3GWRA

Crystal structure of putative calcium/calmodulin-dependent protein kinase type ii association domain (yp_315894.1) from thiobacillus denitrificans atcc 25259 at 2.00 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
EPVFPTPEAAEDAFYAAFEARSLDDMMAVWARDDHVACIHPLAAPLNGRAAVAAGWRSMFGAAGRFRLQVKAVHEIRQADHVIRIVDEFLTIGDETAPRPAILATNVYRREADGWRMVLHHASPLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Putative calcium/calmodulin-dependent protein kinase type II
publication title Crystal structure of Putative calcium/calmodulin-dependent protein kinase type II association domain (YP_315894.1) from THIOBACILLUS DENITRIFICANS ATCC 25259 at 2.00 A resolution
rcsb
source organism Thiobacillus denitrificans atcc 25259
total genus 29
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3gwrA00
3BLZA 2RCDA 1EA2A 1BUQA 3HZPA 3SOAA 3K0ZA 1U5OA 4IIAA 2BNGA 2R4IA 1Z1SA 1CQSA 4ORLA 1ASKA 2PZVA 1HKXA 3LZAA 1GYBA 3FF0A 3DUKA 4STDA 1O7GB 3OWUA 5D82A 1K41A 4R1KA 3F8XA 4HM7B 3CNXA 2RFRA 3HX8A 2B1XB 2XRXB 1DMMA 4K1UA 3B7CA 1W6YA 3VSYA 1JN5B 4HM2B 3EC9A 4FCMA 3WMDA 5AI1A 1NDOB 4CDLA 4HM4B 5CK6A 1ZX2A 3LYGA 4HM6B 3IPTA 3SEDA 2STDA 1GS3A 5IG5A 8CHOA 1E3RA 3STDA 1QJGA 5AIFA 5KP4A 5IF6A 2XSOB 5CXOA 4R9LA 5JPUA 1ULIB 3H51A 1ULJB 5G2GA 1JKGB 3EQQB 4XB5A 4MJDA 3JUOA 7STDA 1AR0A 4HJLB 2HMJB 5AIGA 3OWYA 3OX9A 3OWSA 3F9SA 1O7HB 2W2CA 5IG3A 3B4PA 5BVBA 4H3UA 4RZMA 3G16A 3MG2A 2BMOB 3FLJA 4LEHA 3MYTA 2QIYA 4J9AA 3FH1A 3I0YA 2GBXB 2K54A 3E99A 3FGYA 3H3HA 2Z7AA 1EG9B 3FF2A 1O7NB 3DZLA 3EBTA 1OGZA 1OUNA 4HVNA 3NM2A 3HK4A 3GWRA 5CLKA 3DMCA 3KKGA 2F98A 4WYKB 5CF2A 5D83A 1JN5A 2CHCA 1QMAA 3GZXB 5IENA 3B4OA 3RGAA 2F99A 3GZBA 5STDA 2A15A 3D9RA 3MSOA 1A2KA 4PEJA 3JUQA 1OPYA 4XM4A 4J8TA 5HGRA 1TP6A 2HMMB 1NWWA 3T8NA 1OH0A 1UUVB 3CNMA 5DRVA 4K1VA 3EF8A 1GY7A 2BMQB 3CU3A 4XBXA 4HM5B 2XR8B 1JKGA 1SJWA 1DMNA 2QGUA 2HMKB 5KP1A 4KVHA 5IG0A 2Z76A 3JUMA 1Q40B 3JUNA 1OHSA 4L8PA 5DREA 4L8OA 4LMIA 3NV0B 4Q53A 4FCJA 4N3VA 1JB4A 1OHOA 3ER7A 3KSPA 5IG4A 3VGNA 2UX0A 3MG3A 5EVHA 3GZRA 2RGQA 3FKAA 1W00A 1STDA 5IEOA 3CPOA 1OGXA 3F7XA 4XBYA 1ISKA 3NUVA 4HM1B 1C7HA 3NHXA 4WYKA 1OF5B 2GXFA 3NBRA 6STDA 2XSHB 2HMOB 5CF1A 2HMNB 4I4KA 1UUWB 3F14A 3B8LA 2F86B 3T8UA 2I9WA 3DXOA 5KP3A 4HM3B 1O7PB 3EJVA 1DMQA 3OXAA 3UNLA 2YFIB 3DM8A 4WP5A 3EHCA 4XDVA 4L7KA 1VZZA 4HM0B 3EX9A 3Q90A 4HM8B 4OVMA 4HZ9B 5AIHA 3JUPA 2YFJB 3EN8A 1NU3A 4HZBB 4XDWA 1Q40A 3S5CA 1E3VA 4U13A 3GZYB 3NV0A 3SOYA 1ZO2A 1IDPA 3F40A 3EBYA 3NXJA 1OCVA 3MG1A 4GB5A 3G0KA 2JQ5A 5D81A 3MHEA 4HKVB 3BB9A 2GEYA 3FZWA 3MKIA 3RGRA 3ECFA 1JB2A 3KE7A 2Z77A 4OUQA 3ROBA 1W01A 2IMJA 3FSDA 5IEPA 3G8ZA 2INXA 4XBTA 1E97A 3UJMA 2OWPA 3KZTA 3A76A 3F8HA 1OF5A 1Q42A 2YFLB 5BXQA 1WQLB 1TUHA 1JB5A 1O7MB 4X2OA 5FW5A 3GRDA 4LGQA 1S5AA 5AEWB 3OV4A 2GBWB 1W02A 1OHPA 5TGNA 2B24B 4X2HA 1GY6A 5AEUB 5IERA 5AIIA 3F7SA 3M8CA 2BMRB 1O7WB 2CKFB 3EN1B 2GEXA 1GY5A 4WWUC 2HMLB 3K7CA 5JPPA 4R9KA
chains in the Genus database with same CATH superfamily
1UI7A 5G1LA 6GSPA 2KAAA 3BLZA 1C54A 2RCDA 4J5GA 1EA2A 1BUQA 4GHOA 2XEPA 2O3OA 5ELUA 1GOYA 4I5QA 1A67A 1B2XA 1V57A 1MGWA 1MWTA 1MWSA 3HZPA 4FMDA 3PZWA 1VQP3 1YNVX 1K734 1K8A4 3SOAA 1T5YA 3K0ZA 3RDEA 2MF7A 1U5OA 1G96A 2FGTA 4IIAA 3UL5A 1FGOA 2BNGA 2R4IA 3KCHA 2F5MA 2UUGC 1FGTA 1Z1SA 1CQSA 3KSED 1VQK3 4ORLA 1LOVA 3I553 1JBSA 1ASKA 1US1A 2PZVA 1HU9A 1HKXA 3LZAA 3N8BA 4J5KA 7RNTA 1X1YA 1GYBA 3FF0A 3DUKA 4STDA 3SXXA 2CK3H 2IY2A 1O7GB 1BSAA 3V99A 3GAXA 3OWUA 2F4YA 5D82A 1X1WA 4FR9A 1FUTA 1Q864 3PXMA 2ZL8A 3WR2A 3BNCA 4ZM8A 1K41A 4AKZA 4R1KA 3CC73 3F8XA 1DVDA 2CWUA 4RBNA 4CJNA 4ILFA 2CG0A 4O3VA 3BIRA 4HM7B 3CNXA 2RFRA 3HX8A 2B1XB 2XRXB 2XGNA 1DMMA 1DVCA 3UB1A 4K1UA 3B7CA 1Q7HA 1W6YA 1W5ZA 3VSYA 4BL3A 1JN5B 1FGRA 2UGIA 4HM2B 1SQWA 1WNHA 3ZG5A 1JNQA 3EC9A 1KD14 1M1XB 4FCMA 3WMDA 4LYLB 2XH9A 1B20A 3X40A 3BNEA 4KFDA 2IUJA 3LXUX 5I97A 3RNTA 5AI1A 5KP3A 1U8CB 1DETA 1YIT3 1NDOB 3SVAA 4CDLA 4HM4B 2Y74A 5CK6A 1BU4A 1ZX2A 1BNJA 2BT3A 3DGMA 3LYGA 4HM6B 3AMOA 3IPTA 3SEDA 3LH4A 2STDA 1GS3A 1IVXA 2CW9A 5IG5A 1NO3A 1E3RA 2CG1A 8CHOA 2FNQA 1B27A 1YJW3 4BU4A 2W03A 1N8R4 1KC84 1HZ1A 3STDA 1AV4A 1TU5A 4DKIA 1QJGA 1LRAA 3WODG 5G1KA 3CC43 4KFFA 1EQKA 3V92A 2ML5A 5AIFA 2ZHXB 2AAEA 5KP4A 5IF6A 5EEOA 2OCTA 2XSOB 5CXOA 4R9LA 5JPUA 1IT7A 1ULIB 3H51A 1ULJB 5G2GA 3S67A 1JKGB 