1B2ZA

Deletion of a buried salt bridge in barnase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSNWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2zA00
2F56A 1DETA 1I2FA 1RHLA 1HYFA 2BU4A 5BU4A 1BSDA 1B3SA 1BRIA 1BRJA 4HOHA 1AQZA 1RNTA 1BNGA 1MGRA 1FUTA 1GSPA 1X1XA 2HOHA 3AGOA 1DE3A 4RNTA 1RGGA 2AADA 1RGLA 1PY3A 1BRGA 1BUJA 1YGWA 3DH2A 1ZGXA 1I8VA 2KAAA 1BAOA 1HZ1A 1UCIA 1LNIA 1RMSA 1LOVA 1X1YA 1GMQA 1UCLA 1BVIA 2RBIA 3RNTA 1FW7A 2KF3A 3GSPA 3URPA 1BSCA 1B2MA 4J5GA 3WHOA 1BNEA 9RNTA 1RCLA 1C54A 1BGSA 1GOYA 1RTUA 1TTOA 2AAEA 5BIRA 1I0XA 1UCKA 1AY7A 1BRHA 1BNSA 3A5EA 1GMPA 1BNJA 2SARA 2BIRA 1YVSA 1CH0A 3D4AA 1JBSA 3AHWA 1I3IA 1FZUA 1BNRA 1FUSA 1RGEA 1RGHA 1RCKA 1LRAA 2KF5A 1GOUA 4BU4A 1BOXA 1I2GA 1BANA 1MGWA 1RDSA 1JBTA 4J5KA 2KF4A 2GSPA 1RN4A 4GSPA 2RNTA 7GSPA 1R4YA 1B27A 6RNTA 1RGCA 1I3FA 7RNTA 1RGFA 6GSPA 5HOHA 3WR2A 8RNTA 1BSBA 1GMRA 5RNTA 1SARA 1IYYA 1I70A 2F5MA 1TRPA 3Q3FA 1B2XA 1B21A 1BRNL 3AGNA 3BU4A 3KCHA 1Q9EA 1BRSA 3HOHA 1BRKA 1RGKA 4GHOA 1GOVA 3D5GA 1RLSA 1TRQA 1T2HA 1BSAA 1B20A 2KF6A 1UCJA 1LOWA 1RSNA 1BSEA 1B2SA 1BNFA 1G02A 1RGAA 2F4YA 1B2UA 1JBRA 1I2EA 1I0VA 3DGYA 1PYLA 1BNIA 2ZA4A 4HAAA 2F5WA 1X1WA 1BU4A 1FYSA 1RN1A 2C4BA 3D5IA 1X1UA 5GSPA 3BIRA 1LOYA 3SYUA 4BIRA 1T2IA 1BIRA 1YNVX 1A2PA 1RNBA 3AHSA 1B2ZA
chains in the Genus database with same CATH superfamily
3IPTA 3UL6A 2B24B 1D6YA 3NQYA 3OWSA 1IK3A 3CCE3 2INXA 3UB1A 5IG3A 4HBRA 4R4KA 1BRIA 3SEDA 3BNBA 2RGQA 3NHXA 4L7KA 1FUTA 2HOHA 2W6JH 4RNTA 2OTJ3 1GY5A 2V1LA 3DXOA 1NO3A 4O3VA 3DH2A 1ZGXA 2QIYA 3GRDA 2KAAA 3FKAA 3DZLA 1YJW3 3X40A 1RMSA 1LOVA 2CG0A 3CCU3 5JBSA 3Q1CA 3AMOB 3T8NA 3CCV3 3F8XA 2KXGA 2W2CA 1IDPA 4WFOA 2E2TA 3RDEA 3SVAA 2CWTA 2IMJA 2ML6A 3PS8A 1FUWA 1BNEA 1GY6A 1GOYA 2AAEA 1E3VA 2WOHA 4PEJA 4FCZA 1O7PB 1UCKA 3B8LA 2OQEC 1A2VA 1AY7A 2CX1A 3BLZA 2P38A 1BNSA 3WA2X 5IERA 5FW5A 3KE7A 3LH4A 3J7Yd 1GMPA 4BL3A 3DMCA 3FH1A 3D4AA 1QAKA 2FXTA 4HVNA 3CC43 1AV4A 1RGEA 2R4IA 1R4CA 3NXJA 3SOAA 2CW9A 2K3DA 3NBBA 3KN4A 4FCMA 4H61A 2FNQA 1GOUA 2KF5A 4HZBB 3I553 1BOXA 4BTYA 1BUQA 1N5HA 1BANA 2CFGA 2L4VA 2SBLA 5EEOA 3K9MC 3CPOA 3OWYA 2KF4A 1Q814 2ML5A 2Q07A 1A67A 1KC84 6RNTA 4EC6A 4K90B 1STDA 3VGNA 1TIJA 5AEWB 1UUWB 2CH9A 3RGRA 4HM7B 1OF5A 3KSPA 3WR2A 5EQLA 1BSBA 4LMIA 1GMRA 2XSHB 4FMCA 1I70A 1IV9A 2F5MA 3PZWA 1ZS7A 2E2UA 4HJLB 1O7MB 1G96A 3CCR3 1M904 3NV0B 1VQL3 4KFFA 4O8SA 1GYBA 3GZXB 1V58A 1BRSA 2K0MA 4MEIA 1BRKA 4GHOA 1OHOA 3B7CA 3JVCA 3OX9A 1O7HB 1OHSA 3X3XA 3I563 1O7WB 3CXC2 2D1WA 3B4OA 3HI7A 3FG3A 4BTWA 1B20A 2Z6BA 3SOYA 4CDLA 5CF1A 1BSEA 1B2SA 1BNFA 1JRQA 1RGAA 1B2UA 1JBRA 1I2EA 3DGYA 2LQVA 3WMDA 2GBWB 4HYZA 1N9JA 1OGZA 4K1VA 1JKGA 2ZA4A 3U1WA 1NDOB 3EJVA 1RN1A 3EBYA 3MWZA 4IPBA 2BMQB 2P0XA 3STDA 3BNEA 4HM6B 5GSPA 