3GWRA

Crystal structure of putative calcium/calmodulin-dependent protein kinase type ii association domain (yp_315894.1) from thiobacillus denitrificans atcc 25259 at 2.00 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
b'EPVFPTPEAAEDAFYAAFEARSLDDMMAVWARDDHVACIHPLAAPLNGRAAVAAGWRSMFGAAGRFRLQVKAVHEIRQADHVIRIVDEFLTIGDETAPRPAILATNVYRREADGWRMVLHHASPLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative calcium/calmodulin-dependent protein kinase type II
molecule tags Protein binding
source organism Thiobacillus denitrificans atcc 25259
publication title Crystal structure of Putative calcium/calmodulin-dependent protein kinase type II association domain (YP_315894.1) from THIOBACILLUS DENITRIFICANS ATCC 25259 at 2.00 A resolution
rcsb
total genus 29
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13474 SnoaL_3 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3gwrA00
1O7GB 3E99A 2QGUA 3VGNA 5BXQA 1ULJB 4XBXA 5IEPA 2PZVA 2BMRB 1O7PB 3H3HA 1GS3A 2QIYA 1NWWA 3F40A 3NV0A 4XB5A 5BVBA 1Z1SA 2GEYA 3F7XA 3FLJA 3OV4A 3KKGA 4HM0B 4HM6B 3FKAA 4J9AA 1OF5B 3STDA 5AEWB 1O7MB 4HZ9B 5JPUA 1QMAA 1TP6A 2OWPA 3CU3A 1C7HA 3D9RA 1JB5A 1NDOB 1Q42A 3EJVA 3MHEA 1OHOA 4HM8B 1OPYA 3DXOA 3EX9A 1E97A 1OGXA 1K41A 3EC9A 3F7SA 3HK4A 3OWSA 4K1VA 1UUVB 3FF0A 1JN5B 1JB4A 3T8NA 2W2CA 2F86B 3BB9A 4HVNA 3OWUA 3CPOA 4LMIA 1W6YA 3K7CA 3G8ZA 1O7WB 3B8LA 2XR8B 2K54A 7STDA 3FSDA 3GRDA 4HM7B 2CKFB 1OCVA 1JKGB 3NV0B 5D82A 3SEDA 3UNLA 3EBTA 5JPPA 5FW5A 3KZTA 3EQQB 4HJLB 3FZWA 1OF5A 3Q90A 4Q53A 1OHPA 1ZX2A 3DMCA 1EG9B 1A2KA 2R4IA 1E3RA 1QJGA 3B4PA 3NUVA 4HM2B 1DMMA 4STDA 2XSHB 3DUKA 5DREA 4R9LA 4FCMA 2B1XB 2YFLB 3G0KA 3F14A 4RZMA 3JUMA 3JUNA 1GY5A 1OGZA 3ER7A 1GY7A 3OXAA 4WYKA 3GZRA 1ASKA 1OUNA 3FF2A 3JUQA 3MG2A 2XSOB 2Z7AA 3WMDA 2STDA 1JB2A 4HKVB 3G16A 5AIIA 5CF1A 2B24B 4KVHA 3S5CA 8CHOA 2HMMB 4U13A 2GBXB 2INXA 3JUOA 1NU3A 3SOYA 2IMJA 3GZBA 5AI1A 4L8OA 4N3VA 4HM1B 3EBYA 3F8XA 2HMLB 2CHCA 1HKXA 1O7HB 3B7CA 4HM3B 5KP1A 3ROBA 3MSOA 5IEOA 1JN5A 4IIAA 3LYGA 4WP5A 3EN1B 3T8UA 2F98A 1Q40A 1OHSA 2XRXB 3EF8A 3RGAA 4LGQA 4L8PA 4WYKB 2HMNB 2RGQA 3F8HA 5TGNA 2HMOB 5AIGA 5STDA 3SOAA 3RGRA 3CNXA 1EA2A 1VZZA 2GEXA 2Z76A 3MKIA 2BMOB 3K0ZA 3DZLA 3H51A 3NBRA 4XBYA 3MG1A 2RFRA 5AEUB 4HM4B 1GYBA 4OVMA 5IG0A 4CDLA 1ZO2A 1O7NB 1U5OA 4H3UA 1GY6A 4ORLA 4X2HA 5G2GA 2A15A 5CF2A 5KP4A 4PEJA 1CQSA 3FH1A 5CK6A 3B4OA 4K1UA 3DM8A 3HZPA 4XDWA 3EN8A 4L7KA 2GBWB 3ECFA 3GZYB 4LEHA 6STDA 5KP3A 1Q40B 1W00A 2I9WA 3I0YA 4HZBB 4J8TA 2Z77A 1STDA 3KSPA 1WQLB 3OX9A 3MG3A 3GWRA 4OUQA 1BUQA 2GXFA 3FGYA 4FCJA 1ISKA 1W01A 2RCDA 2YFJB 5AIFA 1DMNA 5IG4A 1IDPA 1S5AA 5EVHA 5HGRA 2UX0A 3JUPA 3NXJA 4MJDA 4X2OA 1TUHA 5D83A 5IERA 3NHXA 5CLKA 4XBTA 1OH0A 3EHCA 5AIHA 1ULIB 2HMJB 2JQ5A 4HM5B 3BLZA 3HX8A 3VSYA 3A76A 2HMKB 4XM4A 5CXOA 5D81A 5IG3A 4GB5A 4XDVA 2YFIB 5IENA 1DMQA 1AR0A 3UJMA 3IPTA 5IF6A 1UUWB 3NM2A 2F99A 4I4KA 3F9SA 1W02A 1E3VA 5DRVA 1SJWA 3CNMA 3GZXB 3KE7A 3M8CA 3MYTA 4R1KA 4R9KA 5IG5A 1JKGA 3OWYA 2BNGA 4WWUC 2BMQB 3LZAA
chains in the Genus database with same CATH superfamily
3E99A 5RNTA 1Q824 3LXUX 5JBSA 4O2HA 1IQYA 5IEPA 2BMRB 4I5QA 2CFWA 3FCSB 3NV0A 6GSPA 2GEYA 3F7XA 1GOYA 2FNQA 1RDSA 3OV4A 4HM0B 4ILFA 4HZ9B 2C4BA 1JB5A 1OHOA 2P0MA 1AQZA 2OOVC 4K1VA 1B27A 3EC9A 3HK4A 4NHFA 1RHLA 1T2HA 1BRGA 1GMQA 4G1MB 2BT3A 1JN5B 2W9QA 2W2CA 2F86B 3BB9A 1W6YA 3G8ZA 2BHMA 7GSPA 2CW9A 3GRDA 4EV2A 5JPPA 1IK3A 4K90B 8RNTA 3KZTA 4FMCA 3LTDA 1ZX2A 1TTOA 2R4IA 4STDA 1IYYA 3B4PA 5DREA 1RSNA 1TFKA 5LC6A 4HAAA 2W04A 4KFDA 1SPUA 4RZMA 3JUMA 1BRSA 1FGOA 1RTUA 4BL3A 1OGZA 3V92A 1GY7A 3TDGA 1FA3A 1IVXA 1I0VA 3MG2A 2XSOB 2V1LA 2STDA 2WO0A 3CCS3 4BIRA 5AIIA 5CF1A 3CD63 4GSPA 1I2GA 4U13A 3CC73 3WOFB 1NU3A 2XF3A 4K61A 2RSXA 2ZHXB 1TJDA 1YJN3 3DH2A 3WDGB 4EYCA 2FXTA 1HKXA 1BNSA 1O7HB 3D3LA 2O9UX 3ROBA 4WFOA 1C54A 5G1KA 1JV2B 1NNVA 3T8UA 1GMRA 2XRXB 3WR2A 3RGAA 3RNTA 4IPBA 4L8PA 4WYKB 4FR9A 1PFPA 5TGNA 1ROAA 2HMOB 4ZM8A 1X1WA 5STDA 3CNXA 2IUKA 3DZLA 3H51A 1U8CB 4XBYA 1NB5I 2RFRA 2GSPA 5IG0A 1PY3A 1UW1A 1M904 1GY6A 3CCJ3 1LOVA 5CF2A 5KP4A 1IVWA 1KSIA 4LYLB 1KWIA 4PEJA 2AADA 1W7CA 1BUJA 5CK6A 1HYFA 2CX0A 3N8BA 3DM8A 1WMNA 1NB3I 2OCTA 5M1AA 1LOWA 1HZ1A 5KP3A 1Q40B 3LMLA 4HZBB 1TFOA 2OTJ3 2Z77A 1STDA 3MG3A 3GSPA 1MWUA 1V74A 1BUQA 1JZOA 3V98A 1BSDA 1W01A 1I2FA 3SLUA 