4CCVA

Crystal structure of histidine-rich glycoprotein n2 domain reveals redox activity at an interdomain disulfide bridge: implications for the regulation of angiogenesis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
SPVLFDFIEDTEPFRKSADKALEVYKSESEAYASFRVDRVERVTRVKGGERTNYYVDFSVRNCSRSHFHRHPAFGFCRADLSFDVEASNLENPEDVIISCEVFNFEEHGNISGFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords HISTIDINE-RICH GLYCOPROTEIN
publication title Crystal Structure of Histidine-Rich Glycoprotein N2 Domain Reveals Redox Activity at an Interdomain Disulfide Bridge: Implications for Angiogenic Regulation.
pubmed doi rcsb
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ccvA00
1N5PA 2KXGA 1DVCA 4N6UA 3SVAA 3MWZA 1NB5I 3IMAB 1EQKA 3K9MC 1N5HA 2W9QA 1MOLA 1IV7A 1CYVA 4LZIA 4TX4A 1M9GA 1STFI 3QRDA 1MNLA 1TIJA 1IV9A 4N6OB 1KWIA 1FA3A 5A0OB 5LC7A 1R4CA 3PXMA 1PFPA 3UL6A 4EYCA 3NX0A 3KSED 4ZM8A 1A67A 4IT7A 2BO9B 5ELJA 5LC6A 1A90A 4N6LA 5EQLA 1N9JA 1FUWA 2W9PA 1G96A 3S67A 4N6V0 1DVDA 3LH4A 3PYJA 4CCVA 1WNHA 3Q2PA 1GD4A 1YVBI 3L0RA 2CH9A 1ROAA 5ELUA 2O9UX 3UL5A 4N6TA 1CEWI 2OCTA 3KFQC 1CYUA 1GD3A 3GAXA 4N6NB 4N6MA 1LXEA 1NB3I 1RN7A 3PS8A
chains in the Genus database with same CATH superfamily
4J5GA 1YI23 1VQQA 3VF1A 1BU4A 2AAEA 3HK4A 4HM7B 1BRKA 1K734 3FH1A 1DVCA 3G713 4FCZA 1W02A 2IY2A 5EVHA 4NREA 1JJ22 3SVAA 5FGOA 1PY3A 3MWZA 1BNSA 1NB5I 3EHCA 3WHOA 1Q824 2L4VA 2IA7A 1LOVA 1OF5B 3K63A 4HM5B 1QVF2 1OUNA 1JBSA 3X3YA 1RGCA 1ROVA 1ASKA 1DMMA 1CYVA 3U97A 3JUMA 1X1XA 4XB5A 1QMAA 1VQP3 1M1XB 1RGHA 3JUNA 3HI7A 1STFI 3FZWA 3LTCA 9RNTA 1VQ93 1MNLA 1T2IA 3EN1B 1TTOA 3N54B 1Q9EA 2XGLA 1BOXA 1SIIA 3MG2A 1B2SA 1ULIB 4FMCA 1KWIA 3GWRA 4H61A 1EG9B 3EBYA 5AEUB 1TU5A 1FA3A 1Y4KA 1A2VA 3NBBA 5A0OB 2IUKA 3MSOA 2Y73A 1STDA 3GSPA 2XSOB 1RGAA 3CCV3 3U1WA 2P38A 3Q3FA 1OACA 3NBJA 1S723 1AY7A 1PFPA 3LXUX 1EKMA 2XFTA 3VSYA 5BXQA 3SEDA 1VQ63 1I70A 3JUPA 1HYFA 4R4KA 3F9SA 1RGFA 1RKYA 3NM2A 1W6YA 3LOYA 1GOVA 2STDA 2UGIA 4MMZB 1DYUA 4FCMA 5DREA 1A67A 1GS3A 1JV2B 1BSAA 5IENA 3JUOA 2W56A 2ZHXB 1RGLA 5EQLA 2ML6A 2XFSA 4BIRA 2OTJ3 1B2MA 2OWPA 4L7KA 5CK6A 1DETA 3T8UA 1JB2A 1LOXA 4EV5A 2LQVA 3S67A 4DKIA 1OGXA 1FGTA 2WO0A 3E99A 2K54A 2YFIB 1GMQA 5HOHA 1W2B2 3PCRA 1K41A 1VZZA 2UX0A 2HMMB 3EQQB 3DY5A 5M1AA 2CW9A 1BGSA 1FW7A 1R4YA 3K7CA 4KZ1A 5IERA 3CCQ3 3VGNA 1W6GA 2QEX3 3CD63 1LOWA 4HM8B 1JRQA 3D5GA 1WNHA 1IT8A 2LYXA 2SBLA 1YHQ3 1QJGA 3DMCA 3PZWA 4CJNA 2P0MA 3NQZA 3GRDA 1GD4A 3UNLA 2W6JH 1RDSA 1GSPA 3OX9A 2CG0A 3KZTA 1T3BA 4O8SA 5CF2A 3F7SA 1ROAA 2XF3A 3O8YA 3X3XA 5ELUA 3OWYA 5JPPA 2HMJB 1W7CA 1ULJB 1VQ43 5AYRB 3UL5A 3FG1A 2CG1A 1O7PB 2OCTA 3GZXB 4N6TA 2E2TA 4U13A 2IMJA 4O02B 1NJI4 3AHWA 4CDLA 6GSPA 3OXAA 3AGOA 3RGRA 1QALA 4N6MA 5CF1A 2R4IA 1MWSA 1LXEA 3CCL3 2XH9A 3CCU3 1RGKA 1C54A 2INXA 3FG3A 3BU4A 1ZGXA 1O7MB 1LNIA 3ZFZA 5BU4A 1T5YA 3I563 5RNTA 3X41A 3A5EA 1YJ93 2F98A 2ZDJA 1Q40B 1K8A4 4XDVA 4I5QA 3LT9A 3IMAB 3DGNA 2C10A 1N5HA 4OVMA 2HMLB 2GXFA 4NHFA 2F56A 1W2ZA 3CCJ3 1RCKA 7RNTA 4HM1B 1BNIA 2RFRA 3NHXA 1X1UA 1I2GA 1OPYA 4LZIA 2OQEC 3CME3 1VQ73 1FGMA 1M9GA 1BUQA 3NUVA 1BRGA 1UCIA 2KF6A 5IG0A 2CX0A 2J8XB 5AIFA 4FMDA 2CWTA 3F7XA 5EEOA 3RGAA 1IV9A 3FF2A 5STDA 1WMNA 1SIHA 1TUHA 3DGOA 3SOAA 5G1KA 3CCM3 3CMA3 2SARA 5AIGA 1E3RA 3DUKA 3LTAA 5CXOA 4BU4A 3X40A 3G4S3 1UGHI 3FF0A 3WDGB 1YJW3 4XM4A 3KSPA 1BNRA 3FKAA 4XDWA 3OV4A 1R4CA 1CQSA 2Z76A 2H0HA 6STDA 3GZBA 1BSCA 1HKXA 3WA3A 4Q53A 1GOUA 2CHCA 4WHAA 1V57A 2GU1A 5AIIA 1PU4A 1TP6A 3KIIA 1IDPA 1I8VA 3NX0A 1TJDA 2ZL8A 1BNEA 2QIYA 1GY7A 1M904 1I2EA 2P05A 4RNYA 3NBRA 3CCE3 1IU7A 1EUIC 1OHPA 4IT7A 4EC6A 3TDGA 5AI1A 1VQM3 3CNXA 1A90A 1W5ZA 4MMXB 2HMOB 2K0MA 8CHOA 1YGEA 1N9JA 1F8NA 5D82A 1FUWA 1W6CA 4XBTA 2MC8A 5D81A 2GBXB 4BL2A 4L8OA 3ROBA 1I0XA 4FR9A 2GU3A 3FGYA 1B27A 