1B2ZA

Deletion of a buried salt bridge in barnase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSNWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2zA00
1RCKA 1BU4A 1UCKA 5BIRA 7RNTA 4J5KA 4HOHA 1BANA 3KCHA 3D4AA 1PY3A 1FUSA 1MGWA 1BSBA 1SARA 3SYUA 1HYFA 1I0XA 5HOHA 1LOYA 1RGAA 1BAOA 1BVIA 1BOXA 1GOYA 1RTUA 1BNFA 1BRSA 1LNIA 1I8VA 2HOHA 1LOWA 1BNRA 2GSPA 2KF6A 1BGSA 2KAAA 8RNTA 1RHLA 1X1YA 2RBIA 4J5GA 1FW7A 1RCLA 3Q3FA 3AGNA 1RDSA 1B2SA 1RGEA 1BRHA 1I3IA 1RLSA 1T2IA 1B2XA 2C4BA 2BIRA 2RNTA 6GSPA 2F56A 1C54A 2F4YA 1IYYA 1RGGA 4GHOA 1I2EA 1MGRA 3D5IA 4BU4A 1RN1A 3DGYA 1DETA 1FUTA 2KF5A 7GSPA 1GMRA 1DE3A 1AQZA 6RNTA 3BU4A 1UCIA 1UCJA 3AHSA 1BUJA 1YGWA 1CH0A 3D5GA 1FYSA 3DH2A 1RSNA 1TTOA 1LOVA 5BU4A 3GSPA 1BRNL 1TRQA 1AY7A 3BIRA 1B20A 1JBSA 1RGFA 1YNVX 1LRAA 2AAEA 1B3SA 1BSCA 1BSDA 2KF4A 1BRIA 1X1UA 1RNTA 2F5MA 1BSAA 1G02A 3HOHA 4RNTA 2SARA 1A2PA 1I2FA 1BRKA 1I3FA 2ZA4A 1X1WA 1RN4A 1RGHA 1BSEA 1BNIA 1BNSA 1I70A 1HZ1A 1BRJA 1RNBA 1R4YA 1PYLA 2KF3A 1B2MA 3AHWA 9RNTA 1GMQA 1RGCA 1YVSA 4BIRA 3WHOA 3AGOA 1JBRA 1T2HA 1Q9EA 1GMPA 1RGLA 1BNGA 4HAAA 1I2GA 4GSPA 1GOUA 1BRGA 1B2ZA 1TRPA 1I0VA 2AADA 1BIRA 2F5WA 1GSPA 3WR2A 1X1XA 1UCLA 2BU4A 3URPA 3RNTA 1GOVA 1FZUA 1B27A 5RNTA 1RGKA 1B2UA 1BNJA 1BNEA 5GSPA 1JBTA 1B21A 1ZGXA 3A5EA 1RMSA
chains in the Genus database with same CATH superfamily
1RCKA 3STDA 1UCKA 1QJGA 4O8SA 2GBXB 1DYUA 1OHSA 4J5KA 2XGLA 1KC84 4HOHA 2CX0A 1ROAA 1Y4KA 1PY3A 1SARA 3EB8A 4PEJA 3SYUA 1DVDA 1LNHA 2XFSA 3ZG5A 3FCSB 5JBSA 3F9SA 3ZFZA 4EXRA 1DE3A 4N6NB 5CK6A 1LNIA 2A15A 3NQZA 1JN5A 3H51A 3EBYA 2HMOB 4HM6B 4NREA 3NXJA 8RNTA 2OCTA 3CCL3 3CC23 2BMRB 1RHLA 5D81A 1HKXA 2RBIA 4H3UA 4HM8B 2CX1A 3Q3FA 5KP3A 1RDSA 1B2SA 1RGEA 3DMCA 3CNXA 1C7HA 1I3IA 3GZRA 3Q1CA 5G1LA 1UDII 3EC9A 3RDEA 4DKIA 5TGNA 1B2XA 2P0XA 1UUGB 1MWSA 3Q2PA 4KFEA 3MPHA 1T3BA 4MEIA 2OTJ3 8CHOA 1IYYA 1FA3A 4GHOA 3FKAA 3PXMA 1IVWA 1GYBA 2ZL8A 4HM0B 1ULJB 1O7MB 4J9AA 1QAFA 1US1A 3NBRA 4XDVA 2GEXA 3B4PA 3JUPA 3N8BA 1YGWA 2H0IA 4WFOA 3S67A 1OACA 2XF3A 3DH2A 4WYKB 2IA7A 2IMJA 4ORLA 2BMOB 3NM7A 3NHXA 1W6YA 3DM8A 1YNVX 1LRAA 1B3SA 1BRIA 1TFKA 1Q7HA 3CME3 1VQ83 3CCS3 3HOHA 3EHCA 5ELUA 2HMMB 1TU5A 1IV7A 3KSED 1A2PA 2CFWA 5IERA 1FGRA 3K9MC 4R80A 2Q07A 2IUKA 1IV9A 2JQ5A 4LZIA 1BNSA 4TX4A 1I70A 2C10A 1EEJA 1PYLA 1B2MA 1IQXA 2HMNB 1GMQA 1W2ZA 2HMJB 2W9QA 3NV0A 4I4KA 4HM2B 1FGMA 3I553 1E3VA 3AMOA 1NO3A 1D6ZA 4XBTA 3KFQC 3SX1A 3PGBA 1JKGA 1D6YA 1RGLA 3FGYA 3Q90A 4HAAA 3BNBA 3EF8A 2OOVA 1AVKA 1I2GA 2P38A 1GOUA 1LXEA 1B2ZA 2FNQA 3EN1B 3X42A 1W7CA 3CXC2 1YIT3 4N6V0 1I0VA 4MJDA 4O02B 3UL5A 3MWZA 3L0RA 3BNEA 1GSPA 5KP1A 5EEOA 2OTL3 4CPKA 2W6JH 4FMAA 3GZXB 1X1XA 3NV0B 1TIJA 3HI7A 4XBXA 3X3YA 3ALAA 5IG3A 1W5ZA 3NM2A 2CIUA 5RNTA 5IG0A 3TDGA 