU A;  1LNI A;  1W6C A;  1IV9 A;  4KFE A;  2PZV A;  1Q7Y 4;  4IT7 A;  2CG0 A;  2UUG C;  2CH9 A;  2WO0 A;  3DGM A;  4JRF A;  4PEJ A;  4RNT A;  1BUJ A;  3JUN A;  4AEQ A;  1BSC A;  3AMO A;  3HI7 A;  2CFL A;  1F8N A;  1RJO A;  1US1 A;  3FG4 A;  1DMQ A;  3PS8 A;  1RRH A;  1B2U A;  1TIJ A;  3F8H A;  2H0I A;  1JN5 B;  1MWS A;  2INX A;  4RZM A;  4X2O A;  4BL2 A;  2BMQ B;  3F7S A;  4R80 A;  3I56 3;  5D82 A;  3DZL A;  1LRA A;  3DGO A;  1WNH A;  3WA2 X;  3Q3F A;  4CJN A;  1J2B A;  3NM7 A;  4K1V A;  1YHQ 3;  2BMR B;  1NJI 4;  1ULJ B;  4N3V A;  1RTU A;  3FG3 A;  1TU5 A;  1JN5 A;  1NDO B;  3OWU A;  4GB5 A;  1Q42 A;  3AHS A;  1GSP A;  3FKA A;  4IIA A;  5KP3 A;  1TFK A;  2BNG A;  3RGA A;  2CFW A;  1RGF A;  3ROB A;  4EBG A;  5CF1 A;  3NXJ A;  5EEO A;  6STD A;  1EUI C;  2STD A;  3D4A A;  4O2H A;  4XBY A;  3X41 A;  1VZZ A;  2SBL A;  1BVI A;  1O7H B;  4HJL B;  5D83 A;  5FW5 A;  1MNL A;  1UW1 A;  1WMP A;  5AIG A;  5STD A;  4LYL B;  2L4V A;  1FGM A;  5JPU A;  3EBT A;  3Q1C A;  3LZA A;  1LOX A;  1BSB A;  1Q9E A;  3RGR A;  1KD1 4;  3KN4 A;  1EEJ A;  1LOW A;  2XH9 A;  3JUO A;  1FW7 A;  3DGY A;  3K5T A;  1Q40 B;  4K90 B;  2R41 A;  2L1S A;  3PYJ A;  5AYR B;  1AR0 A;  2K3D A;  3CXC 2;  1VQQ A;  3RDE A;  3AHW A;  1FGT A;  1CYU A;  1TJD A;  3B8L A;  1K73 4;  2PNC A;  1NNV A;  1GOV A;  4J5G A;  3S5C A;  1YGE A;  1IT7 A;  1QMA A;  1TRQ A;  5CF2 A;  1A90 A;  3BLZ A;  2P09 A;  2RCD A;  2Z6B A;  1JV2 B;  3CNX A;  3FF2 A;  1W4N A;  2RSX A;  1AVL A;  1FGO A;  3EJV A;  2F99 A;  2P38 A;  3EN8 A;  3CNM A;  3WOF B;  1O7P B;  3WDG B;  1LNH A;  2C10 A;  1OH0 A;  2HMO B;  2XFT A;  3HII A;  4G1M B;  1UCI A;  2QGU A;  3KSE D;  1MWR A;  4HM1 B;  3X40 A;  1VQP 3;  1T3B A;  1TTO A;  2JQ5 A;  3MPH A;  1QAF A;  4XM4 A;  3BNB A;  1G02 A;  5CK6 A;  2GBX B;  2WGQ A;  4N6U A;  3B7C A;  1IVU A;  2Z7A A;  4MMZ B;  3CCJ 3;  1ZX2 A;  1FUS A;  2HOH A;  3KCH A;  4KVH A;  1I3F A;  2XGL A;  3LT8 A;  3NQZ A;  3F9S A;  5IG4 A;  2CFG A;  2F5M A;  4O3V A;  4EXR A;  5IF6 A;  1KWI A;  3JVC A;  1RGA A;  3J7Y d;  1E97 A;  2CFK A;  3GZX B;  1BAO A;  1I8V A;  1TFO A;  1YVB I;  1SPU A;  4WP5 A;  3GWR A;  3F14 A;  3VF1 A;  3K9M C;  3X3X A;  1U8C B;  1ZGX A;  5CLK A;  3STD A;  5IG0 A;  1HYF A;  3KSP A;  1BU4 A;  1GY6 A;  1RGG A;  2W0Q A;  4FR9 