1B2ZA

Deletion of a buried salt bridge in barnase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSNWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2zA00
1UCJA 1MGWA 2ZA4A 1RGHA 2C4BA 1IYYA 1B2XA 1RLSA 5HOHA 4GHOA 1UCKA 2KF5A 1YVSA 2HOHA 1B20A 1JBSA 1A2PA 1I0VA 1BRIA 1BNSA 1B3SA 1I0XA 3Q3FA 1CH0A 1BNGA 1I8VA 1HZ1A 2BIRA 7GSPA 1SARA 1I2EA 1BSCA 1LRAA 1RGCA 1I3IA 1BNRA 1MGRA 1B2ZA 1LOVA 1BVIA 3AGNA 2F4YA 3DGYA 1UCIA 1RCKA 1RGLA 6GSPA 1BRNL 2F56A 3URPA 1GMPA 1FZUA 1RGGA 4J5GA 1GOUA 2AADA 1AQZA 1I3FA 1B2MA 1RNTA 1BRGA 3RNTA 1BRJA 1ZGXA 1RN4A 2F5MA 1BSEA 4HAAA 1GMRA 1T2IA 3A5EA 3D4AA 4RNTA 1TTOA 4BIRA 1BGSA 1PYLA 2GSPA 1HYFA 1UCLA 3AHWA 2KAAA 3KCHA 1RGFA 1RCLA 1I2GA 1RSNA 1BNJA 1TRQA 1C54A 1FUSA 1BOXA 1RMSA 1X1YA 1YGWA 2F5WA 5BU4A 1R4YA 5BIRA 1GOVA 3WHOA 1DE3A 1TRPA 1RHLA 1I2FA 2KF3A 3BIRA 4HOHA 4BU4A 1B21A 1B2SA 3AGOA 1T2HA 1AY7A 2KF6A 1PY3A 8RNTA 4GSPA 1X1XA 1LOWA 1GSPA 1JBTA 1G02A 1X1UA 7RNTA 1YNVX 1RGKA 1BSBA 1LNIA 1BNEA 1Q9EA 2RNTA 1RNBA 1RDSA 1GOYA 1LOYA 2AAEA 1BNIA 2KF4A 3HOHA 1BRSA 1B27A 1RGAA 1RGEA 1BAOA 3D5GA 1BIRA 6RNTA 1B2UA 3GSPA 2RBIA 3WR2A 1FW7A 4J5KA 1X1WA 5GSPA 2BU4A 1GMQA 1BRHA 1I70A 1DETA 1BU4A 1BRKA 1BSDA 3BU4A 3SYUA 1FYSA 9RNTA 3D5IA 1BUJA 1FUTA 1JBRA 1RTUA 1BSAA 3DH2A 5RNTA 3AHSA 1BANA 1BNFA 1RN1A 2SARA
chains in the Genus database with same CATH superfamily
3AMOB 3WA2X 1MGWA 4ILFA 4L8OA 1RGHA 3DY5A 1RLSA 1N8R4 2KCDA 1FGOA 3NX0A 4GHOA 4KZ1A 2KF5A 2XH9A 4FMCA 4OUQA 1NDOB 3IPTA 3F8HA 5BXQA 1FA3A 1A2PA 3BNEA 3VSYA 1W6CA 1VQ83 3LT8A 4LEHA 2XSHB 1VQN3 3EF8A 1CH0A 1W2ZA 5CF1A 2BIRA 2CW9A 1SPUA 3EBTA 3U1WA 4JRFA 3MG3A 4JF8A 2HMMB 2WO0A 1IV9A 3MWZA 3PZWA 5IEOA 2OTJ3 1BSCA 1HKXA 1LRAA 1JJ22 5IG5A 3ZG0A 1VQL3 1BNRA 1L5GB 3FF0A 2WOFA 4QWTA 1OUNA 1QAKA 2F4YA 2W0QA 4Q53A 3LOYA 2W2CA 1RGLA 6GSPA 3GZBA 1IV7A 2OTL3 2XEPA 1BRNL 1DYUA 1IVUA 2OWPA 1UUVB 1QAFA 1EEJA 1RGGA 4J5GA 3BB9A 2IYJA 1RJOA 3OWSA 3MYTA 5FW5A 3WOFB 3BNCA 3B4OA 1W5ZA 4K90B 3SOAA 3DXOA 2INXA 2W6JH 3JUMA 3G8ZA 2O3OA 4N3VA 2RCDA 1D6UA 4FCZA 3ZFZA 1PU4A 2CKFB 1WNHA 3FG1A 1VQ53 4MMYB 3DZLA 4HM2B 5M1AA 3FF2A 4WYKB 4BTWA 5D82A 1Q7Y4 1FGMA 1NWWA 3A76A 3NV0A 2W04A 4HYZA 4N6MA 1AVLA 1JKGA 2P09A 3KCHA 4N6NB 3D3LA 3GZYB 1O7GB 1RSNA 4KFDA 5LC6A 1BNJA 1X1YA 1UGHI 3CCQ3 5M18A 1KQS2 4U13A 1FUWA 4KFEA 3J7Yd 1TFKA 2CWTA 3NM7A 1ULJB 4PEJA 2IUJA 3WHOA 3KZTA 2XF3A 1JB4A 1RHLA 5ELUA 1IDPA 3T8NA 1I2FA 1SQWA 3BIRA 3Q2PA 2KRTA 1A90A 3LTDA 1UW1A 4HM5B 1FGQA 1S5AA 1O7WB 3D79A 3QK9A 1PY3A 2E2UA 1X1XA 5IW9A 1JBTA 2PNCA 4CJNA 2CG1A 7RNTA 3CC43 1M1XB 1GY5A 4IIAA 3UL6A 3CNMA 2RSXA 2BMQB 1NB3I 1Q9EA 3STDA 1RNBA 2KF4A 3WA3A 1WQLB 4R4KA 1MWSA 2WGOA 2CK3H 2LYXA 2CWUA 3GSPA 4RNZA 2K54A 3EN1B 3FGYA 3WMDA 4WFOA 3L0RA 3CCS3 1IK3A 4J8TA 5GSPA 1AVKA 4KFFA 