1VQK3 5CK6A 4L8OA 2K54A 2ZL8A 4R80A 1OF5B 1RJOA 3G713 1F8NA 1Q7HA 2GXFA 3ER7A 3U97A 1AVKA 1MOLA 3AHSA 1CYUA 1EUIC 3MPHA 2LYXA 1B2ZA 1UUGB 2RCDA 2CWUA 2F56A 1W2ZA 4XBYA 6STDA 1VQ63 3OW22 3G0KA 2GU1A 5AIGA 3JUQA 3LT9A 2CC3A 2E2VA 4OVMA 1L5GB 5M1AA 3DGMA 3BB9A 3PYJA 3V92A 5BU4A 2D42A 1PU4A 2XGLA 3MG2A 1B3SA 1IVWA 1BRJA 2GU3A 3MG1A 4QWTA 4DKIA 3G4S3 5AEUB 2Y74A 2XFTA 4XBXA 1RGGA 3LMLA 2QA43 1O7GB 1PY3A 1EKMA 3LT8A 3WOFB 4R9LA 3MSOA 4HKVB 1I8VA 1JZOA 3LOYA 5G1LA 1BAOA 1U5OA 2W9PA 4ORLA 2IUJA 2CX0A 3DUKA 3S28A 3QK9A 5D82A 3SXXA 3JUPA 3RGAA 2H0GA 3EX9A 4FCJA 1UGIA 1BSCA 2OCTA 3LYGA 1MWRA 1QALA 3URPA 2BO9B 1Q864 5AIIA 2YFLB 3WHOA 1C54A 8CHOA 3VF1A 1BGSA 1RTUA 4N6NB 2UGIA 1ULJB 1JN5A 2CIUA 3SX1A 3F14A 4EW5A 1JJ22 3CCM3 4ILFA 3HZPA 4HZ9B 5JPUA 3NBJA 2PZVA 3H3HA 4HM5B 4O02B 1M1K4 1KQS2 1LNHA 3EHCA 3LTDA 1VQP3 1AR0A 4KFDA 3UL5A 1QMAA 3GZYB 2P09A 5G1KA 2BMRB 1ZX2A 5A0OB 5M18A 1I3IA 5IEOA 5ELUA 1MWTA 4NPBA 4OUQA 3LTCA 3EQQB 3UNLA 3G16A 1MGWA 1RDSA 4GB5A 3FF0A 4HM8B 1JNQA 1DVCA 1OACA 2GSPA 1RN4A 2HMLB 3FLJA 4U13A 7GSPA 1R4YA 2UUGC 1V74A 1US1A 4FMDA 1SIIA 3CNXA 1LVNA 7RNTA 1RGFA 6GSPA 3Q2PA 3CCS3 1Q7Y4 3N54B 3DGOA 4H3UA 4AEQA 1K8A4 2F99A 3PCSA 4K61A 5ELJA 1VQO3 4RBNA 1QAFA 1B2XA 4N6UA 3LZAA 1NJI4 3MG3A 3HIGA 1IT8A 3KCHA 1Q9EA 1UDII 3MHEA 1FGQA 3PCRA 1ROAA 5BXQA 2WOFA 1GOVA 1TRQA 4XDVA 4CCVA 5G2GA 5BVBA 2KF6A 1UCJA 1RSNA 2BHMA 1G02A 2FGTA 1OH0A 3GZRA 3IMAB 5IENA 5IF6A 4XB5A 1IU7A 1TFOA 2IA7A 3KIIA 3NM7A 1ROVA 4MMZB 3CCQ3 3FSDA 1ISKA 2P05A 3EE1A 1BU4A 1OHPA 1FYSA 3FCSB 1FA3A 1X1UA 5D81A 1V57A 1VQ53 3FGYA 1Q40A 4FMBA 3SYUA 4BIRA 3QRDA 1C7HA 1YNVX 4LGQA 1FGRA 5D83A 2C10A 2HMMB 1VQ83 2BMOB 1ASKA 1VQM3 1YJ93 1A2PA 2CK3H 2IY2A 3LTBA 1T3BA 1YVBI 5CXOA 1QJGA 2R41A 4N6MA 1DETA 1IQ8A 1RHLA 2HMNB 1JV2B 1HYFA 1BSDA 5AIFA 5AYRB 4CJNA 1NWWA 3D79A 1VZZA 1UUVB 4HOHA 5IG5A 1YJN3 3JUNA 3L0RA 1RNTA 1BNGA 1MGRA 2BNGA 1X1XA 3BNCA 3CNMA 1DE3A 1DMMA 2F86B 1U8CB 1VQN3 2GBXB 2W9QA 3D3LA 1YGWA 5JPPA 1FGOA 4RNYA 3DGNA 4X2HA 4HM3B 1UCIA 1QVG2 3CC73 2QGUA 1X1YA 3GZBA 1GMQA 5STDA 4GL6A 1BVIA 2RBIA 3RNTA 4LEHA 4LYLB 3GSPA 3V98A 1FW7A 3HK4A 2H0HA 3NM2A 4I4KA 1W6CA 4J5GA 4N6TA 2OOVA 1Q40B 3S5CA 2C11A 1ZO2A 2M7OA 4AKZA 4BTXA 1K9M4 2ZDJA 2OWPA 5LC7A 3CPW2 1J2BA 2CFDA 1I0XA 5I97A 1STFI 2W03A 1KSIA 1GY7A 4IT7A 1CYVA 3TDGA 4EV5A 1DVDA 1IT7A 2IUKA 3OXAA 4JRFA 4J9AA 2H0IA 1CQSA 1NNVA 2I9WA 3A5EA 3K63A 1BNJA 2SARA 4WP5A 5DRVA 2CG1A 1CH0A 1MWUA 3FG1A 3LTAA 1JBSA 3AHWA 4FMAA 1FZUA 1BNRA 4NREA 1K734 1JZDA 4JF8A 1JKGB 1W6GA 1PFPA 1YIT3 1Q42A 2Y73A 1YHQ3 2OTL3 3CMA3 1W5ZA 2IYJA 1TU5A 2CFWA 3KFQC 4O2HA 2MC8A 3X42A 1KD14 4GSPA 1K28A 4OK0A 4R9KA 7STDA 1RGCA 2GEXA 1DMNA 1I3FA 1WMOA 1D6ZA 4MMXB 3AMOA 8RNTA 1Y4KA 3DGLA 2ZHXB 3LXUX 3O8YA 3VSYA 1IYYA 1SARA 5KP1A 