4HOHA 2F86B 2Z7AA 3I553 4J8TA 3D4AA 3HIGA 1BUJA 1KQS2 1DVDA 2W56B 1WQLB 3DXOA 1TFOA 3N8BA 3V98A 3FLJA 1YVSA 1UCLA 3NQYA 1DMNA 1UUWB 1IT7A 1AQZA 4HM2B 2H0GA 3AHSA 1KD14 7GSPA 5IW9A 1IVWA 4K1UA 2CFLA 3LT8A 3DGMA 1LVNA 1JBTA 1GYBA 3Q2PA 2FGTA 1TRQA 1BSEA 4H3UA 3Q1CA 7STDA 4R9LA 1YVBI 1FZUA 2XGNA 3L0RA 1O7NB 3S29A 1AVLA 1BSBA 2FNQA 2PNCA 3BNDA 2BNGA 3DH2A 4HYZA 3EX9A 2Z6BA 1D6UA 2CX1A 2OQEA 1AVKA 2BT3A 4R80A 1ZS7A 2WOFA 1UGIA 4FMAA 3SYUA 1LQMB 3WR2A 2CWVA 1CYUA 1GMPA 1GD3A 3SLUA 2A15A 1B20A 4O2HA 5KP3A 3M8CA 2YFLB 2ML5A 2XEPA 3ZG0A 1N8R4 2M7OA 1NB3I 1RN7A 1SQWA 4HJLB 4XBXA 3WODG 2BMRB 3EC9A 1IQYA 1WMPA 5HGRA 2L1SA 3K0ZA 1K9M4 1N5PA 2MF7A 1FUTA 3PCSA 4HZ9B 4N6UA 1D6ZA 1JKGA 1NNVA 3MKIA 3X3ZA 1B2UA 1TFKA 3CU3A 3PGBA 3EBTA 3MHEA 2JQ5A 4MJDA 1EQKA 3K9MC 2CFWA 1I3IA 1I2FA 3OWUA 3IPTA 2OOVA 4GHOA 3KKGA 1OGZA 1E97A 3B8LA 2FXTA 4RBNA 1RSNA 1NO3A 1RGGA 5AYSC 3BNEA 1MOLA 1RJOA 3V92A 1IYYA 1Q7Y4 3B4PA 2HMKB 2CFGA 5M18A 1KC84 1RRLA 2C4BA 3JUQA 3I0YA 1GOYA 4EW5A 3LMLA 4RNTA 1MGWA 1O7WB 1FYSA 1RGEA 2CC3A 2W04A 3S28A 1OCVA 4X2OA 4J9AA 1RNBA 3HZPA 3F8HA 4WP5A 4WYKA 3CC43 4IIAA 2GEXA 1MGRA 5LC7A 1UUGB 3F40A 1W00A 1Q814 3OWSA 1IK3A 3PXMA 1NDOB 2E2VA 3UL6A 2P0XA 3NM7A 3SX1A 4EYCA 1JZOA 1O7HB 3D3LA 3WA2X 1JB5A 4R1KA 5IF6A 2YFJB 2BU4A 1W4NA 2RCDA 3G8ZA 1MWUA 1UCKA 1GY5A 2QGUA 2BO9B 2CIUA 5ELJA 1G0TA 1W01A 2CKFB 5LC6A 1MWTA 4N6LA 1JN5A 3SOYA 2HMNB 2W03A 3DZLA 2AADA 3GZRA 2KAAA 4JRFA 1G96A 1N8QA 1BRJA 1D6YA 1Z1SA 3AGNA 5DRVA 1EA2A 4HVNA 3UJMA 1VQN3 2E2UA 1BRNL 1HU9A 1RRHA 4N6V0 3J7Yd 2RSXA 3STDA 3HX8A 3B7CA 3BIRA 2GEYA 3G0KA 3KE7A 4BL3A 4N3VA 1V58A 2CWUA 5AIHA 4O3VA 5CLKA 1AV4A 4BTWA 2CFDA 4HAAA 3WMDA 1M1K4 3CNMA 1FGQA 1TRPA 1RHLA 1OHSA 2F5WA 2RNTA 1HZ1A 1UW1A 3NV0A 1IVUA 3EB8A 3PYJA 4LYLB 4CCVA 1E3VA 2BHMA 4WFOA 2OOVC 3LTDA 3QK9A 4BTYA 5KP1A 2IUJA 2IYJA 3CCS3 1VQL3 4I4KA 1FGOA 2D1WA 4OK0A 2OTL3 3CPW2 4XBYA 3FSDA 1OHOA 1GMRA 1PYLA 4K61A 3S27A 1VQO3 1RCLA 1L5GB 1K28A 3D5IA 4IPBA 3DGLA 2KF4A 1LQGC 4X2HA 4RZMA 2WGQA 1NWWA 1US1A 1DE3A 1UI8A 5TGNA 4NPBA 3ZG5A 3KFQC 4K90B 2B24B 2RBIA 4HM6B 5IEOA 1SPUA 1V74A 1A2KA 1UI7A 3T0UA 5I97A 1NU3A 4KFDA 1GY6A 3F8XA 1BRIA 1YJN3 4HBRA 2I9WA 1MWRA 4EBGA 1JBRA 4HKVB 5IG5A 1WTHA 3WOFB 1QAFA 3URPA 3IJEB 3KCHA 3ECFA 4ORLA 1OF5A 3EJVA 1VQ83 2KXGA 1YIT3 5IG3A 1U5OA 2XR8B 3OW22 3EE1A 4R9KA 4HM0B 2P09A 1RMSA 1AR0A 2BMOB 1UDII 1FUSA 1BRSA 1UUVB 3S5CA 3CCR3 1RNTA 3Q90A 3D79A 1JB4A 1QAKA 1X1YA 1ZO2A 6RNTA 1J2BA 4OUQA 1JNQA 4GSPA 4EV2A 3K5TA 1EEJA 1SJWA 4QWTA 1IQ8A 3FG4A 2KCDA 3N9HA 2KRTA 1B2ZA 2RGQA 1VQK3 2W9QA 3DGYA 1X1WA 3BNCA 1IV7A 1CH0A 1JKGB 1RN4A 4TX4A 4HZBB 5BVBA 4J5KA 1S5AA 1BSDA 2BIRA 4HM4B 3QRDA 4HM3B 4K1VA 5GSPA 3CC73 4KFFA 1TIJA 3EN8A 4JF8A 4N6OB 3RNTA 5JBSA 1WMOA 4FCJA 2Q07A 1YGWA 3MPHA 1N9EA 1BIRA 2XSHB 1IVVA 2QA43 1I3FA 4GL6A 3LZAA 1BANA 4G1MB 4KT3B 4LGQA 3V99A 3ER7A 2W0QA 5KP4A 4L8PA 2KF5A 4MMYB 3D9RA 1YIJ3 2D42A 5FW5A 4KVHA 1YNVX 2Y74A 3B4OA 4LEHA 4WWUC 5IG4A 2F5MA 3LTBA 1OH0A 2KF3A 3G16A 3H3HA 1Q864 3KSED 4ZM8A 3BNBA 4WYKB 2O3OA 5JPUA 3WOEB 2GSPA 1ZX2A 5BIRA 1LOYA 1B21A 3T8NA 1SARA 3SXXA 2PZVA 1LRAA 1U8CB 4ILFA 3CC23 1JZDA 2W9PA 1Q42A 4AEQA 2V1LA 1G02A 1FGRA 2ZA4A 2B1XB 1BNJA 3HOHA 2HOHA 1B2XA 3BLZA 1T2HA 1ISKA 3G6E3 3HIIA 2GBWB 2JDIH 1JN5B 2BMQB 1RN1A 2UUGC 3LH4A 2Z77A 2CK3H 4BTXA 3GZYB 1UCJA 2WGOA 4EXRA 1Q7HA 2XRXB 1BRHA 3AMOB 3CPOA 3FCSB 3KN4A 3MG1A 2F99A 5M19A 1RTUA 1BNGA 1LNHA 2CFKA 2R41A 1DMQA 3X42A 1QVG2 1O7GB 1B3SA 1VQ53 4LSOA 3CXC2 3H51A 1BNFA 4CPKA 1IQXA 2C11A 2CH9A 3BB9A 2WOHA 5G1LA 5G2GA 4AKZA 1RLSA 2YX9A 2O9UX 3ALAA 3A76A 3AMOA 4RNZA 4STDA 3NXJA 8RNTA 5AEWB 3NV0B 4AKYA 2F4YA 1CEWI 4GB5A 2K3DA 3LYGA 1A2PA 4FMBA 3GAXA 2H0IA 1BAOA 1Q40A 3MG3A 4N6NB 1C7HA 3MYTA 1IVXA 1KSIA 4KFEA 4MEIA 4LMIA 5D83A 1BVIA 3EF8A 3DM8A 2W2CA 5IEPA 1I0VA 4PEJA 3RDEA 3UB1A 3JVCA 3PS8A 3F14A