A;  1GS3 A;  1O7N B;  2CFD A;  4HKV B;  1BNS A;  5IEO A;  5I97 A;  2WGO A;  1G96 A;  4HM6 B;  1DVC A;  1RKY A;  1G0T A;  1IDP A;  1GMP A;  1RHL A;  1SIH A;  2GBW B;  2RNT A;  4JF8 A;  1A67 A;  1Q82 4;  4KFD A;  4WYK B;  3KKG A;  2LQV A;  2K54 A;  3GZY B;  1W7C A;  2ML5 A;  3SXX A;  3LOY A;  4FCZ A;  3WOD G;  1RLS A;  1JBS A;  1BIR A;  1KQS 2;  1BSE A;  3CPO A;  3D79 A;  5EQL A;  1N8Q A;  2KCD A;  5HOH A;  2SAR A;  1UI8 A;  1D6Z A;  4FCJ A;  3G71 3;  4WYK A;  3UJM A;  3H3H A;  3GSP A;  4NHF A;  7GSP A;  3OV4 A;  1GY5 A;  3EF8 A;  3GRD A;  5AYS C;  1BNJ A;  1RGK A;  3EQQ B;  3N54 B;  1GY7 A;  5AIF A;  1D6U A;  4EV5 A;  1NU3 A;  3ALA A;  1A2P A;  4J5K A;  1OPY A;  2CW9 A;  3ECF A;  2QA4 3;  1VQ8 3;  3UB1 A;  3CCE 3;  3U97 A;  5IEN A;  2H0H A;  2OTL 3;  1ZS7 A;  2YFL B;  2P0M A;  1PU4 A;  2ZL8 A;  1YNV X;  1RN7 A;  2CX0 A;  3D5G A;  3D5I A;  1RGE A;  3G0K A;  3MG1 A;  3CCQ 3;  1T2I A;  2Z76 A;  1CQS A;  4DKI A;  2P0X A;  3M8C A;  1QAL A;  4MEI A;  1RGH A;  1OHP A;  2FGT A;  1Z1S A;  2WOF A;  1BNF A;  2XGN A;  3FG1 A;  1X1U A;  3K0Z A;  1VQK 3;  3T8N A;  1VQ7 3;  2KF4 A;  1GOU A;  4WHA A;  1X1W A;  3F7X A;  1BRS A;  9RNT A;  3FGY A;  1SII A;  1FUT A;  3OWY A;  4EV2 A;  1YJ9 3;  2OWP A;  3OXA A;  3UL6 A;  1JJ2 2;  1M9G A;  3JUQ A;  4MJD A;  1TP6 A;  1M1K 4;  5CXO A;  1VQL 3;  1VQ9 3;  3IJE B;  1VQ4 3;  1FA3 A;  1OCV A;  2RFR A;  1BRI A;  4LEH A;  3OW2 2;  8RNT A;  4KT3 B;  1OAC A;  2M7O A;  6RNT A;  3NX0 A;  4ZM8 A;  1GD4 A;  2F98 A;  4ILF A;  2HML B;  3S29 A;  1VQO 3;  4BU4 A;  2D1W A;  4NRE A;  3GZB A;  1LOY A;  4H3U A;  3AGN A;  1C7H A;  5AII A;  5BIR A;  3WA3 A;  5M1A A;  1W5Z A;  1IK3 A;  1R4Y A;  1BGS A;  4QWT A;  1UGH I;  4R9L A;  1I0V A;  3SOA A;  2FXT A;  4X2H A;  2XR8 B;  1TRP A;  1EA2 A;  1UUG B;  4BIR A;  3EB8 A; 
#chains in the Genus database with same CATH homology
 4WWU C;  4J8T A;  1N5P A;  4HM0 B;  1WMN A;  4HVN A;  4N6V 0;  5IW9 A;  1WMO A;  3EE1 A;  2CG1 A;  3G16 A;  3X3Y A;  3DGL A;  1W2B 2;  2P05 A;  4N6M A;  3V92 A;  1VQ5 3;  1EQK A;  1Q40 A;  3MG3 A;  4I4K A;  4HBR A;  5EVH A;  1HU9 A;  3NBR A;  4BTW A;  4OVM A;  4OUQ A;  2UX0 A;  5AI1 A;  3LTC A;  1Q81 4;  1O7G B;  4L8O A;  3HZP A;  1ZO2 A;  4HZ9 B;  3CCL 3;  4HM2 B;  1UUV B;  3SVA A;  3DM8 A;  1JB5 