1L5GB 1G0TA 1FGQA 4K1UA 1JKGB 4IPBA 4KVHA 4RZMA 2FGTA 5AIFA 1WNHA 1ZGXA 2GU3A 2OWPA 1MOLA 3LZAA 1SQWA 1K41A 4AKZA 1IQ8A 1ULIB 1LOXA 3GWRA 3MG1A 3RGRA 1A90A 1JJ22 1BU4A 1G96A 1CEWI 2IYJA 4Q53A 3HK4A 1BUQA 3F14A 4WWUC 1ZO2A 1VQL3 3LYGA 1EKMA 4ILFA 1SIHA 1MGWA 2O9UX 1I0XA 1IU7A 3GAXA 3SXXA 2D42A 1LOYA 2D1WA 3CCE3 2Y74A 3D3LA 4L8PA 1BAOA 2ZDJA 1GOYA 2R41A 4HM5B 4N6UA 4EV5A 5M18A 5JPPA 1W2B2 2L1SA 2XR8B 3KN4A 3WOEB 1YJ93 1BNRA 3SEDA 5JPUA 5A0OB 2KF6A 2R4IA 2KAAA 2RGQA 3JUMA 5IW9A 4FMDA 2CG0A 3OWUA 3T8UA 1ZX2A 1JZDA 4OK0A 2XRXB 3AGNA 1NU3A 5M19A 4N6LA 3LXUX 3HZPA 2CWTA 4STDA 5AIIA 2W04A 5DRVA 1T2IA 2Z77A 3LTAA 4AEQA 2MF7A 3MKIA 1NNVA 3X3ZA 2RNTA 1PU4A 2F56A 1YHQ3 1TJDA 3BB9A 2W0QA 3B4OA 5STDA 2WO0A 3LMLA 2BMQB 3K0ZA 2UUGC 5AYSC 3DGNA 3CD63 4GB5A 1QALA 2E2VA 6RNTA 3BU4A 1AV4A 3JUQA 3D79A 2CH9A 1V58A 3X41A 4KZ1A 2QIYA 1OCVA 3T0UA 1D6UA 3WDGB 3MG2A 1FYSA 1PFPA 2KXGA 1TTOA 5IENA 1V57A 4BL2A 2B24B 3UJMA 4R9LA 2ML5A 3FH1A 3VGNA 2W9PA 1B20A 1Q814 3G4S3 1V74A 3ECFA 2STDA 3F8HA 2FXTA 1VQN3 1TUHA 2H0GA 2Z6BA 2INXA 3DGOA 4WYKA 3VSYA 3KZTA 3LT9A 1Q824 4K61A 1UUVB 1IDPA 3HIGA 1Z1SA 5CF1A 5LC6A 1YIJ3 2JDIH 3WMDA 1BSEA 1N5PA 1OHOA 2I9WA 3I0YA 4HKVB 3DUKA 4IIAA 1VQ93 3GRDA 1M9GA 1HZ1A 1YJN3 1BRJA 1RNBA 3CPOA 1R4YA 1O7WB 4HYZA 4HM7B 3F8XA 1YVSA 1IVUA 2PZVA 1GS3A 3KIIA 1Q864 1CYUA 1BNGA 3EJVA 1NB3I 3KKGA 5HGRA 1BRGA 3UL6A 1EA2A 4RNYA 1YI23 1JZOA 4ZM8A 1A2KA 2RCDA 3CMA3 2AADA 5ELJA 7STDA 4LSOA 3S27A 1IQYA 1MNLA 4FCMA 1DMNA 1QVG2 3URPA 3QK9A 2GEYA 3LTDA 1B27A 3T8NA 1UW1A 4FCZA 1KD14 1BNEA 4BTXA 2CFGA 5GSPA 3CC73 1JB5A 2CC3A 2HMLB 1Q7Y4 1IT8A 3UB1A 2OOVC 1MWUA 1RMSA 2WGQA 2UX0A 3FSDA 5CF2A 1FUWA 4LEHA 5FGOA 6STDA 5IG4A 5BIRA 2H0HA 7RNTA 5G2GA 3N9HA 1W6CA 4EC6A 3D9RA 3D4AA 5BXQA 3LOYA 1FUSA 1GY7A 2XSHB 2XFTA 3OX9A 4N6MA 5HOHA 1VQ63 2YX9A 1OF5B 4NPBA 3SLUA 1BVIA 1BOXA 3OWSA 4JRFA 4OUQA 1BNFA 4IT7A 3FF2A 3ZG0A 2IY2A 1A2VA 1NB5I 1I8VA 1LOWA 2QEX3 2OQEA 2GSPA 2XH9A 4HM3B 3RGAA 1BGSA 1RKYA 5CLKA 1GD4A 1E97A 1W6GA 3DGMA 2RFRA 1M1XB 3V98A 1RCLA 2XGNA 1ASKA 4H61A 1FW7A 1IVXA 3G0KA 2P05A 5G1KA 1BRHA 1W00A 3OV4A 1K9M4 3FLJA 2XEPA 1RLSA 1WQLB 3EN8A 4RNZA 3PCRA 1WMNA 5FW5A 6GSPA 4MMXB 1UI7A 1I2EA 3D5IA 4NHFA 4BU4A 3X40A 1K8A4 1RN1A 2Z7AA 1DETA 1GMRA 4LMIA 1AQZA 2M7OA 1MWRA 1VQK3 1UCIA 1UCJA 3AHSA 1N9EA 1YVBI 4I5QA 4K90B 4EV2A 1BUJA 4JF8A 5EVHA 3HX8A 4FCJA 3D5GA 3I563 1RSNA 1OH0A 4HM1B 1VQP3 1LOVA 2K3DA 1O7PB 4HZBB 1M904 3GSPA 1GY5A 1F8NA 2CKFB 2QGUA 1OUNA 1TRQA 3ER7A 1GD3A 4FR9A 3BNCA 3BIRA 3WA3A 1JBSA 3WA2X 5BVBA 1BSCA 2KF4A 1BSDA 3S28A 1NDOB 1QAKA 1X1UA 2KRTA 1KQS2 3V92A 3KE7A 1CQSA 1QMAA 3LTCA 1K28A 4RNTA 2SARA 3F7SA 3WODG 3EE1A 1I2FA 3JUNA 4CDLA 2CG1A 1I3FA 2SBLA 2ZA4A 5IEPA 1RN4A 1W01A 1RGHA 1JRQA 3U97A 5AEWB 2J8XB 4J8TA 4KT3B 