chains in the Genus database with same CATH topology
1YI23 3VF1A 3HK4A 4HM7B 1K734 3FH1A 1DVCA 3G713 4FCZA 1W02A 5EVHA 4NREA 3SVAA 5FGOA 3MWZA 1NB5I 3EHCA 1Q824 2L4VA 2IA7A 1OF5B 3K63A 4HM5B 1QVF2 1OUNA 3X3YA 1ROVA 1ASKA 1DMMA 1CYVA 3U97A 3JUMA 4XB5A 1QMAA 1VQP3 1M1XB 3JUNA 3HI7A 1STFI 3FZWA 3LTCA 1VQ93 1MNLA 3EN1B 3N54B 2XGLA 1SIIA 3MG2A 1ULIB 4FMCA 1KWIA 3GWRA 4H61A 1EG9B 3EBYA 5AEUB 1TU5A 1FA3A 1Y4KA 1A2VA 3NBBA 5A0OB 2IUKA 3MSOA 2Y73A 1STDA 2XSOB 3CCV3 3U1WA 2P38A 1OACA 3NBJA 3LXUX 1PFPA 1EKMA 2XFTA 3VSYA 5BXQA 3SEDA 1VQ63 3JUPA 4R4KA 3F9SA 1RKYA 3NM2A 1W6YA 3LOYA 2STDA 4MMZB 1DYUA 4FCMA 5DREA 1A67A 1GS3A 1JV2B 5IENA 3JUOA 2W56A 5EQLA 2ML6A 2XFSA 2OTJ3 2OWPA 4L7KA 5CK6A 3T8UA 4EV5A 1JB2A 1LOXA 2LQVA 3S67A 1OGXA 1FGTA 2WO0A 3E99A 2K54A 2YFIB 1W2B2 3PCRA 1K41A 1VZZA 2UX0A 2HMMB 3EQQB 3DY5A 2CW9A 3K7CA 4KZ1A 5IERA 3VGNA 1W6GA 2QEX3 3CD63 4HM8B 1JRQA 1WNHA 1IT8A 2LYXA 2SBLA 1YHQ3 1QJGA 3DMCA 3PZWA 2P0MA 3NQZA 3GRDA 1GD4A 3UNLA 2W6JH 3OX9A 2CG0A 3KZTA 4O8SA 5CF2A 3F7SA 1ROAA 2XF3A 3O8YA 3X3XA 5ELUA 3OWYA 5JPPA 2HMJB 1W7CA 1ULJB 1VQ43 5AYRB 3UL5A 3FG1A 2CG1A 1O7PB 2OCTA 3GZXB 4N6TA 2E2TA 4U13A 2IMJA 4O02B 1NJI4 4CDLA 3OXAA 3RGRA 1QALA 4N6MA 5CF1A 2R4IA 1LXEA 3CCL3 2XH9A 3CCU3 2INXA 3FG3A 1O7MB 1T5YA 3I563 3X41A 1YJ93 2F98A 2ZDJA 1Q40B 1K8A4 4XDVA 3LT9A 3IMAB 3DGNA 2C10A 1N5HA 4OVMA 2HMLB 2GXFA 4NHFA 1W2ZA 3CCJ3 4HM1B 2RFRA 3NHXA 1OPYA 4LZIA 3CME3 2OQEC 1VQ73 1FGMA 1M9GA 1BUQA 3NUVA 5IG0A 5AIFA 4FMDA 2CWTA 3F7XA 5EEOA 3RGAA 1IV9A 3FF2A 5STDA 1WMNA 1SIHA 1TUHA 3DGOA 3SOAA 3CCM3 3CMA3 5AIGA 1E3RA 3DUKA 3LTAA 5CXOA 3G4S3 3X40A 3FF0A 3WDGB 1YJW3 4XM4A 3KSPA 3FKAA 4XDWA 3OV4A 1R4CA 1CQSA 2Z76A 6STDA 3GZBA 1HKXA 3WA3A 4Q53A 2CHCA 4WHAA 2GU1A 5AIIA 1PU4A 1TP6A 3KIIA 1IDPA 3NX0A 2ZL8A 2QIYA 1M904 1GY7A 2P05A 4RNYA 3NBRA 3CCE3 1IU7A 1OHPA 4IT7A 4EC6A 3TDGA 5AI1A 1VQM3 3CNXA 1A90A 1W5ZA 4MMXB 2HMOB 2K0MA 8CHOA 1YGEA 1N9JA 1F8NA 5D82A 1FUWA 1W6CA 4XBTA 2MC8A 5D81A 2GBXB 4L8OA 3ROBA 4FR9A 2GU3A 3FGYA 3I553 2F86B 2Z7AA 4J8TA 3HIGA 1KQS2 1DVDA 2W56B 1WQLB 3DXOA 1TFOA 3N8BA 3V98A 3FLJA 3NQYA 1DMNA 1UUWB 1IT7A 4HM2B 1KD14 5IW9A 1IVWA 4K1UA 2CFLA 3LT8A 3DGMA 1LVNA 1GYBA 3Q2PA 2FGTA 4H3UA 3Q1CA 7STDA 4R9LA 1YVBI 2XGNA 3L0RA 1O7NB 3S29A 1AVLA 2FNQA 4HYZA 2PNCA 3BNDA 2BNGA 3EX9A 2Z6BA 1D6UA 2OQEA 1AVKA 2BT3A 4R80A 2WOFA 4FMAA 2CWVA 1CYUA 1GD3A 3SLUA 2A15A 4O2HA 5KP3A 3M8CA 2YFLB 2ML5A 2XEPA 1N8R4 2M7OA 1NB3I 1RN7A 1SQWA 4HJLB 4XBXA 3WODG 2BMRB 3EC9A 1IQYA 1WMPA 5HGRA 3K0ZA 1K9M4 1N5PA 2MF7A 3PCSA 4HZ9B 4N6UA 1D6ZA 1JKGA 3MKIA 3X3ZA 1TFKA 3CU3A 3PGBA 3EBTA 3MHEA 2JQ5A 4MJDA 1EQKA 3K9MC 2CFWA 3OWUA 3IPTA 2OOVA 3KKGA 1OGZA 1E97A 3B8LA 2FXTA 4RBNA 1NO3A 5AYSC 3BNEA 1MOLA 1RJOA 3V92A 1Q7Y4 3B4PA 2HMKB 2CFGA 1KC84 1RRLA 3JUQA 3I0YA 3LMLA 1O7WB 2CC3A 2W04A 3S28A 1OCVA 4X2OA 4J9AA 3HZPA 3F8HA 4WP5A 4WYKA 3CC43 4IIAA 2GEXA 5LC7A 3F40A 1W00A 1Q814 3OWSA 1IK3A 3PXMA 1NDOB 2E2VA 3UL6A 2P0XA 3NM7A 3SX1A 4EYCA 1O7HB 3D3LA 3WA2X 1JB5A 4R1KA 5IF6A 2YFJB 1W4NA 2RCDA 3G8ZA 1GY5A 2QGUA 2BO9B 2CIUA 5ELJA 1W01A 2CKFB 5LC6A 4N6LA 1JN5A 3SOYA 2HMNB 2W03A 3DZLA 3GZRA 4JRFA 1G96A 1N8QA 1D6YA 1Z1SA 3UJMA 1VQN3 5DRVA 1EA2A 4HVNA 2E2UA 1HU9A 1RRHA 4N6V0 3J7Yd 2RSXA 3STDA 3HX8A 3B7CA 2GEYA 3G0KA 3KE7A 4N3VA 2CWUA 5AIHA 4O3VA 5CLKA 1AV4A 4BTWA 2CFDA 3WMDA 1M1K4 3CNMA 1FGQA 3NV0A 1OHSA 3PYJA 4HKVB 4CCVA 1UW1A 1S723 1IVUA 3EB8A 5KP1A 1E3VA 2BHMA 4WFOA 2OOVC 3LTDA 3QK9A 4BTYA 2IUJA 3CCS3 1VQL3 4I4KA 1FGOA 2D1WA 4OK0A 2OTL3 3CPW2 4XBYA 3FSDA 1OHOA 1VQO3 4K61A 3S27A 1L5GB 1K28A 4IPBA 3DGLA 4X2HA 4RZMA 2WGQA 1NWWA 1US1A 1UI8A 5TGNA 3CCQ3 3KFQC 4K90B 2B24B 4HM6B 5IEOA 1SPUA 1V74A 1A2KA 1UI7A 3T0UA 5I97A 1NU3A 4KFDA 1GY6A 3F8XA 1YJN3 4HBRA 2I9WA 4EBGA 5IG5A 1WTHA 3WOFB 1QAFA 3IJEB 4ORLA 