A;  1OHS A;  1OF5 B;  1NWW A;  3N9H A;  4FCM A;  2CKF B;  3S27 A;  4MMY B;  4TX4 A;  3BB9 A;  3X3Z A;  5KP1 A;  3CMA 3;  1QAK A;  1U5O A;  2I9W A;  2Z77 A;  3O8Y A;  3BNE A;  3B4O A;  5JPP A;  4HM4 B;  5IG5 A;  3DGN A;  4FMD A;  4RNZ A;  1V74 A;  5G2G A;  1ISK A;  4RBN A;  3MKI A;  1SJW A;  3DY5 A;  3MYT A;  4O8S A;  2MC8 A;  1RRL A;  1IQY A;  1KC8 4;  4KFF A;  2CWV A;  4FMB A;  3I55 3;  1KSI A;  2HMK B;  2E2U A;  1YJW 3;  3G6E 3;  2B24 B;  2GEY A;  3S67 A;  3SOY A;  3FZW A;  1N9E A;  1JKG B;  4RNY A;  4AKY A;  2R4I A;  4LGQ A;  2E2T A;  3BNC A;  1QVG 2;  5IER A;  5IG3 A;  2KRT A;  2KXG A;  1R4C A;  3FSD A;  3QRD A;  1YIJ 3;  4R9K A;  1QJG A;  4BTY A;  4LMI A;  1JKG A;  2JDI H;  1GYB A;  1IV7 A;  3H51 A;  3MG2 A;  1ULI B;  3UNL A;  1NB3 I;  1EKM A;  1N5H A;  1TUH A;  2A15 A;  3D3L A;  8CHO A;  3L0R A;  4HZB B;  4BTX A;  3HK4 A;  4XDV A;  1O7M B;  3PCS A;  3IMA B;  3B4P A;  5AIH A;  1LVN A;  3CPW 2;  1VQM 3;  1WTH A;  1A2K A;  2OQE A;  4N6L A;  3VGN A;  4FMC A;  1M90 4;  2W56 B;  2IUJ A;  4N6O B;  1Q86 4;  4FMA A;  5AEW B;  2BO9 B;  3A76 A;  2ML6 A;  4WFO A;  1OUN A;  3CCR 3;  2W9Q A;  1IQ8 A;  1JB4 A;  2HMM B;  3I0Y A;  1ROA A;  2GU1 A;  2OCT A;  1AV4 A;  1W6Y A;  3FCS B;  3Q90 A;  2W56 A;  3D9R A;  4HM3 B;  2B1X B;  1FGQ A;  1W6G A;  2D42 A;  2LYX A;  2OOV A;  3V98 A;  2QIY A;  4O02 B;  2BT3 A;  3CCS 3;  1NO3 A;  2YFI B;  3MSO A;  5ELJ A;  3NV0 B;  2FNQ A;  1D6Y A;  3GZR A;  3KII A;  1NB5 I;  4ORL A;  4GL6 A;  4HM7 B;  1SQW A;  2O9U X;  2BMO B;  3T0U A;  3OX9 A;  3E99 A;  3UL5 A;  1GD3 A;  1DVD A;  4EC6 A;  3SX1 A;  3NV0 A;  3CU3 A;  4AKZ A;  1S5A A;  1JNQ A;  3EN1 B;  2GXF A;  3MWZ A;  1CYV A;  2XF3 A;  3HX8 A;  4HM5 B;  1W00 A;  4L8P A;  5BVB A;  3CD6 3;  1DMM A;  1W2Z A;  2IUK A;  4K61 A;  3CCU 3;  3EC9 A;  2OQE C;  4Q53 A;  2CHC A;  5D81 A;  2Y73 A;  3SLU A;  3NBJ A;  4CCV A;  3FF0 A;  2W6J H;  3EHC A;  3OWS A;  1Y4K A;  4H61 A;  4J9A A;  2XSO B;  1JB2 A;  4LZI A;  3EX9 A;  3LML A;  2O3O A;  2RGQ A;  4XBX A;  3JUM A;  1T5Y A;  3PZW A;  3F8X A;  1FGR A;  3PXM A;  5HGR A;  3KE7 A;  1WQL B;  2YX9 A;  1YJN 3;  2K0M A;  2OOV C;  5JBS A;  4MMX B;  2BHM A;  5FGO A;  3CCV 3;  5IEP A;  1UI7 A;  1VQ6 3;  1K8A 4;  1QVF 2;  1ROV A;  4XDW A;  1OHO A;  5LC6 A;  4R1K A;  1YI2 3;  