4CCVA

Crystal structure of histidine-rich glycoprotein n2 domain reveals redox activity at an interdomain disulfide bridge: implications for the regulation of angiogenesis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
SPVLFDFIEDTEPFRKSADKALEVYKSESEAYASFRVDRVERVTRVKGGERTNYYVDFSVRNCSRSHFHRHPAFGFCRADLSFDVEASNLENPEDVIISCEVFNFEEHGNISGFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTIDINE-RICH GLYCOPROTEIN
publication title Crystal Structure of Histidine-Rich Glycoprotein N2 Domain Reveals Redox Activity at an Interdomain Disulfide Bridge: Implications for Angiogenic Regulation.
pubmed doi rcsb
molecule tags Blood clotting
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ccvA00
1IV9A 1LXEA 1FUWA 1A90A 1N5HA 4EYCA 1A67A 1EQKA 4TX4A 5EQLA 3UL5A 3KSED 1DVDA 1MNLA 3IMAB 2BO9B 3L0RA 1NB5I 1WNHA 5LC6A 3Q2PA 1YVBI 4ZM8A 5A0OB 1STFI 1M9GA 5ELUA 4CCVA 1N9JA 3PYJA 2CH9A 3LH4A 1GD4A 1N5PA 1RN7A 3SVAA 4IT7A 1KWIA 1NB3I 3GAXA 3UL6A 1GD3A 1CYVA 3PXMA 1G96A 1R4CA 1PFPA 2W9PA 3K9MC 2O9UX 1CEWI 4N6UA 1DVCA 5ELJA 3S67A 2KXGA 4N6V0 4N6OB 3PS8A 1CYUA 3QRDA 4N6MA 1IV7A 1TIJA 1FA3A 4N6TA 2W9QA 3KFQC 4LZIA 1MOLA 1ROAA 5LC7A 3MWZA 4N6NB 4N6LA 3NX0A 2OCTA
chains in the Genus database with same CATH superfamily
1LOYA 1IV9A 5BVBA 4O3VA 3PZWA 7RNTA 1YGWA 1WQLB 3MKIA 1YI23 1Q9EA 5IW9A 3N9HA 2WOFA 1IT8A 2Y74A 1FUTA 3GZYB 2IUKA 4MMZB 5STDA 2E2TA 4KFDA 1X1YA 1YJ93 5AIFA 3KSED 3V99A 3FH1A 4WYKA 1I2FA 3G6E3 4LGQA 4LEHA 3HX8A 1IQXA 1OH0A 1RN1A 3WA3A 8RNTA 1VQO3 4H3UA 3A5EA 1EG9B 3AGNA 4HM5B 3SEDA 3EB8A 2CX1A 1Q40A 1O7NB 3AMOB 1K28A 1ULJB 2P38A 3FF0A 1W6YA 1JRQA 1TFKA 1TRPA 3NBBA 4HZBB 1AY7A 1ZS7A 2QGUA 1FUSA 1GYBA 1JJ22 4K1UA 1BNGA 1BNEA 1IVWA 4HJLB 4K1VA 3N54B 1GY5A 5LC6A 2XH9A 3X3ZA 1X1XA 1GOYA 1NU3A 1O7GB 1BUQA 3D79A 1OF5B 1IDPA 2JQ5A 1N9JA 2WOHA 3KKGA 1U5OA 1BSBA 3MG1A 2K0MA 2CH9A 3DGLA 3O8YA 3D3LA 3OV4A 3D5GA 3LXUX 4FMCA 3FG1A 4R80A 2QIYA 5D81A 3HOHA 5GSPA 3SVAA 4KVHA 2GSPA 2CG0A 2LQVA 3LT9A 3STDA 3FG3A 4NHFA 1KWIA 3GZXB 1J2BA 1RGCA 2CWTA 4HAAA 4ILFA 1Q7Y4 4HM2B 1VQ53 1N9EA 2YX9A 4CJNA 3DGMA 1BOXA 3NV0B 3IPTA 4GB5A 1CYVA 4HM0B 1V74A 1YJN3 1X1WA 2KF4A 3CMA3 3EN1B 1N8QA 1JKGA 3GZBA 5JPUA 3KE7A 2QA43 5CF2A 1B3SA 4MEIA 3D5IA 1MWTA 1MWUA 3H3HA 2GBWB 1JBTA 1JZOA 4RZMA 1JN5B 1OHSA 5BU4A 1BNFA 2BNGA 3URPA 5IEOA 3NQZA 3EHCA 1W02A 1B2MA 1GMRA 1OCVA 3EQQB 1RRLA 3IJEB 5AEUB 1CEWI 4STDA 2OOVA 5ELJA 1ROVA 1WMPA 3S67A 3S29A 1STDA 3F40A 3WDGB 3CCV3 1DE3A 1YVSA 4N6V0 4XBXA 1GOVA 4LMIA 4N6OB 1TRQA 4NREA 1CYUA 1RLSA 1OACA 2KCDA 3QRDA 2ZDJA 3CD63 1V58A 2F56A 4GL6A 4XDVA 1BIRA 1UCIA 1EKMA 2Y73A 3DH2A 3CXC2 2OOVC 3CPOA 3BU4A 1PU4A 1B2XA 1BRKA 4N3VA 4N6TA 5M18A 1TP6A 3KFQC 4FMDA 2Z7AA 1VQL3 4FR9A 1W2B2 1PY3A 1RGKA 1ROAA 1I2GA 1W6CA 4CPKA 1T2HA 1QALA 6STDA 1VQQA 1VQ73 4N6LA 3QK9A 1JB2A 1BSCA 1I0VA 2K54A 2SBLA 1GY6A 1F8NA 3BIRA 4U13A 4AEQA 1B2SA 1JB5A 3B7CA 2C11A 3FSDA 4HKVB 1QAFA 1DYUA 1LXEA 1CH0A 2H0IA 4RNTA 4BTXA 3LTCA 1K8A4 1M1K4 1FGOA 1SIHA 1FGRA 4EC6A 2BMQB 2F5WA 1RRHA 5G1KA 1G0TA 2HMNB 2P0MA 3LMLA 4WP5A 1EQKA 4EW5A 1ULIB 3CNMA 4KT3B 2AADA 3DGYA 3JUPA 4HOHA 1ZGXA 4KFEA 4XM4A 2W56B 2B1XB 1UI7A 4K90B 4MMXB 1YIJ3 1S5AA 3SYUA 3CC73 2AAEA 2F98A 3V92A 2RSXA 1UCLA 4AKYA 1K734 2Z6BA 3JUMA 4J5KA 3IMAB 3CNXA 2PZVA 2ML5A 1FYSA 5RNTA 3BNBA 3B4PA 6RNTA 1BRJA 4FMBA 4H61A 5DREA 2L1SA 2W04A 1WMNA 4QWTA 4AKZA 2BU4A 1A2PA 2YFIB 1FGMA 3WMDA 5IENA 1BRHA 1RGHA 1BNRA 1BSDA 3KSPA 1LNHA 1RMSA 1BANA 1STFI 4HM8B 1M9GA 1UUVB 1OGXA 4HM6B 1L5GB 3TDGA 1LQMB 2CFDA 5IG4A 3WA2X 1QJGA 2OQEA 2KF3A 3HIIA 4CDLA 3FF2A 3PYJA 4K61A 1RHLA 1IT7A 3WODG 3FG4A 1MGRA 2HMKB 1UUWB 3EF8A 1N5PA 3UJMA 3DY5A 1SIIA 2CFKA 2I9WA 3CCJ3 2E2UA 4KFFA 3CCL3 2GU1A 5AEWB 1VQM3 1Q824 3HZPA 3NBRA 1QVG2 1KQS2 3S5CA 1ZO2A 3KN4A 5DRVA 1NB3I 3F7XA 2OQEC 2UGIA 