3ECFA 1OF5A 3EJVA 1VQ83 2KXGA 1YIT3 5IG3A 1U5OA 2XR8B 3OW22 3EE1A 4R9KA 4HM0B 2P09A 1AR0A 2BMOB 1UUVB 3S5CA 3CCR3 3Q90A 1JB4A 1QAKA 1ZO2A 1J2BA 4OUQA 1JNQA 4EV2A 3K5TA 1SJWA 4QWTA 1IQ8A 3FG4A 2KCDA 3N9HA 2KRTA 2RGQA 1VQK3 2W9QA 3BNCA 1IV7A 1JKGB 4TX4A 4HZBB 5BVBA 1S5AA 4HM4B 3QRDA 4HM3B 4K1VA 3CC73 4KFFA 1TIJA 3EN8A 4JF8A 4N6OB 5JBSA 1WMOA 4FCJA 2Q07A 3MPHA 1N9EA 2XSHB 1IVVA 2QA43 4GL6A 3LZAA 4G1MB 4LGQA 3V99A 3ER7A 2W0QA 5KP4A 4L8PA 4MMYB 3D9RA 1YIJ3 2D42A 5FW5A 4KVHA 2Y74A 3B4OA 4LEHA 4WWUC 5IG4A 3LTBA 1OH0A 3G16A 3H3HA 1Q864 3KSED 4ZM8A 3BNBA 4WYKB 2O3OA 5JPUA 3WOEB 1ZX2A 3T8NA 3SXXA 2PZVA 1U8CB 3CC23 2W9PA 1Q42A 4AEQA 2V1LA 1FGRA 2B1XB 3BLZA 1ISKA 3G6E3 3HIIA 2GBWB 2JDIH 1JN5B 2BMQB 3LH4A 2Z77A 2CK3H 4BTXA 3GZYB 2WGOA 4EXRA 3AMOB 2XRXB 3FCSB 3KN4A 3CPOA 3MG1A 2F99A 1LNHA 2CFKA 1DMQA 3X42A 1QVG2 1O7GB 1VQ53 4LSOA 3CXC2 3H51A 1IQXA 2C11A 2CH9A 3BB9A 2WOHA 5G2GA 4AKZA 2YX9A 1JJ22 2O9UX 3ALAA 3A76A 3AMOA 4RNZA 4STDA 3NXJA 5AEWB 3NV0B 4AKYA 1CEWI 4GB5A 3LYGA 4FMBA 3GAXA 3MG3A 1Q40A 4N6NB 5D83A 1C7HA 3MYTA 1IVXA 1KSIA 4KFEA 4MEIA 4LMIA 3EF8A 3DM8A 2W2CA 5IEPA 4PEJA 3RDEA 3UB1A 3JVCA 3PS8A 3F14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5P A;  2KXG A;  1DVC A;  4N6U A;  3SVA A;  3MWZ A;  1NB5 I;  3IMA B;  1EQK A;  3K9M C;  1N5H A;  2W9Q A;  1MOL A;  1IV7 A;  1CYV A;  4LZI A;  4TX4 A;  1M9G A;  1STF I;  3QRD A;  1MNL A;  1TIJ A;  1IV9 A;  4N6O B;  1KWI A;  1FA3 A;  5A0O B;  5LC7 A;  1R4C A;  3PXM A;  1PFP A;  3UL6 A;  4EYC A;  3NX0 A;  3KSE D;  4ZM8 A;  1A67 A;  4IT7 A;  2BO9 B;  5ELJ A;  5LC6 A;  1A90 A;  4N6L A;  5EQL A;  1N9J A;  1FUW A;  2W9P A;  1G96 A;  3S67 A;  4N6V 0;  1DVD A;  3LH4 A;  3PYJ A;  4CCV A;  1WNH A;  3Q2P A;  1GD4 A;  1YVB I;  3L0R A;  2CH9 A;  1ROA A;  5ELU A;  2O9U X;  3UL5 A;  4N6T A;  1CEW I;  2OCT A;  3KFQ C;  1CYU A;  1GD3 A;  3GAX A;  4N6N B;  4N6M A;  1LXE A;  1NB3 I;  1RN7 A;  3PS8 A; 
#chains in the Genus database with same CATH topology
 4J5G A;  1YI2 3;  1VQQ A;  3VF1 A;  1BU4 A;  2AAE A;  3HK4 A;  4HM7 B;  1BRK A;  1K73 4;  3FH1 A;  1DVC A;  3G71 3;  4FCZ A;  1W02 A;  2IY2 A;  5EVH A;  4NRE A;  1JJ2 2;  3SVA A;  5FGO A;  1PY3 A;  3MWZ A;  1BNS A;  1NB5 I;  3EHC A;  3WHO A;  1Q82 4;  2L4V A;  2IA7 A;  1LOV A;  1OF5 B;  3K63 A;  4HM5 B;  1QVF 2;  1OUN A;  1JBS A;  3X3Y A;  1RGC A;  1ROV A;  1ASK A;  1DMM A;  1CYV A;  3U97 A;  3JUM A;  1X1X A;  4XB5 A;  1QMA A;  1VQP 3;  1M1X B;  1RGH A;  3JUN A;  3HI7 A;  1STF I;  3FZW A;  3LTC A;  9RNT A;  1VQ9 3;  1MNL A;  1T2I A;  3EN1 B;  1TTO A;  3N54 B;  1Q9E A;  2XGL A;  1BOX A;  1SII A;  3MG2 A;  1B2S A;  1ULI B;  4FMC A;  1KWI A;  3GWR A;  4H61 A;  1EG9 B;  3EBY A;  5AEU B;  1TU5 A;  1FA3 A;  1Y4K A;  1A2V A;  3NBB A;  5A0O B;  2IUK A;  3MSO A;  2Y73 A;  1STD A;  3GSP A;  2XSO B;  1RGA A;  3CCV 3;  3U1W A;  2P38 A;  3Q3F A;  1OAC A;  3NBJ A;  1S72 3;  1AY7 A;  1PFP A;  3LXU X;  1EKM A;  2XFT A;  3VSY A;  5BXQ A;  3SED A;  1VQ6 3;  1I70 A;  3JUP A;  1HYF A;  4R4K A;  3F9S A;  1RGF A;  1RKY A;  3NM2 A;  1W6Y A;  3LOY A;  1GOV A;  2STD A;  2UGI A;  4MMZ B;  1DYU A;  4FCM A;  5DRE A;  1A67 A;  1GS3 A;  1JV2 B;  1BSA A;  5IEN A;  3JUO A;  2W56 A;  2ZHX B;  1RGL A;  5EQL A;  2ML6 A;  2XFS A;  4BIR A;  2OTJ 3;  1B2M A;  2OWP A;  4L7K A;  5CK6 A;  1DET A;  3T8U A;  1JB2 A;  1LOX A;  4EV5 A;  2LQV A;  3S67 A;  4DKI A;  1OGX A;  1FGT A;  2WO0 A;  3E99 A;  2K54 A;  2YFI B;  1GMQ A;  5HOH A;  1W2B 2;  3PCR A;  1K41 A;  1VZZ A;  2UX0 A;  2HMM B;  3EQQ B;  3DY5 A;  5M1A A;  2CW9 A;  1BGS A;  1FW7 A;  1R4Y A;  3K7C A;  4KZ1 A;  5IER A;  3CCQ 3;  3VGN A;  1W6G A;  2QEX 3;  3CD6 3;  1LOW A;  4HM8 B;  1JRQ A;  3D5G A;  1WNH A;  1IT8 A;  2LYX A;  2SBL A;  1YHQ 3;  1QJG A;  3DMC A;  3PZW A;  