1E97A 3G4S3 1S723 2CHCA 3LH4A 4IPBA 1IVWA 1BU4A 4K1VA 3NQYA 1C7HA 3F9SA 3JVCA 3T8UA 1LQMB 3D5IA 4STDA 1Z1SA 2GU1A 1US1A 4H3UA 3NHXA 1ASKA 3EE1A 1W6YA 3DH2A 4MEIA 3X42A 1UUGB 1BANA 1W01A 2GEXA 2GXFA 5RNTA 3GRDA 1Q7HA 3PCRA 2P38A 1V57A 2BMOB 2ZA4A 2Y73A 4AKYA 1IYYA 3NV0B 3CCE3 4H61A 1JKGB 1TUHA 2OOVA 2OOVC 1A2VA 2HOHA 1B20A 3BNBA 2QEX3 1JBSA 1ULIB 2L4VA 4R1KA 1EQKA 1I0VA 2BT3A 1EA2A 1BRIA 3NUVA 3Q3FA 2M7OA 2QA43 3S67A 2L1SA 1N5HA 5CXOA 1CYVA 3EB8A 3HZPA 4HM4B 3X3YA 5IENA 2E2VA 3WOEB 3V98A 3SVAA 1M904 1CYUA 1N9JA 1GY7A 1OH0A 3MG2A 2F99A 4I4KA 3X3ZA 2E2TA 2W03A 1MGRA 1WMOA 1FGRA 2C11A 3ER7A 4FMAA 3CCJ3 4HZ9B 1UI8A 1YIT3 1AV4A 3F40A 3CCL3 2MC8A 1O7PB 1NO3A 4L8PA 3ECFA 1TJDA 1U5OA 2H0GA 2RFRA 3CU3A 3JUNA 2MF7A 3CPOA 1RRLA 2QGUA 5DRVA 1BRJA 3UL5A 4EXRA 1RN4A 4HAAA 1ISKA 3X3XA 3LT9A 1K9M4 1OPYA 2XFTA 3CNXA 3CCU3 3MKIA 2XGLA 5EEOA 1QALA 3OX9A 1M9GA 2B1XB 2FNQA 3EN8A 2OQEA 4RNTA 1TTOA 4HM7B 4BIRA 1DMQA 3EQQB 4O3VA 3TDGA 1PYLA 3X40A 3FH1A 1ROAA 1HYFA 4TX4A 2KAAA 1YJN3 3S29A 2HMJB 3ALAA 1C54A 4WWUC 1YGWA 2F5WA 3Q90A 1G0TA 1QVF2 1VQQA 1NU3A 3DUKA 1SIIA 3GZXB 4K61A 3V99A 1MWTA 1TRPA 2WGQA 2IY2A 1TFOA 2PZVA 4BU4A 1GYBA 1B21A 3N54B 3VGNA 3WODG 3G713 1B2SA 3AGOA 3U97A 2P0MA 1AY7A 1IQXA 4RBNA 1K41A 5HGRA 3PYJA 3O8YA 4GSPA 1DVCA 1GSPA 2Z7AA 4LZIA 5KP4A 4OVMA 1RGKA 2W9PA 3DM8A 5EVHA 4XB5A 1BSBA 3FCSB 3T0UA 4GB5A 2CG0A 1BNEA 5AIHA 1OHPA 2XGNA 1FGTA 2P05A 1BRSA 1B27A 1T3BA 2HMNB 4KVHA 1W6GA 4RZMA 1BAOA 3F14A 4RNYA 3G6E3 3KE7A 3OW22 1YJW3 1QVG2 6RNTA 1B2UA 3CCM3 3URPA 2Z6BA 2BHMA 3I0YA 1Q40A 1STDA 3KKGA 2B24B 3B4PA 5IG3A 4N6TA 2D42A 1LVNA 2BU4A 1GMQA 1ZX2A 5FGOA 3FKAA 5AEUB 1BSDA 2ZHXB 3BU4A 3SXXA 1FYSA 5KP1A 1IT7A 4EW5A 1BUJA 1YVBI 3HIIA 1Q814 2CFWA 2XSOB 7STDA 4R9LA 1W02A 1VQ93 1A67A 3JUOA 2CFGA 2SARA 1IT8A 1E3VA 3H3HA 1TU5A 1YIJ3 1OF5A 5KP3A 1QJGA 3NBRA 2FGTA 1UGIA 4X2HA 5HOHA 1ROVA 1O7MB 4EC6A 2CWVA 1U8CB 1GS3A 1GD3A 3MHEA 1LNHA 4LGQA 1OGXA 3EX9A 1DMNA 1B3SA 3OWYA 3CC23 4ZM8A 1JB5A 3FG3A 1HZ1A 2ZL8A 7GSPA 3K0ZA 3MSOA 2YFJB 1SARA 4HZBB 1W00A 1RKYA 1VQO3 2R41A 6STDA 4FMDA 4X2OA 1JZDA 4HKVB 2HMLB 1RGCA 5G1KA 5A0OB 1WTHA 1B2ZA 1LOVA 1BVIA 1YHQ3 3DGYA 3CXC2 1UCIA 4K1UA 2STDA 3PS8A 4XM4A 4EV2A 1GMPA 1FZUA 3CC73 1GOUA 1V58A 5ELJA 5STDA 2AADA 5AIFA 5D83A 2Z76A 1I3FA 1VZZA 4FCJA 4EYCA 1RNTA 2Z77A 2F5MA 3RGAA 2HMKB 1BSEA 2Q07A 4HM6B 4BL2A 5BVBA 5EQLA 3OXAA 5CF2A 5JPPA 2C10A 3FLJA 1Q40B 3A5EA 3D4AA 4KT3B 1KC84 4N6UA 1PFPA 4R9KA 3LTAA 3WDGB 2ML6A 1BGSA 1W7CA 3EJVA 2W56A 2GSPA 1SIHA 1UCLA 3AHWA 3K9MC 1DMMA 3CMA3 1RGFA 1I2GA 1RCLA 1N9EA 3UNLA 3IJEB 1VQK3 1FUSA 1RMSA 1WMNA 5BU4A 1G96A 3F8XA 4WHAA 3ROBA 3DGOA 1GOVA 3K5TA 1DE3A 1VQP3 1UI7A 2CFLA 3VF1A 4HOHA 1A2KA 1OF5B 4XBYA 4LYLB 3CME3 2F86B 2GBXB 2K0MA 5TGNA 1T2HA 2CX1A 3NXJA 