2XFTA 3LTDA 1I8VA 1OUNA 3PXMA 1GMQA 4WHAA 1TTOA 3K0ZA 5IF6A 4O8SA 1G96A 2O3OA 1MWSA 1V57A 1BSAA 2RCDA 2W6JH 3WOEB 1PFPA 1BSEA 1BGSA 1D6UA 4R4KA 4HZ9B 4WYKB 4PEJA 1W7CA 3OX9A 2FNQA 1AR0A 2J8XB 3Q3FA 2F4YA 5CLKA 1T5YA 2E2VA 2O9UX 1QAKA 3K9MC 4I5QA 2CFWA 1UCJA 3F7SA 2RFRA 5AI1A 1FGQA 3FKAA 1JB4A 1Q40B 1JNQA 1YNVX 5KP3A 4GSPA 2KRTA 1W6GA 4I4KA 1I70A 3JUNA 3K5TA 5AYRB 4EBGA 3LZAA 1O7MB 1SPUA 3DXOA 3BNDA 1Y4KA 1K9M4 2CFLA 1Q42A 1VQN3 1X1UA 1U8CB 1RGEA 1TIJA 2XSHB 3A76A 3HK4A 1BAOA 1LRAA 2HMMB 1HKXA 1G02A 2P09A 1Q7HA 2IY2A 4FCZA 1SQWA 4LZIA 1MOLA 2H0GA 1B21A 1FGTA 1IYYA 2IMJA 5LC7A 5TGNA 5IEPA 2XRXB 4IIAA 3V98A 3MYTA 2OTJ3 1IVUA 1A2VA 5AYSC 3MG2A 3NX0A 2OCTA 3CCU3 3PCRA 5HOHA 1NNVA 3S28A 1RDSA 3PGBA 1GSPA 1O7HB 4RNZA 4EV5A 4HM7B 1IVVA 3EBTA 1T2IA 2F5MA 3BNEA 3F9SA 3AHWA 2B24B 4FCMA 1A90A 5KP1A 1IU7A 1DMQA 3B8LA 3WOFB 1VZZA 3GSPA 4DKIA 1ISKA 1JKGB 5AIHA 1BU4A 3G4S3 1RTUA 2RGQA 3WR2A 4J5GA 1BVIA 3BB9A 7GSPA 3S27A 3T8UA 1US1A 3UL5A 3X40A 7STDA 3DGOA 3FZWA 1DVDA 1RCKA 2XGNA 1E3VA 1MNLA 1UGHI 2W0QA 3AGOA 2HMJB 3AHSA 2XFSA 1KD14 1JZDA 4OUQA 2BO9B 1YIT3 2BMRB 5HGRA 2M7OA 3CU3A 3X41A 1VQ83 1D6ZA 2CK3H 3KCHA 5EEOA 1QMAA 3Q90A 1VQ93 3JUQA 2ZL8A 1TUHA 3CCR3 1JBSA 4XDWA 1WNHA 3K7CA 5JPPA 1E3RA 4L7KA 2L4VA 1TJDA 5KP4A 3HI7A 3JUOA 1LOXA 1YGEA 3DM8A 5AIGA 1TU5A 5ELUA 4RBNA 4CCVA 8CHOA 1JBRA 2C4BA 3LTBA 1RGAA 3LT8A 1CQSA 2IUJA 3NM7A 3PCSA 3OXAA 1I3IA 3G713 5BIRA 1VQP3 4Q53A 2F86B 3EN8A 4NPBA 3FLJA 4GHOA 1GD4A 1RGGA 1RN7A 3NQYA 1BRIA 3DUKA 3ZFZA 1W4NA 2CX0A 2HOHA 1ZX2A 3EJVA 2ZA4A 2RNTA 4L8PA 1YJW3 1UI8A 5CXOA 1M1XB 3GAXA 1K41A 1KSIA 4MMYB 5CF1A 1W5ZA 3OWSA 2XSOB 3UL6A 1UUGB 3LOYA 3UB1A 4FCJA 1KC84 1BUJA 3H51A 1LVNA 3G0KA 3X42A 3SX1A 2W2CA 1OGZA 1R4CA 1I3FA 2W9PA 3CC23 1MWRA 2GEYA 1SJWA 2Z77A 3GZRA 5EVHA 2W03A 3MPHA 1OHOA 1MGWA 3F8HA 5IG5A 2A15A 2RBIA 3GWRA 2YFLB 2XR8B 3RGAA 3MG3A 4HM1B 2KXGA 4BU4A 2OWPA 1FW7A 1BRGA 3AMOA 4BL3A 1AVKA 2QEX3 4XBYA 2SARA 2HMOB 5I97A 3J7Yd 4HM4B 1RCLA 4N6MA 3VSYA 3B4OA 4G1MB 2BMOB 1B2UA 1IV7A 1RKYA 2D42A 3OW22 1RNTA 2GEXA 1FA3A 4R9LA 1Q864 2WGOA 1BNSA 1I0XA 4WFOA 5D83A 3ZG0A 3EE1A 2W9QA 3DZLA 3SLUA 4JRFA 1OF5A 1DMMA 2Z76A 3VGNA 1YHQ3 3M8CA 1RGLA 1SARA 3LYGA 1GOUA 4N6NB 4JF8A 2HMLB 1ASKA 1UW1A 2ZHXB 2LYXA 3NBJA 4LYLB 3K63A 4R1KA 4HVNA 1GMPA 1B20A 1UDII 1LNIA 4HBRA 3BLZA 4FMAA 3CME3 1HU9A 2JDIH 2Q07A 5G2GA 1FUWA 1RJOA 1N5HA 4EYCA 1A67A 5G1LA 1I2EA 3NV0A 3I0YA 3MSOA 3NUVA 3KZTA 2CW9A 3NHXA 4TX4A 3ZG5A 2CHCA 1IK3A 1M904 4X2OA 5IERA 2XGLA 3RGRA 4KZ1A 2UUGC 5EQLA 1IQYA 3ECFA 1JN5A 2XF3A 3RDEA 3CCM3 3I563 4J8TA 4BTWA 3CCQ3 3FGYA 5M19A 1O7PB 1FZUA 3LTAA 4OVMA 3N8BA 1BRNL 2C10A 1LQGC 4LSOA 5JBSA 1O7WB 5AIIA 3RNTA 4XB5A 1B2ZA 3L0RA 5FGOA 2BIRA 3G8ZA 1NB5I 3ROBA 2R41A 2KF6A 1GY7A 2GXFA 1N8R4 5D82A 3Q2PA 4X2HA 1YVBI 3DGNA 2BHMA 3OWYA 4ZM8A 3D9RA 1JV2B 2UX0A 3NM2A 1LOVA 5A0OB 2KAAA 1NO3A 3SXXA 2D1WA 1OPYA 2CKFB 1NWWA 2IYJA 2STDA 3VF1A 3HIGA 4J9AA 1QVF2 2CWVA 3OWUA 1W00A 3D4AA 4WWUC 3LH4A 2V1LA 3WHOA 3X3YA 4BTYA 3CC43 1VQ63 3EBYA 1A2KA 2YFJB 4O2HA 2IA7A 4BIRA 1D6YA 2MF7A 4EXRA 1LOWA 2XEPA 1BNJA 4R9KA 4O02B 2WGQA 1AV4A 1RN4A 4IT7A 1C7HA 1W01A 2CWUA 2F99A 2PNCA 1AQZA 1GD3A 2KF5A 3EX9A 2FXTA 1EA2A 1BRSA 3SOAA 1WMOA 1HYFA 1RSNA 2K3DA 1R4YA 3NXJA 4BL2A 3E99A 1BNIA 4RNYA 4OK0A 1EEJA 1HZ1A 2ML6A 3JVCA 4IPBA 1T3BA 1DMNA 1IVXA 3G16A 2W56A 3ER7A 2OTL3 2MC8A 1AVLA 5M1AA 3F8XA 5BXQA 5IG0A 6GSPA 5FW5A 1RNBA 2CG1A 1Z1SA 1GS3A 4N6UA 1E97A 3UNLA 4ORLA 1DVCA 3T8NA 2WO0A 1NJI4 3I553 2BT3A 3Q1CA 3MHEA 4EV2A 2GU3A 1VQ43 3F14A 3PS8A 3SOYA 1IQ8A 1DETA 2GBXB 5IG3A 3U97A 2H0HA 2FGTA 1S723 1VQK3 1EUIC 2CC3A 1UGIA 4MJDA 3BNCA 1OHPA 3KIIA 5CK6A 2CIUA 2P0XA 1WTHA 1W2ZA 2R4IA 3CCE3 3T0UA 4HYZA 3FCSB 1Q814 1TFOA 3GRDA 1C54A 3U1WA 3DMCA 3MWZA 4HM3B 1UCKA 4L8OA 1RGFA 3EC9A 9RNTA 3CPW2 2P05A 1B27A 1NDOB 1PYLA 3X3XA 2CFGA 3CCS3 3ALAA 4XBTA 2INXA