2F99A 1BNIA 3FZWA 1QVF2 1YJW3 3CU3A 4XB5A 4XBYA 3NX0A 1N9JA 5CXOA 1KSIA 1TFOA 2KF3A 2ML6A 2YFLB 1YGEA 4HZ9B 3CCV3 1ROVA 4L7KA 3WOFB 2E2TA 1RRHA 1FGTA 4BIRA 1JV2B 2BHMA 2RSXA 5AEUB 1J2BA 1Q9EA 3IMAB 2BT3A 1CYVA 1E3RA 4XM4A 1TP6A 3V99A 3F7XA 3SVAA 1STDA 2BNGA 4EW5A 2LYXA 1R4CA 2W56A 4EBGA 4R4KA 2LQVA 1LQGC 2GU1A 1DMMA 1NWWA 1VQ53 3NBJA 3PS8A 3WR2A 3OW22 1RN7A 1SJWA 2V1LA 5AIHA 1UCLA 3PYJA 2XSOB 3RNTA 3SOYA 1FZUA 2CFDA 1B2UA 1BNJA 2PNCA 1Q40A 2B1XB 1DMQA 1JBTA 3ROBA 5IG5A 5D82A 4R9KA 4WHAA 3B8LA 1JNQA 1O7GB 2QA43 3JVCA 3UNLA 1OPYA 2W56B 1LQMB 4AKYA 3G6E3 2KCDA 1Q42A 3NQYA 4LYLB 3CCR3 1ISKA 3EX9A 1BANA 2Y73A 1JN5B 3KCHA 3DZLA 3G16A 1OGXA 1ZS7A 4XDWA 1BSBA 1STFI 3U1WA 1HYFA 2HMKB 4MMZB 1Q40B 5DREA 5IF6A 2W03A 1JB2A 4FMCA 1O7NB 1RGAA 1RTUA 1U5OA 3FG4A 4BL3A 2CW9A 1BRSA 1SPUA 3B7CA 5EQLA 2CWUA 2HOHA 1S5AA 3CCM3 1AVLA 1UGHI 4CJNA 1OF5A 2L4VA 1N8R4 1LVNA 2CHCA 1RJOA 1X1YA 4QWTA 3FG3A 4J5GA 5M1AA 1WTHA 3SOAA 3CPW2 1VQO3 5AI1A 1VQ73 2IUJA 3MG3A 1JB4A 2CK3H 4WP5A 2E2UA 3X3XA 2C4BA 1K734 2BIRA 3LT8A 1S723 3BLZA 4BTWA 1C54A 1M1K4 2F4YA 4RBNA 3J7Yd 1RGGA 3QRDA 1UGIA 1MWTA 2CFLA 1MGRA 2O3OA 3S5CA 2YFJB 1GY6A 1AR0A 1IT7A 3DGYA 1FUTA 1RRLA 2KF5A 3BNDA 2OQEC 3S29A 7GSPA 1SIIA 2P09A 2WOFA 3G8ZA 3NBBA 1OGZA 4FMBA 5LC7A 1VZZA 2ZHXB 3LH4A 4O2HA 1N5HA 3F40A 3DY5A 4BTYA 4HVNA 4MMYB 1CH0A 3OXAA 1FGOA 5I97A 3NUVA 1EUIC 1T5YA 3K7CA 2W2CA 5BU4A 3KSPA 3CC43 2YFIB 4N6TA 1BRNL 2K54A 1IK3A 1O7HB 2GBWB 1AY7A 1EQKA 4O3VA 3DXOA 1RGFA 1WMPA 2K0MA 5KP4A 2AAEA 4HM4B 2CWVA 1RNTA 2F5MA 1BSAA 4EYCA 1G02A 3A76A 2CFKA 1VQQA 2P0MA 1BRKA 2F98A 2GXFA 1X1WA 3IPTA 4N3VA 4X2OA 3AMOB 2Z76A 4GL6A 3N54B 1IVVA 1N8QA 3K5TA 1EG9B 2WGOA 2WOHA 3AHWA 1UUWB 9RNTA 1RGCA 4G1MB 1VQM3 1HU9A 2F86B 1W02A 3EBTA 3WHOA 3AGOA 3JUOA 1T2HA 3M8CA 4K1VA 3CCU3 1JBRA 1GMPA 3GZYB 1UI8A 3E99A 2UGIA 1U8CB 3H3HA 1KWIA 4U13A 4CCVA 4GSPA 1A67A 2MC8A 3FG1A 3MSOA 2C11A 4L8OA 3PCSA 1W4NA 3G713 3FF0A 4HBRA 1TRPA 5D83A 4LGQA 3VF1A 3MHEA 1BIRA 2F5WA 4HJLB 1WMOA 5AIGA 5AYRB 1OHPA 3IJEB 3CCJ3 2BU4A 3LTBA 2BO9B 1GOVA 3O8YA 3CCQ3 1RGKA 3EQQB 3OWYA 3GZBA 4OVMA 3PZWA 4R1KA 3CNMA 4KFFA 1DVCA 3DGLA 4X2HA 5IEOA 1VQ43 1B21A 3K63A 3MYTA 1NJI4 3A5EA 4KFDA 3HIIA 4N6OB
chains in the Genus database with same CATH topology
1RCKA 1BU4A 1UCKA 5BIRA 7RNTA 4J5KA 4HOHA 1BANA 3KCHA 3D4AA 1PY3A 1FUSA 1MGWA 1BSBA 1SARA 3SYUA 1HYFA 1I0XA 5HOHA 1LOYA 1RGAA 1BAOA 1BVIA 1BOXA 1GOYA 1RTUA 1BNFA 1BRSA 1LNIA 1I8VA 2HOHA 1LOWA 1BNRA 2GSPA 2KF6A 1BGSA 2KAAA 8RNTA 1RHLA 1X1YA 2RBIA 4J5GA 1FW7A 1RCLA 3Q3FA 3AGNA 1RDSA 1B2SA 1RGEA 1BRHA 1I3IA 1RLSA 1T2IA 1B2XA 2C4BA 2BIRA 2RNTA 6GSPA 2F56A 1C54A 2F4YA 1IYYA 1RGGA 4GHOA 1I2EA 1MGRA 3D5IA 4BU4A 1RN1A 3DGYA 1DETA 1FUTA 2KF5A 7GSPA 1GMRA 1DE3A 1AQZA 6RNTA 3BU4A 1UCIA 