1LQMB 3K5TA 4WHAA 1TJDA 1UGHI 2YFJB 1TRPA 1W02A 4XDWA 3EB8A 4Q53A 3UJMA 1YI23 3EBTA 1IQXA 2BT3A 3HX8A 1AVLA 3JUOA 3G8ZA 3AGNA 3BU4A 1BRNL 1A90A 3PXMA 3ROBA 5IW9A 4L8PA 3GWRA 3NQZA 4EYCA 1RGKA 1EG9B 1IVVA 3B4PA 3D5GA 1RLSA 3FG4A 1OCVA 2JDIH 2OQEA 1M9GA 1BSAA 3X3ZA 3OWUA 2UX0A 4R1KA 1CEWI 3N9HA 3FZWA 1MWSA 4TX4A 3WA3A 4X2OA 3CCJ3 1PYLA 1BNIA 4N6V0 2Z76A 1X1WA 1IV7A 2XF3A 5TGNA 1NB5I 2RFRA 3D5IA 4HM2B 4IIAA 2W04A 3FF2A 1S723 4LSOA 3PGBA 1ULIB 1JN5B 1LOYA 1WMPA 2GEYA 2XSOB 1JB4A 1T2IA 2CHCA 1M1XB 2CFKA 3KSED 4KVHA 1W6YA 2B1XB 4N6OB 3ZG0A 1S5AA 2HMJB 3CC23 5CLKA 1Q824 1RNBA 1YIJ3 3NUVA 2F98A 5EVHA 4XBTA 1DMQA 2XGNA 2CWVA 1I2FA 3CCL3 4MJDA 2BU4A 2RSXA 2MF7A 3NV0A 3Q90A 3F7XA 3K7CA 3H51A 2CKFB 3CME3 1AQZA 3EN8A 2O9UX 3SLUA 3AGOA 1GSPA 4WYKA 3S67A 2XRXB 3I0YA 4RZMA 1E3RA 2AADA 1RGLA 1EEJA 1BRGA 1VQ93 4I5QA 4KT3B 1BUJA 3CU3A 1KWIA 4ZM8A 3S29A 1HZ1A 5M19A 2JQ5A 1LNIA 1UI8A 1JB2A 1FGTA 1W01A 3F7SA 1UCLA 1D6UA 2KF3A 3NX0A 1UI7A 2A15A 1Z1SA 1SPUA 9RNTA 1DYUA 1RCLA 1EQKA 5LC6A 2Z7AA 1TTOA 1NB3I 5BIRA 3N8BA 4EBGA 1GD3A 3EC9A 5CF2A 1WQLB 3WDGB 3CD63 1BRHA 3WOEB 3K0ZA 2J8XB 3S27A 1N5PA 1LOXA 1N8R4 1YGEA 3V99A 4MMYB 4EXRA 2BIRA 1N8QA 1YVSA 4EV2A 4AKYA 3A76A 3F9SA 2HMOB 1FUSA 3M8CA 3JUMA 1GD4A 1G0TA 1RGHA 1RCKA 1LQGC 1LRAA 4HM0B 4WYKB 4BU4A 3G6E3 1I2GA 1T5YA 4KFEA 2W56A 3E99A 5DREA 2XEPA 1RN7A 3ECFA 4N3VA 2QEX3 5IG4A 4J5KA 2KCDA 1JBTA 5FGOA 4WWUC 3ZG5A 5KP4A 3KKGA 2RNTA 1SQWA 1HKXA 1B27A 1EA2A 3T0UA 2PNCA 1HU9A 5KP3A 1IQYA 1RRLA 2YX9A 1K41A 4CPKA 2Z77A 5HOHA 1TP6A 5AIHA 3EN1B 4NHFA 1N9EA 1UW1A 2O3OA 5RNTA 1VQ43 1RKYA 4HM4B 1JB5A 3DM8A 4K1UA 3EF8A 1LXEA 1TFKA 1TUHA 1B21A 3ALAA 3Q3FA 1A2KA 1FGMA 2WGQA 3MYTA 3ZFZA 5AYSC 4N6LA 3GAXA 3X3YA 3HOHA 5IG0A 3T8UA 1IVXA 3BNDA 1W00A 5AI1A 1MNLA 2WO0A 1E97A 1T2HA 4J8TA 4STDA 1W4NA 2P0MA 2WGOA 4LZIA 1LOWA 1W2B2 1QVF2 1WNHA 5IEPA 1NU3A 2F4YA 1VQQA 4KZ1A 1IVUA 1OPYA 1OGXA 1SJWA 1I0VA 3D9RA 2CFLA 2W56B 2XH9A 4BL2A 3MKIA 4HAAA 3HIIA 1GS3A 1O7NB 2OOVC 1W7CA 4RNZA 1B2MA 1SIHA 2F5WA 1RRHA 2HMKB 2C4BA 2KRTA 2STDA 3F8HA 3KZTA 1OUNA 3NBRA 3IJEB 4XM4A 1VQ73 2L1SA 3F40A 1WMNA 1WTHA 3BIRA 3DY5A 4G1MB 2YFIB 3OV4A 1BIRA 2XFSA 4FR9A 2W0QA 3X41A 5HGRA 3WODG 2XR8B 4HM1B
chains in the Genus database with same CATH topology
2F56A 1DETA 1I2FA 1RHLA 1HYFA 2BU4A 5BU4A 1BSDA 1B3SA 1BRIA 1BRJA 4HOHA 1AQZA 1RNTA 1BNGA 1MGRA 1FUTA 1GSPA 1X1XA 2HOHA 3AGOA 1DE3A 4RNTA 1RGGA 2AADA 1RGLA 1PY3A 1BRGA 1BUJA 1YGWA 3DH2A 1ZGXA 1I8VA 2KAAA 1BAOA 1HZ1A 1UCIA 1LNIA 1RMSA 1LOVA 1X1YA 1GMQA 1UCLA 1BVIA 2RBIA 3RNTA 1FW7A 2KF3A 3GSPA 3URPA 1BSCA 1B2MA 4J5GA 3WHOA 1BNEA 9RNTA 1RCLA 1C54A 1BGSA 1GOYA 1RTUA 1TTOA 2AAEA 5BIRA 1I0XA 1UCKA 1AY7A 1BRHA 1BNSA 3A5EA 1GMPA 1BNJA 2SARA 2BIRA 1YVSA 1CH0A 3D4AA 1JBSA 3AHWA 1I3IA 