1ZS7A 3OWUA 1EG9B 2KF6A 3DGNA 1KD14 1F8NA 5AI1A 4N6LA 2CFDA 1G02A 1LQGC 3PXMA 3SLUA 1VQ43 3H51A 3JUPA 1UDII 2OQEC 1W2B2 3EHCA 2CH9A 3BNDA 1IQ8A 1J2BA 1GOYA 1D6ZA 1LOYA 1TIJA 1RGAA 2UX0A 3B8LA 1OHOA 2FXTA 2ML5A 3D5GA 1BIRA 2CC3A 3HK4A 3V92A 1BUQA 1CEWI 1T5YA 5IF6A 1OCVA 2OCTA 2RBIA 2J8XB 5LC7A 3WR2A 1NJI4 1FW7A 5CLKA 1V74A 4J5KA 5D81A 1K8A4 4EV5A 4MJDA 3NBJA 1W4NA 2D1WA 3LZAA 1OHSA 5AYSC 3LXUX 1OGZA 1JB2A 1I70A 1JZOA 1DETA 4GL6A 1IQYA 3KN4A 3UJMA 5DREA 4NREA 2JQ5A 3SEDA 1VQM3 2SBLA 3KSPA 3K63A 3FZWA 3K7CA 3IMAB 1JRQA 3LTBA 1RN7A 5G2GA 3NQZA 1FUTA 5IG0A 1UUWB 4AKZA 3I553 3N9HA 1JNQA 4HM1B 4J9AA 2V1LA 3AHSA 3FG4A 3X41A 1KSIA 8CHOA 3NM2A 5AYRB 3S27A 1UCJA 1Y4KA 3N8BA 4HM0B 2GEYA 3UB1A 2C4BA 3PGBA 1B2XA 4HM3B 5M19A 1MWUA 2W56B 1UCKA 4XDWA 3GZRA 4O8SA 4BL3A 1YVSA 3HX8A 1RRHA 3S5CA 3MG1A 5IG4A 2IA7A 3JUQA 3GWRA 1BNSA 1I0XA 3DGMA 3RGRA 5JPUA 1BNGA 1K28A 3D9RA 3CPW2 1I8VA 1LOXA 3G0KA 3KIIA 1I2EA 4FCMA 1EUIC 4HJLB 1MOLA 4G1MB 1SJWA 4XDVA 1I3IA 3E99A 1O7HB 1DVDA 3AGNA 1IVVA 2O9UX 5IEPA 1RCKA 2HMOB 1STFI 2XRXB 1N8QA 2F56A 3S28A 3OV4A 2QIYA 4AEQA 1N5PA 2UUGC 2CIUA 3M8CA 3PCSA 2H0IA 4MMZB 1AQZA 5AIGA 4FMBA 1LXEA 1B2MA 1O7NB 3QRDA 4L7KA 1R4CA 2CFKA 1BRGA 1JN5A 2Y74A 3RNTA 1ZGXA 1QMAA 2BNGA 1IU7A 2IUKA 3DMCA 4NHFA 4NPBA 1IVXA 1GD4A 5AIIA 3CCR3 1GMRA 1T2IA 2H0HA 3FSDA 1Q824 3CD63 3SX1A 3AMOA 4EBGA 2I9WA 2W9QA 1Q42A 2F98A 4N6OB 3HIGA 1HU9A 4IT7A 1TRQA 3GAXA 4LSOA 1BOXA 2ZDJA 5JBSA 1OACA 4CDLA 3F7XA 2CX0A 2XFSA 3NBBA 4OK0A 1R4YA 3BLZA 5BIRA 1M1K4 4O02B 1NB5I 2LQVA 5CK6A 1CQSA 2R4IA 2KF3A 1AR0A 4BTXA 1MNLA 3KSED 4BTYA 5AEWB 4XBXA 3LYGA 3G16A 2YX9A 2BO9B 4WP5A 3ZG5A 2RGQA 3B7CA 1D6YA 1YGEA 4I5QA 8RNTA 1YJ93 2UGIA 1LOWA 2IMJA 3LMLA 4DKIA 1X1UA 4ORLA 1TP6A 1YNVX 2YFLB 3EC9A 4FR9A 4LMIA 4R80A 2GBWB 3DGLA 3SOYA 1LNIA 3I563 3CCV3 2P0XA 3EBYA 2RNTA 5I97A 1RDSA 2AAEA 3HOHA 1BNIA 2WOHA 1RGEA 2XR8B 3KFQC 1K734 1E3RA 1ZO2A 3MPHA 2BMRB 4CPKA 2GU3A 2JDIH 1X1WA 1VQ73 4XBTA 4WYKA 2A15A 4MMXB 1JV2B 1BRHA 3RDEA 5IERA 3HI7A 4HBRA 1VQ63 1KWIA 1EKMA 1BRKA 1MWRA 1YI23 2KXGA 2YFIB 3LTCA 3SYUA 4CCVA 4N6V0 9RNTA 1JN5B 1NNVA 3Q1CA 2K3DA 1JBRA 1RTUA 1Q864 1GY6A 4HVNA 4O2HA 1BSAA 5G1LA 3F7SA 1BNFA 1WMPA 4HM8B 1RN1A
chains in the Genus database with same CATH topology
1UCJA 1MGWA 2ZA4A 1RGHA 2C4BA 1IYYA 1B2XA 1RLSA 5HOHA 4GHOA 1UCKA 2KF5A 1YVSA 2HOHA 1B20A 1JBSA 1A2PA 1I0VA 1BRIA 1BNSA 1B3SA 1I0XA 3Q3FA 1CH0A 1BNGA 1I8VA 1HZ1A 2BIRA 7GSPA 1SARA 1I2EA 1BSCA 1LRAA 1RGCA 1I3IA 1BNRA 1MGRA 1B2ZA 1LOVA 1BVIA 3AGNA 2F4YA 3DGYA 1UCIA 1RCKA 1RGLA 6GSPA 1BRNL 2F56A 3URPA 1GMPA 1FZUA 1RGGA 4J5GA 1GOUA 2AADA 1AQZA 1I3FA 1B2MA 1RNTA 1BRGA 3RNTA 1BRJA 1ZGXA 1RN4A 2F5MA 1BSEA 4HAAA 1GMRA 1T2IA 3A5EA 3D4AA 4RNTA 1TTOA 4BIRA 1BGSA 1PYLA 2GSPA 1HYFA 1UCLA 