3EQQB 5ELJA 3QRDA 1YJN3 1NNVA 2KCDA 4NPBA 3D3LA 4XB5A 1K9M4 2WGQA 4MJDA 1B2UA 2W9PA 3JUOA 7STDA 1JZOA 3CCL3 1AR0A 4HJLB 4N6TA 2HMJB 2D1WA 2K3DA 3LTBA 5M19A 3LOYA 3N54B 3NBBA 2H0IA 1BNGA 5AIGA 4EC6A 3Q1CA 4BIRA 1RGGA 1VQ83 3NX0A 3NM7A 3U97A 1GOUA 2CFGA 3OX9A 3OWYA 1I2EA 5BU4A 1I0XA 4MMZB 3OWSA 1SIHA 1T2IA 3F9SA 4FMCA 1O7HB 2W2CA 5IG3A 1FGMA 1FGQA 1FUSA 1X1XA 1RKYA 3CCV3 1IVUA 3AHWA 3B4PA 2L4VA 3EE1A 1NB3I 1NJI4 5BVBA 4H3UA 3IJEB 4RZMA 3FG1A 3AGOA 3G16A 5M1AA 3MG2A 1N9JA 2BMOB 2PNCA 3FLJA 1LXEA 2KF3A 3PGBA 1WMPA 1BSDA 1UW1A 2XGLA 1W2B2 2BO9B 4LEHA 1BNRA 3MYTA 4EBGA 3G4S3 1W7CA 3A5EA 4OK0A 3CCQ3 1YVSA 2QIYA 3DGOA 1BRGA 1IV7A 1I3FA 3S28A 3MWZA 2F56A 1CYVA 1B2SA 1YGEA 3S29A 2KRTA 2OTJ3 1W6CA 2C4BA 4J9AA 3FH1A 3I0YA 2MC8A 2GBXB 2K54A 4O8SA 1VQ43 1SIIA 1X1UA 1TIJA 2IUKA 1J2BA 9RNTA 3LTAA 4BTYA 3E99A 3FGYA 3H3HA 2Z7AA 4LZIA 2CFWA 2W04A 5BIRA 1UGHI 1EG9B 1GSPA 4FMAA 3FCSB 4N6MA 1L5GB 3X3ZA 3FF2A 1O7NB 3DZLA 3EBTA 1OGZA 1T3BA 1OUNA 1RN7A 1IQ8A 1ZS7A 3NM2A 4HVNA 1VQL3 2OOVC 3HK4A 1I70A 1PYLA 3GWRA 5CLKA 4EXRA 3DMCA 2C11A 4EW5A 2CH9A 3KKGA 2F98A 4WYKB 5CF2A 5D83A 1JN5A 2CHCA 2E2TA 2W9QA 3HI7A 3SLUA 1ZGXA 1QMAA 1SARA 1K28A 3UL6A 1VQO3 1BRSA 2OOVA 1WMOA 3GZXB 1I3IA 2ML6A 3BNDA 3QK9A 5IENA 3LTDA 1BNEA 2LYXA 2M7OA 3DY5A 3B4OA 4AEQA 3RGAA 2WOFA 2F99A 2V1LA 2XFSA 3GZBA 5STDA 3S27A 1BNSA 2A15A 1G0TA 2Q07A 3D9RA 3MSOA 1RLSA 1BIRA 1MGRA 3WHOA 1A2KA 4PEJA 2KF6A 4O2HA 4EV2A 5RNTA 3JUQA 1UCKA 4MMYB 1W6GA 1YGWA 2CWVA 3DH2A 1Q824 1OPYA 2RNTA 1B2ZA 1D6YA 1RGHA 3LT8A 4XM4A 3K5TA 4J8TA 2IYJA 1RJOA 3KFQC 5HGRA 1TP6A 2HMMB 1NWWA 3T8NA 3L0RA 3D79A 1OH0A 2W56B 2KF4A 5M18A 1UUVB 4EV5A 1VQ63 3CNMA 2AADA 4KFEA 2BHMA 5DRVA 4K1VA 3EF8A 1GY7A 2BMQB 3DGLA 3CU3A 3WDGB 4XBXA 3CPW2 1YJ93 4HM5B 2R41A 2XR8B 1JKGA 1RN4A 2GU3A 1SJWA 1DMNA 1A90A 1BNFA 2C10A 2Y73A 3BU4A 1AQZA 2QGUA 1UCIA 3CME3 3BNBA 1GOVA 1B21A 2HMKB 4KT3B 5KP1A 1VQN3 4KVHA 5IG0A 1STFI 2CFKA 2WO0A 4H61A 5GSPA 3ZFZA 4BTWA 3JVCA 1OACA 8RNTA 4IPBA 2Z76A 3JUMA 1T2HA 2CC3A 2QEX3 1BRIA 1D6UA 1Q40B 4WFOA 3JUNA 4R80A 1OHSA 4HAAA 3TDGA 1QAFA 2D42A 2P0XA 4L8PA 1LQGC 5DREA 4L8OA 4BTXA 3CCR3 4R4KA 4LMIA 3NV0B 5LC7A 2YX9A 4Q53A 5FGOA 4FCJA 4N3VA 1BAOA 4JF8A 3WA2X 2CWTA 3G6E3 1BRKA 1IV9A 1BVIA 1JB4A 1BRJA 1OHOA 3ER7A 1Y4KA 3KSPA 3VGNA 5IG4A 2UX0A 4O02B 2ZDJA 1LQMB 4BL2A 1RGEA 3MG3A 2JDIH 1V74A 5EVHA 1A2VA 1AVKA 4CCVA 1I0VA 4N6V0 1BSEA 3GZRA 3X42A 1JV2B 1MWUA 1AVLA 1A2PA 2RGQA 3GSPA 4NHFA 4RNZA 1N8QA 4RNYA 3FKAA 1UUGB 1ROVA 3HIGA 1W00A 3X3XA 1STDA 5IEOA 1V58A 1UCJA 1RGLA 2CX1A 3CPOA 1KSIA 1OGXA 4K90B 1GD4A 1LOYA 1VQ53 4K61A 3X3YA 3F7XA 2L1SA 4XBYA 1CEWI 1BNIA 2P0MA 1UDII 2QA43 1ISKA 4GL6A 3EB8A 1KWIA 1RRLA 1IK3A 1YI23 2GSPA 3NUVA 1QVG2 1IU7A 1NB5I 3FG3A 2IA7A 1TTOA 2BIRA 4HM1B 4HYZA 1I2FA 1C7HA 1MOLA 2KF5A 3AHSA 3NHXA 4QWTA 4WYKA 1M9GA 1OF5B 3CC23 1FW7A 2GXFA 1QAKA 3NBRA 5LC6A 1R4CA 1TFKA 6STDA 2XSHB 2E2UA 2CFDA 2CX0A 3HIIA 1KQS2 1RHLA 1B2MA 2HMOB 1BRNL 3SX1A 4AKYA 5CF1A 2HMNB 4I4KA 3URPA 1FA3A 1UUWB 3F14A 3VF1A 4IT7A 5JBSA 3B8LA 1W2ZA 1IVWA 4G1MB 2F86B 1DYUA 3DGNA 2I9WA 3T8UA 3DXOA 3PYJA 4HM3B 1JZDA 2OQEC 1MNLA 1O7PB 3EJVA 1IVVA 1DMQA 1GMPA 1HYFA 3OXAA 3LTCA 4WHAA 1IT8A 1SPUA 1EUIC 1QALA 3UNLA 1B3SA 1RGKA 2SARA 1N5PA 2YFIB 3CMA3 3MPHA 3DM8A 4N6OB 2E2VA 4WP5A 2W56A 4HBRA 3D5IA 4KZ1A 1YHQ3 3EHCA 2OQEA 3PCRA 3OW22 4XDVA 1EEJA 1N5HA 1CH0A 4L7KA 1YIJ3 1VZZA 3X41A 5IW9A 3N9HA 4HM0B 1UCLA 2CFLA 2W6JH 3Q3FA 4RNTA 1BUJA 1TRPA 1N9EA 1FYSA 3EX9A 1AY7A 1FZUA 3Q90A 3CD63 1MWRA 4HM8B 2W0QA 4OVMA 4HZ9B 5AIHA 1BSCA 3JUPA 2YFJB 1BGSA 1NU3A 3EN8A 3CCE3 1RMSA 1JBRA 4HZBB 3LT9A 2KXGA 2RBIA 4XDWA 2GU1A 3DGYA 4FMBA 3D5GA 1Q40A 3S5CA 3V98A 7GSPA 1E3VA 4U13A 2FXTA 2HOHA 3Q2PA 3GZYB 1BSBA 3NV0A 3SOYA 1ZO2A 1IDPA 3PCSA 3F40A 1QVF2 2H0GA 1S723 3EBYA 1PU4A 3NQYA 1YVBI 3NXJA 1RNTA 2P05A 1OCVA 3SYUA 1RCLA 2O9UX 1JBTA 1UGIA 1R4YA 2SBLA 3MG1A 4GB5A 3G0KA 2JQ5A 5D81A 3MHEA 3PS8A 1VQQA 4HKVB 3BB9A 1RCKA 1LVNA 1RN1A 5HOHA 3I563 2P09A 2GEYA 1FUWA 3FZWA 1VQ73 3LMLA 1IQXA 3MKIA 1I2GA 3RGRA 1RGCA 1LOWA 3ECFA 2OTL3 1JB2A 2P38A 1RTUA 3KE7A 1M1K4 5EQLA 2Z77A 1GMQA 4OUQA 3ROBA 3WOEB 3FG4A 3NBJA 1W01A 2IMJA 3FSDA 3IMAB 5IEPA 3G8ZA 1W4NA 1I8VA 3CCU3 1DE3A 2Z6BA 5A0OB 2LQVA 1Q9EA 3ZG0A 3AMOB 1JJ22 1PFPA 3WA3A 3J7Yd 3AGNA 1IYYA 2INXA 1F8NA 3HOHA 4XBTA 2F5WA 4NREA 2BU4A 4EYCA 3CCS3 