3LTBA 3JUPA 4KFFA 3NXJA 1JBSA 3PYJA 1RGAA 3CCE3 2R41A 1OH0A 2K0MA 1CH0A 3EHCA 3PXMA 1VQL3 1AVLA 1ULIB 1Q814 2O3OA 3VSYA 1MNLA 3S27A 1VQ73 1DMQA 4N6OB 3UJMA 1US1A 2ZDJA 2P38A 3KE7A 2C11A 5IW9A 3MYTA 1YIT3 3ZFZA 1G0TA 2D1WA 3OWYA 1UCKA 3G713 2BMOB 2UUGC 4DKIA 3SVAA 4BTXA 1YVSA 1I0XA 1RN1A 4NREA 4XBXA 4O8SA 1VQ43 4O3VA 2PZVA 1O7PB 1FGMA 5AYRB 1N9EA 1DYUA 5EEOA 3WOEB 5IF6A 1GSPA 3FKAA 1OF5B 3STDA 4N6LA 1LQMB 3RDEA 2F5WA 5AEWB 1QMAA 1TP6A 3HI7A 1SIHA 3D9RA 3EJVA 1N9JA 1BANA 1Q42A 1AV4A 4TX4A 1MGWA 1E97A 2D42A 3S29A 4FMBA 1IQXA 1BSBA 1ZGXA 2WOHA 3S28A 3ALAA 3T8NA 1IV9A 3OWUA 1GMPA 1VQK3 4N6TA 1KQS2 1TRPA 1BNRA 1RRHA 7STDA 4HM7B 1AVKA 4EBGA 4BTWA 3Q1CA 2M7OA 4J5GA 1OF5A 1OHPA 2K3DA 1BIRA 1A2KA 3DMCA 3NUVA 1CYVA 2IUJA 1A67A 4HM2B 3DUKA 4JRFA 4R9LA 2L1SA 1QAKA 2KF3A 3F14A 1IU7A 3JUNA 1BRJA 3OXAA 1PU4A 2WOFA 3LOYA 1T3BA 3UL6A 3WMDA 4CJNA 3EE1A 4HYZA 1JB2A 3LTCA 3OW22 4HKVB 1K8A4 1VQ53 2B24B 1FW7A 2XH9A 2CG0A 1NJI4 1BNJA 2P0XA 2INXA 1RCKA 2BU4A 2IMJA 3D5GA 3GZBA 1WNHA 1BGSA 5AI1A 4CPKA 3IJEB 1MWTA 3SYUA 3CCR3 4KFEA 1FGTA 2H0IA 2CHCA 2HMLB 3B7CA 1JZDA 3HIIA 1SARA 4HM3B 5KP1A 3MSOA 1JRQA 5IEOA 2KRTA 3KSED 1FGQA 2ML5A 2KAAA 3FG1A 1OHSA 1YNVX 1YHQ3 3WHOA 3URPA 1VQM3 1N8QA 3D79A 1BNIA 3KCHA 1YGEA 3SOAA 3RGRA 1IT8A 1EA2A 1BRIA 1GD3A 2AAEA 4MMZB 3UB1A 3S67A 1WMOA 2QEX3 1VQ93 1W6CA 1QALA 5AEUB 4HM4B 4CDLA 1ZO2A 4H3UA 4MEIA 4ORLA 4X2HA 1LQGC 1QVF2 4WWUC 1R4CA 1X1UA 2JDIH 3V99A 3CC43 3B4OA 1BSAA 1BVIA 4K1UA 3HZPA 1JNQA 1OACA 4XDWA 3EN8A 6STDA 1BU4A 4O02B 4FCZA 2IY2A 1WQLB 3ZG0A 4OK0A 2GXFA 3AGOA 3FGYA 1ISKA 1B21A 3CCQ3 5AIFA 1RJOA 1UGIA 3Q3FA 1IDPA 1W2ZA 3QRDA 5EVHA 3BIRA 2UX0A 5D83A 4X2OA 1TUHA 3Q2PA 2JQ5A 4BU4A 3KIIA 4LSOA 3HX8A 4BTYA 1UCLA 3NX0A 3KFQC 4EXRA 5IG3A 1RN7A 1K734 1M1XB 2CIUA 3IPTA 1EKMA 3NM2A 2F99A 3F9SA 3CCL3 1E3VA 3GZXB 1N8R4 3NBJA 5IG5A 1VQ63 1JKGA 1NO3A 3LZAA 1JN5A 4MMYB 1UI8A 1O7GB 1UUGB 2QGUA 5EQLA 3D4AA 3NQZA 5BXQA 3N54B 2PNCA 1ULJB 3DGYA 1L5GB 1RKYA 2E2UA 1GS3A 2W9PA 1MWRA 1NWWA 2KF5A 4XB5A 3CPW2 3BNBA 1ROVA 1A90A 3FLJA 4J9AA 1X1XA 1Q9EA 3PGBA 1JJ22 1O7MB 1W5ZA 1W6GA 1CEWI 3SXXA 2OWPA 3CU3A 1C7HA 3AHSA 1NDOB 1EUIC 1RRLA 1B20A 2YX9A 1FUTA 3AGNA 2MF7A 3EX9A 4RNYA 1K41A 2LQVA 3F7SA 1DE3A 1WTHA 2CWVA 2HOHA 3D5IA 1MWSA 1JB4A 1TU5A 4HVNA 1CYUA 3K7CA 1O7WB 3CMA3 2K54A 3U1WA 1RGHA 3SX1A 2CKFB 5D82A 3UNLA 3NV0B 3EBTA 3PS8A 3NM7A 4EW5A 3N9HA 3EQQB 4HJLB 3Q90A 2CFKA 4Q53A 2P09A 2BIRA 4HOHA 1EG9B 1BNGA 2IYJA 2XSHB 4FCMA 4HBRA 2YFLB 3G0KA 2OQEA 4EC6A 3CCV3 5ELJA 3DGOA 1GY5A 2W0QA 2H0HA 3ER7A 4WYKA 1OUNA 2RBIA 1BOXA 2Z7AA 1YGWA 3DGLA 3G4S3 1KD14 4MMXB 3G16A 4RNTA 5A0OB 3CME3 4KVHA 3PCRA 4KT3B 1QVG2 3S5CA 4R4KA 2W56A 1RMSA 3SOYA 1B2ZA 1ZS7A 2F4YA 4L8OA 4N3VA 3F8XA 2L4VA 2KXGA 1LXEA 3AMOB 2ZA4A 3LYGA 4WP5A 3EN1B 4CCVA 1TIJA 2F98A 1Q40A 3EF8A 3X3ZA 2C10A 2W6JH 1STFI 2Q07A 3O8YA 2HMNB 2RGQA 3F8HA 4H61A 5LC7A 3QK9A 3NBBA 3X41A 5AIGA 1G96A 1I8VA 3AHWA 2GEXA 1B3SA 1RGKA 1RNBA 1SQWA 3MG1A 1WMPA 1G02A 1A2PA 1IT7A 1O7NB 1U5OA 2XFTA 4NPBA 1VQO3 3LT9A 2A15A 1IQ8A 1UGHI 3GAXA 1I3FA 4FMDA 1CQSA 2KF4A 3FH1A 1MGRA 2H0GA 1K28A 3MWZA 4FMAA 2QA43 1B2UA 2GBWB 3ECFA 3GZYB 3PZWA 4LEHA 3WODG 3FG4A 1N5HA 1W00A 2WGOA 3HOHA 4J8TA 3OX9A 4OUQA 3J7Yd 3MPHA 3X40A 2W03A 2YFJB 1QAFA 2XGNA 1R4YA 1DMNA 1F8NA 1S5AA 1RGCA 4GHOA 2CG1A 4RNZA 4WHAA 2CFDA 3NHXA 1RGLA 4XBTA 5AIHA 1JBRA 4HM5B 1A2VA 3A76A 4AKZA 4QWTA 3I553 4GB5A 4XDVA 1I3IA 1V57A 1UUWB 4I4KA 2IA7A 1W02A 3M8CA 1VQ83 5BU4A 1D6YA 2CK3H 2BNGA 9RNTA 2BMQB 2OQEC 8CHOA 5AYSC 3CCM3 3VGNA 1B2XA 2Y74A 2ZL8A 1BRHA 4N6NB 3H3HA 1UDII 2QIYA 4JF8A 3F40A 3CC23 5BVBA 1YIJ3 2XFSA 1DVCA 1Z1SA 5GSPA 2CC3A 2Y73A 3BNDA 3KKGA 4HM6B 2J8XB 1FUSA 3IMAB 3NQYA 1YVBI 2F5MA 1RLSA 3FG3A 5JPUA 3VF1A 3MHEA 5FGOA 1VQP3 4HM8B 1OPYA 2OTL3 3DXOA 1BRKA 3K9MC 1OGXA 1VQQA 2CFLA 5ELUA 3CXC2 1UUVB 1X1YA 3FF0A 1D6ZA 1IVVA 4LMIA 3CPOA 3AMOA 1LOXA 2XR8B 3B8LA 3DY5A 2CH9A 3FSDA 1OCVA 1JKGB 3HIGA 3SEDA 1LVNA 2BO9B 1T5YA 5FW5A 4N6V0 4N6UA 3FZWA 1N5PA 5G1LA 3A5EA 3OWSA 1LRAA 1E3RA 1QJGA 6RNTA 1DMMA 3G6E3 4AKYA 1Q7Y4 2B1XB 1Q7HA 4KZ1A 1RNTA 2OOVA 3WA2X 3X3XA 2GU1A 3GZRA 1ASKA 3JVCA 3FF2A 3JUQA 4LZIA 3LH4A 1RCLA 1BRNL 1RN4A 3X3YA 2KCDA 1M9GA 5M19A 2KF6A 2CX1A 2WGQA 2HMMB 1Q864 2GBXB 3JUOA 2LYXA 3CCU3 1JBTA 1UI7A 4HM1B 3EBYA 2CWTA 3I563 2XGLA 4IIAA 1RGEA 1KC84 2ML6A 2SARA 1B2SA 3LTAA 1FYSA 