2XEP A;  4K1U A;  1W02 A;  3FH1 A;  2W04 A;  3V99 A;  3WOE B;  2CC3 A;  1LXE A;  1BUQ A;  3GAX A;  1STD A;  1JRQ A;  2C11 A;  3Q2P A;  3IPT A;  3T8U A;  3CCM 3;  3MHE A;  2IA7 A;  3N8B A;  4HM8 B;  4EYC A;  1OF5 A;  2IMJ A;  1OGZ A;  1IVX A;  4XB5 A;  3PCR A;  2XSH B;  2Q07 A;  2XFS A;  1YIT 3;  1A2V A;  5AEU B;  2XRX B;  3X42 A;  1E3V A;  3CC7 3;  1DMN A;  2F86 B;  2YFJ B;  2CIU A;  1W01 A;  5ELU A;  3HIG A;  3KZT A;  3QK9 A;  1CEW I;  7STD A;  1ASK A;  3NBB A;  1O7W B;  1IU7 A;  1UUW B;  1IT8 A;  3JUP A;  3DXO A;  4U13 A;  1N8R 4;  3VSY A;  2ZDJ A;  1M1X B;  2W03 A;  1K41 A;  2WOH A;  5DRV A;  5A0O B;  3TDG A;  2QEX 3;  3WMD A;  3DMC A;  3SED A;  1E3R A;  1OGX A;  4L7K A;  4IPB A;  1PFP A;  3LTD A;  3LYG A;  3CC2 3;  1HKX A;  1STF I;  2CK3 H;  3NM2 A;  1N9J A;  2HMN B;  1AVK A;  2Y74 A;  4N6T A;  1IVW A;  3LT9 A;  3NHX A;  3LH4 A;  3BND A;  5DRE A;  2CWT A;  3K7C A;  3PGB A;  2W9P A;  2HMJ B;  2GU3 A;  3LXU X;  4R4K A;  3ER7 A;  3NUV A;  2CWU A;  1FUW A;  2V1L A;  3LTA A;  4XBT A;  1K9M 4;  3DUK A;  1MOL A;  4KZ1 A;  3KFQ C;  4LSO A;  4N6N B;  3S28 A;  1IVV A;  1EG9 B;  5KP4 A;  3F40 A;  3U1W A;  4CDL A;  3LTB A;  4HYZ A;  3G8Z A;  3K63 A;  3CME 3;  5LC7 A;  2MF7 A;  3CC4 3;  3FLJ A;  4STD A;  1L5G B;  5BXQ A;  5TGN A;  4OK0 A;  3AMO B;  3G4S 3;  2E2V A;  2OTJ 3;  2GEX A;  3EBY A;  2W2C A;  3NQY A;  1IQX A;  1K28 A;  1DYU A;  1W6C A;  1IV9 A;  4KFE A;  2PZV A;  1Q7Y 4;  4IT7 A;  2CG0 A;  2CH9 A;  2WO0 A;  3DGM A;  4JRF A;  4PEJ A;  3JUN A;  4AEQ A;  3AMO A;  3HI7 A;  2CFL A;  1F8N A;  1RJO A;  1US1 A;  3FG4 A;  1DMQ A;  3PS8 A;  1RRH A;  1TIJ A;  3F8H A;  1JN5 B;  2INX A;  4RZM A;  4X2O A;  2BMQ B;  3F7S A;  4R80 A;  3I56 3;  5D82 A;  3DZL A;  3DGO A;  1WNH A;  3WA2 X;  1J2B A;  3NM7 A;  4K1V A;  1YHQ 3;  2BMR B;  1ULJ B;  4N3V A;  3FG3 A;  1TU5 A;  1JN5 A;  1NDO B;  3OWU A;  4GB5 A;  1Q42 A;  3FKA A;  4IIA A;  5KP3 A;  1TFK A;  2BNG A;  3RGA A;  2CFW A;  3ROB A;  4EBG A;  5CF1 A;  3NXJ A;  5EEO A;  6STD A;  2STD A;  3X41 A;  4O2H A;  4XBY A;  1S72 3;  1VQN 3;  1VZZ A;  2SBL A;  4HJL B;  1O7H B;  5D83 A;  5FW5 A;  1MNL A;  1UW1 A;  1WMP A;  5AIG A;  5STD A;  2L4V A;  1FGM A;  5JPU A;  3EBT A;  3Q1C A;  3LZA A;  1LOX A;  3RGR A;  1KD1 4;  3KN4 A;  2XH9 A;  3JUO A;  3K5T