1E97A 1JRQA 3UJMA 5AYSC 2OWPA 3KZTA 4MEIA 3A76A 1IQYA 4CPKA 3WOFB 3F8HA 3K9MC 1OF5A 1UI8A 2K0MA 3G713 1BOXA 1Q42A 2YFLB 5BXQA 1WQLB 3O8YA 3NQZA 4N6UA 1RDSA 1RGFA 4N6NB 1TUHA 1JB5A 2ZA4A 1LNHA 1PY3A 1O7MB 2WGOA 1VQM3 1RNBA 5AYRB 2RSXA 4X2OA 5FW5A 1VQ93 3GRDA 4LGQA 1S5AA 3D4AA 5AEWB 1Q814 4MMXB 3OV4A 4GSPA 1CYUA 2H0HA 1TRQA 2GBWB 4JRFA 2CIUA 1W02A 3ALAA 1OHPA 4N6LA 5TGNA 1TJDA 2B24B 1BRHA 1RSNA 4FCZA 1GY6A 1WMNA 4HOHA 4X2HA 3T0UA 5AEUB 3CCJ3 1LNIA 2XFTA 4LSOA 3F7SA 5AIIA 5IERA 1GD3A 3KIIA 3M8CA 2WOHA 2BMRB 3CCM3 1Q7Y4 1O7WB 3K63A 1RRHA 1TFOA 1GMRA 1EKMA 1WTHA 2CKFB 2J8XB 1G02A 1BANA 1D6ZA 3EN1B 3U1WA 2GEXA 1ROAA 1M904 3KN4A 1GY5A 4WWUC 4TX4A 1RGAA 2XF3A 2HMLB 3CXC2 3K7CA 5JPPA 4R9KA 6RNTA 1LOXA
chains in the Genus database with same CATH topology
1UI7A 3BLZA 2RCDA 1EA2A 1BUQA 2XEPA 2O3OA 5ELUA 1A67A 3HZPA 1VQP3 4FMDA 3PZWA 1K734 1K8A4 3SOAA 1T5YA 3K0ZA 3RDEA 2MF7A 1U5OA 1G96A 2FGTA 4IIAA 3UL5A 1FGOA 2BNGA 2R4IA 1FGTA 1Z1SA 1CQSA 3KSED 1VQK3 4ORLA 3I553 1ASKA 1US1A 2PZVA 1HU9A 1HKXA 3LZAA 3N8BA 1GYBA 3FF0A 3DUKA 4STDA 3SXXA 2CK3H 1O7GB 3V99A 3GAXA 3OWUA 5D82A 4FR9A 1Q864 3PXMA 2ZL8A 3BNCA 4ZM8A 1K41A 4AKZA 4R1KA 3CC73 3F8XA 1DVDA 2CWUA 4RBNA 2CG0A 4O3VA 4HM7B 3CNXA 2RFRA 3HX8A 2B1XB 2XRXB 2XGNA 1DMMA 1DVCA 3UB1A 4K1UA 3B7CA 1W6YA 1W5ZA 3VSYA 1JN5B 1FGRA 4HM2B 1SQWA 1WNHA 1JNQA 3EC9A 1KD14 1M1XB 4FCMA 3WMDA 2XH9A 3X40A 3BNEA 4KFDA 2IUJA 3LXUX 5I97A 5AI1A 1U8CB 1YIT3 1NDOB 3SVAA 4CDLA 4HM4B 2Y74A 5CK6A 1ZX2A 3DGMA 2BT3A 3LYGA 4HM6B 3AMOA 3IPTA 3SEDA 3LH4A 2STDA 1GS3A 1IVXA 2CW9A 5IG5A 1NO3A 1E3RA 2CG1A 8CHOA 2FNQA 1YJW3 2W03A 1N8R4 1KC84 3STDA 1AV4A 1TU5A 1QJGA 1EQKA 3WODG 3CC43 4KFFA 3V92A 2ML5A 5AIFA 5KP4A 5IF6A 5EEOA 2OCTA 2XSOB 5CXOA 4R9LA 5JPUA 1IT7A 1ULIB 3H51A 1ULJB 5G2GA 3S67A 1JKGB 3EQQB 5ELJA 3QRDA 1YJN3 4XB5A 2KCDA 1K9M4 3D3LA 2WGQA 4MJDA 2W9PA 3JUOA 7STDA 3CCL3 1AR0A 4HJLB 4N6TA 2HMJB 2D1WA 3LTBA 3LOYA 3N54B 3NBBA 5AIGA 4EC6A 3Q1CA 1VQ83 3NX0A 3NM7A 3U97A 2CFGA 3OWYA 3OX9A 4MMZB 3OWSA 1SIHA 3F9SA 4FMCA 1O7HB 2W2CA 5IG3A 1FGMA 1FGQA 1RKYA 3CCV3 1IVUA 3B4PA 3EE1A 2L4VA 1NB3I 1NJI4 5BVBA 4H3UA 3IJEB 4RZMA 3FG1A 3G16A 3MG2A 1N9JA 2BMOB 2PNCA 3FLJA 1LXEA 3PGBA 1WMPA 1UW1A 2XGLA 1W2B2 2BO9B 4LEHA 3MYTA 4EBGA 3G4S3 1W7CA 3CCQ3 4OK0A 2QIYA 3DGOA 1IV7A 3S28A 3MWZA 1CYVA 1YGEA 3S29A 2KRTA 1W6CA 4J9AA 3FH1A 3I0YA 2MC8A 2GBXB 2K54A 4O8SA 1VQ43 1SIIA 1TIJA 2IUKA 1J2BA 3LTAA 4BTYA 3E99A 3FGYA 3H3HA 2Z7AA 4LZIA 2CFWA 2W04A 1EG9B 4FMAA 3FCSB 4N6MA 1L5GB 3X3ZA 3FF2A 1O7NB 3DZLA 3EBTA 1OGZA 1OUNA 1RN7A 1IQ8A 3NM2A 4HVNA 1VQL3 2OOVC 3HK4A 3GWRA 5CLKA 4EXRA 3DMCA 2C11A 2CH9A 3KKGA 2F98A 4WYKB 5CF2A 5D83A 1JN5A 2CHCA 2E2TA 2W9QA 3HI7A 3SLUA 1QMAA 3UL6A 1K28A 1VQO3 2OOVA 1WMOA 3GZXB 2ML6A 3BNDA 3QK9A 5IENA 3LTDA 2LYXA 2M7OA 3DY5A 3B4OA 4AEQA 3RGAA 2WOFA 2F99A 2V1LA 2XFSA 3GZBA 5STDA 3S27A 2A15A 2Q07A 3D9RA 3MSOA 1A2KA 4PEJA 4O2HA 4EV2A 3JUQA 4MMYB 1W6GA 2CWVA 1Q824 1OPYA 1D6YA 3LT8A 4XM4A 3K5TA 4J8TA 1RJOA 3KFQC 5HGRA 1TP6A 2HMMB 1NWWA 3T8NA 3L0RA 1OH0A 2W56B 1UUVB 4EV5A 1VQ63 3CNMA 4KFEA 2BHMA 5DRVA 4K1VA 3EF8A 1GY7A 2BMQB 3DGLA 3CU3A 3WDGB 4XBXA 3CPW2 1YJ93 4HM5B 2XR8B 1JKGA 2GU3A 1SJWA 1DMNA 1A90A 2C10A 2Y73A 2QGUA 3CME3 3BNBA 2HMKB 5KP1A 1VQN3 4KVHA 5IG0A 2CFKA 1STFI 2WO0A 4H61A 4BTWA 3JVCA 1OACA 4IPBA 2Z76A 3JUMA 2CC3A 2QEX3 4WFOA 1Q40B 3JUNA 4R80A 1OHSA 3TDGA 1QAFA 2D42A 2P0XA 4L8PA 5DREA 4L8OA 3CCR3 4R4KA 4LMIA 3NV0B 5LC7A 2YX9A 4Q53A 5FGOA 4FCJA 4N3VA 4JF8A 3WA2X 2CWTA 3G6E3 1IV9A 1JB4A 1OHOA 3ER7A 1Y4KA 3KSPA 3VGNA 5IG4A 2UX0A 4O02B 2ZDJA 3MG3A 2JDIH 1V74A 5EVHA 1A2VA 1AVKA 4CCVA 4N6V0 3X42A 3GZRA 1JV2B 1AVLA 2RGQA 4NHFA 4RNZA 1N8QA 4RNYA 3FKAA 1ROVA 3HIGA 1W00A 3X3XA 1STDA 5IEOA 4BTXA 3CPOA 4K90B 1KSIA 1OGXA 1GD4A 4K61A 3X3YA 3F7XA 4XBYA 1CEWI 2P0MA 2QA43 1ISKA 4GL6A 3EB8A 1KWIA 1RRLA 1IK3A 1YI23 1QVG2 3NUVA 1IU7A 1NB5I 3FG3A 2IA7A 4HM1B 4HYZA 1VQ53 1C7HA 1MOLA 3NHXA 4QWTA 4WYKA 1M9GA 1OF5B 3CC23 2GXFA 1QAKA 3NBRA 5LC6A 1R4CA 1TFKA 6STDA 2XSHB 2E2UA 2CFDA 3HIIA 1KQS2 2HMOB 3SX1A 4AKYA 5CF1A 2HMNB 4I4KA 1FA3A 1UUWB 3F14A 3VF1A 4IT7A 5JBSA 3B8LA 1W2ZA 1IVWA 4G1MB 2F86B 1DYUA 3DGNA 2I9WA 3T8UA 3DXOA 3PYJA 4HM3B 2OQEC 5KP3A 1MNLA 1O7PB 3EJVA 1IVVA 1DMQA 2OTJ3 3OXAA 3LTCA 4WHAA 1IT8A 1SPUA 3UNLA 1QALA 2YFIB 3CMA3 1N5PA 3MPHA 3DM8A 4N6OB 2E2VA 4WP5A 2W56A 