1GOUA 1DETA 1IVUA 1FGRA 1T2IA 1UCJA 4LGQA 5I97A 4GL6A 1EQKA 1UCIA 1HU9A 1BNFA 1J2BA 1VZZA 4AEQA 1PYLA 2CFGA 2Z76A 3K0ZA 3MKIA 1YI23 3NBRA 5BIRA 3DGMA 1GYBA 1I2EA 4OVMA 4J5KA 3X42A 1LNIA 1SIIA 3U97A 1BNEA 1B2MA 5G2GA 1TRQA 2GU3A 4BL2A 3K5TA 3T0UA 2UGIA 7RNTA 5HOHA 2E2VA 1YJW3 1S723 4L7KA 2W56B 1BSCA 1BSEA 2I9WA 2RNTA 3BNCA 3EB8A 3I0YA 4EV5A 4IT7A 3KSPA 1LOYA 1RGGA 3ZG5A 2FGTA 3GWRA 5M18A 3WA3A 2CWUA 1MOLA 4FCJA 1AY7A 1VQN3 4R80A 2RCDA 2XEPA 1W4NA 3UL5A 3LT8A 2SBLA 5IG4A 5HGRA 4RBNA 3L0RA 1DVDA 4MJDA 1V58A 1EEJA 1GD4A 3PCSA 1BAOA 5CLKA 1Y4KA 5IERA 2HMJB 3KN4A 2MC8A 3BLZA 5CXOA 2HMKB 4XM4A 5D81A 1I70A 5IENA 1RGFA 2YFIB 1YJ93 1AR0A 1FUWA 3BU4A 1K9M4 3K63A 4N6MA 3DGNA 1M1K4 1D6UA 5DRVA 1FZUA 1SJWA 3CNMA 2P05A 4R1KA 4R9KA 2F56A 1LNHA 1GOVA 2Z6BA 1W2B2 2E2TA 1IV7A 3BNEA
chains in the Genus database with same CATH topology
3E99A 1Q824 3LXUX 5JBSA 4O2HA 1IQYA 5IEPA 2BMRB 2CFWA 3FCSB 3NV0A 2GEYA 3F7XA 3OV4A 2FNQA 4HM0B 4HZ9B 1JB5A 1OHOA 2P0MA 2OOVC 4K1VA 3EC9A 3HK4A 4NHFA 4G1MB 2BT3A 1JN5B 2W9QA 2W2CA 2F86B 3BB9A 1W6YA 3G8ZA 2BHMA 2CW9A 3GRDA 4EV2A 5JPPA 1IK3A 4K90B 3KZTA 4FMCA 3LTDA 1ZX2A 2R4IA 4STDA 3B4PA 5DREA 1TFKA 5LC6A 2W04A 4KFDA 1SPUA 4RZMA 3JUMA 1FGOA 1FA3A 1OGZA 3V92A 1GY7A 3TDGA 1IVXA 3MG2A 2XSOB 2V1LA 2STDA 2WO0A 3CCS3 3CD63 5AIIA 5CF1A 4U13A 3CC73 3WOFB 1NU3A 2XF3A 4K61A 2RSXA 1YJN3 3WDGB 4EYCA 2FXTA 1HKXA 1O7HB 3D3LA 2O9UX 3ROBA 4WFOA 1JV2B 3T8UA 2XRXB 3RGAA 4IPBA 4L8PA 4WYKB 4FR9A 1PFPA 5TGNA 1ROAA 2HMOB 4ZM8A 5STDA 3CNXA 2IUKA 3DZLA 3H51A 1U8CB 4XBYA 1NB5I 2RFRA 5IG0A 1UW1A 1M904 1GY6A 3CCJ3 5CF2A 5KP4A 1IVWA 1KSIA 4PEJA 1KWIA 1W7CA 5CK6A 3N8BA 3DM8A 1WMNA 1NB3I 2OCTA 5KP3A 1Q40B 3LMLA 4HZBB 1TFOA 2OTJ3 2Z77A 1STDA 3MG3A 1V74A 1BUQA 3V98A 1W01A 3SLUA 3LTBA 3JUPA 4KFFA 3NXJA 3PYJA 3CCE3 1OH0A 2K0MA 3EHCA 3PXMA 1VQL3 1AVLA 1ULIB 1Q814 2O3OA 3VSYA 1MNLA 3S27A 1VQ73 1DMQA 4N6OB 3UJMA 1US1A 2ZDJA 2P38A 3KE7A 2C11A 5IW9A 3MYTA 1YIT3 2D1WA 3OWYA 3G713 2BMOB 3SVAA 4BTXA 4NREA 4XBXA 4O8SA 1VQ43 4O3VA 2PZVA 1O7PB 1FGMA 5AYRB 1N9EA 1DYUA 5EEOA 3WOEB 5IF6A 3FKAA 5AEWB 1OF5B 3STDA 4N6LA 3RDEA 1QMAA 1TP6A 3HI7A 1SIHA 3D9RA 3EJVA 1N9JA 1Q42A 1AV4A 4TX4A 1E97A 2D42A 3S29A 4FMBA 1IQXA 2WOHA 3S28A 3ALAA 3T8NA 1IV9A 3OWUA 1VQK3 4N6TA 1KQS2 1RRHA 7STDA 4HM7B 1AVKA 4EBGA 4BTWA 3Q1CA 2M7OA 1OF5A 1OHPA 3DMCA 3NUVA 1A2KA 2IUJA 1CYVA 1A67A 4HM2B 3DUKA 4JRFA 4R9LA 3F14A 1QAKA 1PU4A 3JUNA 1IU7A 3OXAA 2WOFA 3LOYA 3UL6A 3WMDA 3EE1A 4HYZA 1JB2A 3LTCA 3OW22 4HKVB 1K8A4 1VQ53 2B24B 2XH9A 2CG0A 1NJI4 2P0XA 2INXA 2IMJA 3GZBA 1WNHA 5AI1A 3CCR3 3IJEB 4KFEA 1FGTA 2HMLB 2CHCA 3B7CA 4HM3B 3HIIA 5KP1A 3MSOA 1JRQA 5IEOA 2KRTA 3KSED 1FGQA 2ML5A 3FG1A 1OHSA 1YHQ3 1VQM3 1N8QA 1YGEA 3SOAA 3RGRA 1IT8A 1EA2A 1GD3A 3UB1A 4MMZB 3S67A 1WMOA 2QEX3 1VQ93 1W6CA 1QALA 5AEUB 4HM4B 4CDLA 1ZO2A 4H3UA 4MEIA 4ORLA 4X2HA 1QVF2 4WWUC 1R4CA 2JDIH 3V99A 3CC43 3B4OA 4K1UA 3HZPA 1JNQA 1OACA 4XDWA 3EN8A 6STDA 4O02B 4FCZA 1WQLB 4OK0A 2GXFA 3FGYA 1ISKA 3CCQ3 5AIFA 1RJOA 1IDPA 1W2ZA 3QRDA 5EVHA 2UX0A 5D83A 4X2OA 1TUHA 3Q2PA 2JQ5A 4BTYA 3KIIA 4LSOA 3HX8A 3NX0A 3KFQC 4EXRA 5IG3A 1RN7A 1M1XB 2CIUA 3IPTA 1EKMA 3NM2A 2F99A 3F9SA 3CCL3 1E3VA 3GZXB 1N8R4 3NBJA 5IG5A 1VQ63 1JKGA 1NO3A 3LZAA 1JN5A 4MMYB 1UI8A 1O7GB 2QGUA 5EQLA 3NQZA 5BXQA 3N54B 2PNCA 1ULJB 1L5GB 1RKYA 2E2UA 1GS3A 2W9PA 1NWWA 4XB5A 3CPW2 3BNBA 1ROVA 1A90A 3FLJA 4J9AA 3PGBA 1JJ22 1O7MB 1W5ZA 1W6GA 1CEWI 3SXXA 2OWPA 3CU3A 1C7HA 1NDOB 1RRLA 2YX9A 3EX9A 2MF7A 4RNYA 1K41A 2LQVA 3F7SA 1WTHA 2CWVA 1JB4A 1TU5A 4HVNA 1CYUA 3K7CA 1O7WB 3CMA3 2K54A 3U1WA 3SX1A 2CKFB 5D82A 3UNLA 3NV0B 3EBTA 3PS8A 3NM7A 3N9HA 3EQQB 4HJLB 3Q90A 2CFKA 4Q53A 2P09A 1EG9B 2XSHB 4FCMA 4HBRA 2YFLB 3G0KA 2OQEA 4EC6A 3CCV3 5ELJA 3DGOA 1GY5A 2W0QA 3ER7A 4WYKA 1OUNA 3DGLA 2Z7AA 3G4S3 1KD14 4MMXB 3G16A 5A0OB 3CME3 4KVHA 3PCRA 1QVG2 3S5CA 4R4KA 2W56A 3SOYA 4L8OA 4N3VA 3F8XA 2L4VA 2KXGA 1LXEA 3AMOB 3LYGA 4WP5A 3EN1B 4CCVA 1TIJA 2F98A 1Q40A 3EF8A 3X3ZA 2C10A 2W6JH 1STFI 2Q07A 3O8YA 2HMNB 2RGQA 3F8HA 4H61A 5LC7A 3QK9A 3NBBA 3X41A 5AIGA 1G96A 2GEXA 1SQWA 3MG1A 1WMPA 1IT7A 1O7NB 2XFTA 1U5OA 1VQO3 3LT9A 2A15A 1IQ8A 3GAXA 4FMDA 1CQSA 3FH1A 1K28A 3MWZA 4FMAA 2QA43 2GBWB 3ECFA 3GZYB 3PZWA 4LEHA 1K734 3WODG 3FG4A 1N5HA 1W00A 2WGOA 4J8TA 3OX9A 4OUQA 3J7Yd 3MPHA 3X40A 2W03A 2YFJB 1QAFA 2XGNA 1DMNA 1F8NA 1S5AA 2CG1A 