1UCJA 3AHSA 1BUJA 1YGWA 1CH0A 3D5GA 1FYSA 3DH2A 1RSNA 1TTOA 1LOVA 5BU4A 3GSPA 1BRNL 1TRQA 1AY7A 3BIRA 1B20A 1JBSA 1RGFA 1YNVX 1LRAA 2AAEA 1B3SA 1BSCA 1BSDA 2KF4A 1BRIA 1X1UA 1RNTA 2F5MA 1BSAA 1G02A 3HOHA 4RNTA 2SARA 1A2PA 1I2FA 1BRKA 1I3FA 2ZA4A 1X1WA 1RN4A 1RGHA 1BSEA 1BNIA 1BNSA 1I70A 1HZ1A 1BRJA 1RNBA 1R4YA 1PYLA 2KF3A 1B2MA 3AHWA 9RNTA 1GMQA 1RGCA 1YVSA 4BIRA 3WHOA 3AGOA 1JBRA 1T2HA 1Q9EA 1GMPA 1RGLA 1BNGA 4HAAA 1I2GA 4GSPA 1GOUA 1BRGA 1B2ZA 1TRPA 1I0VA 2AADA 1BIRA 2F5WA 1GSPA 3WR2A 1X1XA 1UCLA 2BU4A 3URPA 3RNTA 1GOVA 1FZUA 1B27A 5RNTA 1RGKA 1B2UA 1BNJA 1BNEA 5GSPA 1JBTA 1B21A 1ZGXA 3A5EA 1RMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCK A;  1BU4 A;  1UCK A;  5BIR A;  7RNT A;  4J5K A;  4HOH A;  1BAN A;  3KCH A;  3D4A A;  1PY3 A;  1FUS A;  1MGW A;  1BSB A;  1SAR A;  3SYU A;  1HYF A;  1I0X A;  5HOH A;  1LOY A;  1RGA A;  1BAO A;  1BVI A;  1BOX A;  1GOY A;  1RTU A;  1BNF A;  1BRS A;  1LNI A;  1I8V A;  2HOH A;  1LOW A;  1BNR A;  2GSP A;  2KF6 A;  1BGS A;  2KAA A;  8RNT A;  1RHL A;  1X1Y A;  2RBI A;  4J5G A;  1FW7 A;  1RCL A;  3Q3F A;  3AGN A;  1RDS A;  1B2S A;  1RGE A;  1BRH A;  1I3I A;  1RLS A;  1T2I A;  1B2X A;  2C4B A;  2BIR A;  2RNT A;  6GSP A;  2F56 A;  1C54 A;  2F4Y A;  1IYY A;  1RGG A;  4GHO A;  1I2E A;  1MGR A;  3D5I A;  4BU4 A;  1RN1 A;  3DGY A;  1DET A;  1FUT A;  2KF5 A;  7GSP A;  1GMR A;  1DE3 A;  1AQZ A;  6RNT A;  3BU4 A;  1UCI A;  1UCJ A;  3AHS A;  1BUJ A;  1YGW A;  1CH0 A;  3D5G A;  1FYS A;  3DH2 A;  1RSN A;  1TTO A;  1LOV A;  5BU4 A;  3GSP A;  1BRN L;  1TRQ A;  1AY7 A;  3BIR A;  1B20 A;  1JBS A;  1RGF A;  1YNV X;  1LRA A;  2AAE A;  1B3S A;  1BSC A;  1BSD A;  2KF4 A;  1BRI A;  1X1U A;  1RNT A;  2F5M A;  1BSA A;  1G02 A;  3HOH A;  4RNT A;  2SAR A;  1A2P A;  1I2F A;  1BRK A;  1I3F A;  2ZA4 A;  1X1W A;  1RN4 A;  1RGH A;  1BSE A;  1BNI A;  1BNS A;  1I70 A;  1HZ1 A;  1BRJ A;  1RNB A;  1R4Y A;  1PYL A;  2KF3 A;  1B2M A;  3AHW A;  9RNT A;  1GMQ A;  1RGC A;  1YVS A;  4BIR A;  3WHO A;  3AGO A;  1JBR A;  1T2H A;  1Q9E A;  1GMP A;  1RGL A;  1BNG A;  4HAA A;  1I2G A;  4GSP A;  1GOU A;  1BRG A;  1B2Z A;  1TRP A;  1I0V A;  2AAD A;  1BIR A;  2F5W A;  1GSP A;  3WR2 A;  1X1X A;  1UCL A;  2BU4 A;  3URP A;  3RNT A;  1GOV A;  1FZU A;  1B27 A;  5RNT A;  1RGK A;  1B2U A;  1BNJ A;  1BNE A;  5GSP A;  1JBT A;  1B21 A;  1ZGX A;  3A5E A;  1RMS A; 
#chains in the Genus database with same CATH topology