A;  1Q40 B;  4K90 B;  3PYJ A;  5AYR B;  1AR0 A;  3CXC 2;  3RDE A;  1FGT A;  1CYU A;  3B8L A;  1K73 4;  2PNC A;  3S5C A;  1YGE A;  1IT7 A;  1QMA A;  5CF2 A;  1A90 A;  3BLZ A;  2P09 A;  2RCD A;  2Z6B A;  1JV2 B;  3CNX A;  3FF2 A;  1W4N A;  2RSX A;  1AVL A;  1FGO A;  3EJV A;  2F99 A;  2P38 A;  3EN8 A;  3CNM A;  3WOF B;  1O7P B;  3WDG B;  1LNH A;  2HMO B;  2XFT A;  1OH0 A;  2C10 A;  3HII A;  4G1M B;  2QGU A;  3KSE D;  3X40 A;  4HM1 B;  1VQP 3;  3MPH A;  4XM4 A;  2JQ5 A;  1QAF A;  3BNB A;  5CK6 A;  2GBX B;  2WGQ A;  4N6U A;  3B7C A;  2Z7A A;  1IVU A;  4MMZ B;  3CCJ 3;  1ZX2 A;  4KVH A;  3LT8 A;  2XGL A;  3NQZ A;  3F9S A;  5IG4 A;  2CFG A;  4EXR A;  4O3V A;  5IF6 A;  1KWI A;  3JVC A;  3J7Y d;  1E97 A;  2CFK A;  3GZX B;  1TFO A;  4WP5 A;  1YVB I;  1SPU A;  3GWR A;  3F14 A;  3VF1 A;  3K9M C;  3X3X A;  1U8C B;  5CLK A;  3STD A;  5IG0 A;  3KSP A;  1GY6 A;  2W0Q A;  4FR9 A;  1GS3 A;  1O7N B;  2CFD A;  4HKV B;  5IEO A;  5I97 A;  2WGO A;  1G96 A;  4HM6 B;  1DVC A;  1RKY A;  1IDP A;  1SIH A;  2GBW B;  4JF8 A;  1A67 A;  1Q82 4;  4KFD A;  4WYK B;  3KKG A;  2LQV A;  2K54 A;  3GZY B;  1W7C A;  2ML5 A;  3SXX A;  3LOY A;  4FCZ A;  3WOD G;  1KQS 2;  3CPO A;  5EQL A;  1N8Q A;  2KCD A;  4FCJ A;  1UI8 A;  1D6Z A;  3G71 3;  4WYK A;  3UJM A;  3H3H A;  4NHF A;  3OV4 A;  1GY5 A;  3EF8 A;  3GRD A;  5AYS C;  3EQQ B;  3N54 B;  1GY7 A;  5AIF A;  1D6U A;  4EV5 A;  1NU3 A;  3ALA A;  1OPY A;  2CW9 A;  3ECF A;  2QA4 3;  1VQ8 3;  3UB1 A;  3CCE 3;  3U97 A;  5IEN A;  2OTL 3;  2YFL B;  2P0M A;  1PU4 A;  2ZL8 A;  3G0K A;  1RN7 A;  3CCQ 3;  3MG1 A;  2Z76 A;  1CQS A;  2P0X A;  3M8C A;  1QAL A;  4MEI A;  1OHP A;  2FGT A;  1Z1S A;  2WOF A;  2XGN A;  3FG1 A;  1VQ7 3;  3K0Z A;  1VQK 3;  3T8N A;  4WHA A;  3F7X A;  3FGY A;  1SII A;  3OWY A;  4EV2 A;  1YJ9 3;  2OWP A;  3OXA A;  3UL6 A;  1JJ2 2;  1M9G A;  3JUQ A;  4MJD A;  1TP6 A;  1M1K 4;  5CXO A;  1VQL 3;  1VQ9 3;  3IJE B;  1VQ4 3;  1FA3 A;  1OCV A;  2RFR A;  4LEH A;  3OW2 2;  1OAC A;  2M7O A;  3NX0 A;  4ZM8 A;  1GD4 A;  2F98 A;  2HML B;  3S29 A;  1VQO 3;  2D1W A;  4NRE A;  3GZB A;  4H3U A;  1C7H A;  5AII A;  3WA3 A;  1W5Z A;  1IK3 A;  4QWT A;  3SOA A;  4R9L A;  2FXT A;  4X2H A;  2XR8 B;  1EA2 A;  1NJI 4;  3EB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...