4RNZA 4WHAA 2CFDA 3NHXA 4XBTA 5AIHA 4HM5B 1A2VA 3A76A 4AKZA 4QWTA 3I553 4GB5A 4XDVA 1UUWB 4I4KA 2IA7A 1W02A 3M8CA 1VQ83 1D6YA 2CK3H 2BNGA 2OQEC 2BMQB 8CHOA 5AYSC 3CCM3 3VGNA 2Y74A 2ZL8A 4N6NB 3H3HA 4JF8A 2QIYA 3F40A 3CC23 5BVBA 1YIJ3 2XFSA 1DVCA 1Z1SA 2CC3A 2Y73A 3BNDA 3KKGA 4HM6B 3IMAB 3NQYA 1YVBI 3FG3A 5JPUA 3VF1A 3MHEA 5FGOA 1VQP3 4HM8B 1OPYA 2OTL3 3DXOA 3K9MC 1OGXA 2CFLA 5ELUA 3CXC2 1UUVB 3FF0A 1D6ZA 1IVVA 4LMIA 3CPOA 3AMOA 1LOXA 2XR8B 3B8LA 3DY5A 2CH9A 3FSDA 1OCVA 1JKGB 3HIGA 3SEDA 1LVNA 2BO9B 1T5YA 5FW5A 4N6V0 4N6UA 3FZWA 1N5PA 3OWSA 1E3RA 1QJGA 1DMMA 3G6E3 4AKYA 1Q7Y4 2B1XB 2OOVA 4KZ1A 3WA2X 3X3XA 2GU1A 3GZRA 1ASKA 3JVCA 3FF2A 3JUQA 4LZIA 3LH4A 3X3YA 2KCDA 1M9GA 2WGQA 2HMMB 1Q864 2GBXB 3JUOA 2LYXA 3CCU3 1UI7A 4HM1B 3EBYA 2CWTA 3I563 2XGLA 4IIAA 1KC84 2ML6A 3LTAA 1IVUA 1FGRA 4LGQA 5I97A 4GL6A 1EQKA 1HU9A 1J2BA 1VZZA 4AEQA 2CFGA 2Z76A 3MKIA 3K0ZA 1YI23 3NBRA 3DGMA 1GYBA 4OVMA 3X42A 1SIIA 3U97A 5G2GA 2GU3A 3K5TA 3T0UA 1YJW3 2E2VA 1S723 4L7KA 2W56B 3I0YA 3BNCA 2I9WA 4EV5A 3EB8A 4IT7A 3KSPA 3WA3A 2FGTA 3GWRA 2CWUA 1MOLA 4FCJA 1VQN3 4R80A 2RCDA 2XEPA 1W4NA 3UL5A 3LT8A 2SBLA 5IG4A 5HGRA 4RBNA 3L0RA 1DVDA 4MJDA 1GD4A 5CLKA 3PCSA 5IERA 1Y4KA 2HMJB 3KN4A 2MC8A 3BLZA 5CXOA 2HMKB 4XM4A 5D81A 5IENA 2YFIB 1YJ93 1FUWA 1AR0A 1K9M4 3K63A 4N6MA 3DGNA 1M1K4 1D6UA 5DRVA 1SJWA 3CNMA 4R1KA 2P05A 4R9KA 2Z6BA 1LNHA 1W2B2 2E2TA 1IV7A 3BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7G B;  3E99 A;  2QGU A;  3VGN A;  5BXQ A;  1ULJ B;  4XBX A;  5IEP A;  2PZV A;  2BMR B;  1O7P B;  3H3H A;  1GS3 A;  2QIY A;  1NWW A;  3F40 A;  3NV0 A;  4XB5 A;  5BVB A;  1Z1S A;  2GEY A;  3F7X A;  3FLJ A;  3OV4 A;  3KKG A;  4HM0 B;  4HM6 B;  3FKA A;  4J9A A;  1OF5 B;  3STD A;  5AEW B;  1O7M B;  4HZ9 B;  5JPU A;  1QMA A;  1TP6 A;  2OWP A;  3CU3 A;  1C7H A;  3D9R A;  1JB5 A;  1NDO B;  1Q42 A;  3EJV A;  3MHE A;  1OHO A;  4HM8 B;  1OPY A;  3DXO A;  3EX9 A;  1E97 A;  1OGX A;  1K41 A;  3EC9 A;  3F7S A;  3HK4 A;  3OWS A;  4K1V A;  1UUV B;  3FF0 A;  1JN5 B;  1JB4 A;  3T8N A;  2W2C A;  2F86 B;  3BB9 A;  4HVN A;  3OWU A;  3CPO A;  4LMI A;  1W6Y A;  3K7C A;  3G8Z A;  1O7W B;  3B8L A;  2XR8 B;  2K54 A;  7STD A;  3FSD A;  3GRD A;  4HM7 B;  2CKF B;  1OCV A;  1JKG B;  3NV0 B;  5D82 A;  3SED A;  3UNL A;  3EBT A;  5JPP A;  5FW5 A;  3KZT A;  3EQQ B;  4HJL B;  3FZW A;  1OF5 A;  3Q90 A;  4Q53 A;  1OHP A;  1ZX2 A;  3DMC A;  1EG9 B;  1A2K A;  2R4I A;  1E3R A;  1QJG A;  3B4P A;  3NUV A;  4HM2 B;  1DMM A;  4STD A;  2XSH B;  3DUK A;  5DRE A;  4R9L A;  4FCM A;  2B1X B;  2YFL B;  3G0K A;  3F14 A;  4RZM A;  3JUM A;  3JUN A;  1GY5 A;  1OGZ A;  3ER7 A;  1GY7 A;  3OXA A;  4WYK A;  3GZR A;  1ASK A;  1OUN A;  3FF2 A;  3JUQ A;  3MG2 A;  2XSO B;  2Z7A A;  3WMD A;  2STD A;  1JB2 A;  4HKV B;  3G16 A;  5AII A;  5CF1 A;  2B24 B;  4KVH A;  3S5C A;  8CHO A;  2HMM B;  4U13 A;  2GBX B;  2INX A;  3JUO A;  1NU3 A;  3SOY A;  2IMJ A;  3GZB A;  5AI1 A;  4L8O A;  4N3V A;  4HM1 B;  3EBY A;  3F8X A;  2HML B;  2CHC A;  1HKX A;  1O7H B;  3B7C A;  4HM3 B;  5KP1 A;  3ROB A;  3MSO A;  5IEO A;  1JN5 A;  4IIA A;  3LYG A;  4WP5 A;  3EN1 B;  3T8U A;  2F98 A;  1Q40 A;  1OHS A;  2XRX B;  3EF8 A;  3RGA A;  4LGQ A;  4L8P A;  4WYK B;  2HMN B;  2RGQ A;  3F8H A;  5TGN A;  2HMO B;  5AIG A;  5STD A;  3SOA A;  3RGR A;  3CNX A;  1EA2 A;  1VZZ A;  2GEX A;  2Z76 A;  3MKI A;  2BMO B;  3K0Z A;  3DZL A;  3H51 A;  3NBR A;  4XBY A;  3MG1 A;  2RFR A;  5AEU B;  4HM4 B;  1GYB A;  4OVM A;  5IG0 A;  4CDL A;  1ZO2 A;  1O7N B;  1U5O A;  4H3U A;  1GY6 A;  4ORL A;  4X2H A;  5G2G A;  2A15 A;  5CF2 A;  5KP4 A;  4PEJ A;  1CQS A;  3FH1 A;  5CK6 A;  3B4O A;  4K1U A;  3DM8 A;  3HZP A;  4XDW A;  3EN8 A;  4L7K A;  2GBW B;  3ECF A;  3GZY B;  4LEH A;  6STD A;  5KP3 A;  1Q40 B;  1W00 A;  2I9W A;  3I0Y A;  4HZB B;  4J8T A;  2Z77 A;  1STD A;  3KSP A;  1WQL B;  3OX9 A;  3MG3 A;  3GWR A;  4OUQ A;  1BUQ A;  2GXF A;  3FGY A;  4FCJ A;  1ISK A;  1W01 A;  2RCD A;  2YFJ B;  5AIF A;  1DMN A;  5IG4 A;  1IDP A;  1S5A A;  5EVH A;  5HGR A;  2UX0 A;  3JUP A;  3NXJ A;  4MJD A;  4X2O A;  1TUH A;  5D83 A;  5IER A;  3NHX A;  5CLK A;  4XBT A;  1OH0 A;  3EHC A;  5AIH A;  1ULI B;  2HMJ B;  2JQ5 A;  4HM5 B;  3BLZ A;  3HX8 A;  3VSY A;  3A76 A;  2HMK B;  4XM4 A;  5CXO A;  5D81 A;  5IG3 A;  4GB5 A;  4XDV A;  2YFI B;  5IEN A;  1DMQ A;  1AR0 A;  3UJM A;  3IPT A;  5IF6 A;  1UUW B;  3NM2 A;  2F99 A;  4I4K A;  3F9S A;  1W02 A;  1E3V A;  5DRV A;  1SJW A;  3CNM A;  3GZX B;  3KE7 A;  3M8C A;  3MYT A;  4R1K A;  4R9K A;  5IG5 A;  1JKG A;  3OWY A;  2BNG A;  4WWU C;  2BMQ B;  3LZA A; 