3AHWA 2KAAA 3KCHA 1RGFA 1RCLA 1I2GA 1RSNA 1BNJA 1TRQA 1C54A 1FUSA 1BOXA 1RMSA 1X1YA 1YGWA 2F5WA 5BU4A 1R4YA 5BIRA 1GOVA 3WHOA 1DE3A 1TRPA 1RHLA 1I2FA 2KF3A 3BIRA 4HOHA 4BU4A 1B21A 1B2SA 3AGOA 1T2HA 1AY7A 2KF6A 1PY3A 8RNTA 4GSPA 1X1XA 1LOWA 1GSPA 1JBTA 1G02A 1X1UA 7RNTA 1YNVX 1RGKA 1BSBA 1LNIA 1BNEA 1Q9EA 2RNTA 1RNBA 1RDSA 1GOYA 1LOYA 2AAEA 1BNIA 2KF4A 3HOHA 1BRSA 1B27A 1RGAA 1RGEA 1BAOA 3D5GA 1BIRA 6RNTA 1B2UA 3GSPA 2RBIA 3WR2A 1FW7A 4J5KA 1X1WA 5GSPA 2BU4A 1GMQA 1BRHA 1I70A 1DETA 1BU4A 1BRKA 1BSDA 3BU4A 3SYUA 1FYSA 9RNTA 3D5IA 1BUJA 1FUTA 1JBRA 1RTUA 1BSAA 3DH2A 5RNTA 3AHSA 1BANA 1BNFA 1RN1A 2SARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCJ A;  1MGW A;  2ZA4 A;  1RGH A;  2C4B A;  1IYY A;  1B2X A;  1RLS A;  5HOH A;  4GHO A;  1UCK A;  2KF5 A;  1YVS A;  2HOH A;  1B20 A;  1JBS A;  1A2P A;  1I0V A;  1BRI A;  1BNS A;  1B3S A;  1I0X A;  3Q3F A;  1CH0 A;  1BNG A;  1I8V A;  1HZ1 A;  2BIR A;  7GSP A;  1SAR A;  1I2E A;  1BSC A;  1LRA A;  1RGC A;  1I3I A;  1BNR A;  1MGR A;  1B2Z A;  1LOV A;  1BVI A;  3AGN A;  2F4Y A;  3DGY A;  1UCI A;  1RCK A;  1RGL A;  6GSP A;  1BRN L;  2F56 A;  3URP A;  1GMP A;  1FZU A;  1RGG A;  4J5G A;  1GOU A;  2AAD A;  1AQZ A;  1I3F A;  1B2M A;  1RNT A;  1BRG A;  3RNT A;  1BRJ A;  1ZGX A;  1RN4 A;  2F5M A;  1BSE A;  4HAA A;  1GMR A;  1T2I A;  3A5E A;  3D4A A;  4RNT A;  1TTO A;  4BIR A;  1BGS A;  1PYL A;  2GSP A;  1HYF A;  1UCL A;  3AHW A;  2KAA A;  3KCH A;  1RGF A;  1RCL A;  1I2G A;  1RSN A;  1BNJ A;  1TRQ A;  1C54 A;  1FUS A;  1BOX A;  1RMS A;  1X1Y A;  1YGW A;  2F5W A;  5BU4 A;  1R4Y A;  5BIR A;  1GOV A;  3WHO A;  1DE3 A;  1TRP A;  1RHL A;  1I2F A;  2KF3 A;  3BIR A;  4HOH A;  4BU4 A;  1B21 A;  1B2S A;  3AGO A;  1T2H A;  1AY7 A;  2KF6 A;  1PY3 A;  8RNT A;  4GSP A;  1X1X A;  1LOW A;  1GSP A;  1JBT A;  1G02 A;  1X1U A;  7RNT A;  1YNV X;  1RGK A;  1BSB A;  1LNI A;  1BNE A;  1Q9E A;  2RNT A;  1RNB A;  1RDS A;  1GOY A;  1LOY A;  2AAE A;  1BNI A;  2KF4 A;  3HOH A;  1BRS A;  1B27 A;  1RGA A;  1RGE A;  1BAO A;  3D5G A;  1BIR A;  6RNT A;  1B2U A;  3GSP A;  2RBI A;  3WR2 A;  1FW7 A;  4J5K A;  1X1W A;  5GSP A;  2BU4 A;  1GMQ A;  1BRH A;  1I70 A;  1DET A;  1BU4 A;  1BRK A;  1BSD A;  3BU4 A;  3SYU A;  1FYS A;  9RNT A;  3D5I A;  1BUJ A;  1FUT A;  1JBR A;  1RTU A;  1BSA A;  3DH2 A;  5RNT A;  3AHS A;  1BAN A;  1BNF A;  1RN1 A;  2SAR A; 
#chains in the Genus database with same CATH topology