chains in the Genus database with same CATH topology
1IV9A 5BVBA 4O3VA 3PZWA 1WQLB 3MKIA 1YI23 5IW9A 3N9HA 2WOFA 1IT8A 2Y74A 3GZYB 2IUKA 4MMZB 5STDA 2E2TA 4KFDA 5AIFA 3KSED 3V99A 3FH1A 4WYKA 3G6E3 4LGQA 4LEHA 3HX8A 1IQXA 1OH0A 3WA3A 1VQO3 4H3UA 1EG9B 4HM5B 3SEDA 3EB8A 1Q40A 1O7NB 3AMOB 1K28A 1ULJB 2P38A 3FF0A 1W6YA 1JRQA 1TFKA 3NBBA 4HZBB 2QGUA 1GYBA 1JJ22 4K1UA 1IVWA 4HJLB 4K1VA 3N54B 1GY5A 5LC6A 2XH9A 3X3ZA 1NU3A 1O7GB 1BUQA 1OF5B 1IDPA 2JQ5A 1N9JA 2WOHA 3KKGA 1U5OA 3MG1A 2K0MA 2CH9A 3DGLA 3O8YA 3D3LA 3OV4A 3LXUX 4FMCA 3FG1A 4R80A 2QIYA 5D81A 3SVAA 4KVHA 2CG0A 2LQVA 3LT9A 3STDA 3FG3A 4NHFA 1KWIA 3GZXB 1J2BA 1Q7Y4 2CWTA 1VQ53 4HM2B 1N9EA 2YX9A 3DGMA 3NV0B 3IPTA 4GB5A 1CYVA 4HM0B 1V74A 1YJN3 3CMA3 3EN1B 1N8QA 1JKGA 3GZBA 5JPUA 3KE7A 2QA43 5CF2A 4MEIA 3H3HA 2GBWB 4RZMA 1JN5B 1OHSA 2BNGA 5IEOA 3NQZA 3EHCA 1W02A 1OCVA 3EQQB 1RRLA 3IJEB 5AEUB 1CEWI 4STDA 2OOVA 5ELJA 1ROVA 1WMPA 3S67A 3S29A 1STDA 3F40A 3WDGB 3CCV3 4N6V0 4XBXA 4LMIA 4N6OB 4NREA 1CYUA 1OACA 2KCDA 3QRDA 2ZDJA 3CD63 4GL6A 4XDVA 1EKMA 2Y73A 3CXC2 2OOVC 3CPOA 1PU4A 4N6TA 4N3VA 1TP6A 3KFQC 4FMDA 2Z7AA 1VQL3 4FR9A 1W2B2 1ROAA 1W6CA 1QALA 6STDA 1VQ73 4N6LA 3QK9A 1JB2A 2K54A 2SBLA 1GY6A 1F8NA 4U13A 4AEQA 1JB5A 3B7CA 2C11A 3FSDA 4HKVB 1QAFA 1DYUA 1LXEA 3I553 1YJ93 4BTXA 1K8A4 3LTCA 1M1K4 1FGOA 1SIHA 1FGRA 4EC6A 2BMQB 1RRHA 3LMLA 2HMNB 2P0MA 4WP5A 1EQKA 1ULIB 3CNMA 3JUPA 4KFEA 4XM4A 2W56B 2B1XB 1UI7A 4K90B 4MMXB 1YIJ3 1S5AA 3CC73 2F98A 3V92A 2RSXA 4AKYA 1K734 2Z6BA 3JUMA 3IMAB 3CNXA 2PZVA 2ML5A 3BNBA 3B4PA 4H61A 4FMBA 5DREA 2W04A 1WMNA 4QWTA 4AKZA 2YFIB 1FGMA 3WMDA 5IENA 3KSPA 1LNHA 1STFI 4HM8B 1M9GA 1UUVB 1OGXA 4HM6B 1L5GB 3TDGA 2CFDA 5IG4A 3WA2X 1QJGA 2OQEA 4CDLA 3HIIA 3FF2A 3PYJA 4K61A 1IT7A 3WODG 3FG4A 2HMKB 1UUWB 3EF8A 1N5PA 3UJMA 3DY5A 1SIIA 2CFKA 2I9WA 3CCJ3 2E2UA 4KFFA 3CCL3 2GU1A 5AEWB 1VQM3 1Q824 3HZPA 3NBRA 1QVG2 1KQS2 3S5CA 1ZO2A 3KN4A 5DRVA 1NB3I 3F7XA 2OQEC 2XFTA 3LTDA 1OUNA 3PXMA 4WHAA 3K0ZA 5IF6A 4O8SA 1G96A 2O3OA 2RCDA 3WOEB 2W6JH 1PFPA 1D6UA 4R4KA 4WYKB 4HZ9B 4PEJA 1W7CA 3OX9A 2FNQA 1AR0A 5CLKA 1T5YA 2E2VA 2O9UX 1QAKA 3K9MC 5AI1A 2CFWA 3F7SA 2RFRA 1FGQA 3FKAA 1JB4A 1Q40B 1JNQA 5KP3A 2KRTA 1W6GA 4I4KA 3JUNA 3K5TA 5AYRB 4EBGA 3LZAA 1O7MB 1SPUA 3DXOA 3BNDA 1Y4KA 1K9M4 2CFLA 1Q42A 1VQN3 1U8CB 3HK4A 1TIJA 2XSHB 3A76A 2HMMB 1HKXA 2P09A 4FCZA 1SQWA 4LZIA 1MOLA 1FGTA 2IMJA 5LC7A 5TGNA 5IEPA 2XRXB 4IIAA 3V98A 3MYTA 2OTJ3 1IVUA 1A2VA 5AYSC 3MG2A 3NX0A 2OCTA 3CCU3 3PCRA 3S28A 3PGBA 1O7HB 4RNZA 4EV5A 4HM7B 1IVVA 3EBTA 3BNEA 3F9SA 4FCMA 2B24B 1A90A 5KP1A 1IU7A 1DMQA 3B8LA 3WOFB 1VZZA 1ISKA 1JKGB 5AIHA 3G4S3 2RGQA 3BB9A 3S27A 3T8UA 1US1A 3UL5A 3X40A 7STDA 3DGOA 3FZWA 1DVDA 2XGNA 1E3VA 1MNLA 2W0QA 2HMJB 2XFSA 1KD14 4OUQA 2BO9B 1YIT3 2BMRB 5HGRA 2M7OA 3CU3A 3X41A 1VQ83 1D6ZA 2CK3H 5EEOA 1QMAA 3Q90A 1VQ93 3JUQA 2ZL8A 1TUHA 3CCR3 4XDWA 1WNHA 3K7CA 5JPPA 1E3RA 4L7KA 2L4VA 5KP4A 3HI7A 3JUOA 1LOXA 1YGEA 3DM8A 5AIGA 1TU5A 5ELUA 4RBNA 4CCVA 8CHOA 2IUJA 3LTBA 3LT8A 1CQSA 3NM7A 3PCSA 3OXAA 3G713 1VQP3 4Q53A 2F86B 3EN8A 3FLJA 1GD4A 1RN7A 3NQYA 3DUKA 1W4NA 3EJVA 1ZX2A 4L8PA 1YJW3 1UI8A 5CXOA 1M1XB 3GAXA 1K41A 1KSIA 4MMYB 5CF1A 1W5ZA 3OWSA 2XSOB 3UL6A 3LOYA 3UB1A 4FCJA 1KC84 3H51A 1LVNA 3G0KA 3X42A 3SX1A 2W2CA 1OGZA 1R4CA 2W9PA 3CC23 2GEYA 1SJWA 2Z77A 3GZRA 5EVHA 2W03A 3MPHA 1OHOA 3F8HA 5IG5A 2A15A 3GWRA 2YFLB 2XR8B 3RGAA 3MG3A 4HM1B 2KXGA 2OWPA 3AMOA 2QEX3 1AVKA 4XBYA 2HMOB 5I97A 3J7Yd 4HM4B 4N6MA 3VSYA 3B4OA 4G1MB 2BMOB 1IV7A 1RKYA 2D42A 3OW22 2GEXA 1FA3A 4R9LA 1Q864 2WGOA 4WFOA 5D83A 3EE1A 2W9QA 3DZLA 3SLUA 4JRFA 1OF5A 1DMMA 2Z76A 3VGNA 1YHQ3 3M8CA 3LYGA 4N6NB 4JF8A 2HMLB 1ASKA 1UW1A 3NBJA 2LYXA 4R1KA 3K63A 4HVNA 4HBRA 3BLZA 4FMAA 3CME3 1HU9A 2JDIH 2Q07A 5G2GA 1FUWA 