#chains in the Genus database with same CATH topology
 3E99 A;  5RNT A;  1Q82 4;  3LXU X;  5JBS A;  4O2H A;  1IQY A;  5IEP A;  2BMR B;  4I5Q A;  2CFW A;  3FCS B;  3NV0 A;  6GSP A;  2GEY A;  3F7X A;  1GOY A;  2FNQ A;  1RDS A;  3OV4 A;  4HM0 B;  4ILF A;  4HZ9 B;  2C4B A;  1JB5 A;  1OHO A;  2P0M A;  1AQZ A;  2OOV C;  4K1V A;  1B27 A;  3EC9 A;  3HK4 A;  4NHF A;  1RHL A;  1T2H A;  1BRG A;  1GMQ A;  4G1M B;  2BT3 A;  1JN5 B;  2W9Q A;  2W2C A;  2F86 B;  3BB9 A;  1W6Y A;  3G8Z A;  2BHM A;  7GSP A;  2CW9 A;  3GRD A;  4EV2 A;  5JPP A;  1IK3 A;  4K90 B;  8RNT A;  3KZT A;  4FMC A;  3LTD A;  1ZX2 A;  1TTO A;  2R4I A;  4STD A;  1IYY A;  3B4P A;  5DRE A;  1RSN A;  1TFK A;  5LC6 A;  4HAA A;  2W04 A;  4KFD A;  1SPU A;  4RZM A;  3JUM A;  1BRS A;  1FGO A;  1RTU A;  4BL3 A;  1OGZ A;  3V92 A;  1GY7 A;  3TDG A;  1FA3 A;  1IVX A;  1I0V A;  3MG2 A;  2XSO B;  2V1L A;  2STD A;  2WO0 A;  3CCS 3;  4BIR A;  5AII A;  5CF1 A;  3CD6 3;  4GSP A;  1I2G A;  4U13 A;  3CC7 3;  3WOF B;  1NU3 A;  2XF3 A;  4K61 A;  2RSX A;  2ZHX B;  1TJD A;  1YJN 3;  3DH2 A;  3WDG B;  4EYC A;  2FXT A;  1HKX A;  1BNS A;  1O7H B;  3D3L A;  2O9U X;  3ROB A;  4WFO A;  1C54 A;  5G1K A;  1JV2 B;  1NNV A;  3T8U A;  1GMR A;  2XRX B;  3WR2 A;  3RGA A;  3RNT A;  4IPB A;  4L8P A;  4WYK B;  4FR9 A;  1PFP A;  5TGN A;  1ROA A;  2HMO B;  4ZM8 A;  1X1W A;  5STD A;  3CNX A;  2IUK A;  3DZL A;  3H51 A;  1U8C B;  4XBY A;  1NB5 I;  2RFR A;  2GSP A;  5IG0 A;  1PY3 A;  1UW1 A;  1M90 4;  1GY6 A;  3CCJ 3;  1LOV A;  5CF2 A;  5KP4 A;  1IVW A;  1KSI A;  4LYL B;  1KWI A;  4PEJ A;  2AAD A;  1W7C A;  1BUJ A;  5CK6 A;  1HYF A;  2CX0 A;  3N8B A;  3DM8 A;  1WMN A;  1NB3 I;  2OCT A;  5M1A A;  1LOW A;  1HZ1 A;  5KP3 A;  1Q40 B;  3LML A;  4HZB B;  1TFO A;  2OTJ 3;  2Z77 A;  1STD A;  3MG3 A;  3GSP A;  1MWU A;  1V74 A;  1BUQ A;  1JZO A;  3V98 A;  1BSD A;  1W01 A;  1I2F A;  3SLU A;  3LTB A;  3JUP A;  4KFF A;  3NXJ A;  1JBS A;  3PYJ A;  1RGA A;  3CCE 3;  2R41 A;  1OH0 A;  2K0M A;  1CH0 A;  3EHC A;  3PXM A;  1VQL 3;  1AVL A;  1ULI B;  1Q81 4;  2O3O A;  3VSY A;  1MNL A;  3S27 A;  1VQ7 3;  1DMQ A;  4N6O B;  3UJM A;  1US1 A;  2ZDJ A;  2P38 A;  3KE7 A;  2C11 A;  5IW9 A;  3MYT A;  1YIT 3;  3ZFZ A;  1G0T A;  2D1W A;  3OWY A;  1UCK A;  3G71 3;  2BMO B;  2UUG C;  4DKI A;  3SVA A;  4BTX A;  1YVS A;  1I0X A;  1RN1 A;  4NRE A;  4XBX A;  4O8S A;  1VQ4 3;  4O3V A;  2PZV A;  1O7P B;  1FGM A;  5AYR B;  1N9E A;  1DYU A;  5EEO A;  3WOE B;  5IF6 A;  1GSP A;  3FKA A;  1OF5 B;  3STD A;  4N6L A;  1LQM B;  3RDE A;  2F5W A;  5AEW B;  1QMA A;  1TP6 A;  3HI7 A;  1SIH A;  3D9R A;  3EJV A;  1N9J A;  1BAN A;  1Q42 A;  1AV4 A;  4TX4 A;  1MGW A;  1E97 A;  2D42 A;  3S29 A;  4FMB A;  1IQX A;  1BSB A;  1ZGX A;  2WOH A;  3S28 A;  3ALA A;  3T8N A;  1IV9 A;  3OWU A;  1GMP A;  1VQK 3;  4N6T A;  1KQS 2;  1TRP A;  1BNR A;  1RRH A;  7STD A;  4HM7 B;  1AVK A;  4EBG A;  4BTW A;  3Q1C A;  2M7O A;  4J5G A;  1OF5 A;  1OHP A;  2K3D A;  1BIR A;  1A2K A;  3DMC A;  3NUV A;  1CYV A;  2IUJ A;  1A67 A;  4HM2 B;  3DUK A;  4JRF A;  4R9L A;  2L1S A;  1QAK A;  2KF3 A;  3F14 A;  1IU7 A;  3JUN A;  1BRJ A;  3OXA A;  1PU4 A;  2WOF A;  3LOY A;  1T3B A;  3UL6 A;  3WMD A;  4CJN A;  3EE1 A;  4HYZ A;  1JB2 A;  3LTC A;  3OW2 2;  4HKV B;  1K8A 4;  1VQ5 3;  2B24 B;  1FW7 A;  2XH9 A;  2CG0 A;  1NJI 4;  1BNJ A;  2P0X A;  2INX A;  1RCK A;  2BU4 A;  2IMJ A;  3D5G A;  3GZB A;  1WNH A;  1BGS A;  5AI1 A;  4CPK A;  3IJE B;  1MWT A;  3SYU A;  3CCR 3;  4KFE A;  1FGT A;  2H0I A;  2CHC A;  2HML B;  3B7C A;  1JZD A;  3HII A;  1SAR A;  4HM3 B;  5KP1 A;  3MSO A;  1JRQ A;  5IEO A;  2KRT A;  3KSE D;  1FGQ A;  2ML5 A;  2KAA A;  3FG1 A;  1OHS A;  1YNV X;  1YHQ 3;  3WHO A;  3URP A;  1VQM 3;  1N8Q A;  3D79 A;  1BNI A;  3KCH A;  1YGE A;  3SOA A;  3RGR A;  1IT8 A;  1EA2 A;  1BRI A;  1GD3 A;  2AAE A;  4MMZ B;  3UB1 A;  3S67 A;  1WMO A;  2QEX 3;  1VQ9 3;  1W6C A;  1QAL A;  5AEU B;  4HM4 B;  4CDL A;  1ZO2 A;  4H3U A;  4MEI A;  4ORL A;  4X2H A;  1LQG C;  1QVF 2;  4WWU C;  1R4C A;  