4HBRA 4KZ1A 1YHQ3 3EHCA 2OQEA 3PCRA 3OW22 4XDVA 1N5HA 4L7KA 1YIJ3 1VZZA 3X41A 5IW9A 3N9HA 4HM0B 2CFLA 2W6JH 1N9EA 3EX9A 3Q90A 3CD63 4HM8B 2W0QA 4OVMA 4HZ9B 5AIHA 3JUPA 2YFJB 3EN8A 1NU3A 3CCE3 4HZBB 3LT9A 2KXGA 4XDWA 2GU1A 4FMBA 1Q40A 3S5CA 3V98A 1E3VA 4U13A 2FXTA 3Q2PA 3GZYB 3NV0A 3SOYA 1ZO2A 1IDPA 3PCSA 3F40A 1QVF2 1S723 3EBYA 1PU4A 3NQYA 1YVBI 3NXJA 2P05A 1OCVA 2O9UX 2SBLA 3MG1A 4GB5A 3G0KA 2JQ5A 1LOXA 5D81A 3MHEA 3PS8A 4HKVB 3BB9A 1LVNA 3I563 2P09A 2GEYA 1FUWA 3FZWA 1VQ73 3LMLA 1IQXA 3MKIA 3RGRA 3ECFA 2OTL3 1JB2A 2P38A 3KE7A 1M1K4 5EQLA 2Z77A 4OUQA 3ROBA 3WOEB 3FG4A 3NBJA 1W01A 2IMJA 3FSDA 3IMAB 5IEPA 3G8ZA 1W4NA 3CCU3 2Z6BA 5A0OB 2LQVA 3AMOB 1JJ22 1PFPA 3WA3A 3J7Yd 2INXA 1F8NA 4XBTA 4NREA 4EYCA 3CCS3 1E97A 1JRQA 3UJMA 5AYSC 2OWPA 3KZTA 4MEIA 3A76A 1IQYA 3WOFB 3F8HA 3K9MC 1OF5A 1UI8A 2K0MA 3G713 1Q42A 2YFLB 5BXQA 1WQLB 3O8YA 3NQZA 4N6UA 4N6NB 1TUHA 1JB5A 1LNHA 1O7MB 2WGOA 1VQM3 5AYRB 2RSXA 4X2OA 5FW5A 1VQ93 3GRDA 4LGQA 1S5AA 5AEWB 1Q814 4MMXB 3OV4A 1CYUA 2GBWB 4JRFA 2CIUA 1W02A 3ALAA 1OHPA 4N6LA 5TGNA 2B24B 3CCJ3 4FCZA 1GY6A 1WMNA 4X2HA 3T0UA 5AEUB 2XFTA 4LSOA 5AIIA 3F7SA 5IERA 1GD3A 3KIIA 3M8CA 2WOHA 2BMRB 3CCM3 1Q7Y4 1O7WB 3K63A 1RRHA 1TFOA 1EKMA 1WTHA 2CKFB 1D6ZA 3EN1B 3U1WA 2GEXA 1ROAA 1M904 3KN4A 1GY5A 4WWUC 4TX4A 2XF3A 3CXC2 2HMLB 3K7CA 5JPPA 4R9KA 1D6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLZ A;  2RCD A;  1EA2 A;  1BUQ A;  3HZP A;  3SOA A;  3K0Z A;  1U5O A;  4IIA A;  2BNG A;  2R4I A;  1Z1S A;  1CQS A;  4ORL A;  1ASK A;  2PZV A;  1HKX A;  3LZA A;  1GYB A;  3FF0 A;  3DUK A;  4STD A;  1O7G B;  3OWU A;  5D82 A;  1K41 A;  4R1K A;  3F8X A;  4HM7 B;  3CNX A;  2RFR A;  3HX8 A;  2B1X B;  2XRX B;  1DMM A;  4K1U A;  3B7C A;  1W6Y A;  3VSY A;  1JN5 B;  4HM2 B;  3EC9 A;  4FCM A;  3WMD A;  5AI1 A;  1NDO B;  4CDL A;  4HM4 B;  5CK6 A;  1ZX2 A;  3LYG A;  4HM6 B;  3IPT A;  3SED A;  2STD A;  1GS3 A;  5IG5 A;  8CHO A;  1E3R A;  3STD A;  1QJG A;  5AIF A;  5KP4 A;  5IF6 A;  2XSO B;  5CXO A;  4R9L A;  5JPU A;  1ULI B;  3H51 A;  1ULJ B;  5G2G A;  1JKG B;  3EQQ B;  4XB5 A;  4MJD A;  3JUO A;  7STD A;  1AR0 A;  4HJL B;  2HMJ B;  5AIG A;  3OWY A;  3OX9 A;  3OWS A;  3F9S A;  1O7H B;  2W2C A;  5IG3 A;  3B4P A;  5BVB A;  4H3U A;  4RZM A;  3G16 A;  3MG2 A;  2BMO B;  3FLJ A;  4LEH A;  3MYT A;  2QIY A;  4J9A A;  3FH1 A;  3I0Y A;  2GBX B;  2K54 A;  3E99 A;  3FGY A;  3H3H A;  2Z7A A;  1EG9 B;  3FF2 A;  1O7N B;  3DZL A;  3EBT A;  1OGZ A;  1OUN A;  4HVN A;  3NM2 A;  3HK4 A;  3GWR A;  5CLK A;  3DMC A;  3KKG A;  2F98 A;  4WYK B;  5CF2 A;  5D83 A;  1JN5 A;  2CHC A;  1QMA A;  3GZX B;  5IEN A;  3B4O A;  3RGA A;  2F99 A;  3GZB A;  5STD A;  2A15 A;  3D9R A;  3MSO A;  1A2K A;  4PEJ A;  3JUQ A;  1OPY A;  4XM4 A;  4J8T A;  5HGR A;  1TP6 A;  2HMM B;  1NWW A;  3T8N A;  1OH0 A;  1UUV B;  3CNM A;  5DRV A;  4K1V A;  3EF8 A;  1GY7 A;  2BMQ B;  3CU3 A;  4XBX A;  4HM5 B;  2XR8 B;  1JKG A;  1SJW A;  1DMN A;  2QGU A;  2HMK B;  5KP1 A;  4KVH A;  5IG0 A;  2Z76 A;  3JUM A;  1Q40 B;  3JUN A;  1OHS A;  4L8P A;  5DRE A;  4L8O A;  4LMI A;  3NV0 B;  4Q53 A;  4FCJ A;  4N3V A;  1JB4 A;  1OHO A;  3ER7 A;  3KSP A;  5IG4 A;  3VGN A;  2UX0 A;  3MG3 A;  5EVH A;  3GZR A;  2RGQ A;  3FKA A;  1W00 A;  1STD A;  5IEO A;  3CPO A;  1OGX A;  3F7X A;  4XBY A;  1ISK A;  3NUV A;  4HM1 B;  1C7H A;  3NHX A;  4WYK A;  1OF5 B;  2GXF A;  3NBR A;  6STD A;  2XSH B;  2HMO B;  5CF1 A;  2HMN B;  4I4K A;  1UUW B;  3F14 A;  3B8L A;  2F86 B;  3T8U A;  2I9W A;  3DXO A;  5KP3 A;  4HM3 B;  1O7P B;  3EJV A;  1DMQ A;  3OXA A;  3UNL A;  2YFI B;  3DM8 A;  4WP5 A;  3EHC A;  4XDV A;  4L7K A;  1VZZ A;  4HM0 B;  3EX9 A;  3Q90 A;  4HM8 B;  4OVM A;  4HZ9 B;  5AIH A;  3JUP A;  2YFJ B;  3EN8 A;  1NU3 A;  4HZB B;  4XDW A;  1Q40 A;  3S5C A;  1E3V A;  4U13 A;  3GZY B;  3NV0 A;  3SOY A;  1ZO2 A;  1IDP A;  3F40 A;  3EBY A;  3NXJ A;  1OCV A;  3MG1 A;  4GB5 A;  3G0K A;  2JQ5 A;  5D81 A;  3MHE A;  4HKV B;  3BB9 A;  2GEY A;  3FZW A;  3MKI A;  3RGR A;  3ECF A;  1JB2 A;  3KE7 A;  2Z77 A;  4OUQ A;  3ROB A;  1W01 A;  2IMJ A;  3FSD A;  5IEP A;  3G8Z A;  2INX A;  4XBT A;  1E97 A;  3UJM A;  2OWP A;  3KZT A;  3A76 A;  3F8H A;  1OF5 A;  1Q42 A;  2YFL B;  5BXQ A;  1WQL B;  1TUH A;  1JB5 A;  1O7M B;  4X2O A;  5FW5 A;  3GRD A;  4LGQ A;  1S5A A;  5AEW B;  3OV4 A;  2GBW B;  1W02 A;  1OHP A;  5TGN A;  2B24 B;  4X2H A;  1GY6 A;  5AEU B;  5IER A;  5AII A;  3F7S A;  3M8C A;  2BMR B;  1O7W B;  2CKF B;  3EN1 B;  2GEX A;  1GY5 A;  4WWU C;  2HML B;  3K7C A;  5JPP A;  4R9K A; 
