1B2ZA

Deletion of a buried salt bridge in barnase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSNWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2zA00
1BNGA 1GOVA 1C54A 1GMPA 1I3IA 1I2FA 3A5EA 4HAAA 1PYLA 2RBIA 1AY7A 1GOUA 1I8VA 1BNIA 5BIRA 1BSAA 1MGWA 1X1XA 1I2GA 1BNFA 1RCLA 1RGLA 1R4YA 9RNTA 1MGRA 3AGNA 3GSPA 1FW7A 1X1UA 1YGWA 1BU4A 1PY3A 3Q3FA 2AAEA 5BU4A 5HOHA 1JBRA 1LOYA 1T2HA 6RNTA 2F5MA 1HYFA 3BU4A 2SARA 1Q9EA 1BANA 6GSPA 1JBSA 3AHSA 4BU4A 3SYUA 1FYSA 1BRHA 1BRIA 1RGFA 1BSEA 3RNTA 1RGGA 1I3FA 2GSPA 1GMQA 1A2PA 1B2UA 1CH0A 1B2MA 1I2EA 1LRAA 1T2IA 4J5KA 5GSPA 1BUJA 1BVIA 1BNEA 1LNIA 5RNTA 1DETA 1IYYA 1SARA 2BIRA 1RNTA 1BRGA 1BOXA 1FUTA 1I0XA 1B27A 1X1WA 2KAAA 1RGAA 3AHWA 4GHOA 1UCJA 1RN4A 4J5GA 2ZA4A 1BRKA 1FUSA 2BU4A 1HZ1A 2F4YA 1BNRA 1LOVA 2F5WA 1X1YA 1G02A 1RMSA 2F56A 4RNTA 3URPA 1RGEA 2KF6A 1GOYA 2HOHA 1GSPA 1I0VA 1YVSA 1RNBA 1BAOA 1BSBA 1DE3A 2RNTA 1UCIA 3D5GA 1UCLA 3D5IA 1RGHA 1BSCA 1I70A 1RGKA 2AADA 3WR2A 7GSPA 3DGYA 1FZUA 1B2ZA 1TRQA 1BGSA 1RN1A 2KF4A 4BIRA 1RHLA 1B20A 1GMRA 1TTOA 1ZGXA 7RNTA 3AGOA 1BRJA 1AQZA 1TRPA 8RNTA 1BRSA 1RGCA 1BNJA 1JBTA 3DH2A 3BIRA 4HOHA 1B2XA 3KCHA 2C4BA 2KF3A 1RCKA 1UCKA 1B21A 1B2SA 1BSDA 1RDSA 1RLSA 2KF5A 4GSPA 3WHOA 1BNSA 1LOWA 1RSNA 1RTUA 1YNVX 1BRNL 1BIRA 3HOHA 3D4AA 1B3SA
chains in the Genus database with same CATH superfamily
1BNGA 1NO3A 2BHMA 4MMXB 4ORLA 3PXMA 4LEHA 2HMMB 4O8SA 5IF6A 1GMPA 2CX0A 5KP4A 4H61A 4HAAA 4K1VA 1FGTA 1VQK3 2CG1A 3WA3A 3H3HA 5IW9A 1UUGB 1NU3A 1AY7A 1LXEA 1MOLA 1BNIA 5BIRA 5CK6A 1AVKA 1E97A 3JUOA 2W56A 2OQEC 3AMOA 1RJOA 2IA7A 5BVBA 4N6NB 1WMPA 3X3XA 1MWRA 2CWUA 2Y74A 3AGNA 1OF5A 1Z1SA 1JNQA 1F8NA 1PY3A 3Q3FA 4ZM8A 2CK3H 2XEPA 2GEXA 1JBRA 1QVG2 1RKYA 3K9MC 2CG0A 4XBTA 4EV2A 2XR8B 4RNZA 3MSOA 3RGRA 4FMBA 3KE7A 1JJ22 2WOFA 3Q2PA 5CLKA 1N5HA 3FKAA 1RGFA 1WNHA 3E99A 4K1UA 3CXC2 2UUGC 4N6LA 1A2PA 1CH0A 1HKXA 1OHPA 1I2EA 3B7CA 4R9KA 1B2MA 2QGUA 1GD4A 1RRHA 2FNQA 3DMCA 1BUJA 4BTWA 5G2GA 5RNTA 2HMOB 2ZHXB 3ZFZA 2OTL3 5DREA 1TJDA 3NXJA 1UI7A 1S5AA 1BRGA 3GZRA 4FCJA 4XM4A 1BOXA 1WMOA 1Q7HA 4HM8B 3N9HA 