1X1U A;  2JDI H;  3V99 A;  3CC4 3;  3B4O A;  1BSA A;  1BVI A;  4K1U A;  3HZP A;  1JNQ A;  1OAC A;  4XDW A;  3EN8 A;  6STD A;  1BU4 A;  4O02 B;  4FCZ A;  2IY2 A;  1WQL B;  3ZG0 A;  4OK0 A;  2GXF A;  3AGO A;  3FGY A;  1ISK A;  1B21 A;  3CCQ 3;  5AIF A;  1RJO A;  1UGI A;  3Q3F A;  1IDP A;  1W2Z A;  3QRD A;  5EVH A;  3BIR A;  2UX0 A;  5D83 A;  4X2O A;  1TUH A;  3Q2P A;  2JQ5 A;  4BU4 A;  3KII A;  4LSO A;  3HX8 A;  4BTY A;  1UCL A;  3NX0 A;  3KFQ C;  4EXR A;  5IG3 A;  1RN7 A;  1K73 4;  1M1X B;  2CIU A;  3IPT A;  1EKM A;  3NM2 A;  2F99 A;  3F9S A;  3CCL 3;  1E3V A;  3GZX B;  1N8R 4;  3NBJ A;  5IG5 A;  1VQ6 3;  1JKG A;  1NO3 A;  3LZA A;  1JN5 A;  4MMY B;  1UI8 A;  1O7G B;  1UUG B;  2QGU A;  5EQL A;  3D4A A;  3NQZ A;  5BXQ A;  3N54 B;  2PNC A;  1ULJ B;  3DGY A;  1L5G B;  1RKY A;  2E2U A;  1GS3 A;  2W9P A;  1MWR A;  1NWW A;  2KF5 A;  4XB5 A;  3CPW 2;  3BNB A;  1ROV A;  1A90 A;  3FLJ A;  4J9A A;  1X1X A;  1Q9E A;  3PGB A;  1JJ2 2;  1O7M B;  1W5Z A;  1W6G A;  1CEW I;  3SXX A;  2OWP A;  3CU3 A;  1C7H A;  3AHS A;  1NDO B;  1EUI C;  1RRL A;  1B20 A;  2YX9 A;  1FUT A;  3AGN A;  2MF7 A;  3EX9 A;  4RNY A;  1K41 A;  2LQV A;  3F7S A;  1DE3 A;  1WTH A;  2CWV A;  2HOH A;  3D5I A;  1MWS A;  1JB4 A;  1TU5 A;  4HVN A;  1CYU A;  3K7C A;  1O7W B;  3CMA 3;  2K54 A;  3U1W A;  1RGH A;  3SX1 A;  2CKF B;  5D82 A;  3UNL A;  3NV0 B;  3EBT A;  3PS8 A;  3NM7 A;  4EW5 A;  3N9H A;  3EQQ B;  4HJL B;  3Q90 A;  2CFK A;  4Q53 A;  2P09 A;  2BIR A;  4HOH A;  1EG9 B;  1BNG A;  2IYJ A;  2XSH B;  4FCM A;  4HBR A;  2YFL B;  3G0K A;  2OQE A;  4EC6 A;  3CCV 3;  5ELJ A;  3DGO A;  1GY5 A;  2W0Q A;  2H0H A;  3ER7 A;  4WYK A;  1OUN A;  2RBI A;  1BOX A;  2Z7A A;  1YGW A;  3DGL A;  3G4S 3;  1KD1 4;  4MMX B;  3G16 A;  4RNT A;  5A0O B;  3CME 3;  4KVH A;  3PCR A;  4KT3 B;  1QVG 2;  3S5C A;  4R4K A;  2W56 A;  1RMS A;  3SOY A;  1B2Z A;  1ZS7 A;  2F4Y A;  4L8O A;  4N3V A;  3F8X A;  2L4V A;  2KXG A;  1LXE A;  3AMO B;  2ZA4 A;  3LYG A;  4WP5 A;  3EN1 B;  4CCV A;  1TIJ A;  2F98 A;  1Q40 A;  3EF8 A;  3X3Z A;  2C10 A;  2W6J H;  1STF I;  2Q07 A;  3O8Y A;  2HMN B;  2RGQ A;  3F8H A;  4H61 A;  5LC7 A;  3QK9 A;  3NBB A;  3X41 A;  5AIG A;  1G96 A;  1I8V A;  3AHW A;  2GEX A;  1B3S A;  1RGK A;  1RNB A;  1SQW A;  3MG1 A;  1WMP A;  1G02 A;  1A2P A;  1IT7 A;  1O7N B;  1U5O A;  2XFT A;  4NPB A;  1VQO 3;  3LT9 A;  2A15 A;  1IQ8 A;  1UGH I;  3GAX A;  1I3F A;  4FMD A;  1CQS A;  2KF4 A;  3FH1 A;  1MGR A;  2H0G A;  1K28 A;  3MWZ A;  4FMA A;  2QA4 3;  1B2U A;  2GBW B;  3ECF A;  3GZY B;  3PZW A;  4LEH A;  3WOD G;  3FG4 A;  1N5H A;  1W00 A;  2WGO A;  3HOH A;  4J8T A;  3OX9 A;  4OUQ A;  3J7Y d;  3MPH A;  3X40 A;  2W03 A;  2YFJ B;  1QAF A;  2XGN A;  1R4Y A;  1DMN A;  1F8N A;  1S5A A;  1RGC A;  4GHO A;  2CG1 A;  4RNZ A;  4WHA A;  2CFD A;  3NHX A;  1RGL A;  4XBT A;  5AIH A;  1JBR A;  4HM5 B;  1A2V A;  3A76 A;  4AKZ A;  4QWT A;  3I55 3;  4GB5 A;  4XDV A;  1I3I A;  1V57 A;  1UUW B;  4I4K A;  2IA7 A;  1W02 A;  3M8C A;  1VQ8 3;  5BU4 A;  1D6Y A;  2CK3 H;  2BNG A;  9RNT A;  2BMQ B;  2OQE C;  8CHO A;  5AYS C;  3CCM 3;  3VGN A;  1B2X A;  2Y74 A;  2ZL8 A;  1BRH A;  4N6N B;  3H3H A;  1UDI I;  2QIY A;  4JF8 A;  3F40 A;  3CC2 3;  5BVB A;  1YIJ 3;  2XFS A;  1DVC A;  1Z1S A;  5GSP A;  2CC3 A;  2Y73 A;  3BND A;  3KKG A;  4HM6 B;  2J8X B;  1FUS A;  3IMA B;  3NQY A;  1YVB I;  2F5M A;  1RLS A;  3FG3 A;  5JPU A;  3VF1 A;  3MHE A;  5FGO A;  1VQP 3;  4HM8 B;  1OPY A;  2OTL 3;  3DXO A;  1BRK A;  3K9M C;  1OGX A;  1VQQ A;  2CFL A;  5ELU A;  3CXC 2;  1UUV B;  1X1Y A;  3FF0 A;  1D6Z A;  1IVV A;  4LMI A;  3CPO A;  3AMO A;  1LOX A;  2XR8 B;  3B8L A;  3DY5 A;  2CH9 A;  3FSD A;  1OCV A;  1JKG B;  3HIG A;  3SED A;  1LVN A;  2BO9 B;  1T5Y A;  5FW5 A;  4N6V 0;  4N6U A;  3FZW A;  1N5P A;  5G1L A;  3A5E A;  3OWS A;  1LRA A;  1E3R A;  1QJG A;  6RNT A;  1DMM A;  3G6E 3;  4AKY A;  1Q7Y 4;  2B1X B;  1Q7H A;  4KZ1 A;  1RNT A;  2OOV A;  3WA2 X;  3X3X A;  2GU1 A;  3GZR A;  1ASK A;  3JVC A;  3FF2 A;  3JUQ A;  4LZI A;  3LH4 A;  1RCL A;  1BRN L;  1RN4 A;  3X3Y A;  2KCD A;  1M9G A;  5M19 A;  2KF6 A;  2CX1 A;  2WGQ A;  2HMM B;  1Q86 4;  2GBX B;  3JUO A;  2LYX A;  3CCU 3;  1JBT A;  1UI7 A;  4HM1 B;  3EBY A;  2CWT A;  3I56 3;  2XGL A;  4IIA A;  1RGE A;  1KC8 4;  2ML6 A;  2SAR A;  1B2S A;  