4CJN A;  2P0M A;  3NQZ A;  3GRD A;  1GD4 A;  3UNL A;  2W6J H;  1RDS A;  1GSP A;  3OX9 A;  2CG0 A;  3KZT A;  1T3B A;  4O8S A;  5CF2 A;  3F7S A;  1ROA A;  2XF3 A;  3O8Y A;  3X3X A;  5ELU A;  3OWY A;  5JPP A;  2HMJ B;  1W7C A;  1ULJ B;  1VQ4 3;  5AYR B;  3UL5 A;  3FG1 A;  2CG1 A;  1O7P B;  2OCT A;  3GZX B;  4N6T A;  2E2T A;  4U13 A;  2IMJ A;  4O02 B;  1NJI 4;  3AHW A;  4CDL A;  6GSP A;  3OXA A;  3AGO A;  3RGR A;  1QAL A;  4N6M A;  5CF1 A;  2R4I A;  1MWS A;  1LXE A;  3CCL 3;  2XH9 A;  3CCU 3;  1RGK A;  1C54 A;  2INX A;  3FG3 A;  3BU4 A;  1ZGX A;  1O7M B;  1LNI A;  3ZFZ A;  5BU4 A;  1T5Y A;  3I56 3;  5RNT A;  3X41 A;  3A5E A;  1YJ9 3;  2F98 A;  2ZDJ A;  1Q40 B;  1K8A 4;  4XDV A;  4I5Q A;  3LT9 A;  3IMA B;  3DGN A;  2C10 A;  1N5H A;  4OVM A;  2HML B;  2GXF A;  4NHF A;  2F56 A;  1W2Z A;  3CCJ 3;  1RCK A;  7RNT A;  4HM1 B;  1BNI A;  2RFR A;  3NHX A;  1X1U A;  1I2G A;  1OPY A;  4LZI A;  2OQE C;  3CME 3;  1VQ7 3;  1FGM A;  1M9G A;  1BUQ A;  3NUV A;  1BRG A;  1UCI A;  2KF6 A;  5IG0 A;  2CX0 A;  2J8X B;  5AIF A;  4FMD A;  2CWT A;  3F7X A;  5EEO A;  3RGA A;  1IV9 A;  3FF2 A;  5STD A;  1WMN A;  1SIH A;  1TUH A;  3DGO A;  3SOA A;  5G1K A;  3CCM 3;  3CMA 3;  2SAR A;  5AIG A;  1E3R A;  3DUK A;  3LTA A;  5CXO A;  4BU4 A;  3X40 A;  3G4S 3;  1UGH I;  3FF0 A;  3WDG B;  1YJW 3;  4XM4 A;  3KSP A;  1BNR A;  3FKA A;  4XDW A;  3OV4 A;  1R4C A;  1CQS A;  2Z76 A;  2H0H A;  6STD A;  3GZB A;  1BSC A;  1HKX A;  3WA3 A;  4Q53 A;  1GOU A;  2CHC A;  4WHA A;  1V57 A;  2GU1 A;  5AII A;  1PU4 A;  1TP6 A;  3KII A;  1IDP A;  1I8V A;  3NX0 A;  1TJD A;  2ZL8 A;  1BNE A;  2QIY A;  1GY7 A;  1M90 4;  1I2E A;  2P05 A;  4RNY A;  3NBR A;  3CCE 3;  1IU7 A;  1EUI C;  1OHP A;  4IT7 A;  4EC6 A;  3TDG A;  5AI1 A;  1VQM 3;  3CNX A;  1A90 A;  1W5Z A;  4MMX B;  2HMO B;  2K0M A;  8CHO A;  1YGE A;  1N9J A;  1F8N A;  5D82 A;  1FUW A;  1W6C A;  4XBT A;  2MC8 A;  5D81 A;  2GBX B;  4BL2 A;  4L8O A;  3ROB A;  1I0X A;  4FR9 A;  2GU3 A;  3FGY A;  1B27 A;  4HOH A;  2F86 B;  2Z7A A;  3I55 3;  4J8T A;  3D4A A;  3HIG A;  1BUJ A;  1KQS 2;  1DVD A;  2W56 B;  1WQL B;  3DXO A;  1TFO A;  3N8B A;  3V98 A;  3FLJ A;  1YVS A;  1UCL A;  3NQY A;  1DMN A;  1UUW B;  1IT7 A;  1AQZ A;  4HM2 B;  2H0G A;  3AHS A;  1KD1 4;  7GSP A;  5IW9 A;  1IVW A;  4K1U A;  2CFL A;  3LT8 A;  3DGM A;  1LVN A;  1JBT A;  1GYB A;  3Q2P A;  2FGT A;  1TRQ A;  1BSE A;  4H3U A;  3Q1C A;  7STD A;  4R9L A;  1YVB I;  1FZU A;  2XGN A;  3L0R A;  1O7N B;  3S29 A;  1AVL A;  1BSB A;  2FNQ A;  2PNC A;  3BND A;  2BNG A;  3DH2 A;  4HYZ A;  3EX9 A;  2Z6B A;  1D6U A;  2CX1 A;  2OQE A;  1AVK A;  2BT3 A;  4R80 A;  1ZS7 A;  2WOF A;  1UGI A;  4FMA A;  3SYU A;  1LQM B;  3WR2 A;  2CWV A;  1CYU A;  1GMP A;  1GD3 A;  3SLU A;  2A15 A;  1B20 A;  4O2H A;  5KP3 A;  3M8C A;  2YFL B;  2ML5 A;  2XEP A;  3ZG0 A;  1N8R 4;  2M7O A;  1NB3 I;  1RN7 A;  1SQW A;  4HJL B;  4XBX A;  3WOD G;  2BMR B;  3EC9 A;  1IQY A;  1WMP A;  5HGR A;  2L1S A;  3K0Z A;  1K9M 4;  1N5P A;  2MF7 A;  1FUT A;  3PCS A;  4HZ9 B;  4N6U A;  1D6Z A;  1JKG A;  1NNV A;  3MKI A;  3X3Z A;  1B2U A;  1TFK A;  3CU3 A;  3PGB A;  3EBT A;  3MHE A;  2JQ5 A;  4MJD A;  1EQK A;  3K9M C;  2CFW A;  1I3I A;  1I2F A;  3OWU A;  3IPT A;  2OOV A;  4GHO A;  3KKG A;  1OGZ A;  1E97 A;  3B8L A;  2FXT A;  4RBN A;  1RSN A;  1NO3 A;  1RGG A;  5AYS C;  3BNE A;  1MOL A;  1RJO A;  3V92 A;  1IYY A;  1Q7Y 4;  3B4P A;  2HMK B;  2CFG A;  5M18 A;  1KC8 4;  1RRL A;  2C4B A;  3JUQ A;  3I0Y A;  1GOY A;  4EW5 A;  3LML A;  4RNT A;  1MGW A;  1O7W B;  1FYS A;  1RGE A;  2CC3 A;  2W04 A;  3S28 A;  1OCV A;  4X2O A;  4J9A A;  1RNB A;  3HZP A;  3F8H A;  4WP5 A;  4WYK A;  3CC4 3;  4IIA A;  2GEX A;  1MGR A;  5LC7 A;  1UUG B;  3F40 A;  1W00 A;  1Q81 4;  3OWS A;  1IK3 A;  3PXM