 1RCK A;  3STD A;  1UCK A;  1QJG A;  4O8S A;  2GBX B;  1DYU A;  1OHS A;  4J5K A;  2XGL A;  1KC8 4;  4HOH A;  2CX0 A;  1ROA A;  1Y4K A;  1PY3 A;  1SAR A;  3EB8 A;  4PEJ A;  3SYU A;  1DVD A;  1LNH A;  2XFS A;  3ZG5 A;  3FCS B;  5JBS A;  3F9S A;  3ZFZ A;  4EXR A;  1DE3 A;  4N6N B;  5CK6 A;  1LNI A;  2A15 A;  3NQZ A;  1JN5 A;  3H51 A;  3EBY A;  2HMO B;  4HM6 B;  4NRE A;  3NXJ A;  8RNT A;  2OCT A;  3CCL 3;  3CC2 3;  2BMR B;  1RHL A;  5D81 A;  1HKX A;  2RBI A;  4H3U A;  4HM8 B;  2CX1 A;  3Q3F A;  5KP3 A;  1RDS A;  1B2S A;  1RGE A;  3DMC A;  3CNX A;  1C7H A;  1I3I A;  3GZR A;  3Q1C A;  5G1L A;  1UDI I;  3EC9 A;  3RDE A;  4DKI A;  5TGN A;  1B2X A;  2P0X A;  1UUG B;  1MWS A;  3Q2P A;  4KFE A;  3MPH A;  1T3B A;  4MEI A;  2OTJ 3;  8CHO A;  1IYY A;  1FA3 A;  4GHO A;  3FKA A;  3PXM A;  1IVW A;  1GYB A;  2ZL8 A;  4HM0 B;  1ULJ B;  1O7M B;  4J9A A;  1QAF A;  1US1 A;  3NBR A;  4XDV A;  2GEX A;  3B4P A;  3JUP A;  3N8B A;  1YGW A;  2H0I A;  4WFO A;  3S67 A;  1OAC A;  2XF3 A;  3DH2 A;  4WYK B;  2IA7 A;  2IMJ A;  4ORL A;  2BMO B;  3NM7 A;  3NHX A;  1W6Y A;  3DM8 A;  1YNV X;  1LRA A;  1B3S A;  1BRI A;  1TFK A;  1Q7H A;  3CME 3;  1VQ8 3;  3CCS 3;  3HOH A;  3EHC A;  5ELU A;  2HMM B;  1TU5 A;  1IV7 A;  3KSE D;  1A2P A;  2CFW A;  5IER A;  1FGR A;  3K9M C;  4R80 A;  2Q07 A;  2IUK A;  1IV9 A;  2JQ5 A;  4LZI A;  1BNS A;  4TX4 A;  1I70 A;  2C10 A;  1EEJ A;  1PYL A;  1B2M A;  1IQX A;  2HMN B;  1GMQ A;  1W2Z A;  2HMJ B;  2W9Q A;  3NV0 A;  4I4K A;  4HM2 B;  1FGM A;  3I55 3;  1E3V A;  3AMO A;  1NO3 A;  1D6Z A;  4XBT A;  3KFQ C;  3SX1 A;  3PGB A;  1JKG A;  1D6Y A;  1RGL A;  3FGY A;  3Q90 A;  4HAA A;  3BNB A;  3EF8 A;  2OOV A;  1AVK A;  1I2G A;  2P38 A;  1GOU A;  1LXE A;  1B2Z A;  2FNQ A;  3EN1 B;  3X42 A;  1W7C A;  3CXC 2;  1YIT 3;  4N6V 0;  1I0V A;  4MJD A;  4O02 B;  3UL5 A;  3MWZ A;  3L0R A;  3BNE A;  1GSP A;  5KP1 A;  5EEO A;  2OTL 3;  4CPK A;  2W6J H;  4FMA A;  3GZX B;  1X1X A;  3NV0 B;  1TIJ A;  3HI7 A;  4XBX A;  3X3Y A;  3ALA A;  5IG3 A;  1W5Z A;  3NM2 A;  2CIU A;  5RNT A;  5IG0 A;  3TDG A;  1L5G B;  1G0T A;  1FGQ A;  4K1U A;  1JKG B;  4IPB A;  4KVH A;  4RZM A;  2FGT A;  5AIF A;  1WNH A;  1ZGX A;  2GU3 A;  2OWP A;  1MOL A;  3LZA A;  1SQW A;  1K41 A;  4AKZ A;  1IQ8 A;  1ULI B;  1LOX A;  3GWR A;  3MG1 A;  3RGR A;  1A90 A;  1JJ2 2;  1BU4 A;  1G96 A;  1CEW I;  2IYJ A;  4Q53 A;  3HK4 A;  1BUQ A;  3F14 A;  4WWU C;  1ZO2 A;  1VQL 3;  3LYG A;  1EKM A;  4ILF A;  1SIH A;  1MGW A;  2O9U X;  1I0X A;  1IU7 A;  3GAX A;  3SXX A;  2D42 A;  1LOY A;  2D1W A;  3CCE 3;  2Y74 A;  3D3L A;  4L8P A;  1BAO A;  2ZDJ A;  1GOY A;  2R41 A;  4HM5 B;  4N6U A;  4EV5 A;  5M18 A;  5JPP A;  1W2B 2;  2L1S A;  2XR8 B;  3KN4 A;  3WOE B;  1YJ9 3;  1BNR A;  3SED A;  5JPU A;  5A0O B;  2KF6 A;  2R4I A;  2KAA A;  2RGQ A;  3JUM A;  5IW9 A;  4FMD A;  2CG0 A;  3OWU A;  3T8U A;  1ZX2 A;  1JZD A;  4OK0 A;  2XRX B;  3AGN A;  1NU3 A;  5M19 A;  4N6L A;  3LXU X;  3HZP A;  2CWT A;  4STD A;  5AII A;  2W04 A;  5DRV A;  1T2I A;  2Z77 A;  3LTA A;  4AEQ A;  2MF7 A;  