1FZUA 1BNRA 1FUSA 1RGEA 1RGHA 1RCKA 1LRAA 2KF5A 1GOUA 4BU4A 1BOXA 1I2GA 1BANA 1MGWA 1RDSA 1JBTA 4J5KA 2KF4A 2GSPA 1RN4A 4GSPA 2RNTA 7GSPA 1R4YA 1B27A 6RNTA 1RGCA 1I3FA 7RNTA 1RGFA 6GSPA 5HOHA 3WR2A 8RNTA 1BSBA 1GMRA 5RNTA 1SARA 1IYYA 1I70A 2F5MA 1TRPA 3Q3FA 1B2XA 1B21A 1BRNL 3AGNA 3BU4A 3KCHA 1Q9EA 1BRSA 3HOHA 1BRKA 1RGKA 4GHOA 1GOVA 3D5GA 1RLSA 1TRQA 1T2HA 1BSAA 1B20A 2KF6A 1UCJA 1LOWA 1RSNA 1BSEA 1B2SA 1BNFA 1G02A 1RGAA 2F4YA 1B2UA 1JBRA 1I2EA 1I0VA 3DGYA 1PYLA 1BNIA 2ZA4A 4HAAA 2F5WA 1X1WA 1BU4A 1FYSA 1RN1A 2C4BA 3D5IA 1X1UA 5GSPA 3BIRA 1LOYA 3SYUA 4BIRA 1T2IA 1BIRA 1YNVX 1A2PA 1RNBA 3AHSA 1B2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F56 A;  1DET A;  1I2F A;  1RHL A;  1HYF A;  2BU4 A;  5BU4 A;  1BSD A;  1B3S A;  1BRI A;  1BRJ A;  4HOH A;  1AQZ A;  1RNT A;  1BNG A;  1MGR A;  1FUT A;  1GSP A;  1X1X A;  2HOH A;  3AGO A;  1DE3 A;  4RNT A;  1RGG A;  2AAD A;  1RGL A;  1PY3 A;  1BRG A;  1BUJ A;  1YGW A;  3DH2 A;  1ZGX A;  1I8V A;  2KAA A;  1BAO A;  1HZ1 A;  1UCI A;  1LNI A;  1RMS A;  1LOV A;  1X1Y A;  1GMQ A;  1UCL A;  1BVI A;  2RBI A;  3RNT A;  1FW7 A;  2KF3 A;  3GSP A;  3URP A;  1BSC A;  1B2M A;  4J5G A;  3WHO A;  1BNE A;  9RNT A;  1RCL A;  1C54 A;  1BGS A;  1GOY A;  1RTU A;  1TTO A;  2AAE A;  5BIR A;  1I0X A;  1UCK A;  1AY7 A;  1BRH A;  1BNS A;  3A5E A;  1GMP A;  1BNJ A;  2SAR A;  2BIR A;  1YVS A;  1CH0 A;  3D4A A;  1JBS A;  3AHW A;  1I3I A;  1FZU A;  1BNR A;  1FUS A;  1RGE A;  1RGH A;  1RCK A;  1LRA A;  2KF5 A;  1GOU A;  4BU4 A;  1BOX A;  1I2G A;  1BAN A;  1MGW A;  1RDS A;  1JBT A;  4J5K A;  2KF4 A;  2GSP A;  1RN4 A;  4GSP A;  2RNT A;  7GSP A;  1R4Y A;  1B27 A;  6RNT A;  1RGC A;  1I3F A;  7RNT A;  1RGF A;  6GSP A;  5HOH A;  3WR2 A;  8RNT A;  1BSB A;  1GMR A;  5RNT A;  1SAR A;  1IYY A;  1I70 A;  2F5M A;  1TRP A;  3Q3F A;  1B2X A;  1B21 A;  1BRN L;  3AGN A;  3BU4 A;  3KCH A;  1Q9E A;  1BRS A;  3HOH A;  1BRK A;  1RGK A;  4GHO A;  1GOV A;  3D5G A;  1RLS A;  1TRQ A;  1T2H A;  1BSA A;  1B20 A;  2KF6 A;  1UCJ A;  1LOW A;  1RSN A;  1BSE A;  1B2S A;  1BNF A;  1G02 A;  1RGA A;  2F4Y A;  1B2U A;  1JBR A;  1I2E A;  1I0V A;  3DGY A;  1PYL A;  1BNI A;  2ZA4 A;  4HAA A;  2F5W A;  1X1W A;  1BU4 A;  1FYS A;  1RN1 A;  2C4B A;  3D5I A;  1X1U A;  5GSP A;  3BIR A;  1LOY A;  3SYU A;  4BIR A;  1T2I A;  1BIR A;  1YNV X;  1A2P A;  1RNB A;  3AHS A;  1B2Z A; 
#chains in the Genus database with same CATH topology