1RJOA 1N5HA 4EYCA 1A67A 3NV0A 3I0YA 3MSOA 3NUVA 3KZTA 2CW9A 3NHXA 4TX4A 1M904 2CHCA 1IK3A 4X2OA 5IERA 2XGLA 3RGRA 4KZ1A 5EQLA 1IQYA 3ECFA 1JN5A 2XF3A 3RDEA 3CCM3 3I563 4J8TA 4BTWA 3CCQ3 3FGYA 1O7PB 3LTAA 4OVMA 3N8BA 2C10A 4LSOA 5JBSA 1O7WB 5AIIA 4XB5A 3L0RA 5FGOA 3G8ZA 1NB5I 3ROBA 1GY7A 2GXFA 1N8R4 5D82A 3Q2PA 4X2HA 1YVBI 3DGNA 2BHMA 3OWYA 4ZM8A 3D9RA 1JV2B 2UX0A 3NM2A 5A0OB 1NO3A 3SXXA 2D1WA 1OPYA 2CKFB 1NWWA 2STDA 3VF1A 3HIGA 4J9AA 1QVF2 2CWVA 3OWUA 1W00A 4WWUC 3X3YA 3LH4A 2V1LA 4BTYA 1VQ63 3CC43 3EBYA 1A2KA 2YFJB 4O2HA 2IA7A 1D6YA 2MF7A 4EXRA 2XEPA 4R9KA 4O02B 2WGQA 1AV4A 4IT7A 1C7HA 1W01A 2CWUA 2F99A 2PNCA 1GD3A 3EX9A 2FXTA 1EA2A 3SOAA 1WMOA 3NXJA 3E99A 4RNYA 4OK0A 3JVCA 2ML6A 4IPBA 1DMNA 1IVXA 3G16A 2W56A 3ER7A 2OTL3 2MC8A 1AVLA 3F8XA 5BXQA 5IG0A 5FW5A 2CG1A 1Z1SA 1GS3A 4N6UA 1E97A 3UNLA 4ORLA 1DVCA 3T8NA 2WO0A 1NJI4 2BT3A 3Q1CA 3MHEA 4EV2A 2GU3A 1VQ43 3F14A 3PS8A 3SOYA 1IQ8A 2GBXB 5IG3A 3U97A 2FGTA 1S723 1VQK3 2CC3A 4MJDA 3BNCA 1OHPA 3KIIA 5CK6A 2CIUA 2P0XA 1WTHA 1W2ZA 2R4IA 3CCE3 3T0UA 4HYZA 3FCSB 1Q814 1TFOA 3GRDA 3U1WA 3DMCA 3MWZA 4HM3B 4L8OA 3EC9A 3CPW2 2P05A 1NDOB 3X3XA 2CFGA 3CCS3 3ALAA 4XBTA 2INXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV9 A;  1LXE A;  1FUW A;  1A90 A;  1N5H A;  4EYC A;  1A67 A;  1EQK A;  4TX4 A;  5EQL A;  3UL5 A;  3KSE D;  1DVD A;  1MNL A;  3IMA B;  2BO9 B;  3L0R A;  1NB5 I;  1WNH A;  5LC6 A;  3Q2P A;  1YVB I;  4ZM8 A;  5A0O B;  1STF I;  1M9G A;  5ELU A;  4CCV A;  1N9J A;  3PYJ A;  2CH9 A;  3LH4 A;  1GD4 A;  1N5P A;  1RN7 A;  3SVA A;  4IT7 A;  1KWI A;  1NB3 I;  3GAX A;  3UL6 A;  1GD3 A;  1CYV A;  3PXM A;  1G96 A;  1R4C A;  1PFP A;  2W9P A;  3K9M C;  2O9U X;  1CEW I;  4N6U A;  1DVC A;  5ELJ A;  3S67 A;  2KXG A;  4N6V 0;  4N6O B;  3PS8 A;  1CYU A;  3QRD A;  4N6M A;  1IV7 A;  1TIJ A;  1FA3 A;  4N6T A;  2W9Q A;  3KFQ C;  4LZI A;  1MOL A;  1ROA A;  5LC7 A;  3MWZ A;  4N6N B;  4N6L A;  3NX0 A;  2OCT A; 
#chains in the Genus database with same CATH topology
 1LOY A;  1IV9 A;  5BVB A;  4O3V A;  3PZW A;  7RNT A;  1YGW A;  1WQL B;  3MKI A;  1YI2 3;  1Q9E A;  5IW9 A;  3N9H A;  2WOF A;  1IT8 A;  2Y74 A;  1FUT A;  3GZY B;  2IUK A;  4MMZ B;  5STD A;  2E2T A;  4KFD A;  1X1Y A;  1YJ9 3;  5AIF A;  3KSE D;  3V99 A;  3FH1 A;  4WYK A;  1I2F A;  3G6E 3;  4LGQ A;  4LEH A;  3HX8 A;  1IQX A;  1OH0 A;  1RN1 A;  3WA3 A;  8RNT A;  1VQO 3;  4H3U A;  3A5E A;  1EG9 B;  3AGN A;  4HM5 B;  3SED A;  3EB8 A;  2CX1 A;  1Q40 A;  1O7N B;  3AMO B;  1K28 A;  1ULJ B;  2P38 A;  3FF0 A;  1W6Y A;  1JRQ A;  1TFK A;  1TRP A;  3NBB A;  4HZB B;  1AY7 A;  1ZS7 A;  2QGU A;  1FUS A;  1GYB A;  1JJ2 2;  4K1U A;  1BNG A;  1BNE A;  1IVW A;  4HJL B;  4K1V A;  3N54 B;  1GY5 A;  5LC6 A;  2XH9 A;  3X3Z A;  1X1X A;  1GOY A;  1NU3 A;  1O7G B;  1BUQ A;  3D79 A;  1OF5 B;  1IDP A;  2JQ5 A;  1N9J A;  2WOH A;  3KKG A;  1U5O A;  1BSB A;  3MG1 A;  2K0M A;  2CH9 A;  3DGL A;  3O8Y A;  3D3L A;  3OV4 A;  3D5G A;  3LXU X;  4FMC A;  3FG1 A;  4R80 A;  2QIY A;  5D81 A;  3HOH A;  5GSP A;  3SVA A;  4KVH A;  2GSP A;  2CG0 A;  2LQV A;  3LT9 A;  3STD A;  3FG3 A;  4NHF A;  1KWI A;  3GZX B;  1J2B A;  1RGC A;  2CWT A;  4HAA A;  4ILF A;  1Q7Y 4;  4HM2 B;  1VQ5 3;  1N9E A;  2YX9 A;  4CJN A;  3DGM A;  1BOX A;  3NV0 B;  3IPT A;  4GB5 A;  1CYV A;  4HM0 B;  1V74 A;  1YJN 3;  1X1W A;  2KF4 A;  3CMA 3;  3EN1 B;  1N8Q A;  1JKG A;  3GZB A;  5JPU A;  3KE7 A;  2QA4 3;  5CF2 A;  1B3S A;  4MEI A;  3D5I A;  1MWT A;  1MWU A;  3H3H A;  2GBW B;  1JBT A;  1JZO A;  4RZM A;  1JN5 B;  1OHS A;  5BU4 A;  1BNF A;  2BNG A;  3URP A;  5IEO A;  3NQZ A;  3EHC A;  1W02 A;  1B2M A;  1GMR A;  1OCV A;  3EQQ B;  1RRL A;  3IJE B;  5AEU B;  1CEW I;  4STD A;  2OOV A;  5ELJ A;  1ROV A;  1WMP A;  3S67 A;  3S29 A;  1STD A;  3F40 A;  3WDG B;  