1HU9A 3NUVA 1ISKA 3S28A 3PGBA 1RGAA 5FW5A 2E2VA 3CPOA 4HM0B 3LTAA 3GZYB 1W2B2 1OPYA 1FUSA 2W9PA 1FA3A 4CPKA 2OQEA 1IYYA 5IG0A 2M7OA 1G02A 3FG3A 3EF8A 5IG5A 1GY5A 3LT9A 1RGEA 1A90A 1YHQ3 1NNVA 2CC3A 3NBJA 5IG3A 1GSPA 1YVSA 1EG9B 3STDA 3JUQA 1W5ZA 5KP3A 1SPUA 1FUWA 4FR9A 4STDA 1IT8A 1UI8A 1UCLA 1RN7A 1Q42A 1LQMB 2PZVA 4MMZB 2XF3A 3PYJA 2D1WA 1AV4A 1K41A 2B24B 3OWUA 1TRQA 5M18A 2CH9A 3FG4A 3KSPA 1B20A 1JN5A 1GMRA 3MKIA 1WTHA 3MWZA 4BIRA 4EXRA 1N8R4 5D83A 3LTCA 1ZGXA 3NQYA 4KFFA 4XDVA 1A2VA 3SXXA 5AEUB 3CNXA 2K0MA 2F86B 2QEX3 1RGCA 4HM7B 4QWTA 3BIRA 1IVWA 3EE1A 2IY2A 2C4BA 1WQLB 1STFI 3S67A 3CCU3 1UW1A 5CF1A 4L7KA 1UCKA 1YJW3 3T8UA 3FSDA 4FCZA 1B2SA 3ZG5A 1E3RA 1MNLA 3RDEA 2JQ5A 2KCDA 1JB4A 3F40A 5IEPA 1U8CB 4GSPA 3WHOA 2D42A 2O3OA 1BNSA 4BTYA 1YVBI 1QAKA 1RRLA 1OUNA 4NPBA 3WODG 3B8LA 3I0YA 1NDOB 3LZAA 1IK3A 1GOVA 1YGEA 2LYXA 2XGNA 4X2OA 4HM5B 1WMNA 3CNMA 1I3IA 2Q07A 3K0ZA 3ER7A 3CME3 4FCMA 3NHXA 1DVCA 1OH0A 1PYLA 2RBIA 3Q90A 1GOUA 2XFTA 1M1XB 4CJNA 1BSAA 2GEYA 1L5GB 1R4YA 3MPHA 3B4PA 3G4S3 1ZX2A 2BNGA 5AIHA 3UL5A 1S723 2RSXA 3F7XA 5KP1A 4I5QA 4EBGA 4AKYA 1A67A 4NREA 1YGWA 1BU4A 1JKGA 1SIIA 5I97A 1KC84 1VQQA 1VQ83 3IPTA 1DMNA 1D6ZA 2F5MA 1HYFA 2RFRA 3L0RA 3WA2X 1Q824 2SARA 4JRFA 3VF1A 4K61A 1UGHI 4BU4A 1BRHA 4FMDA 3WOEB 1W00A 4N6V0 1BRIA 3I553 2GU3A 3NBBA 3QK9A 4O02B 4XBYA 1OCVA 1B2UA 1DMQA 2KXGA 4GB5A 1SQWA 8CHOA 1V57A 4WYKA 5IENA 3NM7A 4J5KA 4KVHA 4U13A 2BT3A 1O7WB 1BNEA 3FZWA 2C10A 3OV4A 3UNLA 2XSHB 1U5OA 1SARA 3EN1B 1M904 3ECFA 3BNBA 3PCRA 4HKVB 1I0XA 4HVNA 4MMYB 1OHSA 2WOHA 1FGRA 1Q40A 2BMQB 3NV0A 3CMA3 2KAAA 5CXOA 3D3LA 1IU7A 1QAFA 3KSED 1CQSA 2YFJB 3LH4A 4J5GA 3KKGA 1YIJ3 1IV9A 1BRKA 2CFDA 2INXA 1VQ43 3CC43 1BNRA 3EBTA 1KWIA 1O7NB 1LOVA 4NHFA 2Z6BA 2F5WA 3MHEA 4RNTA 5JPPA 4R9LA 3CCE3 4IT7A 2KF6A 1GOYA 2W03A 1TP6A 1DMMA 3OWSA 1BSBA 1UDII 2E2UA 1NJI4 1VZZA 2Y73A 3JUMA 4XBXA 3Q1CA 2AADA 3PCSA 4N3VA 2KRTA 3DGYA 1PU4A 3F14A 3OXAA 3HI7A 1STDA 1RN1A 3CD63 2UX0A 1QMAA 2Z76A 3X40A 1TFKA 4DKIA 2P0XA 3FF2A 4HYZA 2GXFA 2MF7A 3JVCA 1BRJA 1TRPA 3F8HA 1ROAA 8RNTA 1UUWB 1IQ8A 3D9RA 