 3AMO B;  3WA2 X;  1MGW A;  4ILF A;  4L8O A;  1RGH A;  3DY5 A;  1RLS A;  1N8R 4;  2KCD A;  1FGO A;  3NX0 A;  4GHO A;  4KZ1 A;  2KF5 A;  2XH9 A;  4FMC A;  4OUQ A;  1NDO B;  3IPT A;  3F8H A;  5BXQ A;  1FA3 A;  1A2P A;  3BNE A;  3VSY A;  1W6C A;  1VQ8 3;  3LT8 A;  4LEH A;  2XSH B;  1VQN 3;  3EF8 A;  1CH0 A;  1W2Z A;  5CF1 A;  2BIR A;  2CW9 A;  1SPU A;  3EBT A;  3U1W A;  4JRF A;  3MG3 A;  4JF8 A;  2HMM B;  2WO0 A;  1IV9 A;  3MWZ A;  3PZW A;  5IEO A;  2OTJ 3;  1BSC A;  1HKX A;  1LRA A;  1JJ2 2;  5IG5 A;  3ZG0 A;  1VQL 3;  1BNR A;  1L5G B;  3FF0 A;  2WOF A;  4QWT A;  1OUN A;  1QAK A;  2F4Y A;  2W0Q A;  4Q53 A;  3LOY A;  2W2C A;  1RGL A;  6GSP A;  3GZB A;  1IV7 A;  2OTL 3;  2XEP A;  1BRN L;  1DYU A;  1IVU A;  2OWP A;  1UUV B;  1QAF A;  1EEJ A;  1RGG A;  4J5G A;  3BB9 A;  2IYJ A;  1RJO A;  3OWS A;  3MYT A;  5FW5 A;  3WOF B;  3BNC A;  3B4O A;  1W5Z A;  4K90 B;  3SOA A;  3DXO A;  2INX A;  2W6J H;  3JUM A;  3G8Z A;  2O3O A;  4N3V A;  2RCD A;  1D6U A;  4FCZ A;  3ZFZ A;  1PU4 A;  2CKF B;  1WNH A;  3FG1 A;  1VQ5 3;  4MMY B;  3DZL A;  4HM2 B;  5M1A A;  3FF2 A;  4WYK B;  4BTW A;  5D82 A;  1Q7Y 4;  1FGM A;  1NWW A;  3A76 A;  3NV0 A;  2W04 A;  4HYZ A;  4N6M A;  1AVL A;  1JKG A;  2P09 A;  3KCH A;  4N6N B;  3D3L A;  3GZY B;  1O7G B;  1RSN A;  4KFD A;  5LC6 A;  1BNJ A;  1X1Y A;  1UGH I;  3CCQ 3;  5M18 A;  1KQS 2;  4U13 A;  1FUW A;  4KFE A;  3J7Y d;  1TFK A;  2CWT A;  3NM7 A;  1ULJ B;  4PEJ A;  2IUJ A;  3WHO A;  3KZT A;  2XF3 A;  1JB4 A;  1RHL A;  5ELU A;  1IDP A;  3T8N A;  1I2F A;  1SQW A;  3BIR A;  3Q2P A;  2KRT A;  1A90 A;  3LTD A;  1UW1 A;  4HM5 B;  1FGQ A;  1S5A A;  1O7W B;  3D79 A;  3QK9 A;  1PY3 A;  2E2U A;  1X1X A;  5IW9 A;  1JBT A;  2PNC A;  4CJN A;  2CG1 A;  7RNT A;  3CC4 3;  1M1X B;  1GY5 A;  4IIA A;  3UL6 A;  3CNM A;  2RSX A;  2BMQ B;  1NB3 I;  1Q9E A;  3STD A;  1RNB A;  2KF4 A;  3WA3 A;  1WQL B;  4R4K A;  1MWS A;  2WGO A;  2CK3 H;  2LYX A;  2CWU A;  3GSP A;  4RNZ A;  2K54 A;  3EN1 B;  3FGY A;  3WMD A;  4WFO A;  3L0R A;  3CCS 3;  1IK3 A;  4J8T A;  5GSP A;  1AVK A;  4KFF A;  1E97 A;  3G4S 3;  1S72 3;  2CHC A;  3LH4 A;  4IPB A;  1IVW A;  1BU4 A;  4K1V A;  3NQY A;  1C7H A;  3F9S A;  3JVC A;  3T8U A;  1LQM B;  3D5I A;  4STD A;  1Z1S A;  2GU1 A;  1US1 A;  4H3U A;  3NHX A;  1ASK A;  3EE1 A;  1W6Y A;  3DH2 A;  4MEI A;  3X42 A;  1UUG B;  1BAN A;  1W01 A;  2GEX A;  2GXF A;  5RNT A;  3GRD A;  1Q7H A;  3PCR A;  2P38 A;  1V57 A;  2BMO B;  2ZA4 A;  2Y73 A;  4AKY A;  1IYY A;  3NV0 B;  3CCE 3;  4H61 A;  1JKG B;  1TUH A;  2OOV A;  2OOV C;  1A2V A;  2HOH A;  1B20 A;  3BNB A;  2QEX 3;  1JBS A;  1ULI B;  2L4V A;  4R1K A;  1EQK A;  1I0V A;  2BT3 A;  1EA2 A;  1BRI A;  3NUV A;  3Q3F A;  2M7O A;  2QA4 3;  3S67 A;  2L1S A;  1N5H A;  5CXO A;  1CYV A;  3EB8 A;  3HZP A;  4HM4 B;  3X3Y A;  5IEN A;  2E2V A;  3WOE B;  3V98 A;  3SVA A;  1M90 4;  1CYU A;  1N9J A;  1GY7 A;  1OH0 A;  3MG2 A;  2F99 A;  4I4K A;  3X3Z A;  2E2T A;  2W03 A;  1MGR A;  1WMO A;  1FGR A;  2C11 A;  3ER7 A;  4FMA A;  3CCJ 3;  4HZ9 B;  1UI8 A;  1YIT 3;  