A;  1NDO B;  2E2V A;  3UL6 A;  2P0X A;  3NM7 A;  3SX1 A;  4EYC A;  1JZO A;  1O7H B;  3D3L A;  3WA2 X;  1JB5 A;  4R1K A;  5IF6 A;  2YFJ B;  2BU4 A;  1W4N A;  2RCD A;  3G8Z A;  1MWU A;  1UCK A;  1GY5 A;  2QGU A;  2BO9 B;  2CIU A;  5ELJ A;  1G0T A;  1W01 A;  2CKF B;  5LC6 A;  1MWT A;  4N6L A;  1JN5 A;  3SOY A;  2HMN B;  2W03 A;  3DZL A;  2AAD A;  3GZR A;  2KAA A;  4JRF A;  1G96 A;  1N8Q A;  1BRJ A;  1D6Y A;  1Z1S A;  3AGN A;  5DRV A;  1EA2 A;  4HVN A;  3UJM A;  1VQN 3;  2E2U A;  1BRN L;  1HU9 A;  1RRH A;  4N6V 0;  3J7Y d;  2RSX A;  3STD A;  3HX8 A;  3B7C A;  3BIR A;  2GEY A;  3G0K A;  3KE7 A;  4BL3 A;  4N3V A;  1V58 A;  2CWU A;  5AIH A;  4O3V A;  5CLK A;  1AV4 A;  4BTW A;  2CFD A;  4HAA A;  3WMD A;  1M1K 4;  3CNM A;  1FGQ A;  1TRP A;  1RHL A;  1OHS A;  2F5W A;  2RNT A;  1HZ1 A;  1UW1 A;  3NV0 A;  1IVU A;  3EB8 A;  3PYJ A;  4LYL B;  4CCV A;  1E3V A;  2BHM A;  4WFO A;  2OOV C;  3LTD A;  3QK9 A;  4BTY A;  5KP1 A;  2IUJ A;  2IYJ A;  3CCS 3;  1VQL 3;  4I4K A;  1FGO A;  2D1W A;  4OK0 A;  2OTL 3;  3CPW 2;  4XBY A;  3FSD A;  1OHO A;  1GMR A;  1PYL A;  4K61 A;  3S27 A;  1VQO 3;  1RCL A;  1L5G B;  1K28 A;  3D5I A;  4IPB A;  3DGL A;  2KF4 A;  1LQG C;  4X2H A;  4RZM A;  2WGQ A;  1NWW A;  1US1 A;  1DE3 A;  1UI8 A;  5TGN A;  4NPB A;  3ZG5 A;  3KFQ C;  4K90 B;  2B24 B;  2RBI A;  4HM6 B;  5IEO A;  1SPU A;  1V74 A;  1A2K A;  1UI7 A;  3T0U A;  5I97 A;  1NU3 A;  4KFD A;  1GY6 A;  3F8X A;  1BRI A;  1YJN 3;  4HBR A;  2I9W A;  1MWR A;  4EBG A;  1JBR A;  4HKV B;  5IG5 A;  1WTH A;  3WOF B;  1QAF A;  3URP A;  3IJE B;  3KCH A;  3ECF A;  4ORL A;  1OF5 A;  3EJV A;  1VQ8 3;  2KXG A;  1YIT 3;  5IG3 A;  1U5O A;  2XR8 B;  3OW2 2;  3EE1 A;  4R9K A;  4HM0 B;  2P09 A;  1RMS A;  1AR0 A;  2BMO B;  1UDI I;  1FUS A;  1BRS A;  1UUV B;  3S5C A;  3CCR 3;  1RNT A;  3Q90 A;  3D79 A;  1JB4 A;  1QAK A;  1X1Y A;  1ZO2 A;  6RNT A;  1J2B A;  4OUQ A;  1JNQ A;  4GSP A;  4EV2 A;  3K5T A;  1EEJ A;  1SJW A;  4QWT A;  1IQ8 A;  3FG4 A;  2KCD A;  3N9H A;  2KRT A;  1B2Z A;  2RGQ A;  1VQK 3;  2W9Q A;  3DGY A;  1X1W A;  3BNC A;  1IV7 A;  1CH0 A;  1JKG B;  1RN4 A;  4TX4 A;  4HZB B;  5BVB A;  4J5K A;  1S5A A;  1BSD A;  2BIR A;  4HM4 B;  3QRD A;  4HM3 B;  4K1V A;  5GSP A;  3CC7 3;  4KFF A;  1TIJ A;  3EN8 A;  4JF8 A;  4N6O B;  3RNT A;  5JBS A;  1WMO A;  4FCJ A;  2Q07 A;  1YGW A;  3MPH A;  1N9E A;  1BIR A;  2XSH B;  1IVV A;  2QA4 3;  1I3F A;  4GL6 A;  3LZA A;  1BAN A;  4G1M B;  4KT3 B;  4LGQ A;  3V99 A;  3ER7 A;  2W0Q A;  5KP4 A;  4L8P A;  2KF5 A;  4MMY B;  3D9R A;  1YIJ 3;  2D42 A;  5FW5 A;  4KVH A;  1YNV X;  2Y74 A;  3B4O A;  4LEH A;  4WWU C;  5IG4 A;  2F5M A;  3LTB A;  1OH0 A;  2KF3 A;  3G16 A;  3H3H A;  1Q86 4;  3KSE D;  4ZM8 A;  3BNB A;  4WYK B;  2O3O A;  5JPU A;  3WOE B;  2GSP A;  1ZX2 A;  5BIR A;  1LOY A;  1B21 A;  3T8N A;  1SAR A;  3SXX A;  2PZV A;  1LRA A;  1U8C B;  4ILF A;  3CC2 3;  1JZD A;  2W9P A;  1Q42 A;  4AEQ A;  2V1L A;  1G02 A;  1FGR A;  2ZA4 A;  2B1X B;  1BNJ A;  3HOH A;  2HOH A;  1B2X A;  3BLZ A;  1T2H A;  1ISK A;  3G6E 3;  3HII A;  2GBW B;  2JDI H;  1JN5 B;  2BMQ B;  1RN1 A;  2UUG C;  3LH4 A;  2Z77 A;  2CK3 H;  4BTX A;  3GZY B;  1UCJ A;  2WGO A;  4EXR A;  1Q7H A;  2XRX B;  1BRH A;  3AMO B;  3CPO A;  3FCS B;  3KN4 A;  3MG1 A;  2F99 A;  5M19 A;  1RTU A;  1BNG A;  1LNH A;  2CFK A;  2R41 A;  1DMQ A;  3X42 A;  1QVG 2;  1O7G B;  1B3S A;  1VQ5 3;  4LSO A;  3CXC 2;  3H51 A;  1BNF A;  4CPK A;  1IQX A;  2C11 A;  2CH9 A;  3BB9 A;  2WOH A;  5G1L A;  5G2G A;  4AKZ A;  1RLS A;  2YX9 A;  2O9U X;  3ALA A;  3A76 A;  3AMO A;  4RNZ A;  4STD A;  3NXJ A;  8RNT A;  5AEW B;  3NV0 B;  4AKY A;  2F4Y A;  1CEW I;  4GB5 A;  2K3D A;  3LYG A;  1A2P A;  4FMB A;  3GAX A;  2H0I A;  1BAO A;  1Q40 A;  3MG3 A;  4N6N B;  1C7H A;  3MYT A;  1IVX A;  1KSI A;  4KFE A;  4MEI A;  4LMI A;  5D83 A;  1BVI A;  3EF8 A;  3DM8 A;  2W2C A;  5IEP A;  1I0V A;  4PEJ A;  3RDE A;  3UB1 A;  3JVC A;  3PS8 A;  3F14 A; 