3MKI A;  1NNV A;  3X3Z A;  2RNT A;  1PU4 A;  2F56 A;  1YHQ 3;  1TJD A;  3BB9 A;  2W0Q A;  3B4O A;  5STD A;  2WO0 A;  3LML A;  2BMQ B;  3K0Z A;  2UUG C;  5AYS C;  3DGN A;  3CD6 3;  4GB5 A;  1QAL A;  2E2V A;  6RNT A;  3BU4 A;  1AV4 A;  3JUQ A;  3D79 A;  2CH9 A;  1V58 A;  3X41 A;  4KZ1 A;  2QIY A;  1OCV A;  3T0U A;  1D6U A;  3WDG B;  3MG2 A;  1FYS A;  1PFP A;  2KXG A;  1TTO A;  5IEN A;  1V57 A;  4BL2 A;  2B24 B;  3UJM A;  4R9L A;  2ML5 A;  3FH1 A;  3VGN A;  2W9P A;  1B20 A;  1Q81 4;  3G4S 3;  1V74 A;  3ECF A;  2STD A;  3F8H A;  2FXT A;  1VQN 3;  1TUH A;  2H0G A;  2Z6B A;  2INX A;  3DGO A;  4WYK A;  3VSY A;  3KZT A;  3LT9 A;  1Q82 4;  4K61 A;  1UUV B;  1IDP A;  3HIG A;  1Z1S A;  5CF1 A;  5LC6 A;  1YIJ 3;  2JDI H;  3WMD A;  1BSE A;  1N5P A;  1OHO A;  2I9W A;  3I0Y A;  4HKV B;  3DUK A;  4IIA A;  1VQ9 3;  3GRD A;  1M9G A;  1HZ1 A;  1YJN 3;  1BRJ A;  1RNB A;  3CPO A;  1R4Y A;  1O7W B;  4HYZ A;  4HM7 B;  3F8X A;  1YVS A;  1IVU A;  2PZV A;  1GS3 A;  3KII A;  1Q86 4;  1CYU A;  1BNG A;  3EJV A;  1NB3 I;  3KKG A;  5HGR A;  1BRG A;  3UL6 A;  1EA2 A;  4RNY A;  1YI2 3;  1JZO A;  4ZM8 A;  1A2K A;  2RCD A;  3CMA 3;  2AAD A;  5ELJ A;  7STD A;  4LSO A;  3S27 A;  1IQY A;  1MNL A;  4FCM A;  1DMN A;  1QVG 2;  3URP A;  3QK9 A;  2GEY A;  3LTD A;  1B27 A;  3T8N A;  1UW1 A;  4FCZ A;  1KD1 4;  1BNE A;  4BTX A;  2CFG A;  5GSP A;  3CC7 3;  1JB5 A;  2CC3 A;  2HML B;  1Q7Y 4;  1IT8 A;  3UB1 A;  2OOV C;  1MWU A;  1RMS A;  2WGQ A;  2UX0 A;  3FSD A;  5CF2 A;  1FUW A;  4LEH A;  5FGO A;  6STD A;  5IG4 A;  5BIR A;  2H0H A;  7RNT A;  5G2G A;  3N9H A;  1W6C A;  4EC6 A;  3D9R A;  3D4A A;  5BXQ A;  3LOY A;  1FUS A;  1GY7 A;  2XSH B;  2XFT A;  3OX9 A;  4N6M A;  5HOH A;  1VQ6 3;  2YX9 A;  1OF5 B;  4NPB A;  3SLU A;  1BVI A;  1BOX A;  3OWS A;  4JRF A;  4OUQ A;  1BNF A;  4IT7 A;  3FF2 A;  3ZG0 A;  2IY2 A;  1A2V A;  1NB5 I;  1I8V A;  1LOW A;  2QEX 3;  2OQE A;  2GSP A;  2XH9 A;  4HM3 B;  3RGA A;  1BGS A;  1RKY A;  5CLK A;  1GD4 A;  1E97 A;  1W6G A;  3DGM A;  2RFR A;  1M1X B;  3V98 A;  1RCL A;  2XGN A;  1ASK A;  4H61 A;  1FW7 A;  1IVX A;  3G0K A;  2P05 A;  5G1K A;  1BRH A;  1W00 A;  3OV4 A;  1K9M 4;  3FLJ A;  2XEP A;  1RLS A;  1WQL B;  3EN8 A;  4RNZ A;  3PCR A;  1WMN A;  5FW5 A;  6GSP A;  4MMX B;  1UI7 A;  1I2E A;  3D5I A;  4NHF A;  4BU4 A;  3X40 A;  1K8A 4;  1RN1 A;  2Z7A A;  1DET A;  1GMR A;  4LMI A;  1AQZ A;  2M7O A;  1MWR A;  1VQK 3;  1UCI A;  1UCJ A;  3AHS A;  1N9E A;  1YVB I;  4I5Q A;  4K90 B;  4EV2 A;  1BUJ A;  4JF8 A;  5EVH A;  3HX8 A;  4FCJ A;  3D5G A;  3I56 3;  1RSN A;  1OH0 A;  4HM1 B;  1VQP 3;  1LOV A;  2K3D A;  1O7P B;  4HZB B;  1M90 4;  3GSP A;  1GY5 A;  1F8N A;  2CKF B;  2QGU A;  1OUN A;  1TRQ A;  3ER7 A;  1GD3 A;  4FR9 A;  3BNC