1AV4 A;  3F40 A;  3CCL 3;  2MC8 A;  1O7P B;  1NO3 A;  4L8P A;  3ECF A;  1TJD A;  1U5O A;  2H0G A;  2RFR A;  3CU3 A;  3JUN A;  2MF7 A;  3CPO A;  1RRL A;  2QGU A;  5DRV A;  1BRJ A;  3UL5 A;  4EXR A;  1RN4 A;  4HAA A;  1ISK A;  3X3X A;  3LT9 A;  1K9M 4;  1OPY A;  2XFT A;  3CNX A;  3CCU 3;  3MKI A;  2XGL A;  5EEO A;  1QAL A;  3OX9 A;  1M9G A;  2B1X B;  2FNQ A;  3EN8 A;  2OQE A;  4RNT A;  1TTO A;  4HM7 B;  4BIR A;  1DMQ A;  3EQQ B;  4O3V A;  3TDG A;  1PYL A;  3X40 A;  3FH1 A;  1ROA A;  1HYF A;  4TX4 A;  2KAA A;  1YJN 3;  3S29 A;  2HMJ B;  3ALA A;  1C54 A;  4WWU C;  1YGW A;  2F5W A;  3Q90 A;  1G0T A;  1QVF 2;  1VQQ A;  1NU3 A;  3DUK A;  1SII A;  3GZX B;  4K61 A;  3V99 A;  1MWT A;  1TRP A;  2WGQ A;  2IY2 A;  1TFO A;  2PZV A;  4BU4 A;  1GYB A;  1B21 A;  3N54 B;  3VGN A;  3WOD G;  3G71 3;  1B2S A;  3AGO A;  3U97 A;  2P0M A;  1AY7 A;  1IQX A;  4RBN A;  1K41 A;  5HGR A;  3PYJ A;  3O8Y A;  4GSP A;  1DVC A;  1GSP A;  2Z7A A;  4LZI A;  5KP4 A;  4OVM A;  1RGK A;  2W9P A;  3DM8 A;  5EVH A;  4XB5 A;  1BSB A;  3FCS B;  3T0U A;  4GB5 A;  2CG0 A;  1BNE A;  5AIH A;  1OHP A;  2XGN A;  1FGT A;  2P05 A;  1BRS A;  1B27 A;  1T3B A;  2HMN B;  4KVH A;  1W6G A;  4RZM A;  1BAO A;  3F14 A;  4RNY A;  3G6E 3;  3KE7 A;  3OW2 2;  1YJW 3;  1QVG 2;  6RNT A;  1B2U A;  3CCM 3;  3URP A;  2Z6B A;  2BHM A;  3I0Y A;  1Q40 A;  1STD A;  3KKG A;  2B24 B;  3B4P A;  5IG3 A;  4N6T A;  2D42 A;  1LVN A;  2BU4 A;  1GMQ A;  1ZX2 A;  5FGO A;  3FKA A;  5AEU B;  1BSD A;  2ZHX B;  3BU4 A;  3SXX A;  1FYS A;  5KP1 A;  1IT7 A;  4EW5 A;  1BUJ A;  1YVB I;  3HII A;  1Q81 4;  2CFW A;  2XSO B;  7STD A;  4R9L A;  1W02 A;  1VQ9 3;  1A67 A;  3JUO A;  2CFG A;  2SAR A;  1IT8 A;  1E3V A;  3H3H A;  1TU5 A;  1YIJ 3;  1OF5 A;  5KP3 A;  1QJG A;  3NBR A;  2FGT A;  1UGI A;  4X2H A;  5HOH A;  1ROV A;  1O7M B;  4EC6 A;  2CWV A;  1U8C B;  1GS3 A;  1GD3 A;  3MHE A;  1LNH A;  4LGQ A;  1OGX A;  3EX9 A;  1DMN A;  1B3S A;  3OWY A;  3CC2 3;  4ZM8 A;  1JB5 A;  3FG3 A;  1HZ1 A;  2ZL8 A;  7GSP A;  3K0Z A;  3MSO A;  2YFJ B;  1SAR A;  4HZB B;  1W00 A;  1RKY A;  1VQO 3;  2R41 A;  6STD A;  4FMD A;  4X2O A;  1JZD A;  4HKV B;  2HML B;  1RGC A;  5G1K A;  5A0O B;  1WTH A;  1B2Z A;  1LOV A;  1BVI A;  1YHQ 3;  3DGY A;  3CXC 2;  1UCI A;  4K1U A;  2STD A;  3PS8 A;  4XM4 A;  4EV2 A;  1GMP A;  1FZU A;  3CC7 3;  1GOU A;  1V58 A;  5ELJ A;  5STD A;  2AAD A;  5AIF A;  5D83 A;  2Z76 A;  1I3F A;  1VZZ A;  4FCJ A;  4EYC A;  1RNT A;  2Z77 A;  2F5M A;  3RGA A;  2HMK B;  1BSE A;  2Q07 A;  4HM6 B;  4BL2 A;  5BVB A;  5EQL A;  3OXA A;  5CF2 A;  5JPP A;  2C10 A;  3FLJ A;  1Q40 B;  3A5E A;  3D4A A;  4KT3 B;  1KC8 4;  4N6U A;  1PFP A;  4R9K A;  3LTA A;  3WDG B;  2ML6 A;  1BGS A;  1W7C A;  3EJV A;  2W56 A;  2GSP