#chains in the Genus database with same CATH homology
 1YI2 3;  3VF1 A;  3HK4 A;  4HM7 B;  1K73 4;  3FH1 A;  1DVC A;  3G71 3;  4FCZ A;  1W02 A;  5EVH A;  4NRE A;  3SVA A;  5FGO A;  3MWZ A;  1NB5 I;  3EHC A;  1Q82 4;  2L4V A;  2IA7 A;  1OF5 B;  3K63 A;  4HM5 B;  1QVF 2;  1OUN A;  3X3Y A;  1ROV A;  1ASK A;  1DMM A;  1CYV A;  3U97 A;  3JUM A;  4XB5 A;  1QMA A;  1VQP 3;  1M1X B;  3JUN A;  3HI7 A;  1STF I;  3FZW A;  3LTC A;  1VQ9 3;  1MNL A;  3EN1 B;  3N54 B;  2XGL A;  1SII A;  3MG2 A;  1ULI B;  4FMC A;  1KWI A;  3GWR A;  4H61 A;  1EG9 B;  3EBY A;  5AEU B;  1TU5 A;  1FA3 A;  1Y4K A;  1A2V A;  3NBB A;  5A0O B;  2IUK A;  3MSO A;  2Y73 A;  1STD A;  2XSO B;  3CCV 3;  3U1W A;  2P38 A;  1OAC A;  3NBJ A;  3LXU X;  1PFP A;  1EKM A;  2XFT A;  3VSY A;  5BXQ A;  3SED A;  1VQ6 3;  3JUP A;  4R4K A;  3F9S A;  1RKY A;  3NM2 A;  1W6Y A;  3LOY A;  2STD A;  4MMZ B;  1DYU A;  4FCM A;  5DRE A;  1A67 A;  1GS3 A;  1JV2 B;  5IEN A;  3JUO A;  2W56 A;  5EQL A;  2ML6 A;  2XFS A;  2OTJ 3;  2OWP A;  4L7K A;  5CK6 A;  3T8U A;  4EV5 A;  1JB2 A;  1LOX A;  2LQV A;  3S67 A;  1OGX A;  1FGT A;  2WO0 A;  3E99 A;  2K54 A;  2YFI B;  1W2B 2;  3PCR A;  1K41 A;  1VZZ A;  2UX0 A;  2HMM B;  3EQQ B;  3DY5 A;  2CW9 A;  3K7C A;  4KZ1 A;  5IER A;  3VGN A;  1W6G A;  2QEX 3;  3CD6 3;  4HM8 B;  1JRQ A;  1WNH A;  1IT8 A;  2LYX A;  2SBL A;  1YHQ 3;  1QJG A;  3DMC A;  3PZW A;  2P0M A;  3NQZ A;  3GRD A;  1GD4 A;  3UNL A;  2W6J H;  3OX9 A;  2CG0 A;  3KZT A;  4O8S A;  5CF2 A;  3F7S A;  1ROA A;  2XF3 A;  3O8Y A;  3X3X A;  5ELU A;  3OWY A;  5JPP A;  2HMJ B;  1W7C A;  1ULJ B;  1VQ4 3;  5AYR B;  3UL5 A;  3FG1 A;  2CG1 A;  1O7P B;  2OCT A;  3GZX B;  4N6T A;  2E2T A;  4U13 A;  2IMJ A;  4O02 B;  1NJI 4;  4CDL A;  3OXA A;  3RGR A;  1QAL A;  4N6M A;  5CF1 A;  2R4I A;  1LXE A;  3CCL 3;  2XH9 A;  3CCU 3;  2INX A;  3FG3 A;  1O7M B;  1T5Y A;  3I56 3;  3X41 A;  1YJ9 3;  2F98 A;  2ZDJ A;  1Q40 B;  1K8A 4;  4XDV A;  3LT9 A;  3IMA B;  3DGN A;  2C10 A;  1N5H A;  4OVM A;  2HML B;  2GXF A;  4NHF A;  1W2Z A;  3CCJ 3;  4HM1 B;  2RFR A;  3NHX A;  1OPY A;  4LZI A;  3CME 3;  2OQE C;  1VQ7 3;  1FGM A;  1M9G A;  1BUQ A;  3NUV A;  5IG0 A;  5AIF A;  4FMD A;  2CWT A;  3F7X A;  5EEO A;  3RGA A;  1IV9 A;  3FF2 A;  5STD A;  1WMN A;  1SIH A;  1TUH A;  3DGO A;  3SOA A;  3CCM 3;  3CMA 3;  5AIG A;  1E3R A;  3DUK A;  3LTA A;  5CXO A;  3G4S 3;  3X40 A;  3FF0 A;  3WDG B;  1YJW 3;  4XM4 A;  3KSP A;  3FKA A;  4XDW A;  3OV4 A;  1R4C A;  1CQS A;  2Z76 A;  6STD A;  3GZB A;  1HKX A;  3WA3 A;  4Q53 A;  2CHC A;  4WHA A;  2GU1 A;  5AII A;  1PU4 A;  1TP6 A;  3KII A;  1IDP A;  3NX0 A;  2ZL8 A;  2QIY A;  1M90 4;  1GY7 A;  2P05 A;  4RNY A;  3NBR A;  3CCE 3;  1IU7 A;  1OHP A;  4IT7 A;  4EC6 A;  3TDG A;  5AI1 A;  1VQM 3;  3CNX A;  1A90 A;  1W5Z A;  4MMX B;  2HMO B;  2K0M A;  8CHO A;  1YGE A;  1N9J A;  1F8N A;  5D82 A;  1FUW A;  1W6C A;  4XBT A;  2MC8 A;  5D81 A;  2GBX B;  4L8O A;  3ROB A;  4FR9 A;  2GU3 A;  3FGY A;  3I55 3;  2F86 B;  2Z7A A;  4J8T A;  3HIG A;  1KQS 2;  1DVD A;  2W56 B;  1WQL B;  3DXO A;  1TFO A;  3N8B A;  3V98 A;  3FLJ A;  3NQY A;  1DMN A;  1UUW B;  1IT7 A;  4HM2 B;  1KD1 4;  5IW9 A;  1IVW A;  4K1U A;  2CFL A;  3LT8 A;  3DGM A;  1LVN A;  1GYB A;  3Q2P A;  2FGT A;  4H3U A;  3Q1C A;  7STD A;  4R9L A;  1YVB I;  2XGN A;  3L0R A;  1O7N B;  3S29 A;  1AVL A;  2FNQ A;  4HYZ A;  2PNC A;  3BND A;  2BNG A;  3EX9 A;  2Z6B A;  1D6U A;  2OQE A;  1AVK A;  2BT3 A;  4R80 A;  2WOF A;  4FMA A;  2CWV A;  1CYU A;  1GD3 A;  3SLU A;  2A15 A;  4O2H A;  5KP3 A;  3M8C A;  2YFL B;  2ML5 A;  2XEP A;  1N8R 4;  2M7O A;  