 3IPT A;  3UL6 A;  2B24 B;  1D6Y A;  3NQY A;  3OWS A;  1IK3 A;  3CCE 3;  2INX A;  3UB1 A;  5IG3 A;  4HBR A;  4R4K A;  1BRI A;  3SED A;  3BNB A;  2RGQ A;  3NHX A;  4L7K A;  1FUT A;  2HOH A;  2W6J H;  4RNT A;  2OTJ 3;  1GY5 A;  2V1L A;  3DXO A;  1NO3 A;  4O3V A;  3DH2 A;  1ZGX A;  2QIY A;  3GRD A;  2KAA A;  3FKA A;  3DZL A;  1YJW 3;  3X40 A;  1RMS A;  1LOV A;  2CG0 A;  3CCU 3;  5JBS A;  3Q1C A;  3AMO B;  3T8N A;  3CCV 3;  3F8X A;  2KXG A;  2W2C A;  1IDP A;  4WFO A;  2E2T A;  3RDE A;  3SVA A;  2CWT A;  2IMJ A;  2ML6 A;  3PS8 A;  1FUW A;  1BNE A;  1GY6 A;  1GOY A;  2AAE A;  1E3V A;  2WOH A;  4PEJ A;  4FCZ A;  1O7P B;  1UCK A;  3B8L A;  2OQE C;  1A2V A;  1AY7 A;  2CX1 A;  3BLZ A;  2P38 A;  1BNS A;  3WA2 X;  5IER A;  5FW5 A;  3KE7 A;  3LH4 A;  3J7Y d;  1GMP A;  4BL3 A;  3DMC A;  3FH1 A;  3D4A A;  1QAK A;  2FXT A;  4HVN A;  3CC4 3;  1AV4 A;  1RGE A;  2R4I A;  1R4C A;  3NXJ A;  3SOA A;  2CW9 A;  2K3D A;  3NBB A;  3KN4 A;  4FCM A;  4H61 A;  2FNQ A;  1GOU A;  2KF5 A;  4HZB B;  3I55 3;  1BOX A;  4BTY A;  1BUQ A;  1N5H A;  1BAN A;  2CFG A;  2L4V A;  2SBL A;  5EEO A;  3K9M C;  3CPO A;  3OWY A;  2KF4 A;  1Q81 4;  2ML5 A;  2Q07 A;  1A67 A;  1KC8 4;  6RNT A;  4EC6 A;  4K90 B;  1STD A;  3VGN A;  1TIJ A;  5AEW B;  1UUW B;  2CH9 A;  3RGR A;  4HM7 B;  1OF5 A;  3KSP A;  3WR2 A;  5EQL A;  1BSB A;  4LMI A;  1GMR A;  2XSH B;  4FMC A;  1I70 A;  1IV9 A;  2F5M A;  3PZW A;  1ZS7 A;  2E2U A;  4HJL B;  1O7M B;  1G96 A;  3CCR 3;  1M90 4;  3NV0 B;  1VQL 3;  4KFF A;  4O8S A;  1GYB A;  3GZX B;  1V58 A;  1BRS A;  2K0M A;  4MEI A;  1BRK A;  4GHO A;  1OHO A;  3B7C A;  3JVC A;  3OX9 A;  1O7H B;  1OHS A;  3X3X A;  3I56 3;  1O7W B;  3CXC 2;  2D1W A;  3B4O A;  3HI7 A;  3FG3 A;  4BTW A;  1B20 A;  2Z6B A;  3SOY A;  4CDL A;  5CF1 A;  1BSE A;  1B2S A;  1BNF A;  1JRQ A;  1RGA A;  1B2U A;  1JBR A;  1I2E A;  3DGY A;  2LQV A;  3WMD A;  2GBW B;  4HYZ A;  1N9J A;  1OGZ A;  4K1V A;  1JKG A;  2ZA4 A;  3U1W A;  1NDO B;  3EJV A;  1RN1 A;  3EBY A;  3MWZ A;  4IPB A;  2BMQ B;  2P0X A;  3STD A;  3BNE A;  4HM6 B;  5GSP A;  1VQK 3;  5CK6 A;  4L8O A;  2K54 A;  2ZL8 A;  4R80 A;  1OF5 B;  1RJO A;  3G71 3;  1F8N A;  1Q7H A;  2GXF A;  3ER7 A;  3U97 A;  1AVK A;  1MOL A;  3AHS A;  1CYU A;  1EUI C;  3MPH A;  2LYX A;  1B2Z A;  1UUG B;  2RCD A;  2CWU A;  2F56 A;  1W2Z A;  4XBY A;  6STD A;  1VQ6 3;  3OW2 2;  3G0K A;  2GU1 A;  5AIG A;  3JUQ A;  3LT9 A;  2CC3 A;  2E2V A;  4OVM A;  1L5G B;  5M1A A;  3DGM A;  3BB9 A;  3PYJ A;  3V92 A;  5BU4 A;  2D42 A;  1PU4 A;  2XGL A;  3MG2 A;  1B3S A;  1IVW A;  1BRJ A;  2GU3 A;  3MG1 A;  4QWT A;  4DKI A;  3G4S 3;  5AEU B;  2Y74 A;  2XFT A;  4XBX A;  1RGG A;  3LML A;  2QA4 3;  1O7G B;  1PY3 A;  1EKM A;  3LT8 A;  3WOF B;  4R9L A;  3MSO A;  4HKV B;  1I8V A;  1JZO A;  3LOY A;  5G1L A;  1BAO A;  1U5O A;  2W9P A;  4ORL A;  2IUJ A;  2CX0 A;  3DUK A;  3S28 A;  3QK9 A;  5D82 A;  3SXX A;  3JUP A;  3RGA A;  2H0G A;  3EX9 A;  4FCJ A;  1UGI A;  1BSC A;  2OCT A;  3LYG A;  1MWR A;  1QAL A;  3URP A;  2BO9 B;  1Q86 4;  5AII A;  2YFL B;  