A;  1SIH A;  1UCL A;  3AHW A;  3K9M C;  1DMM A;  3CMA 3;  1RGF A;  1I2G A;  1RCL A;  1N9E A;  3UNL A;  3IJE B;  1VQK 3;  1FUS A;  1RMS A;  1WMN A;  5BU4 A;  1G96 A;  3F8X A;  4WHA A;  3ROB A;  3DGO A;  1GOV A;  3K5T A;  1DE3 A;  1VQP 3;  1UI7 A;  2CFL A;  3VF1 A;  4HOH A;  1A2K A;  1OF5 B;  4XBY A;  4LYL B;  3CME 3;  2F86 B;  2GBX B;  2K0M A;  5TGN A;  1T2H A;  2CX1 A;  3NXJ A;  1ZS7 A;  3OWU A;  1EG9 B;  2KF6 A;  3DGN A;  1KD1 4;  1F8N A;  5AI1 A;  4N6L A;  2CFD A;  1G02 A;  1LQG C;  3PXM A;  3SLU A;  1VQ4 3;  3H51 A;  3JUP A;  1UDI I;  2OQE C;  1W2B 2;  3EHC A;  2CH9 A;  3BND A;  1IQ8 A;  1J2B A;  1GOY A;  1D6Z A;  1LOY A;  1TIJ A;  1RGA A;  2UX0 A;  3B8L A;  1OHO A;  2FXT A;  2ML5 A;  3D5G A;  1BIR A;  2CC3 A;  3HK4 A;  3V92 A;  1BUQ A;  1CEW I;  1T5Y A;  5IF6 A;  1OCV A;  2OCT A;  2RBI A;  2J8X B;  5LC7 A;  3WR2 A;  1NJI 4;  1FW7 A;  5CLK A;  1V74 A;  4J5K A;  5D81 A;  1K8A 4;  4EV5 A;  4MJD A;  3NBJ A;  1W4N A;  2D1W A;  3LZA A;  1OHS A;  5AYS C;  3LXU X;  1OGZ A;  1JB2 A;  1I70 A;  1JZO A;  1DET A;  4GL6 A;  1IQY A;  3KN4 A;  3UJM A;  5DRE A;  4NRE A;  2JQ5 A;  3SED A;  1VQM 3;  2SBL A;  3KSP A;  3K63 A;  3FZW A;  3K7C A;  3IMA B;  1JRQ A;  3LTB A;  1RN7 A;  5G2G A;  3NQZ A;  1FUT A;  5IG0 A;  1UUW B;  4AKZ A;  3I55 3;  3N9H A;  1JNQ A;  4HM1 B;  4J9A A;  2V1L A;  3AHS A;  3FG4 A;  3X41 A;  1KSI A;  8CHO A;  3NM2 A;  5AYR B;  3S27 A;  1UCJ A;  1Y4K A;  3N8B A;  4HM0 B;  2GEY A;  3UB1 A;  2C4B A;  3PGB A;  1B2X A;  4HM3 B;  5M19 A;  1MWU A;  2W56 B;  1UCK A;  4XDW A;  3GZR A;  4O8S A;  4BL3 A;  1YVS A;  3HX8 A;  1RRH A;  3S5C A;  3MG1 A;  5IG4 A;  2IA7 A;  3JUQ A;  3GWR A;  1BNS A;  1I0X A;  3DGM A;  3RGR A;  5JPU A;  1BNG A;  1K28 A;  3D9R A;  3CPW 2;  1I8V A;  1LOX A;  3G0K A;  3KII A;  1I2E A;  4FCM A;  1EUI C;  4HJL B;  1MOL A;  4G1M B;  1SJW A;  4XDV A;  1I3I A;  3E99 A;  1O7H B;  1DVD A;  3AGN A;  1IVV A;  2O9U X;  5IEP A;  1RCK A;  2HMO B;  1STF I;  2XRX B;  1N8Q A;  2F56 A;  3S28 A;  3OV4 A;  2QIY A;  4AEQ A;  1N5P A;  2UUG C;  2CIU A;  3M8C A;  3PCS A;  2H0I A;  4MMZ B;  1AQZ A;  5AIG A;  4FMB A;  1LXE A;  1B2M A;  1O7N B;  3QRD A;  4L7K A;  1R4C A;  2CFK A;  1BRG A;  1JN5 A;  2Y74 A;  3RNT A;  1ZGX A;  1QMA A;  2BNG A;  1IU7 A;  2IUK A;  3DMC A;  4NHF A;  4NPB A;  1IVX A;  1GD4 A;  5AII A;  3CCR 3;  1GMR A;  1T2I A;  2H0H A;  3FSD A;  1Q82 4;  3CD6 3;  3SX1 A;  3AMO A;  4EBG A;  2I9W A;  2W9Q A;  1Q42 A;  2F98 A;  4N6O B;  3HIG A;  1HU9 A;  4IT7 A;  1TRQ A;  3GAX A;  4LSO A;  1BOX A;  2ZDJ A;  5JBS A;  1OAC A;  4CDL A;  3F7X A;  2CX0 A;  2XFS A;  3NBB A;  4OK0 A;  1R4Y A;  3BLZ A;  5BIR A;  1M1K 4;  4O02 B;  1NB5 I;  2LQV A;  5CK6 A;  1CQS A;  2R4I A;  2KF3 A;  1AR0 A;  4BTX