#chains in the Genus database with same CATH topology
 1UI7 A;  5G1L A;  6GSP A;  2KAA A;  3BLZ A;  1C54 A;  2RCD A;  4J5G A;  1EA2 A;  1BUQ A;  4GHO A;  2XEP A;  2O3O A;  5ELU A;  1GOY A;  4I5Q A;  1A67 A;  1B2X A;  1V57 A;  1MGW A;  1MWT A;  1MWS A;  3HZP A;  4FMD A;  3PZW A;  1VQP 3;  1YNV X;  1K73 4;  1K8A 4;  3SOA A;  1T5Y A;  3K0Z A;  3RDE A;  2MF7 A;  1U5O A;  1G96 A;  2FGT A;  4IIA A;  3UL5 A;  1FGO A;  2BNG A;  2R4I A;  3KCH A;  2F5M A;  2UUG C;  1FGT A;  1Z1S A;  1CQS A;  3KSE D;  1VQK 3;  4ORL A;  1LOV A;  3I55 3;  1JBS A;  1ASK A;  1US1 A;  2PZV A;  1HU9 A;  1HKX A;  3LZA A;  3N8B A;  4J5K A;  7RNT A;  1X1Y A;  1GYB A;  3FF0 A;  3DUK A;  4STD A;  3SXX A;  2CK3 H;  2IY2 A;  1O7G B;  1BSA A;  3V99 A;  3GAX A;  3OWU A;  2F4Y A;  5D82 A;  1X1W A;  4FR9 A;  1FUT A;  1Q86 4;  3PXM A;  2ZL8 A;  3WR2 A;  3BNC A;  4ZM8 A;  1K41 A;  4AKZ A;  4R1K A;  3CC7 3;  3F8X A;  1DVD A;  2CWU A;  4RBN A;  4CJN A;  4ILF A;  2CG0 A;  4O3V A;  3BIR A;  4HM7 B;  3CNX A;  2RFR A;  3HX8 A;  2B1X B;  2XRX B;  2XGN A;  1DMM A;  1DVC A;  3UB1 A;  4K1U A;  3B7C A;  1Q7H A;  1W6Y A;  1W5Z A;  3VSY A;  4BL3 A;  1JN5 B;  1FGR A;  2UGI A;  4HM2 B;  1SQW A;  1WNH A;  3ZG5 A;  1JNQ A;  3EC9 A;  1KD1 4;  1M1X B;  4FCM A;  3WMD A;  4LYL B;  2XH9 A;  1B20 A;  3X40 A;  3BNE A;  4KFD A;  2IUJ A;  3LXU X;  5I97 A;  3RNT A;  5AI1 A;  5KP3 A;  1U8C B;  1DET A;  1YIT 3;  1NDO B;  3SVA A;  4CDL A;  4HM4 B;  2Y74 A;  5CK6 A;  1BU4 A;  1ZX2 A;  1BNJ A;  2BT3 A;  3DGM A;  3LYG A;  4HM6 B;  3AMO A;  3IPT A;  3SED A;  3LH4 A;  2STD A;  1GS3 A;  1IVX A;  2CW9 A;  5IG5 A;  1NO3 A;  1E3R A;  2CG1 A;  8CHO A;  2FNQ A;  1B27 A;  1YJW 3;  4BU4 A;  2W03 A;  1N8R 4;  1KC8 4;  1HZ1 A;  3STD A;  1AV4 A;  1TU5 A;  4DKI A;  1QJG A;  1LRA A;  3WOD G;  5G1K A;  3CC4 3;  4KFF A;  1EQK A;  3V92 A;  2ML5 A;  5AIF A;  2ZHX B;  2AAE A;  5KP4 A;  5IF6 A;  5EEO A;  2OCT A;  2XSO B;  5CXO A;  4R9L A;  5JPU A;  1IT7 A;  1ULI B;  3H51 A;  1ULJ B;  5G2G A;  3S67 A;  1JKG B;  3EQQ B;  5ELJ A;  3QRD A;  1YJN 3;  1NNV A;  2KCD A;  4NPB A;  3D3L A;  4XB5 A;  1K9M 4;  2WGQ A;  4MJD A;  1B2U A;  2W9P A;  3JUO A;  7STD A;  1JZO A;  3CCL 3;  1AR0 A;  4HJL B;  4N6T A;  2HMJ B;  2D1W A;  2K3D A;  3LTB A;  5M19 A;  3LOY A;  3N54 B;  3NBB A;  2H0I A;  1BNG A;  5AIG A;  4EC6 A;  3Q1C A;  4BIR A;  1RGG A;  1VQ8 3;  3NX0 A;  3NM7 A;  3U97 A;  1GOU A;  2CFG A;  3OX9 A;  3OWY A;  1I2E A;  5BU4 A;  1I0X A;  4MMZ B;  3OWS A;  1SIH A;  1T2I A;  3F9S A;  4FMC A;  1O7H B;  2W2C A;  5IG3 A;  1FGM A;  1FGQ A;  1FUS A;  1X1X A;  1RKY A;  3CCV 3;  1IVU A;  3AHW A;  3B4P A;  2L4V A;  3EE1 A;  1NB3 I;  1NJI 4;  5BVB A;  4H3U A;  3IJE B;  4RZM A;  3FG1 A;  3AGO A;  3G16 A;  5M1A A;  3MG2 A;  1N9J A;  2BMO B;  2PNC A;  3FLJ A;  1LXE A;  2KF3 A;  3PGB A;  1WMP A;  1BSD A;  1UW1 A;  2XGL A;  1W2B 2;  2BO9 B;  4LEH A;  1BNR A;  3MYT A;  4EBG A;  3G4S 3;  1W7C A;  3A5E A;  4OK0 A;  3CCQ 3;  1YVS A;  2QIY A;  3DGO A;  1BRG A;  1IV7 A;  1I3F A;  3S28 A;  3MWZ A;  2F56 A;  1CYV A;  1B2S A;  1YGE A;  3S29 A;  2KRT A;  2OTJ 3;  1W6C A;  2C4B A;  4J9A A;  3FH1 A;  3I0Y A;  2MC8 A;  2GBX B;  2K54 A;  4O8S A;  1VQ4 3;  1SII A;  1X1U A;  1TIJ A;  2IUK A;  1J2B A;  9RNT A;  3LTA A;  4BTY A;  3E99 A;  3FGY A;  3H3H A;  2Z7A A;  4LZI A;  2CFW A;  2W04 A;  5BIR A;  1UGH I;  1EG9 B;  1GSP A;  4FMA A;  3FCS B;  4N6M A;  1L5G B;  3X3Z A;  3FF2 A;  1O7N B;  3DZL A;  3EBT A;  1OGZ A;  1T3B A;  1OUN A;  1RN7 A;  1IQ8 A;  1ZS7 A;  3NM2 A;  4HVN A;  1VQL 3;  2OOV C;  3HK4 A;  1I70 A;  1PYL A;  3GWR A;  5CLK A;  4EXR A;  3DMC A;  2C11 A;  4EW5 A;  2CH9 A;  3KKG A;  2F98 A;  4WYK B;  5CF2 A;  5D83 A;  1JN5 A;  2CHC A;  2E2T A;  2W9Q A;  3HI7 A;  3SLU A;  1ZGX A;  1QMA A;  1SAR A;  1K28 A;  3UL6 A;  1VQO 3;  1BRS A;  2OOV A;  1WMO A;  3GZX B;  1I3I A;  2ML6 A;  3BND A;  3QK9 A;  5IEN A;  3LTD A;  1BNE A;  2LYX A;  2M7O A;  3DY5 A;  3B4O A;  4AEQ A;  3RGA A;  2WOF A;  2F99 A;  2V1L A;  2XFS A;  3GZB A;  5STD A;  3S27 A;  1BNS A;  2A15 A;  1G0T A;  