3CCV 3;  1DE3 A;  1YVS A;  4N6V 0;  4XBX A;  1GOV A;  4LMI A;  4N6O B;  1TRQ A;  4NRE A;  1CYU A;  1RLS A;  1OAC A;  2KCD A;  3QRD A;  2ZDJ A;  3CD6 3;  1V58 A;  2F56 A;  4GL6 A;  4XDV A;  1BIR A;  1UCI A;  1EKM A;  2Y73 A;  3DH2 A;  3CXC 2;  2OOV C;  3CPO A;  3BU4 A;  1PU4 A;  1B2X A;  1BRK A;  4N3V A;  4N6T A;  5M18 A;  1TP6 A;  3KFQ C;  4FMD A;  2Z7A A;  1VQL 3;  4FR9 A;  1W2B 2;  1PY3 A;  1RGK A;  1ROA A;  1I2G A;  1W6C A;  4CPK A;  1T2H A;  1QAL A;  6STD A;  1VQQ A;  1VQ7 3;  4N6L A;  3QK9 A;  1JB2 A;  1BSC A;  1I0V A;  2K54 A;  2SBL A;  1GY6 A;  1F8N A;  3BIR A;  4U13 A;  4AEQ A;  1B2S A;  1JB5 A;  3B7C A;  2C11 A;  3FSD A;  4HKV B;  1QAF A;  1DYU A;  1LXE A;  1CH0 A;  2H0I A;  4RNT A;  4BTX A;  3LTC A;  1K8A 4;  1M1K 4;  1FGO A;  1SIH A;  1FGR A;  4EC6 A;  2BMQ B;  2F5W A;  1RRH A;  5G1K A;  1G0T A;  2HMN B;  2P0M A;  3LML A;  4WP5 A;  1EQK A;  4EW5 A;  1ULI B;  3CNM A;  4KT3 B;  2AAD A;  3DGY A;  3JUP A;  4HOH A;  1ZGX A;  4KFE A;  4XM4 A;  2W56 B;  2B1X B;  1UI7 A;  4K90 B;  4MMX B;  1YIJ 3;  1S5A A;  3SYU A;  3CC7 3;  2AAE A;  2F98 A;  3V92 A;  2RSX A;  1UCL A;  4AKY A;  1K73 4;  2Z6B A;  3JUM A;  4J5K A;  3IMA B;  3CNX A;  2PZV A;  2ML5 A;  1FYS A;  5RNT A;  3BNB A;  3B4P A;  6RNT A;  1BRJ A;  4FMB A;  4H61 A;  5DRE A;  2L1S A;  2W04 A;  1WMN A;  4QWT A;  4AKZ A;  2BU4 A;  1A2P A;  2YFI B;  1FGM A;  3WMD A;  5IEN A;  1BRH A;  1RGH A;  1BNR A;  1BSD A;  3KSP A;  1LNH A;  1RMS A;  1BAN A;  1STF I;  4HM8 B;  1M9G A;  1UUV B;  1OGX A;  4HM6 B;  1L5G B;  3TDG A;  1LQM B;  2CFD A;  5IG4 A;  3WA2 X;  1QJG A;  2OQE A;  2KF3 A;  3HII A;  4CDL A;  3FF2 A;  3PYJ A;  4K61 A;  1RHL A;  1IT7 A;  3WOD G;  3FG4 A;  1MGR A;  2HMK B;  1UUW B;  3EF8 A;  1N5P A;  3UJM A;  3DY5 A;  1SII A;  2CFK A;  2I9W A;  3CCJ 3;  2E2U A;  4KFF A;  3CCL 3;  2GU1 A;  5AEW B;  1VQM 3;  1Q82 4;  3HZP A;  3NBR A;  1QVG 2;  1KQS 2;  3S5C A;  1ZO2 A;  3KN4 A;  5DRV A;  1NB3 I;  3F7X A;  2OQE C;  2UGI A;  2XFT A;  3LTD A;  1I8V A;  1OUN A;  3PXM A;  1GMQ A;  4WHA A;  1TTO A;  3K0Z A;  5IF6 A;  4O8S A;  1G96 A;  2O3O A;  1MWS A;  1V57 A;  1BSA A;  2RCD A;  2W6J H;  3WOE B;  1PFP A;  1BSE A;  1BGS A;  1D6U A;  4R4K A;  4HZ9 B;  4WYK B;  4PEJ A;  1W7C A;  3OX9 A;  2FNQ A;  1AR0 A;  2J8X B;  3Q3F A;  2F4Y A;  5CLK A;  1T5Y A;  2E2V A;  2O9U X;  1QAK A;  3K9M C;  4I5Q A;  2CFW A;  1UCJ A;  3F7S A;  2RFR A;  5AI1 A;  1FGQ A;  3FKA A;  1JB4 A;  1Q40 B;  1JNQ A;  1YNV X;  5KP3 A;  4GSP A;  2KRT A;  1W6G A;  4I4K A;  1I70 A;  3JUN A;  3K5T A;  5AYR B;  4EBG A;  3LZA A;  1O7M B;  1SPU A;  3DXO A;  3BND A;  1Y4K A;  1K9M 4;  2CFL A;  1Q42 A;  1VQN 3;  1X1U A;  1U8C B;  1RGE A;  1TIJ A;  2XSH B;  3A76 A;  3HK4 A;  1BAO A;  1LRA A;  2HMM B;  1HKX A;  1G02 A;  2P09 A;  1Q7H A;  2IY2 A;  4FCZ A;  1SQW A;  4LZI A;  1MOL A;  2H0G A;  1B21 A;  1FGT A;  1IYY A;  2IMJ A;  5LC7 A;  5TGN A;  5IEP A;  2XRX B;  4IIA A;  3V98 A;  3MYT A;  2OTJ 3;  1IVU A;  1A2V A;  5AYS C;  3MG2 A;  3NX0 A;  2OCT A;  3CCU 3;  3PCR A;  5HOH A;  1NNV A;  3S28 A;  1RDS A;  3PGB A;  1GSP A;  1O7H B;  4RNZ A;  4EV5 A;  4HM7 B;  1IVV A;  3EBT A;  1T2I A;  2F5M A;  3BNE A;  3F9S A;  3AHW A;  2B24 B;  4FCM A;  1A90 A;  5KP1 A;  1IU7 A;  1DMQ A;  3B8L A;  3WOF B;  1VZZ A;  3GSP A;  4DKI A;  1ISK A;  1JKG B;  5AIH A;  1BU4 A;  3G4S 3;  1RTU A;  2RGQ A;  3WR2 A;  4J5G A;  1BVI A;  3BB9 A;  7GSP A;  3S27 A;  3T8U A;  1US1 A;  3UL5 A;  3X40 A;  7STD A;  3DGO A;  3FZW A;  1DVD A;  1RCK A;  2XGN A;  1E3V A;  1MNL A;  1UGH I;  2W0Q A;  3AGO A;  2HMJ B;  3AHS A;  2XFS A;  1KD1 4;  1JZD A;  4OUQ A;  2BO9 B;  1YIT 3;  2BMR B;  5HGR A;  2M7O A;  3CU3 A;  3X41 A;  1VQ8 3;  1D6Z A;  2CK3 H;  3KCH A;  5EEO A;  1QMA A;  3Q90 A;  1VQ9 3;  3JUQ A;  2ZL8 A;  1TUH A;  3CCR 3;  1JBS A;  4XDW A;  1WNH A;  3K7C A;  5JPP A;  1E3R A;  4L7K A;  2L4V A;  1TJD A;  5KP4 A;  3HI7 A;  3JUO A;  1LOX A;  1YGE A;  3DM8 A;  5AIG A;  1TU5 A;  5ELU A;  4RBN A;  4CCV A;  8CHO A;  1JBR A;  2C4B A;  3LTB A;  1RGA A;  3LT8 A;  1CQS A;  2IUJ A;  3NM7 A;  3PCS A;  3OXA A;  1I3I A;  3G71 3;  5BIR A;  1VQP 3;  4Q53 A;  2F86 B;  3EN8 A;  4NPB A;  3FLJ A;  4GHO A;  1GD4 A;  1RGG A;  1RN7 A;  3NQY A;  1BRI A;  3DUK A;  3ZFZ A;  1W4N A;  2CX0 A;  2HOH A;  1ZX2 A;  3EJV A;  2ZA4 A;  2RNT A;  4L8P A;  1YJW 3;  1UI8 A;  5CXO A;  1M1X B;  3GAX A;  1K41 A;  1KSI A;  4MMY B;  5CF1 A;  1W5Z A;  3OWS A;  2XSO B;  3UL6 A;  1UUG B;  3LOY A;  3UB1 A;  4FCJ A;  1KC8 4;  1BUJ A;  3H51 A;  1LVN A;  3G0K A;  3X42 A;  3SX1 A;  2W2C A;  1OGZ A;  1R4C A;  1I3F A;  2W9P A;  3CC2 3;  1MWR A;  2GEY A;  1SJW A;  2Z77 A;  3GZR A;  5EVH A;  2W03 A;  3MPH A;  1OHO A;  1MGW A;  3F8H A;  5IG5 A;  2A15 A;  2RBI A;  3GWR A;  2YFL B;  2XR8 B;  3RGA A;  3MG3 A;  4HM1 B;  2KXG A;  4BU4 A;  2OWP A;  1FW7 A;  1BRG A;  3AMO A;  4BL3 A;  1AVK A;  2QEX 3;  4XBY A;  2SAR A;  2HMO B;  5I97 A;  3J7Y d;  4HM4 B;  1RCL A;  4N6M A;  3VSY A;  3B4O A;  4G1M B;  2BMO B;  1B2U A;  1IV7 A;  1RKY A;  2D42 A;  3OW2 2;  1RNT A;  2GEX A;  1FA3 A;  4R9L A;  1Q86 4;  2WGO A;  1BNS A;  1I0X A;  4WFO A;  5D83 A;  3ZG0 A;  3EE1 A;  2W9Q A;  3DZL A;  3SLU A;  4JRF A;  1OF5 A;  1DMM A;  2Z76 A;  3VGN A;  1YHQ 3;  3M8C A;  1RGL A;  1SAR A;  3LYG A;  1GOU A;  4N6N B;  4JF8 A;  2HML B;  1ASK A;  1UW1 A;  2ZHX B;  2LYX A;  3NBJ A;  4LYL B;  3K63 A;  4R1K A;  4HVN A;  1GMP A;  1B20 A;  1UDI I;  1LNI A;  4HBR A;  3BLZ A;  4FMA A;  3CME 3;  1HU9 A;  2JDI H;  2Q07 A;  5G2G A;  1FUW A;  1RJO A;  1N5H A;  4EYC A;  1A67 A;  5G1L A;  1I2E A;  3NV0 A;  3I0Y A;  3MSO A;  3NUV A;  3KZT A;  2CW9 A;  3NHX A;  4TX4 A;  3ZG5 A;  2CHC A;  1IK3 A;  1M90 4;  4X2O A;  5IER A;  2XGL A;  3RGR A;  4KZ1 A;  2UUG C;  5EQL A;  1IQY A;  3ECF A;  1JN5 A;  2XF3 A;  3RDE A;  3CCM 3;  3I56 3;  4J8T A;  4BTW A;  3CCQ 3;  3FGY A;  5M19 A;  1O7P B;  1FZU A;  3LTA A;  4OVM A;  3N8B A;  1BRN L;  2C10 A;  1LQG C;  4LSO A;  5JBS A;  1O7W B;  5AII A;  3RNT A;  4XB5 A;  1B2Z A;  3L0R A;  5FGO A;  2BIR A;  3G8Z A;  1NB5 I;  3ROB A;  2R41 A;  2KF6 A;  1GY7 A;  2GXF A;  1N8R 4;  5D82 A;  3Q2P A;  4X2H A;  1YVB I;  3DGN A;  2BHM A;  3OWY A;  4ZM8 A;  3D9R A;  1JV2 B;  2UX0 A;  3NM2 A;  1LOV A;  5A0O B;  2KAA A;  1NO3 A;  3SXX A;  2D1W A;  1OPY A;  2CKF B;  1NWW A;  2IYJ A;  2STD A;  3VF1 A;  3HIG A;  4J9A A;  1QVF 2;  2CWV A;  3OWU A;  1W00 A;  3D4A A;  4WWU C;  3LH4 A;  2V1L A;  3WHO A;  3X3Y A;  4BTY A;  3CC4 3;  1VQ6 3;  3EBY A;  1A2K A;  2YFJ B;  4O2H A;  2IA7 A;  4BIR A;  1D6Y A;  2MF7 A;  4EXR A;  1LOW A;  2XEP A;  1BNJ A;  4R9K A;  4O02 B;  2WGQ A;  1AV4 A;  1RN4 A;  4IT7 A;  1C7H A;  1W01 A;  2CWU A;  2F99 A;  2PNC A;  1AQZ A;  1GD3 A;  2KF5 A;  3EX9 A;  2FXT A;  1EA2 A;  1BRS A;  3SOA A;  1WMO A;  1HYF A;  1RSN A;  2K3D A;  1R4Y A;  3NXJ A;  4BL2 A;  3E99 A;  1BNI A;  4RNY A;  4OK0 A;  1EEJ A;  1HZ1 A;  2ML6 A;  3JVC A;  4IPB A;  1T3B A;  1DMN A;  1IVX A;  3G16 A;  2W56 A;  3ER7 A;  2OTL 3;  2MC8 A;  1AVL A;  5M1A A;  3F8X A;  5BXQ A;  5IG0 A;  6GSP A;  5FW5 A;  1RNB A;  2CG1 A;  1Z1S A;  1GS3 A;  4N6U A;  1E97 A;  3UNL A;  4ORL A;  1DVC A;  3T8N A;  2WO0 A;  1NJI 4;  3I55 3;  2BT3 A;  3Q1C A;  3MHE A;  4EV2 A;  2GU3 A;  1VQ4 3;  3F14 A;  3PS8 A;  3SOY A;  1IQ8 A;  1DET A;  2GBX B;  5IG3 A;  3U97 A;  2H0H A;  2FGT A;  1S72 3;  1VQK 3;  1EUI C;  2CC3 A;  1UGI A;  4MJD A;  3BNC A;  1OHP A;  3KII A;  5CK6 A;  2CIU A;  2P0X A;  1WTH A;  1W2Z A;  2R4I A;  3CCE 3;  3T0U A;  4HYZ A;  3FCS B;  1Q81 4;  1TFO A;  3GRD A;  1C54 A;  3U1W A;  3DMC A;  3MWZ A;  4HM3 B;  1UCK A;  4L8O A;  1RGF A;  3EC9 A;  9RNT A;  3CPW 2;  2P05 A;  1B27 A;  1NDO B;  1PYL A;  3X3X A;  2CFG A;  3CCS 3;  3ALA A;  4XBT A;  2INX A; 