A;  3BIR A;  3WA3 A;  1JBS A;  3WA2 X;  5BVB A;  1BSC A;  2KF4 A;  1BSD A;  3S28 A;  1NDO B;  1QAK A;  1X1U A;  2KRT A;  1KQS 2;  3V92 A;  3KE7 A;  1CQS A;  1QMA A;  3LTC A;  1K28 A;  4RNT A;  2SAR A;  3F7S A;  3WOD G;  3EE1 A;  1I2F A;  3JUN A;  4CDL A;  2CG1 A;  1I3F A;  2SBL A;  2ZA4 A;  5IEP A;  1RN4 A;  1W01 A;  1RGH A;  1JRQ A;  3U97 A;  5AEW B;  2J8X B;  4J8T A;  4KT3 B;  2F99 A;  1BNI A;  3FZW A;  1QVF 2;  1YJW 3;  3CU3 A;  4XB5 A;  4XBY A;  3NX0 A;  1N9J A;  5CXO A;  1KSI A;  1TFO A;  2KF3 A;  2ML6 A;  2YFL B;  1YGE A;  4HZ9 B;  3CCV 3;  1ROV A;  4L7K A;  3WOF B;  2E2T A;  1RRH A;  1FGT A;  4BIR A;  1JV2 B;  2BHM A;  2RSX A;  5AEU B;  1J2B A;  1Q9E A;  3IMA B;  2BT3 A;  1CYV A;  1E3R A;  4XM4 A;  1TP6 A;  3V99 A;  3F7X A;  3SVA A;  1STD A;  2BNG A;  4EW5 A;  2LYX A;  1R4C A;  2W56 A;  4EBG A;  4R4K A;  2LQV A;  1LQG C;  2GU1 A;  1DMM A;  1NWW A;  1VQ5 3;  3NBJ A;  3PS8 A;  3WR2 A;  3OW2 2;  1RN7 A;  1SJW A;  2V1L A;  5AIH A;  1UCL A;  3PYJ A;  2XSO B;  3RNT A;  3SOY A;  1FZU A;  2CFD A;  1B2U A;  1BNJ A;  2PNC A;  1Q40 A;  2B1X B;  1DMQ A;  1JBT A;  3ROB A;  5IG5 A;  5D82 A;  4R9K A;  4WHA A;  3B8L A;  1JNQ A;  1O7G B;  2QA4 3;  3JVC A;  3UNL A;  1OPY A;  2W56 B;  1LQM B;  4AKY A;  3G6E 3;  2KCD A;  1Q42 A;  3NQY A;  4LYL B;  3CCR 3;  1ISK A;  3EX9 A;  1BAN A;  2Y73 A;  1JN5 B;  3KCH A;  3DZL A;  3G16 A;  1OGX A;  1ZS7 A;  4XDW A;  1BSB A;  1STF I;  3U1W A;  1HYF A;  2HMK B;  4MMZ B;  1Q40 B;  5DRE A;  5IF6 A;  2W03 A;  1JB2 A;  4FMC A;  1O7N B;  1RGA A;  1RTU A;  1U5O A;  3FG4 A;  4BL3 A;  2CW9 A;  1BRS A;  1SPU A;  3B7C A;  5EQL A;  2CWU A;  2HOH A;  1S5A A;  3CCM 3;  1AVL A;  1UGH I;  4CJN A;  1OF5 A;  2L4V A;  1N8R 4;  1LVN A;  2CHC A;  1RJO A;  1X1Y A;  4QWT A;  3FG3 A;  4J5G A;  5M1A A;  1WTH A;  3SOA A;  3CPW 2;  1VQO 3;  5AI1 A;  1VQ7 3;  2IUJ A;  3MG3 A;  1JB4 A;  2CK3 H;  4WP5 A;  2E2U A;  3X3X A;  2C4B A;  1K73 4;  2BIR A;  3LT8 A;  1S72 3;  3BLZ A;  4BTW A;  1C54 A;  1M1K 4;  2F4Y A;  4RBN A;  3J7Y d;  1RGG A;  3QRD A;  1UGI A;  1MWT A;  2CFL A;  1MGR A;  2O3O A;  3S5C A;  2YFJ B;  1GY6 A;  1AR0 A;  1IT7 A;  3DGY A;  1FUT A;  1RRL A;  2KF5 A;  3BND A;  2OQE C;  3S29 A;  7GSP A;  1SII A;  2P09 A;  2WOF A;  3G8Z A;  3NBB A;  1OGZ A;  4FMB A;  5LC7 A;  1VZZ A;  2ZHX B;  3LH4 A;  4O2H A;  1N5H A;  3F40 A;  3DY5 A;  4BTY A;  4HVN A;  4MMY B;  1CH0 A;  3OXA A;  1FGO A;  5I97 A;  3NUV A;  1EUI C;  1T5Y A;  3K7C A;  2W2C A;  5BU4 A;  3KSP A;  3CC4 3;  2YFI B;  4N6T A;  1BRN L;  2K54 A;  1IK3 A;  1O7H B;  2GBW B;  1AY7 A;  1EQK A;  4O3V A;  3DXO A;  1RGF A;  1WMP A;  2K0M A;  5KP4 A;  2AAE A;  4HM4 B;  2CWV A;  1RNT A;  2F5M A;  1BSA A;  4EYC A;  1G02 A;  3A76 A;  2CFK A;  1VQQ A;  2P0M A;  1BRK A;  2F98 A;  2GXF A;  1X1W A;  3IPT A;  4N3V A;  4X2O A;  3AMO B;  2Z76 A;  4GL6 A;  3N54 B;  1IVV A;  1N8Q A;  3K5T A;  1EG9 B;  2WGO A;  2WOH A;  3AHW A;  1UUW B;  9RNT A;  1RGC A;  4G1M B;  1VQM 3;  1HU9 A;  2F86 B;  1W02 A;  3EBT A;  3WHO A;  3AGO A;  3JUO A;  1T2H A;  3M8C A;  4K1V A;  3CCU 3;  1JBR A;  1GMP A;  3GZY B;  1UI8 A;  3E99 A;  2UGI A;  1U8C B;  3H3H A;  1KWI A;  4U13 A;  4CCV A;  4GSP A;  1A67 A;  2MC8 A;  3FG1 A;  3MSO A;  2C11 A;  4L8O A;  3PCS A;  1W4N A;  3G71 3;  3FF0 A;  4HBR A;  1TRP A;  5D83 A;  4LGQ A;  3VF1 A;  3MHE A;  1BIR A;  2F5W A;  4HJL B;  1WMO A;  5AIG A;  5AYR B;  1OHP A;  3IJE B;  3CCJ 3;  2BU4 A;  3LTB A;  2BO9 B;  1GOV A;  3O8Y A;  3CCQ 3;  1RGK A;  3EQQ B;  3OWY A;  3GZB A;  4OVM A;  3PZW A;  4R1K A;  3CNM A;  4KFF A;  1DVC A;  3DGL A;  4X2H A;  5IEO A;  1VQ4 3;  1B21 A;  3K63 A;  3MYT A;  1NJI 4;  3A5E A;  4KFD A;  3HII A;  4N6O B; 
#chains in the Genus database with same CATH homology
 1RCK A;  1BU4 A;  1UCK A;  5BIR A;  7RNT A;  4J5K A;  4HOH A;  1BAN A;  3KCH A;  3D4A A;  1PY3 A;  1FUS A;  1MGW A;  1BSB A;  1SAR A;  3SYU A;  1HYF A;  1I0X A;  5HOH A;  1LOY A;  1RGA A;  1BAO A;  1BVI A;  1BOX A;  1GOY A;  1RTU A;  1BNF A;  1BRS A;  1LNI A;  1I8V A;  2HOH A;  1LOW A;  1BNR A;  2GSP A;  2KF6 A;  1BGS A;  2KAA A;  8RNT A;  1RHL A;  1X1Y A;  2RBI A;  4J5G A;  1FW7 A;  1RCL A;  3Q3F A;  3AGN A;  1RDS A;  1B2S A;  1RGE A;  1BRH A;  1I3I A;  1RLS A;  1T2I A;  1B2X A;  2C4B A;  2BIR A;  2RNT A;  6GSP A;  2F56 A;  1C54 A;  2F4Y A;  1IYY A;  1RGG A;  4GHO A;  1I2E A;  1MGR A;  3D5I A;  4BU4 A;  1RN1 A;  3DGY A;  1DET A;  1FUT A;  2KF5 A;  7GSP A;  1GMR A;  1DE3 A;  1AQZ A;  6RNT A;  3BU4 A;  1UCI A;  1UCJ A;  3AHS A;  1BUJ A;  1YGW A;  1CH0 A;  3D5G A;  1FYS A;  3DH2 A;  1RSN A;  1TTO A;  1LOV A;  5BU4 A;  3GSP A;  1BRN L;  1TRQ A;  1AY7 A;  3BIR A;  1B20 A;  1JBS A;  1RGF A;  1YNV X;  1LRA A;  2AAE A;  1B3S A;  1BSC A;  1BSD A;  2KF4 A;  1BRI A;  1X1U A;  1RNT A;  2F5M A;  1BSA A;  1G02 A;  3HOH A;  4RNT A;  2SAR A;  1A2P A;  1I2F A;  1BRK A;  1I3F A;  2ZA4 A;  1X1W A;  1RN4 A;  1RGH A;  1BSE A;  1BNI A;  1BNS A;  1I70 A;  1HZ1 A;  1BRJ A;  1RNB A;  1R4Y A;  1PYL A;  2KF3 A;  1B2M A;  3AHW A;  9RNT A;  1GMQ A;  1RGC A;  1YVS A;  4BIR A;  3WHO A;  3AGO A;  1JBR A;  1T2H A;  1Q9E A;  1GMP A;  1RGL A;  1BNG A;  4HAA A;  1I2G A;  4GSP A;  1GOU A;  1BRG A;  1B2Z A;  1TRP A;  1I0V A;  2AAD A;  1BIR A;  2F5W A;  1GSP A;  3WR2 A;  1X1X A;  1UCL A;  2BU4 A;  3URP A;  3RNT A;  1GOV A;  1FZU A;  1B27 A;  5RNT A;  1RGK A;  1B2U A;  1BNJ A;  1BNE A;  5GSP A;  1JBT A;  1B21 A;  1ZGX A;  3A5E A;  1RMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...