2Q07 A;  3D9R A;  3MSO A;  1RLS A;  1BIR A;  1MGR A;  3WHO A;  1A2K A;  4PEJ A;  2KF6 A;  4O2H A;  4EV2 A;  5RNT A;  3JUQ A;  1UCK A;  4MMY B;  1W6G A;  1YGW A;  2CWV A;  3DH2 A;  1Q82 4;  1OPY A;  2RNT A;  1B2Z A;  1D6Y A;  1RGH A;  3LT8 A;  4XM4 A;  3K5T A;  4J8T A;  2IYJ A;  1RJO A;  3KFQ C;  5HGR A;  1TP6 A;  2HMM B;  1NWW A;  3T8N A;  3L0R A;  3D79 A;  1OH0 A;  2W56 B;  2KF4 A;  5M18 A;  1UUV B;  4EV5 A;  1VQ6 3;  3CNM A;  2AAD A;  4KFE A;  2BHM A;  5DRV A;  4K1V A;  3EF8 A;  1GY7 A;  2BMQ B;  3DGL A;  3CU3 A;  3WDG B;  4XBX A;  3CPW 2;  1YJ9 3;  4HM5 B;  2R41 A;  2XR8 B;  1JKG A;  1RN4 A;  2GU3 A;  1SJW A;  1DMN A;  1A90 A;  1BNF A;  2C10 A;  2Y73 A;  3BU4 A;  1AQZ A;  2QGU A;  1UCI A;  3CME 3;  3BNB A;  1GOV A;  1B21 A;  2HMK B;  4KT3 B;  5KP1 A;  1VQN 3;  4KVH A;  5IG0 A;  1STF I;  2CFK A;  2WO0 A;  4H61 A;  5GSP A;  3ZFZ A;  4BTW A;  3JVC A;  1OAC A;  8RNT A;  4IPB A;  2Z76 A;  3JUM A;  1T2H A;  2CC3 A;  2QEX 3;  1BRI A;  1D6U A;  1Q40 B;  4WFO A;  3JUN A;  4R80 A;  1OHS A;  4HAA A;  3TDG A;  1QAF A;  2D42 A;  2P0X A;  4L8P A;  1LQG C;  5DRE A;  4L8O A;  4BTX A;  3CCR 3;  4R4K A;  4LMI A;  3NV0 B;  5LC7 A;  2YX9 A;  4Q53 A;  5FGO A;  4FCJ A;  4N3V A;  1BAO A;  4JF8 A;  3WA2 X;  2CWT A;  3G6E 3;  1BRK A;  1IV9 A;  1BVI A;  1JB4 A;  1BRJ A;  1OHO A;  3ER7 A;  1Y4K A;  3KSP A;  3VGN A;  5IG4 A;  2UX0 A;  4O02 B;  2ZDJ A;  1LQM B;  4BL2 A;  1RGE A;  3MG3 A;  2JDI H;  1V74 A;  5EVH A;  1A2V A;  1AVK A;  4CCV A;  1I0V A;  4N6V 0;  1BSE A;  3GZR A;  3X42 A;  1JV2 B;  1MWU A;  1AVL A;  1A2P A;  2RGQ A;  3GSP A;  4NHF A;  4RNZ A;  1N8Q A;  4RNY A;  3FKA A;  1UUG B;  1ROV A;  3HIG A;  1W00 A;  3X3X A;  1STD A;  5IEO A;  1V58 A;  1UCJ A;  1RGL A;  2CX1 A;  3CPO A;  1KSI A;  1OGX A;  4K90 B;  1GD4 A;  1LOY A;  1VQ5 3;  4K61 A;  3X3Y A;  3F7X A;  2L1S A;  4XBY A;  1CEW I;  1BNI A;  2P0M A;  1UDI I;  2QA4 3;  1ISK A;  4GL6 A;  3EB8 A;  1KWI A;  1RRL A;  1IK3 A;  1YI2 3;  2GSP A;  3NUV A;  1QVG 2;  1IU7 A;  1NB5 I;  3FG3 A;  2IA7 A;  1TTO A;  2BIR A;  4HM1 B;  4HYZ A;  1I2F A;  1C7H A;  1MOL A;  2KF5 A;  3AHS A;  3NHX A;  4QWT A;  4WYK A;  1M9G A;  1OF5 B;  3CC2 3;  1FW7 A;  2GXF A;  1QAK A;  3NBR A;  5LC6 A;  1R4C A;  1TFK A;  6STD A;  2XSH B;  2E2U A;  2CFD A;  2CX0 A;  3HII A;  1KQS 2;  1RHL A;  1B2M A;  2HMO B;  1BRN L;  3SX1 A;  4AKY A;  5CF1 A;  2HMN B;  4I4K A;  3URP A;  1FA3 A;  1UUW B;  3F14 A;  3VF1 A;  4IT7 A;  5JBS A;  3B8L A;  1W2Z A;  1IVW A;  4G1M B;  2F86 B;  1DYU A;  3DGN A;  2I9W A;  3T8U A;  3DXO A;  3PYJ A;  4HM3 B;  1JZD A;  2OQE C;  1MNL A;  1O7P B;  3EJV A;  1IVV A;  1DMQ A;  1GMP A;  1HYF A;  3OXA A;  3LTC A;  4WHA A;  1IT8 A;  1SPU A;  1EUI C;  1QAL A;  3UNL A;  1B3S A;  1RGK A;  2SAR A;  1N5P A;  2YFI B;  3CMA 3;  3MPH A;  3DM8 A;  4N6O B;  2E2V A;  4WP5 A;  2W56 A;  4HBR A;  3D5I A;  4KZ1 A;  1YHQ 3;  3EHC A;  2OQE A;  3PCR A;  3OW2 2;  4XDV A;  1EEJ A;  1N5H A;  1CH0 A;  4L7K A;  1YIJ 3;  1VZZ A;  3X41 A;  5IW9 A;  3N9H A;  4HM0 B;  1UCL A;  2CFL A;  2W6J H;  3Q3F A;  4RNT A;  1BUJ A;  1TRP A;  1N9E A;  1FYS A;  3EX9 A;  1AY7 A;  1FZU A;  3Q90 A;  3CD6 3;  1MWR A;  4HM8 B;  2W0Q A;  4OVM A;  4HZ9 B;  5AIH A;  1BSC A;  3JUP A;  2YFJ B;  1BGS A;  1NU3 A;  3EN8 A;  3CCE 3;  1RMS A;  1JBR A;  4HZB B;  3LT9 A;  2KXG A;  2RBI A;  4XDW A;  2GU1 A;  3DGY A;  4FMB A;  3D5G A;  1Q40 A;  3S5C A;  3V98 A;  7GSP A;  1E3V A;  4U13 A;  2FXT A;  2HOH A;  3Q2P A;  3GZY B;  1BSB A;  3NV0 A;  3SOY A;  1ZO2 A;  1IDP A;  3PCS A;  3F40 A;  1QVF 2;  2H0G A;  1S72 3;  3EBY A;  1PU4 A;  3NQY A;  1YVB I;  3NXJ A;  1RNT A;  2P05 A;  1OCV A;  3SYU A;  1RCL A;  2O9U X;  1JBT A;  1UGI A;  1R4Y A;  2SBL A;  3MG1 A;  4GB5 A;  3G0K A;  2JQ5 A;  5D81 A;  3MHE A;  3PS8 A;  1VQQ A;  4HKV B;  3BB9 A;  1RCK A;  1LVN A;  1RN1 A;  5HOH A;  3I56 3;  2P09 A;  2GEY A;  1FUW A;  3FZW A;  1VQ7 3;  3LML A;  1IQX A;  3MKI A;  1I2G A;  3RGR A;  1RGC A;  1LOW A;  3ECF A;  2OTL 3;  1JB2 A;  2P38 A;  1RTU A;  3KE7 A;  1M1K 4;  5EQL A;  2Z77 A;  1GMQ A;  4OUQ A;  3ROB A;  3WOE B;  3FG4 A;  3NBJ A;  1W01 A;  2IMJ A;  3FSD A;  3IMA B;  5IEP A;  3G8Z A;  1W4N A;  1I8V A;  3CCU 3;  1DE3 A;  2Z6B A;  5A0O B;  2LQV A;  1Q9E A;  3ZG0 A;  3AMO B;  1JJ2 2;  1PFP A;  3WA3 A;  3J7Y