1NB3 I;  1RN7 A;  1SQW A;  4HJL B;  4XBX A;  3WOD G;  2BMR B;  3EC9 A;  1IQY A;  1WMP A;  5HGR A;  3K0Z A;  1K9M 4;  1N5P A;  2MF7 A;  3PCS A;  4HZ9 B;  4N6U A;  1D6Z A;  1JKG A;  3MKI A;  3X3Z A;  1TFK A;  3CU3 A;  3PGB A;  3EBT A;  3MHE A;  2JQ5 A;  4MJD A;  1EQK A;  3K9M C;  2CFW A;  3OWU A;  3IPT A;  2OOV A;  3KKG A;  1OGZ A;  1E97 A;  3B8L A;  2FXT A;  4RBN A;  1NO3 A;  5AYS C;  3BNE A;  1MOL A;  1RJO A;  3V92 A;  1Q7Y 4;  3B4P A;  2HMK B;  2CFG A;  1KC8 4;  1RRL A;  3JUQ A;  3I0Y A;  3LML A;  1O7W B;  2CC3 A;  2W04 A;  3S28 A;  1OCV A;  4X2O A;  4J9A A;  3HZP A;  3F8H A;  4WP5 A;  4WYK A;  3CC4 3;  4IIA A;  2GEX A;  5LC7 A;  3F40 A;  1W00 A;  1Q81 4;  3OWS A;  1IK3 A;  3PXM A;  1NDO B;  2E2V A;  3UL6 A;  2P0X A;  3NM7 A;  3SX1 A;  4EYC A;  1O7H B;  3D3L A;  3WA2 X;  1JB5 A;  4R1K A;  5IF6 A;  2YFJ B;  1W4N A;  2RCD A;  3G8Z A;  1GY5 A;  2QGU A;  2BO9 B;  2CIU A;  5ELJ A;  1W01 A;  2CKF B;  5LC6 A;  4N6L A;  1JN5 A;  3SOY A;  2HMN B;  2W03 A;  3DZL A;  3GZR A;  4JRF A;  1G96 A;  1N8Q A;  1D6Y A;  1Z1S A;  3UJM A;  1VQN 3;  5DRV A;  1EA2 A;  4HVN A;  2E2U A;  1HU9 A;  1RRH A;  4N6V 0;  3J7Y d;  2RSX A;  3STD A;  3HX8 A;  3B7C A;  2GEY A;  3G0K A;  3KE7 A;  4N3V A;  2CWU A;  5AIH A;  4O3V A;  5CLK A;  1AV4 A;  4BTW A;  2CFD A;  3WMD A;  1M1K 4;  3CNM A;  1FGQ A;  3NV0 A;  1OHS A;  3PYJ A;  4HKV B;  4CCV A;  1UW1 A;  1S72 3;  1IVU A;  3EB8 A;  5KP1 A;  1E3V A;  2BHM A;  4WFO A;  2OOV C;  3LTD A;  3QK9 A;  4BTY A;  2IUJ A;  3CCS 3;  1VQL 3;  4I4K A;  1FGO A;  2D1W A;  4OK0 A;  2OTL 3;  3CPW 2;  4XBY A;  3FSD A;  1OHO A;  1VQO 3;  4K61 A;  3S27 A;  1L5G B;  1K28 A;  4IPB A;  3DGL A;  4X2H A;  4RZM A;  2WGQ A;  1NWW A;  1US1 A;  1UI8 A;  5TGN A;  3CCQ 3;  3KFQ C;  4K90 B;  2B24 B;  4HM6 B;  5IEO A;  1SPU A;  1V74 A;  1A2K A;  1UI7 A;  3T0U A;  5I97 A;  1NU3 A;  4KFD A;  1GY6 A;  3F8X A;  1YJN 3;  4HBR A;  2I9W A;  4EBG A;  5IG5 A;  1WTH A;  3WOF B;  1QAF A;  3IJE B;  4ORL A;  3ECF A;  1OF5 A;  3EJV A;  1VQ8 3;  2KXG A;  1YIT 3;  5IG3 A;  1U5O A;  2XR8 B;  3OW2 2;  3EE1 A;  4R9K A;  4HM0 B;  2P09 A;  1AR0 A;  2BMO B;  1UUV B;  3S5C A;  3CCR 3;  3Q90 A;  1JB4 A;  1QAK A;  1ZO2 A;  1J2B A;  4OUQ A;  1JNQ A;  4EV2 A;  3K5T A;  1SJW A;  4QWT A;  1IQ8 A;  3FG4 A;  2KCD A;  3N9H A;  2KRT A;  2RGQ A;  1VQK 3;  2W9Q A;  3BNC A;  1IV7 A;  1JKG B;  4TX4 A;  4HZB B;  5BVB A;  1S5A A;  4HM4 B;  3QRD A;  4HM3 B;  4K1V A;  3CC7 3;  4KFF A;  1TIJ A;  3EN8 A;  4JF8 A;  4N6O B;  5JBS A;  1WMO A;  4FCJ A;  2Q07 A;  3MPH A;  1N9E A;  2XSH B;  1IVV A;  2QA4 3;  4GL6 A;  3LZA A;  4G1M B;  4LGQ A;  3V99 A;  3ER7 A;  2W0Q A;  5KP4 A;  4L8P A;  4MMY B;  3D9R A;  1YIJ 3;  2D42 A;  5FW5 A;  4KVH A;  2Y74 A;  3B4O A;  4LEH A;  4WWU C;  5IG4 A;  3LTB A;  1OH0 A;  3G16 A;  3H3H A;  1Q86 4;  3KSE D;  4ZM8 A;  3BNB A;  4WYK B;  2O3O A;  5JPU A;  3WOE B;  1ZX2 A;  3T8N A;  3SXX A;  2PZV A;  1U8C B;  3CC2 3;  2W9P A;  1Q42 A;  4AEQ A;  2V1L A;  1FGR A;  2B1X B;  3BLZ A;  1ISK A;  3G6E 3;  3HII A;  2GBW B;  2JDI H;  1JN5 B;  2BMQ B;  3LH4 A;  2Z77 A;  2CK3 H;  4BTX A;  3GZY B;  2WGO A;  4EXR A;  3AMO B;  2XRX B;  3FCS B;  3KN4 A;  3CPO A;  3MG1 A;  2F99 A;  1LNH A;  2CFK A;  1DMQ A;  3X42 A;  1QVG 2;  1O7G B;  1VQ5 3;  4LSO A;  3CXC 2;  3H51 A;  1IQX A;  2C11 A;  2CH9 A;  3BB9 A;  2WOH A;  5G2G A;  4AKZ A;  2YX9 A;  1JJ2 2;  2O9U X;  3ALA A;  3A76 A;  3AMO A;  4RNZ A;  4STD A;  3NXJ A;  5AEW B;  3NV0 B;  4AKY A;  1CEW I;  4GB5 A;  3LYG A;  4FMB A;  3GAX A;  3MG3 A;  1Q40 A;  4N6N B;  5D83 A;  1C7H A;  3MYT A;  1IVX A;  1KSI A;  4KFE A;  4MEI A;  4LMI A;  3EF8 A;  3DM8 A;  2W2C A;  5IEP A;  4PEJ A;  3RDE A;  3UB1 A;  3JVC A;  3PS8 A;  3F14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...