#chains in the Genus database with same CATH homology
 1IV9 A;  5BVB A;  4O3V A;  3PZW A;  1WQL B;  3MKI A;  1YI2 3;  5IW9 A;  3N9H A;  2WOF A;  1IT8 A;  2Y74 A;  3GZY B;  2IUK A;  4MMZ B;  5STD A;  2E2T A;  4KFD A;  5AIF A;  3KSE D;  3V99 A;  3FH1 A;  4WYK A;  3G6E 3;  4LGQ A;  4LEH A;  3HX8 A;  1IQX A;  1OH0 A;  3WA3 A;  1VQO 3;  4H3U A;  1EG9 B;  4HM5 B;  3SED A;  3EB8 A;  1Q40 A;  1O7N B;  3AMO B;  1K28 A;  1ULJ B;  2P38 A;  3FF0 A;  1W6Y A;  1JRQ A;  1TFK A;  3NBB A;  4HZB B;  2QGU A;  1GYB A;  1JJ2 2;  4K1U A;  1IVW A;  4HJL B;  4K1V A;  3N54 B;  1GY5 A;  5LC6 A;  2XH9 A;  3X3Z A;  1NU3 A;  1O7G B;  1BUQ A;  1OF5 B;  1IDP A;  2JQ5 A;  1N9J A;  2WOH A;  3KKG A;  1U5O A;  3MG1 A;  2K0M A;  2CH9 A;  3DGL A;  3O8Y A;  3D3L A;  3OV4 A;  3LXU X;  4FMC A;  3FG1 A;  4R80 A;  2QIY A;  5D81 A;  3SVA A;  4KVH A;  2CG0 A;  2LQV A;  3LT9 A;  3STD A;  3FG3 A;  4NHF A;  1KWI A;  3GZX B;  1J2B A;  1Q7Y 4;  2CWT A;  1VQ5 3;  4HM2 B;  1N9E A;  2YX9 A;  3DGM A;  3NV0 B;  3IPT A;  4GB5 A;  1CYV A;  4HM0 B;  1V74 A;  1YJN 3;  3CMA 3;  3EN1 B;  1N8Q A;  1JKG A;  3GZB A;  5JPU A;  3KE7 A;  2QA4 3;  5CF2 A;  4MEI A;  3H3H A;  2GBW B;  4RZM A;  1JN5 B;  1OHS A;  2BNG A;  5IEO A;  3NQZ A;  3EHC A;  1W02 A;  1OCV A;  3EQQ B;  1RRL A;  3IJE B;  5AEU B;  1CEW I;  4STD A;  2OOV A;  5ELJ A;  1ROV A;  1WMP A;  3S67 A;  3S29 A;  1STD A;  3F40 A;  3WDG B;  3CCV 3;  4N6V 0;  4XBX A;  4LMI A;  4N6O B;  4NRE A;  1CYU A;  1OAC A;  2KCD A;  3QRD A;  2ZDJ A;  3CD6 3;  4GL6 A;  4XDV A;  1EKM A;  2Y73 A;  3CXC 2;  2OOV C;  3CPO A;  1PU4 A;  4N6T A;  4N3V A;  1TP6 A;  3KFQ C;  4FMD A;  2Z7A A;  1VQL 3;  4FR9 A;  1W2B 2;  1ROA A;  1W6C A;  1QAL A;  6STD A;  1VQ7 3;  4N6L A;  3QK9 A;  1JB2 A;  2K54 A;  2SBL A;  1GY6 A;  1F8N A;  4U13 A;  4AEQ A;  1JB5 A;  3B7C A;  2C11 A;  3FSD A;  4HKV B;  1QAF A;  1DYU A;  1LXE A;  3I55 3;  1YJ9 3;  4BTX A;  1K8A 4;  3LTC A;  1M1K 4;  1FGO A;  1SIH A;  1FGR A;  4EC6 A;  2BMQ B;  1RRH A;  3LML A;  2HMN B;  2P0M A;  4WP5 A;  1EQK A;  1ULI B;  3CNM A;  3JUP A;  4KFE A;  4XM4 A;  2W56 B;  2B1X B;  1UI7 A;  4K90 B;  4MMX B;  1YIJ 3;  1S5A A;  3CC7 3;  2F98 A;  3V92 A;  2RSX A;  4AKY A;  1K73 4;  2Z6B A;  3JUM A;  3IMA B;  3CNX A;  2PZV A;  2ML5 A;  3BNB A;  3B4P A;  4H61 A;  4FMB A;  5DRE A;  2W04 A;  1WMN A;  4QWT A;  4AKZ A;  2YFI B;  1FGM A;  3WMD A;  5IEN A;  3KSP A;  1LNH A;  1STF I;  4HM8 B;  1M9G A;  1UUV B;  1OGX A;  4HM6 B;  1L5G B;  3TDG A;  2CFD A;  5IG4 A;  3WA2 X;  1QJG A;  2OQE A;  4CDL A;  3HII A;  3FF2 A;  3PYJ A;  4K61 A;  1IT7 A;  3WOD G;  3FG4 A;  2HMK B;  1UUW B;  3EF8 A;  1N5P A;  3UJM A;  3DY5 A;  1SII A;  2CFK A;  2I9W A;  3CCJ 3;  2E2U A;  4KFF A;  3CCL 3;  2GU1 A;  5AEW B;  1VQM 3;  1Q82 4;  3HZP A;  3NBR A;  1QVG 2;  1KQS 2;  3S5C A;  1ZO2 A;  3KN4 A;  5DRV A;  1NB3 I;  3F7X A;  2OQE C;  2XFT A;  3LTD A;  1OUN A;  3PXM A;  4WHA A;  3K0Z A;  5IF6 A;  4O8S A;  1G96 A;  2O3O A;  2RCD A;  3WOE B;  2W6J H;  1PFP A;  1D6U A;  4R4K A;  4WYK B;  4HZ9 B;  4PEJ A;  1W7C A;  3OX9 A;  2FNQ A;  1AR0 A;  5CLK A;  1T5Y A;  2E2V A;  2O9U X;  1QAK A;  3K9M C;  5AI1 A;  2CFW A;  3F7S A;  2RFR A;  1FGQ A;  3FKA A;  1JB4 A;  1Q40 B;  1JNQ A;  5KP3 A;  2KRT A;  1W6G A;  4I4K A;  3JUN A;  3K5T A;  5AYR B;  4EBG A;  3LZA A;  1O7M B;  1SPU A;  3DXO A;  3BND A;  1Y4K A;  1K9M 4;  2CFL A;  1Q42 A;  1VQN 3;  1U8C B;  3HK4 A;  1TIJ A;  2XSH B;  3A76 A;  2HMM B;  1HKX A;  2P09 A;  4FCZ A;  1SQW A;  4LZI A;  1MOL A;  1FGT A;  2IMJ A;  5LC7 A;  5TGN A;  5IEP A;  2XRX B;  4IIA A;  3V98 A;  3MYT A;  2OTJ 3;  