3WHO A;  1C54 A;  8CHO A;  3VF1 A;  1BGS A;  1RTU A;  4N6N B;  2UGI A;  1ULJ B;  1JN5 A;  2CIU A;  3SX1 A;  3F14 A;  4EW5 A;  1JJ2 2;  3CCM 3;  4ILF A;  3HZP A;  4HZ9 B;  5JPU A;  3NBJ A;  2PZV A;  3H3H A;  4HM5 B;  4O02 B;  1M1K 4;  1KQS 2;  1LNH A;  3EHC A;  3LTD A;  1VQP 3;  1AR0 A;  4KFD A;  3UL5 A;  1QMA A;  3GZY B;  2P09 A;  5G1K A;  2BMR B;  1ZX2 A;  5A0O B;  5M18 A;  1I3I A;  5IEO A;  5ELU A;  1MWT A;  4NPB A;  4OUQ A;  3LTC A;  3EQQ B;  3UNL A;  3G16 A;  1MGW A;  1RDS A;  4GB5 A;  3FF0 A;  4HM8 B;  1JNQ A;  1DVC A;  1OAC A;  2GSP A;  1RN4 A;  2HML B;  3FLJ A;  4U13 A;  7GSP A;  1R4Y A;  2UUG C;  1V74 A;  1US1 A;  4FMD A;  1SII A;  3CNX A;  1LVN A;  7RNT A;  1RGF A;  6GSP A;  3Q2P A;  3CCS 3;  1Q7Y 4;  3N54 B;  3DGO A;  4H3U A;  4AEQ A;  1K8A 4;  2F99 A;  3PCS A;  4K61 A;  5ELJ A;  1VQO 3;  4RBN A;  1QAF A;  1B2X A;  4N6U A;  3LZA A;  1NJI 4;  3MG3 A;  3HIG A;  1IT8 A;  3KCH A;  1Q9E A;  1UDI I;  3MHE A;  1FGQ A;  3PCR A;  1ROA A;  5BXQ A;  2WOF A;  1GOV A;  1TRQ A;  4XDV A;  4CCV A;  5G2G A;  5BVB A;  2KF6 A;  1UCJ A;  1RSN A;  2BHM A;  1G02 A;  2FGT A;  1OH0 A;  3GZR A;  3IMA B;  5IEN A;  5IF6 A;  4XB5 A;  1IU7 A;  1TFO A;  2IA7 A;  3KII A;  3NM7 A;  1ROV A;  4MMZ B;  3CCQ 3;  3FSD A;  1ISK A;  2P05 A;  3EE1 A;  1BU4 A;  1OHP A;  1FYS A;  3FCS B;  1FA3 A;  1X1U A;  5D81 A;  1V57 A;  1VQ5 3;  3FGY A;  1Q40 A;  4FMB A;  3SYU A;  4BIR A;  3QRD A;  1C7H A;  1YNV X;  4LGQ A;  1FGR A;  5D83 A;  2C10 A;  2HMM B;  1VQ8 3;  2BMO B;  1ASK A;  1VQM 3;  1YJ9 3;  1A2P A;  2CK3 H;  2IY2 A;  3LTB A;  1T3B A;  1YVB I;  5CXO A;  1QJG A;  2R41 A;  4N6M A;  1DET A;  1IQ8 A;  1RHL A;  2HMN B;  1JV2 B;  1HYF A;  1BSD A;  5AIF A;  5AYR B;  4CJN A;  1NWW A;  3D79 A;  1VZZ A;  1UUV B;  4HOH A;  5IG5 A;  1YJN 3;  3JUN A;  3L0R A;  1RNT A;  1BNG A;  1MGR A;  2BNG A;  1X1X A;  3BNC A;  3CNM A;  1DE3 A;  1DMM A;  2F86 B;  1U8C B;  1VQN 3;  2GBX B;  2W9Q A;  3D3L A;  1YGW A;  5JPP A;  1FGO A;  4RNY A;  3DGN A;  4X2H A;  4HM3 B;  1UCI A;  1QVG 2;  3CC7 3;  2QGU A;  1X1Y A;  3GZB A;  1GMQ A;  5STD A;  4GL6 A;  1BVI A;  2RBI A;  3RNT A;  4LEH A;  4LYL B;  3GSP A;  3V98 A;  1FW7 A;  3HK4 A;  2H0H A;  3NM2 A;  4I4K A;  1W6C A;  4J5G A;  4N6T A;  2OOV A;  1Q40 B;  3S5C A;  2C11 A;  1ZO2 A;  2M7O A;  4AKZ A;  4BTX A;  1K9M 4;  2ZDJ A;  2OWP A;  5LC7 A;  3CPW 2;  1J2B A;  2CFD A;  1I0X A;  5I97 A;  1STF I;  2W03 A;  1KSI A;  1GY7 A;  4IT7 A;  1CYV A;  3TDG A;  4EV5 A;  1DVD A;  1IT7 A;  2IUK A;  3OXA A;  4JRF A;  4J9A A;  2H0I A;  1CQS A;  1NNV A;  2I9W A;  3A5E A;  3K63 A;  1BNJ A;  2SAR A;  4WP5 A;  5DRV A;  2CG1 A;  1CH0 A;  1MWU A;  3FG1 A;  3LTA A;  1JBS A;  3AHW A;  4FMA A;  1FZU A;  1BNR A;  4NRE A;  1K73 4;  1JZD