d;  3AGN A;  1IYY A;  2INX A;  1F8N A;  3HOH A;  4XBT A;  2F5W A;  4NRE A;  2BU4 A;  4EYC A;  3CCS 3;  1E97 A;  1JRQ A;  3UJM A;  5AYS C;  2OWP A;  3KZT A;  4MEI A;  3A76 A;  1IQY A;  4CPK A;  3WOF B;  3F8H A;  3K9M C;  1OF5 A;  1UI8 A;  2K0M A;  3G71 3;  1BOX A;  1Q42 A;  2YFL B;  5BXQ A;  1WQL B;  3O8Y A;  3NQZ A;  4N6U A;  1RDS A;  1RGF A;  4N6N B;  1TUH A;  1JB5 A;  2ZA4 A;  1LNH A;  1PY3 A;  1O7M B;  2WGO A;  1VQM 3;  1RNB A;  5AYR B;  2RSX A;  4X2O A;  5FW5 A;  1VQ9 3;  3GRD A;  4LGQ A;  1S5A A;  3D4A A;  5AEW B;  1Q81 4;  4MMX B;  3OV4 A;  4GSP A;  1CYU A;  2H0H A;  1TRQ A;  2GBW B;  4JRF A;  2CIU A;  1W02 A;  3ALA A;  1OHP A;  4N6L A;  5TGN A;  1TJD A;  2B24 B;  1BRH A;  1RSN A;  4FCZ A;  1GY6 A;  1WMN A;  4HOH A;  4X2H A;  3T0U A;  5AEU B;  3CCJ 3;  1LNI A;  2XFT A;  4LSO A;  3F7S A;  5AII A;  5IER A;  1GD3 A;  3KII A;  3M8C A;  2WOH A;  2BMR B;  3CCM 3;  1Q7Y 4;  1O7W B;  3K63 A;  1RRH A;  1TFO A;  1GMR A;  1EKM A;  1WTH A;  2CKF B;  2J8X B;  1G02 A;  1BAN A;  1D6Z A;  3EN1 B;  3U1W A;  2GEX A;  1ROA A;  1M90 4;  3KN4 A;  1GY5 A;  4WWU C;  4TX4 A;  1RGA A;  2XF3 A;  2HML B;  3CXC 2;  3K7C A;  5JPP A;  4R9K A;  6RNT A;  1LOX A; 
#chains in the Genus database with same CATH homology
 1UI7 A;  3BLZ A;  2RCD A;  1EA2 A;  1BUQ A;  2XEP A;  2O3O A;  5ELU A;  1A67 A;  3HZP A;  1VQP 3;  4FMD A;  3PZW A;  1K73 4;  1K8A 4;  3SOA A;  1T5Y A;  3K0Z A;  3RDE A;  2MF7 A;  1U5O A;  1G96 A;  2FGT A;  4IIA A;  3UL5 A;  1FGO A;  2BNG A;  2R4I A;  1FGT A;  1Z1S A;  1CQS A;  3KSE D;  1VQK 3;  4ORL A;  3I55 3;  1ASK A;  1US1 A;  2PZV A;  1HU9 A;  1HKX A;  3LZA A;  3N8B A;  1GYB A;  3FF0 A;  3DUK A;  4STD A;  3SXX A;  2CK3 H;  1O7G B;  3V99 A;  3GAX A;  3OWU A;  5D82 A;  4FR9 A;  1Q86 4;  3PXM A;  2ZL8 A;  3BNC A;  4ZM8 A;  1K41 A;  4AKZ A;  4R1K A;  3CC7 3;  3F8X A;  1DVD A;  2CWU A;  4RBN A;  2CG0 A;  4O3V A;  4HM7 B;  3CNX A;  2RFR A;  3HX8 A;  2B1X B;  2XRX B;  2XGN A;  1DMM A;  1DVC A;  3UB1 A;  4K1U A;  3B7C A;  1W6Y A;  1W5Z A;  3VSY A;  1JN5 B;  1FGR A;  4HM2 B;  1SQW A;  1WNH A;  1JNQ A;  3EC9 A;  1KD1 4;  1M1X B;  4FCM A;  3WMD A;  2XH9 A;  3X40 A;  3BNE A;  4KFD A;  2IUJ A;  3LXU X;  5I97 A;  5AI1 A;  1U8C B;  1YIT 3;  1NDO B;  3SVA A;  4CDL A;  4HM4 B;  2Y74 A;  5CK6 A;  1ZX2 A;  3DGM A;  2BT3 A;  3LYG A;  4HM6 B;  3AMO A;  3IPT A;  3SED A;  3LH4 A;  2STD A;  1GS3 A;  1IVX A;  2CW9 A;  5IG5 A;  1NO3 A;  1E3R A;  2CG1 A;  8CHO A;  2FNQ A;  1YJW 3;  2W03 A;  1N8R 4;  1KC8 4;  3STD A;  1AV4 A;  1TU5 A;  1QJG A;  1EQK A;  3WOD G;  3CC4 3;  4KFF A;  3V92 A;  2ML5 A;  5AIF A;  5KP4 A;  5IF6 A;  5EEO A;  2OCT A;  2XSO B;  5CXO A;  4R9L A;  5JPU A;  1IT7 A;  1ULI B;  3H51 A;  1ULJ B;  5G2G A;  3S67 A;  1JKG B;  3EQQ B;  5ELJ A;  3QRD A;  1YJN 3;  4XB5 A;  2KCD A;  1K9M 4;  3D3L A;  2WGQ A;  4MJD A;  2W9P A;  3JUO A;  7STD A;  3CCL 3;  1AR0 A;  4HJL B;  4N6T A;  2HMJ B;  2D1W A;  3LTB A;  3LOY A;  3N54 B;  3NBB A;  5AIG A;  4EC6 A;  3Q1C A;  1VQ8 3;  3NX0 A;  3NM7 A;  3U97 A;  2CFG A;  3OWY A;  3OX9 A;  4MMZ B;  3OWS A;  1SIH A;  3F9S A;  4FMC A;  1O7H B;  2W2C A;  5IG3 A;  1FGM A;  1FGQ A;  1RKY A;  3CCV 3;  1IVU A;  3B4P A;  3EE1 A;  2L4V A;  1NB3 I;  1NJI 4;  5BVB A;  4H3U A;  3IJE B;  4RZM A;  3FG1 A;  3G16 A;  3MG2 A;  1N9J A;  2BMO B;  2PNC A;  3FLJ A;  1LXE A;  3PGB A;  1WMP A;  1UW1 A;  2XGL A;  1W2B 2;  2BO9 B;  4LEH A;  3MYT A;  4EBG A;  3G4S 3;  1W7C A;  3CCQ 3;  4OK0 A;  2QIY A;  3DGO A;  1IV7 A;  3S28 A;  3MWZ A;  1CYV A;  1YGE A;  3S29 A;  2KRT A;  1W6C A;  4J9A A;  3FH1 A;  3I0Y A;  2MC8 A;  2GBX B;  2K54 A;  4O8S A;  1VQ4 3;  1SII A;  1TIJ A;  2IUK A;  1J2B A;  3LTA A;  4BTY A;  3E99 A;  3FGY A;  3H3H A;  2Z7A A;  4LZI A;  2CFW A;  2W04 A;  1EG9 B;  4FMA A;  3FCS B;  4N6M A;  1L5G B;  3X3Z A;  3FF2 A;  1O7N B;  3DZL A;  3EBT A;  1OGZ A;  1OUN A;  1RN7 A;  1IQ8 A;  3NM2 A;  4HVN A;  1VQL 3;  2OOV C;  3HK4 A;  3GWR A;  5CLK A;  4EXR A;  3DMC A;  2C11 A;  2CH9 A;  3KKG A;  2F98 A;  4WYK B;  5CF2 A;  5D83 A;  1JN5 A;  2CHC A;  2E2T A;  2W9Q A;  3HI7 A;  3SLU A;  1QMA A;  3UL6 A;  1K28 A;  1VQO 3;  2OOV A;  1WMO A;  3GZX B;  2ML6 A;  3BND A;  3QK9 A;  5IEN A;  3LTD A;  2LYX A;  2M7O A;  3DY5 A;  3B4O A;  4AEQ A;  3RGA A;  2WOF A;  2F99 A;  