1IVU A;  1A2V A;  5AYS C;  3MG2 A;  3NX0 A;  2OCT A;  3CCU 3;  3PCR A;  3S28 A;  3PGB A;  1O7H B;  4RNZ A;  4EV5 A;  4HM7 B;  1IVV A;  3EBT A;  3BNE A;  3F9S A;  4FCM A;  2B24 B;  1A90 A;  5KP1 A;  1IU7 A;  1DMQ A;  3B8L A;  3WOF B;  1VZZ A;  1ISK A;  1JKG B;  5AIH A;  3G4S 3;  2RGQ A;  3BB9 A;  3S27 A;  3T8U A;  1US1 A;  3UL5 A;  3X40 A;  7STD A;  3DGO A;  3FZW A;  1DVD A;  2XGN A;  1E3V A;  1MNL A;  2W0Q A;  2HMJ B;  2XFS A;  1KD1 4;  4OUQ A;  2BO9 B;  1YIT 3;  2BMR B;  5HGR A;  2M7O A;  3CU3 A;  3X41 A;  1VQ8 3;  1D6Z A;  2CK3 H;  5EEO A;  1QMA A;  3Q90 A;  1VQ9 3;  3JUQ A;  2ZL8 A;  1TUH A;  3CCR 3;  4XDW A;  1WNH A;  3K7C A;  5JPP A;  1E3R A;  4L7K A;  2L4V A;  5KP4 A;  3HI7 A;  3JUO A;  1LOX A;  1YGE A;  3DM8 A;  5AIG A;  1TU5 A;  5ELU A;  4RBN A;  4CCV A;  8CHO A;  2IUJ A;  3LTB A;  3LT8 A;  1CQS A;  3NM7 A;  3PCS A;  3OXA A;  3G71 3;  1VQP 3;  4Q53 A;  2F86 B;  3EN8 A;  3FLJ A;  1GD4 A;  1RN7 A;  3NQY A;  3DUK A;  1W4N A;  3EJV A;  1ZX2 A;  4L8P A;  1YJW 3;  1UI8 A;  5CXO A;  1M1X B;  3GAX A;  1K41 A;  1KSI A;  4MMY B;  5CF1 A;  1W5Z A;  3OWS A;  2XSO B;  3UL6 A;  3LOY A;  3UB1 A;  4FCJ A;  1KC8 4;  3H51 A;  1LVN A;  3G0K A;  3X42 A;  3SX1 A;  2W2C A;  1OGZ A;  1R4C A;  2W9P A;  3CC2 3;  2GEY A;  1SJW A;  2Z77 A;  3GZR A;  5EVH A;  2W03 A;  3MPH A;  1OHO A;  3F8H A;  5IG5 A;  2A15 A;  3GWR A;  2YFL B;  2XR8 B;  3RGA A;  3MG3 A;  4HM1 B;  2KXG A;  2OWP A;  3AMO A;  2QEX 3;  1AVK A;  4XBY A;  2HMO B;  5I97 A;  3J7Y d;  4HM4 B;  4N6M A;  3VSY A;  3B4O A;  4G1M B;  2BMO B;  1IV7 A;  1RKY A;  2D42 A;  3OW2 2;  2GEX A;  1FA3 A;  4R9L A;  1Q86 4;  2WGO A;  4WFO A;  5D83 A;  3EE1 A;  2W9Q A;  3DZL A;  3SLU A;  4JRF A;  1OF5 A;  1DMM A;  2Z76 A;  3VGN A;  1YHQ 3;  3M8C A;  3LYG A;  4N6N B;  4JF8 A;  2HML B;  1ASK A;  1UW1 A;  3NBJ A;  2LYX A;  4R1K A;  3K63 A;  4HVN A;  4HBR A;  3BLZ A;  4FMA A;  3CME 3;  1HU9 A;  2JDI H;  2Q07 A;  5G2G A;  1FUW A;  1RJO A;  1N5H A;  4EYC A;  1A67 A;  3NV0 A;  3I0Y A;  3MSO A;  3NUV A;  3KZT A;  2CW9 A;  3NHX A;  4TX4 A;  1M90 4;  2CHC A;  1IK3 A;  4X2O A;  5IER A;  2XGL A;  3RGR A;  4KZ1 A;  5EQL A;  1IQY A;  3ECF A;  1JN5 A;  2XF3 A;  3RDE A;  3CCM 3;  3I56 3;  4J8T A;  4BTW A;  3CCQ 3;  3FGY A;  1O7P B;  3LTA A;  4OVM A;  3N8B A;  2C10 A;  4LSO A;  5JBS A;  1O7W B;  5AII A;  4XB5 A;  3L0R A;  5FGO A;  3G8Z A;  1NB5 I;  3ROB A;  1GY7 A;  2GXF A;  1N8R 4;  5D82 A;  3Q2P A;  4X2H A;  1YVB I;  3DGN A;  2BHM A;  3OWY A;  4ZM8 A;  3D9R A;  1JV2 B;  2UX0 A;  3NM2 A;  5A0O B;  1NO3 A;  3SXX A;  2D1W A;  1OPY A;  2CKF B;  1NWW A;  2STD A;  3VF1 A;  3HIG A;  4J9A A;  1QVF 2;  2CWV A;  3OWU A;  1W00 A;  4WWU C;  3X3Y A;  3LH4 A;  2V1L A;  4BTY A;  1VQ6 3;  3CC4 3;  3EBY A;  1A2K A;  2YFJ B;  4O2H A;  2IA7 A;  1D6Y A;  2MF7 A;  4EXR A;  2XEP A;  4R9K A;  4O02 B;  2WGQ A;  1AV4 A;  4IT7 A;  1C7H A;  1W01 A;  2CWU A;  2F99 A;  2PNC A;  1GD3 A;  3EX9 A;  2FXT A;  1EA2 A;  3SOA A;  1WMO A;  3NXJ A;  3E99 A;  4RNY A;  4OK0 A;  3JVC A;  2ML6 A;  4IPB A;  1DMN A;  1IVX A;  3G16 A;  2W56 A;  3ER7 A;  2OTL 3;  2MC8 A;  1AVL A;  3F8X A;  5BXQ A;  5IG0 A;  5FW5 A;  2CG1 A;  1Z1S A;  1GS3 A;  4N6U A;  1E97 A;  3UNL A;  4ORL A;  1DVC A;  3T8N A;  2WO0 A;  1NJI 4;  2BT3 A;  3Q1C A;  3MHE A;  4EV2 A;  2GU3 A;  1VQ4 3;  3F14 A;  3PS8 A;  3SOY A;  1IQ8 A;  2GBX B;  5IG3 A;  3U97 A;  2FGT A;  1S72 3;  1VQK 3;  2CC3 A;  4MJD A;  3BNC A;  1OHP A;  3KII A;  5CK6 A;  2CIU A;  2P0X A;  1WTH A;  1W2Z A;  2R4I A;  3CCE 3;  3T0U A;  4HYZ A;  3FCS B;  1Q81 4;  1TFO A;  3GRD A;  3U1W A;  3DMC A;  3MWZ A;  4HM3 B;  4L8O A;  3EC9 A;  3CPW 2;  2P05 A;  1NDO B;  3X3X A;  2CFG A;  3CCS 3;  3ALA A;  4XBT A;  2INX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...