3LTA A;  1FYS A;  1GOU A;  1DET A;  1IVU A;  1FGR A;  1T2I A;  1UCJ A;  4LGQ A;  5I97 A;  4GL6 A;  1EQK A;  1UCI A;  1HU9 A;  1BNF A;  1J2B A;  1VZZ A;  4AEQ A;  1PYL A;  2CFG A;  2Z76 A;  3K0Z A;  3MKI A;  1YI2 3;  3NBR A;  5BIR A;  3DGM A;  1GYB A;  1I2E A;  4OVM A;  4J5K A;  3X42 A;  1LNI A;  1SII A;  3U97 A;  1BNE A;  1B2M A;  5G2G A;  1TRQ A;  2GU3 A;  4BL2 A;  3K5T A;  3T0U A;  2UGI A;  7RNT A;  5HOH A;  2E2V A;  1YJW 3;  1S72 3;  4L7K A;  2W56 B;  1BSC A;  1BSE A;  2I9W A;  2RNT A;  3BNC A;  3EB8 A;  3I0Y A;  4EV5 A;  4IT7 A;  3KSP A;  1LOY A;  1RGG A;  3ZG5 A;  2FGT A;  3GWR A;  5M18 A;  3WA3 A;  2CWU A;  1MOL A;  4FCJ A;  1AY7 A;  1VQN 3;  4R80 A;  2RCD A;  2XEP A;  1W4N A;  3UL5 A;  3LT8 A;  2SBL A;  5IG4 A;  5HGR A;  4RBN A;  3L0R A;  1DVD A;  4MJD A;  1V58 A;  1EEJ A;  1GD4 A;  3PCS A;  1BAO A;  5CLK A;  1Y4K A;  5IER A;  2HMJ B;  3KN4 A;  2MC8 A;  3BLZ A;  5CXO A;  2HMK B;  4XM4 A;  5D81 A;  1I70 A;  5IEN A;  1RGF A;  2YFI B;  1YJ9 3;  1AR0 A;  1FUW A;  3BU4 A;  1K9M 4;  3K63 A;  4N6M A;  3DGN A;  1M1K 4;  1D6U A;  5DRV A;  1FZU A;  1SJW A;  3CNM A;  2P05 A;  4R1K A;  4R9K A;  2F56 A;  1LNH A;  1GOV A;  2Z6B A;  1W2B 2;  2E2T A;  1IV7 A;  3BNE A; 
#chains in the Genus database with same CATH homology
 3E99 A;  1Q82 4;  3LXU X;  5JBS A;  4O2H A;  1IQY A;  5IEP A;  2BMR B;  2CFW A;  3FCS B;  3NV0 A;  2GEY A;  3F7X A;  3OV4 A;  2FNQ A;  4HM0 B;  4HZ9 B;  1JB5 A;  1OHO A;  2P0M A;  2OOV C;  4K1V A;  3EC9 A;  3HK4 A;  4NHF A;  4G1M B;  2BT3 A;  1JN5 B;  2W9Q A;  2W2C A;  2F86 B;  3BB9 A;  1W6Y A;  3G8Z A;  2BHM A;  2CW9 A;  3GRD A;  4EV2 A;  5JPP A;  1IK3 A;  4K90 B;  3KZT A;  4FMC A;  3LTD A;  1ZX2 A;  2R4I A;  4STD A;  3B4P A;  5DRE A;  1TFK A;  5LC6 A;  2W04 A;  4KFD A;  1SPU A;  4RZM A;  3JUM A;  1FGO A;  1FA3 A;  1OGZ A;  3V92 A;  1GY7 A;  3TDG A;  1IVX A;  3MG2 A;  2XSO B;  2V1L A;  2STD A;  2WO0 A;  3CCS 3;  3CD6 3;  5AII A;  5CF1 A;  4U13 A;  3CC7 3;  3WOF B;  1NU3 A;  2XF3 A;  4K61 A;  2RSX A;  1YJN 3;  3WDG B;  4EYC A;  2FXT A;  1HKX A;  1O7H B;  3D3L A;  2O9U X;  3ROB A;  4WFO A;  1JV2 B;  3T8U A;  2XRX B;  3RGA A;  4IPB A;  4L8P A;  4WYK B;  4FR9 A;  1PFP A;  5TGN A;  1ROA A;  2HMO B;  4ZM8 A;  5STD A;  3CNX A;  2IUK A;  3DZL A;  3H51 A;  1U8C B;  4XBY A;  1NB5 I;  2RFR A;  5IG0 A;  1UW1 A;  1M90 4;  1GY6 A;  3CCJ 3;  5CF2 A;  5KP4 A;  1IVW A;  1KSI A;  4PEJ A;  1KWI A;  1W7C A;  5CK6 A;  3N8B A;  3DM8 A;  1WMN A;  1NB3 I;  2OCT A;  5KP3 A;  1Q40 B;  3LML A;  4HZB B;  1TFO A;  2OTJ 3;  2Z77 A;  1STD A;  3MG3 A;  1V74 A;  1BUQ A;  3V98 A;  1W01 A;  3SLU A;  3LTB A;  3JUP A;  4KFF A;  3NXJ A;  3PYJ A;  3CCE 3;  1OH0 A;  2K0M A;  3EHC A;  3PXM A;  1VQL 3;  1AVL A;  1ULI B;  1Q81 4;  2O3O A;  3VSY A;  1MNL A;  3S27 A;  1VQ7 3;  1DMQ A;  4N6O B;  3UJM A;  1US1 A;  2ZDJ A;  2P38 A;  3KE7 A;  2C11 A;  5IW9 A;  3MYT A;  1YIT 3;  2D1W A;  3OWY A;  3G71 3;  2BMO B;  3SVA A;  4BTX A;  4NRE A;  4XBX A;  4O8S A;  1VQ4 3;  4O3V A;  2PZV A;  1O7P B;  1FGM A;  5AYR B;  1N9E A;  1DYU A;  5EEO A;  3WOE B;  5IF6 A;  3FKA A;  5AEW B;  1OF5 B;  3STD A;  4N6L A;  3RDE A;  1QMA A;  1TP6 A;  3HI7 A;  1SIH A;  3D9R A;  3EJV A;  1N9J A;  1Q42 A;  1AV4 A;  4TX4 A;  1E97 A;  2D42 A;  3S29 A;  4FMB A;  1IQX A;  2WOH A;  3S28 A;  3ALA A;  3T8N A;  1IV9 A;  3OWU A;  1VQK 3;  4N6T A;  1KQS 2;  1RRH A;  7STD A;  4HM7 B;  1AVK A;  4EBG A;  4BTW A;  3Q1C A;  2M7O A;  1OF5 A;  1OHP A;  3DMC A;  3NUV A;  1A2K A;  2IUJ A;  1CYV A;  1A67 A;  4HM2 B;  3DUK A;  4JRF A;  4R9L A;  3F14 A;  1QAK A;  1PU4 A;  3JUN A;  1IU7 A;  3OXA A;  2WOF A;  3LOY A;  3UL6 A;  3WMD A;  3EE1 A;  4HYZ A;  1JB2 A;  3LTC A;  3OW2 2;  4HKV B;  1K8A 4;  1VQ5 3;  2B24 B;  2XH9 A;  2CG0 A;  1NJI 4;  2P0X A;  2INX A;  2IMJ A;  3GZB A;  1WNH A;  5AI1 A;  3CCR 3;  3IJE B;  4KFE A;  1FGT A;  2HML B;  2CHC A;  3B7C A;  4HM3 B;  3HII A;  5KP1 A;  3MSO A;  1JRQ A;  5IEO A;  2KRT A;  3KSE D;  1FGQ A;  2ML5 A;  3FG1 A;  1OHS A;  1YHQ 3;  1VQM 3;  1N8Q A;  1YGE A;  3SOA A;  3RGR A;  1IT8 A;  1EA2 A;  1GD3 A;  3UB1 A;  4MMZ B;  3S67 A;  1WMO A;  2QEX 3;  1VQ9 3;  1W6C A;  1QAL A;  5AEU B;  4HM4 B;  4CDL A;  1ZO2 A;  4H3U A;  4MEI A;  4ORL A;  4X2H A;  1QVF 2;  4WWU C;  1R4C A;  2JDI H;  3V99 A;  3CC4 3;  3B4O