2V1L A;  2XFS A;  3GZB A;  5STD A;  3S27 A;  2A15 A;  2Q07 A;  3D9R A;  3MSO A;  1A2K A;  4PEJ A;  4O2H A;  4EV2 A;  3JUQ A;  4MMY B;  1W6G A;  2CWV A;  1Q82 4;  1OPY A;  1D6Y A;  3LT8 A;  4XM4 A;  3K5T A;  4J8T A;  1RJO A;  3KFQ C;  5HGR A;  1TP6 A;  2HMM B;  1NWW A;  3T8N A;  3L0R A;  1OH0 A;  2W56 B;  1UUV B;  4EV5 A;  1VQ6 3;  3CNM A;  4KFE A;  2BHM A;  5DRV A;  4K1V A;  3EF8 A;  1GY7 A;  2BMQ B;  3DGL A;  3CU3 A;  3WDG B;  4XBX A;  3CPW 2;  1YJ9 3;  4HM5 B;  2XR8 B;  1JKG A;  2GU3 A;  1SJW A;  1DMN A;  1A90 A;  2C10 A;  2Y73 A;  2QGU A;  3CME 3;  3BNB A;  2HMK B;  5KP1 A;  1VQN 3;  4KVH A;  5IG0 A;  2CFK A;  1STF I;  2WO0 A;  4H61 A;  4BTW A;  3JVC A;  1OAC A;  4IPB A;  2Z76 A;  3JUM A;  2CC3 A;  2QEX 3;  4WFO A;  1Q40 B;  3JUN A;  4R80 A;  1OHS A;  3TDG A;  1QAF A;  2D42 A;  2P0X A;  4L8P A;  5DRE A;  4L8O A;  3CCR 3;  4R4K A;  4LMI A;  3NV0 B;  5LC7 A;  2YX9 A;  4Q53 A;  5FGO A;  4FCJ A;  4N3V A;  4JF8 A;  3WA2 X;  2CWT A;  3G6E 3;  1IV9 A;  1JB4 A;  1OHO A;  3ER7 A;  1Y4K A;  3KSP A;  3VGN A;  5IG4 A;  2UX0 A;  4O02 B;  2ZDJ A;  3MG3 A;  2JDI H;  1V74 A;  5EVH A;  1A2V A;  1AVK A;  4CCV A;  4N6V 0;  3X42 A;  3GZR A;  1JV2 B;  1AVL A;  2RGQ A;  4NHF A;  4RNZ A;  1N8Q A;  4RNY A;  3FKA A;  1ROV A;  3HIG A;  1W00 A;  3X3X A;  1STD A;  5IEO A;  4BTX A;  3CPO A;  4K90 B;  1KSI A;  1OGX A;  1GD4 A;  4K61 A;  3X3Y A;  3F7X A;  4XBY A;  1CEW I;  2P0M A;  2QA4 3;  1ISK A;  4GL6 A;  3EB8 A;  1KWI A;  1RRL A;  1IK3 A;  1YI2 3;  1QVG 2;  3NUV A;  1IU7 A;  1NB5 I;  3FG3 A;  2IA7 A;  4HM1 B;  4HYZ A;  1VQ5 3;  1C7H A;  1MOL A;  3NHX A;  4QWT A;  4WYK A;  1M9G A;  1OF5 B;  3CC2 3;  2GXF A;  1QAK A;  3NBR A;  5LC6 A;  1R4C A;  1TFK A;  6STD A;  2XSH B;  2E2U A;  2CFD A;  3HII A;  1KQS 2;  2HMO B;  3SX1 A;  4AKY A;  5CF1 A;  2HMN B;  4I4K A;  1FA3 A;  1UUW B;  3F14 A;  3VF1 A;  4IT7 A;  5JBS A;  3B8L A;  1W2Z A;  1IVW A;  4G1M B;  2F86 B;  1DYU A;  3DGN A;  2I9W A;  3T8U A;  3DXO A;  3PYJ A;  4HM3 B;  2OQE C;  5KP3 A;  1MNL A;  1O7P B;  3EJV A;  1IVV A;  1DMQ A;  2OTJ 3;  3OXA A;  3LTC A;  4WHA A;  1IT8 A;  1SPU A;  3UNL A;  1QAL A;  2YFI B;  3CMA 3;  1N5P A;  3MPH A;  3DM8 A;  4N6O B;  2E2V A;  4WP5 A;  2W56 A;  4HBR A;  4KZ1 A;  1YHQ 3;  3EHC A;  2OQE A;  3PCR A;  3OW2 2;  4XDV A;  1N5H A;  4L7K A;  1YIJ 3;  1VZZ A;  3X41 A;  5IW9 A;  3N9H A;  4HM0 B;  2CFL A;  2W6J H;  1N9E A;  3EX9 A;  3Q90 A;  3CD6 3;  4HM8 B;  2W0Q A;  4OVM A;  4HZ9 B;  5AIH A;  3JUP A;  2YFJ B;  3EN8 A;  1NU3 A;  3CCE 3;  4HZB B;  3LT9 A;  2KXG A;  4XDW A;  2GU1 A;  4FMB A;  1Q40 A;  3S5C A;  3V98 A;  1E3V A;  4U13 A;  2FXT A;  3Q2P A;  3GZY B;  3NV0 A;  3SOY A;  1ZO2 A;  1IDP A;  3PCS A;  3F40 A;  1QVF 2;  1S72 3;  3EBY A;  1PU4 A;  3NQY A;  1YVB I;  3NXJ A;  2P05 A;  1OCV A;  2O9U X;  2SBL A;  3MG1 A;  4GB5 A;  3G0K A;  2JQ5 A;  1LOX A;  5D81 A;  3MHE A;  3PS8 A;  4HKV B;  3BB9 A;  1LVN A;  3I56 3;  2P09 A;  2GEY A;  1FUW A;  3FZW A;  1VQ7 3;  3LML A;  1IQX A;  3MKI A;  3RGR A;  3ECF A;  2OTL 3;  1JB2 A;  2P38 A;  3KE7 A;  1M1K 4;  5EQL A;  2Z77 A;  4OUQ A;  3ROB A;  3WOE B;  3FG4 A;  3NBJ A;  1W01 A;  2IMJ A;  3FSD A;  3IMA B;  5IEP A;  3G8Z A;  1W4N A;  3CCU 3;  2Z6B A;  5A0O B;  2LQV A;  3AMO B;  1JJ2 2;  1PFP A;  3WA3 A;  3J7Y d;  2INX A;  1F8N A;  4XBT A;  4NRE A;  4EYC A;  3CCS 3;  1E97 A;  1JRQ A;  3UJM A;  5AYS C;  2OWP A;  3KZT A;  4MEI A;  3A76 A;  1IQY A;  3WOF B;  3F8H A;  3K9M C;  1OF5 A;  1UI8 A;  2K0M A;  3G71 3;  1Q42 A;  2YFL B;  5BXQ A;  1WQL B;  3O8Y A;  3NQZ A;  4N6U A;  4N6N B;  1TUH A;  1JB5 A;  1LNH A;  1O7M B;  2WGO A;  1VQM 3;  5AYR B;  2RSX A;  4X2O A;  5FW5 A;  1VQ9 3;  3GRD A;  4LGQ A;  1S5A A;  5AEW B;  1Q81 4;  4MMX B;  3OV4 A;  1CYU A;  2GBW B;  4JRF A;  2CIU A;  1W02 A;  3ALA A;  1OHP A;  4N6L A;  5TGN A;  2B24 B;  3CCJ 3;  4FCZ A;  1GY6 A;  1WMN A;  4X2H A;  3T0U A;  5AEU B;  2XFT A;  4LSO A;  5AII A;  3F7S A;  5IER A;  1GD3 A;  3KII A;  3M8C A;  2WOH A;  2BMR B;  3CCM 3;  1Q7Y 4;  1O7W B;  3K63 A;  1RRH A;  1TFO A;  1EKM A;  1WTH A;  2CKF B;  1D6Z A;  3EN1 B;  3U1W A;  2GEX A;  1ROA A;  1M90 4;  3KN4 A;  1GY5 A;  4WWU C;  4TX4 A;  2XF3 A;  3CXC 2;  2HML B;  3K7C A;  5JPP A;  4R9K A;  1D6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...