A;  1MNL A;  3KSE D;  4BTY A;  5AEW B;  4XBX A;  3LYG A;  3G16 A;  2YX9 A;  2BO9 B;  4WP5 A;  3ZG5 A;  2RGQ A;  3B7C A;  1D6Y A;  1YGE A;  4I5Q A;  8RNT A;  1YJ9 3;  2UGI A;  1LOW A;  2IMJ A;  3LML A;  4DKI A;  1X1U A;  4ORL A;  1TP6 A;  1YNV X;  2YFL B;  3EC9 A;  4FR9 A;  4LMI A;  4R80 A;  2GBW B;  3DGL A;  3SOY A;  1LNI A;  3I56 3;  3CCV 3;  2P0X A;  3EBY A;  2RNT A;  5I97 A;  1RDS A;  2AAE A;  3HOH A;  1BNI A;  2WOH A;  1RGE A;  2XR8 B;  3KFQ C;  1K73 4;  1E3R A;  1ZO2 A;  3MPH A;  2BMR B;  4CPK A;  2GU3 A;  2JDI H;  1X1W A;  1VQ7 3;  4XBT A;  4WYK A;  2A15 A;  4MMX B;  1JV2 B;  1BRH A;  3RDE A;  5IER A;  3HI7 A;  4HBR A;  1VQ6 3;  1KWI A;  1EKM A;  1BRK A;  1MWR A;  1YI2 3;  2KXG A;  2YFI B;  3LTC A;  3SYU A;  4CCV A;  4N6V 0;  9RNT A;  1JN5 B;  1NNV A;  3Q1C A;  2K3D A;  1JBR A;  1RTU A;  1Q86 4;  1GY6 A;  4HVN A;  4O2H A;  1BSA A;  5G1L A;  3F7S A;  1BNF A;  1WMP A;  4HM8 B;  1RN1 A; 
#chains in the Genus database with same CATH homology
 1UCJ A;  1MGW A;  2ZA4 A;  1RGH A;  2C4B A;  1IYY A;  1B2X A;  1RLS A;  5HOH A;  4GHO A;  1UCK A;  2KF5 A;  1YVS A;  2HOH A;  1B20 A;  1JBS A;  1A2P A;  1I0V A;  1BRI A;  1BNS A;  1B3S A;  1I0X A;  3Q3F A;  1CH0 A;  1BNG A;  1I8V A;  1HZ1 A;  2BIR A;  7GSP A;  1SAR A;  1I2E A;  1BSC A;  1LRA A;  1RGC A;  1I3I A;  1BNR A;  1MGR A;  1B2Z A;  1LOV A;  1BVI A;  3AGN A;  2F4Y A;  3DGY A;  1UCI A;  1RCK A;  1RGL A;  6GSP A;  1BRN L;  2F56 A;  3URP A;  1GMP A;  1FZU A;  1RGG A;  4J5G A;  1GOU A;  2AAD A;  1AQZ A;  1I3F A;  1B2M A;  1RNT A;  1BRG A;  3RNT A;  1BRJ A;  1ZGX A;  1RN4 A;  2F5M A;  1BSE A;  4HAA A;  1GMR A;  1T2I A;  3A5E A;  3D4A A;  4RNT A;  1TTO A;  4BIR A;  1BGS A;  1PYL A;  2GSP A;  1HYF A;  1UCL A;  3AHW A;  2KAA A;  3KCH A;  1RGF A;  1RCL A;  1I2G A;  1RSN A;  1BNJ A;  1TRQ A;  1C54 A;  1FUS A;  1BOX A;  1RMS A;  1X1Y A;  1YGW A;  2F5W A;  5BU4 A;  1R4Y A;  5BIR A;  1GOV A;  3WHO A;  1DE3 A;  1TRP A;  1RHL A;  1I2F A;  2KF3 A;  3BIR A;  4HOH A;  4BU4 A;  1B21 A;  1B2S A;  3AGO A;  1T2H A;  1AY7 A;  2KF6 A;  1PY3 A;  8RNT A;  4GSP A;  1X1X A;  1LOW A;  1GSP A;  1JBT A;  1G02 A;  1X1U A;  7RNT A;  1YNV X;  1RGK A;  1BSB A;  1LNI A;  1BNE A;  1Q9E A;  2RNT A;  1RNB A;  1RDS A;  1GOY A;  1LOY A;  2AAE A;  1BNI A;  2KF4 A;  3HOH A;  1BRS A;  1B27 A;  1RGA A;  1RGE A;  1BAO A;  3D5G A;  1BIR A;  6RNT A;  1B2U A;  3GSP A;  2RBI A;  3WR2 A;  1FW7 A;  4J5K A;  1X1W A;  5GSP A;  2BU4 A;  1GMQ A;  1BRH A;  1I70 A;  1DET A;  1BU4 A;  1BRK A;  1BSD A;  3BU4 A;  3SYU A;  1FYS A;  9RNT A;  3D5I A;  1BUJ A;  1FUT A;  1JBR A;  1RTU A;  1BSA A;  3DH2 A;  5RNT A;  3AHS A;  1BAN A;  1BNF A;  1RN1 A;  2SAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...