A;  4K1U A;  3HZP A;  1JNQ A;  1OAC A;  4XDW A;  3EN8 A;  6STD A;  4O02 B;  4FCZ A;  1WQL B;  4OK0 A;  2GXF A;  3FGY A;  1ISK A;  3CCQ 3;  5AIF A;  1RJO A;  1IDP A;  1W2Z A;  3QRD A;  5EVH A;  2UX0 A;  5D83 A;  4X2O A;  1TUH A;  3Q2P A;  2JQ5 A;  4BTY A;  3KII A;  4LSO A;  3HX8 A;  3NX0 A;  3KFQ C;  4EXR A;  5IG3 A;  1RN7 A;  1M1X B;  2CIU A;  3IPT A;  1EKM A;  3NM2 A;  2F99 A;  3F9S A;  3CCL 3;  1E3V A;  3GZX B;  1N8R 4;  3NBJ A;  5IG5 A;  1VQ6 3;  1JKG A;  1NO3 A;  3LZA A;  1JN5 A;  4MMY B;  1UI8 A;  1O7G B;  2QGU A;  5EQL A;  3NQZ A;  5BXQ A;  3N54 B;  2PNC A;  1ULJ B;  1L5G B;  1RKY A;  2E2U A;  1GS3 A;  2W9P A;  1NWW A;  4XB5 A;  3CPW 2;  3BNB A;  1ROV A;  1A90 A;  3FLJ A;  4J9A A;  3PGB A;  1JJ2 2;  1O7M B;  1W5Z A;  1W6G A;  1CEW I;  3SXX A;  2OWP A;  3CU3 A;  1C7H A;  1NDO B;  1RRL A;  2YX9 A;  3EX9 A;  2MF7 A;  4RNY A;  1K41 A;  2LQV A;  3F7S A;  1WTH A;  2CWV A;  1JB4 A;  1TU5 A;  4HVN A;  1CYU A;  3K7C A;  1O7W B;  3CMA 3;  2K54 A;  3U1W A;  3SX1 A;  2CKF B;  5D82 A;  3UNL A;  3NV0 B;  3EBT A;  3PS8 A;  3NM7 A;  3N9H A;  3EQQ B;  4HJL B;  3Q90 A;  2CFK A;  4Q53 A;  2P09 A;  1EG9 B;  2XSH B;  4FCM A;  4HBR A;  2YFL B;  3G0K A;  2OQE A;  4EC6 A;  3CCV 3;  5ELJ A;  3DGO A;  1GY5 A;  2W0Q A;  3ER7 A;  4WYK A;  1OUN A;  3DGL A;  2Z7A A;  3G4S 3;  1KD1 4;  4MMX B;  3G16 A;  5A0O B;  3CME 3;  4KVH A;  3PCR A;  1QVG 2;  3S5C A;  4R4K A;  2W56 A;  3SOY A;  4L8O A;  4N3V A;  3F8X A;  2L4V A;  2KXG A;  1LXE A;  3AMO B;  3LYG A;  4WP5 A;  3EN1 B;  4CCV A;  1TIJ A;  2F98 A;  1Q40 A;  3EF8 A;  3X3Z A;  2C10 A;  2W6J H;  1STF I;  2Q07 A;  3O8Y A;  2HMN B;  2RGQ A;  3F8H A;  4H61 A;  5LC7 A;  3QK9 A;  3NBB A;  3X41 A;  5AIG A;  1G96 A;  2GEX A;  1SQW A;  3MG1 A;  1WMP A;  1IT7 A;  1O7N B;  2XFT A;  1U5O A;  1VQO 3;  3LT9 A;  2A15 A;  1IQ8 A;  3GAX A;  4FMD A;  1CQS A;  3FH1 A;  1K28 A;  3MWZ A;  4FMA A;  2QA4 3;  2GBW B;  3ECF A;  3GZY B;  3PZW A;  4LEH A;  1K73 4;  3WOD G;  3FG4 A;  1N5H A;  1W00 A;  2WGO A;  4J8T A;  3OX9 A;  4OUQ A;  3J7Y d;  3MPH A;  3X40 A;  2W03 A;  2YFJ B;  1QAF A;  2XGN A;  1DMN A;  1F8N A;  1S5A A;  2CG1 A;  4RNZ A;  4WHA A;  2CFD A;  3NHX A;  4XBT A;  5AIH A;  4HM5 B;  1A2V A;  3A76 A;  4AKZ A;  4QWT A;  3I55 3;  4GB5 A;  4XDV A;  1UUW B;  4I4K A;  2IA7 A;  1W02 A;  3M8C A;  1VQ8 3;  1D6Y A;  2CK3 H;  2BNG A;  2OQE C;  2BMQ B;  8CHO A;  5AYS C;  3CCM 3;  3VGN A;  2Y74 A;  2ZL8 A;  4N6N B;  3H3H A;  4JF8 A;  2QIY A;  3F40 A;  3CC2 3;  5BVB A;  1YIJ 3;  2XFS A;  1DVC A;  1Z1S A;  2CC3 A;  2Y73 A;  3BND A;  3KKG A;  4HM6 B;  3IMA B;  3NQY A;  1YVB I;  3FG3 A;  5JPU A;  3VF1 A;  3MHE A;  5FGO A;  1VQP 3;  4HM8 B;  1OPY A;  2OTL 3;  3DXO A;  3K9M C;  1OGX A;  2CFL A;  5ELU A;  3CXC 2;  1UUV B;  3FF0 A;  1D6Z A;  1IVV A;  4LMI A;  3CPO A;  3AMO A;  1LOX A;  2XR8 B;  3B8L A;  3DY5 A;  2CH9 A;  3FSD A;  1OCV A;  1JKG B;  3HIG A;  3SED A;  1LVN A;  2BO9 B;  1T5Y A;  5FW5 A;  4N6V 0;  4N6U A;  3FZW A;  1N5P A;  3OWS A;  1E3R A;  1QJG A;  1DMM A;  3G6E 3;  4AKY A;  1Q7Y 4;  2B1X B;  2OOV A;  4KZ1 A;  3WA2 X;  3X3X A;  2GU1 A;  3GZR A;  1ASK A;  3JVC A;  3FF2 A;  3JUQ A;  4LZI A;  3LH4 A;  3X3Y A;  2KCD A;  1M9G A;  2WGQ A;  2HMM B;  1Q86 4;  2GBX B;  3JUO A;  2LYX A;  3CCU 3;  1UI7 A;  4HM1 B;  3EBY A;  2CWT A;  3I56 3;  2XGL A;  4IIA A;  1KC8 4;  2ML6 A;  3LTA A;  1IVU A;  1FGR A;  4LGQ A;  5I97 A;  4GL6 A;  1EQK A;  1HU9 A;  1J2B A;  1VZZ A;  4AEQ A;  2CFG A;  2Z76 A;  3MKI A;  3K0Z A;  1YI2 3;  3NBR A;  3DGM A;  1GYB A;  4OVM A;  3X42 A;  1SII A;  3U97 A;  5G2G A;  2GU3 A;  3K5T A;  3T0U A;  1YJW 3;  2E2V A;  1S72 3;  4L7K A;  2W56 B;  3I0Y A;  3BNC A;  2I9W A;  4EV5 A;  3EB8 A;  4IT7 A;  3KSP A;  3WA3 A;  2FGT A;  3GWR A;  2CWU A;  1MOL A;  4FCJ A;  1VQN 3;  4R80 A;  2RCD A;  2XEP A;  1W4N A;  3UL5 A;  3LT8 A;  2SBL A;  5IG4 A;  5HGR A;  4RBN A;  3L0R A;  1DVD A;  4MJD A;  1GD4 A;  5CLK A;  3PCS A;  5IER A;  1Y4K A;  2HMJ B;  3KN4 A;  2MC8 A;  3BLZ A;  5CXO A;  2HMK B;  4XM4 A;  5D81 A;  5IEN A;  2YFI B;  1YJ9 3;  1FUW A;  1AR0 A;  1K9M 4;  3K63 A;  4N6M A;  3DGN A;  1M1K 4;  1D6U A;  5DRV A;  1SJW A;  3CNM A;  4R1K A;  2P05 A;  4R9K A;  2Z6B A;  1LNH A;  1W2B 2;  2E2T A;  1IV7 A;  3BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...