A;  4JF8 A;  1JKG B;  1W6G A;  1PFP A;  1YIT 3;  1Q42 A;  2Y73 A;  1YHQ 3;  2OTL 3;  3CMA 3;  1W5Z A;  2IYJ A;  1TU5 A;  2CFW A;  3KFQ C;  4O2H A;  2MC8 A;  3X42 A;  1KD1 4;  4GSP A;  1K28 A;  4OK0 A;  4R9K A;  7STD A;  1RGC A;  2GEX A;  1DMN A;  1I3F A;  1WMO A;  1D6Z A;  4MMX B;  3AMO A;  8RNT A;  1Y4K A;  3DGL A;  2ZHX B;  3LXU X;  3O8Y A;  3VSY A;  1IYY A;  1SAR A;  5KP1 A;  1LQM B;  3K5T A;  4WHA A;  1TJD A;  1UGH I;  2YFJ B;  1TRP A;  1W02 A;  4XDW A;  3EB8 A;  4Q53 A;  3UJM A;  1YI2 3;  3EBT A;  1IQX A;  2BT3 A;  3HX8 A;  1AVL A;  3JUO A;  3G8Z A;  3AGN A;  3BU4 A;  1BRN L;  1A90 A;  3PXM A;  3ROB A;  5IW9 A;  4L8P A;  3GWR A;  3NQZ A;  4EYC A;  1RGK A;  1EG9 B;  1IVV A;  3B4P A;  3D5G A;  1RLS A;  3FG4 A;  1OCV A;  2JDI H;  2OQE A;  1M9G A;  1BSA A;  3X3Z A;  3OWU A;  2UX0 A;  4R1K A;  1CEW I;  3N9H A;  3FZW A;  1MWS A;  4TX4 A;  3WA3 A;  4X2O A;  3CCJ 3;  1PYL A;  1BNI A;  4N6V 0;  2Z76 A;  1X1W A;  1IV7 A;  2XF3 A;  5TGN A;  1NB5 I;  2RFR A;  3D5I A;  4HM2 B;  4IIA A;  2W04 A;  3FF2 A;  1S72 3;  4LSO A;  3PGB A;  1ULI B;  1JN5 B;  1LOY A;  1WMP A;  2GEY A;  2XSO B;  1JB4 A;  1T2I A;  2CHC A;  1M1X B;  2CFK A;  3KSE D;  4KVH A;  1W6Y A;  2B1X B;  4N6O B;  3ZG0 A;  1S5A A;  2HMJ B;  3CC2 3;  5CLK A;  1Q82 4;  1RNB A;  1YIJ 3;  3NUV A;  2F98 A;  5EVH A;  4XBT A;  1DMQ A;  2XGN A;  2CWV A;  1I2F A;  3CCL 3;  4MJD A;  2BU4 A;  2RSX A;  2MF7 A;  3NV0 A;  3Q90 A;  3F7X A;  3K7C A;  3H51 A;  2CKF B;  3CME 3;  1AQZ A;  3EN8 A;  2O9U X;  3SLU A;  3AGO A;  1GSP A;  4WYK A;  3S67 A;  2XRX B;  3I0Y A;  4RZM A;  1E3R A;  2AAD A;  1RGL A;  1EEJ A;  1BRG A;  1VQ9 3;  4I5Q A;  4KT3 B;  1BUJ A;  3CU3 A;  1KWI A;  4ZM8 A;  3S29 A;  1HZ1 A;  5M19 A;  2JQ5 A;  1LNI A;  1UI8 A;  1JB2 A;  1FGT A;  1W01 A;  3F7S A;  1UCL A;  1D6U A;  2KF3 A;  3NX0 A;  1UI7 A;  2A15 A;  1Z1S A;  1SPU A;  9RNT A;  1DYU A;  1RCL A;  1EQK A;  5LC6 A;  2Z7A A;  1TTO A;  1NB3 I;  5BIR A;  3N8B A;  4EBG A;  1GD3 A;  3EC9 A;  5CF2 A;  1WQL B;  3WDG B;  3CD6 3;  1BRH A;  3WOE B;  3K0Z A;  2J8X B;  3S27 A;  1N5P A;  1LOX A;  1N8R 4;  1YGE A;  3V99 A;  4MMY B;  4EXR A;  2BIR A;  1N8Q A;  1YVS A;  4EV2 A;  4AKY A;  3A76 A;  3F9S A;  2HMO B;  1FUS A;  3M8C A;  3JUM A;  1GD4 A;  1G0T A;  1RGH A;  1RCK A;  1LQG C;  1LRA A;  4HM0 B;  4WYK B;  4BU4 A;  3G6E 3;  1I2G A;  1T5Y A;  4KFE A;  2W56 A;  3E99 A;  5DRE A;  2XEP A;  1RN7 A;  3ECF A;  4N3V A;  2QEX 3;  5IG4 A;  4J5K A;  2KCD A;  1JBT A;  5FGO A;  4WWU C;  3ZG5 A;  5KP4 A;  3KKG A;  2RNT A;  1SQW A;  1HKX A;  1B27 A;  1EA2 A;  3T0U A;  2PNC A;  1HU9 A;  5KP3 A;  1IQY A;  1RRL A;  2YX9 A;  1K41 A;  4CPK A;  2Z77 A;  5HOH A;  1TP6 A;  5AIH A;  3EN1 B;  4NHF A;  1N9E A;  1UW1 A;  2O3O A;  5RNT A;  1VQ4 3;  1RKY A;  4HM4 B;  1JB5 A;  3DM8 A;  4K1U A;  3EF8 A;  1LXE A;  1TFK A;  1TUH A;  1B21 A;  3ALA A;  3Q3F A;  1A2K A;  1FGM A;  2WGQ A;  3MYT A;  3ZFZ A;  5AYS C;  4N6L A;  3GAX A;  3X3Y A;  3HOH A;  5IG0 A;  3T8U A;  1IVX A;  3BND A;  1W00 A;  5AI1 A;  1MNL A;  2WO0 A;  1E97 A;  1T2H A;  4J8T A;  4STD A;  1W4N A;  2P0M A;  2WGO A;  4LZI A;  1LOW A;  1W2B 2;  1QVF 2;  1WNH A;  5IEP A;  1NU3 A;  2F4Y A;  1VQQ A;  4KZ1 A;  1IVU A;  1OPY A;  1OGX A;  1SJW A;  1I0V A;  3D9R A;  2CFL A;  2W56 B;  2XH9 A;  4BL2 A;  3MKI A;  4HAA A;  3HII A;  1GS3 A;  1O7N B;  2OOV C;  1W7C A;  4RNZ A;  1B2M A;  1SIH A;  2F5W A;  1RRH A;  2HMK B;  2C4B A;  2KRT A;  2STD A;  3F8H A;  3KZT A;  1OUN A;  3NBR A;  3IJE B;  4XM4 A;  1VQ7 3;  2L1S A;  3F40 A;  1WMN A;  1WTH A;  3BIR A;  3DY5 A;  4G1M B;  2YFI B;  3OV4 A;  1BIR A;  2XFS A;  4FR9 A;  2W0Q A;  3X41 A;  5HGR A;  3WOD G;  2XR8 B;  4HM1 B; 
#chains in the Genus database with same CATH homology
 2F56 A;  1DET A;  1I2F A;  1RHL A;  1HYF A;  2BU4 A;  5BU4 A;  1BSD A;  1B3S A;  1BRI A;  1BRJ A;  4HOH A;  1AQZ A;  1RNT A;  1BNG A;  1MGR A;  1FUT A;  1GSP A;  1X1X A;  2HOH A;  3AGO A;  1DE3 A;  4RNT A;  1RGG A;  2AAD A;  1RGL A;  1PY3 A;  1BRG A;  1BUJ A;  1YGW A;  3DH2 A;  1ZGX A;  1I8V A;  2KAA A;  1BAO A;  1HZ1 A;  1UCI A;  1LNI A;  1RMS A;  1LOV A;  1X1Y A;  1GMQ A;  1UCL A;  1BVI A;  2RBI A;  3RNT A;  1FW7 A;  2KF3 A;  3GSP A;  3URP A;  1BSC A;  1B2M A;  4J5G A;  3WHO A;  1BNE A;  9RNT A;  1RCL A;  1C54 A;  1BGS A;  1GOY A;  1RTU A;  1TTO A;  2AAE A;  5BIR A;  1I0X A;  1UCK A;  1AY7 A;  1BRH A;  1BNS A;  3A5E A;  1GMP A;  1BNJ A;  2SAR A;  2BIR A;  1YVS A;  1CH0 A;  3D4A A;  1JBS A;  3AHW A;  1I3I A;  1FZU A;  1BNR A;  1FUS A;  1RGE A;  1RGH A;  1RCK A;  1LRA A;  2KF5 A;  1GOU A;  4BU4 A;  1BOX A;  1I2G A;  1BAN A;  1MGW A;  1RDS A;  1JBT A;  4J5K A;  2KF4 A;  2GSP A;  1RN4 A;  4GSP A;  2RNT A;  7GSP A;  1R4Y A;  1B27 A;  6RNT A;  1RGC A;  1I3F A;  7RNT A;  1RGF A;  6GSP A;  5HOH A;  3WR2 A;  8RNT A;  1BSB A;  1GMR A;  5RNT A;  1SAR A;  1IYY A;  1I70 A;  2F5M A;  1TRP A;  3Q3F A;  1B2X A;  1B21 A;  1BRN L;  3AGN A;  3BU4 A;  3KCH A;  1Q9E A;  1BRS A;  3HOH A;  1BRK A;  1RGK A;  4GHO A;  1GOV A;  3D5G A;  1RLS A;  1TRQ A;  1T2H A;  1BSA A;  1B20 A;  2KF6 A;  1UCJ A;  1LOW A;  1RSN A;  1BSE A;  1B2S A;  1BNF A;  1G02 A;  1RGA A;  2F4Y A;  1B2U A;  1JBR A;  1I2E A;  1I0V A;  3DGY A;  1PYL A;  1BNI A;  2ZA4 A;  4HAA A;  2F5W A;  1X1W A;  1BU4 A;  1FYS A;  1RN1 A;  2C4B A;  3D5I A;  1X1U A;  5GSP A;  3BIR A;  1LOY A;  3SYU A;  4BIR A;  1T2I A;  1BIR A;  1YNV X;  1A2P A;  1RNB A;  3AHS A;  1B2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...