4RZMA 2E2TA 1BNJA 3PS8A 3S29A 2WGOA 1FGOA 3DXOA 1D6UA 1E3VA 3PZWA 3DGLA 2HMNB 4HZ9B 4O3VA 4XB5A 5TGNA 1VQ53 3J7Yd 1CYUA 1JZDA 2ML6A 5AEWB 4MJDA 1KSIA 1VQL3 1OHOA 3H51A 3KZTA 1VQO3 2KF5A 3MG2A 3V98A 3BLZA 2CFKA 2Z7AA 4R1KA 2I9WA 1LVNA 3LT8A 3HOHA 2YFIB 4KFDA 5BXQA 1Q864 5AIGA 1IQYA 3K7CA 5EVHA 4EV5A 4CDLA 3OW22 3UB1A 2OTJ3 1OACA 3GZBA 3LMLA 4R80A 4WHAA 3WDGB 1I2FA 3A5EA 2OOVC 5DRVA 4HM3B 1N9JA 4H3UA 1QVF2 1DVDA 3F8XA 1ULJB 3FCSB 1MGWA 1X1XA 3LYGA 4AKZA 1I2GA 1BNFA 1RCLA 1RGLA 3GWRA 2ML5A 3NM2A 1W6CA 3EBYA 2GU1A 3CCL3 4HZBB 4TX4A 1W6YA 1YJ93 2W6JH 1TFOA 3MG3A 4AEQA 4EC6A 1FW7A 2AAEA 2IUJA 5BU4A 2CW9A 3S27A 5HOHA 2IMJA 3HIGA 3SOYA 6RNTA 1EEJA 3QRDA 5G1KA 3BU4A 5HGRA 1Q9EA 2XRXB 1BANA 2CKFB 1JBSA 1O7GB 3ALAA 3NQZA 3SYUA 1FYSA 1W4NA 4KFEA 3LTBA 1FGMA 1BSEA 3DUKA 1RGGA 3BNCA 1LNHA 1GMQA 1ASKA 4KT3B 5IG4A 1LRAA 1UUVB 3S5CA 3SOAA 4XDWA 3ZG0A 5GSPA 5IEOA 1LNIA 1SJWA 5AIFA 1MWTA 3T0UA 1CYVA 3WOFB 1KQS2 2CIUA 4LGQA 2K3DA 1UGIA 1JKGB 2CHCA 2V1LA 1FUTA 3GZXB 3HZPA 2OOVA 3LXUX 2MC8A 4BL3A 1IVXA 4IIAA 1VQ73 4EYCA 1YI23 2ZDJA 3LTDA 1O7PB 4N6OB 2SBLA 1JZOA 1T5YA 3CPW2 2BU4A 2RGQA 2ZL8A 1IT7A 4HM2B 1M9GA 3DM8A 2HMJB 1LQGC 1X1YA 1RMSA 3URPA 3MYTA 3M8CA 1GY7A 1QALA 4CCVA 4HBRA 3DZLA 3VGNA 1GD3A 1I0VA 3EX9A 2W56B 3MG1A 4K90B 3SVAA 3AMOB 3CCQ3 2RNTA 2CFLA 2R4IA 1UCIA 2P09A 3IMAB 3D5IA 2W0QA 1BSCA 3VSYA 2BMRB 2OCTA 1IDPA 3U1WA 3G16A 3WR2A 1TIJA 2P05A 1OF5B 1B2ZA 4BTXA 1VQ93 1BGSA 1RHLA 2C11A 2IUKA 4BL2A 1NWWA 1Y4KA 4WWUC 4X2HA 3F9SA 2R41A 1EA2A 1G0TA 1C7HA 4MEIA 3X3ZA 2JDIH 4I4KA 4R4KA 3CC73 4N6UA 1B2XA 1IQXA 1CEWI 1ULIB 3KCHA 4RNYA 4Q53A 3N8BA 1N8QA 1W02A 1T3BA 3FH1A 4LSOA 1RCKA 1IVVA 5LC6A 1EUIC 3CCS3 3DY5A 1TU5A 6STDA 1BSDA 3U97A 3CCJ3 1MWUA 1IV7A 3B4OA 4EW5A 3UL6A 5AIIA 3X42A 1W01A 1ROVA 1LOWA 1RSNA 1YNVX 1BUQA 3EHCA 3BNDA 3EQQB 2H0HA 4WFOA 2F98A 3CC23 1FGQA 2O9UX 3V92A 2FGTA 1IVUA 3DGOA 3KN4A 2CWTA 4IPBA 1C54A 4LZIA 3EJVA 3G713 1EKMA 5AYSC 4GL6A 4HJLB 1ZS7A 3EN8A 2CWVA 1VQ63 1R4CA 3V99A 3EC9A 1I8VA 4HM6B 3LOYA 2QA43 5STDA 4KZ1A 4ILFA 1NB3I 2RCDA 3NX0A 4RBNA 3F7SA 7STDA 9RNTA 3BB9A 2HMLB 1MGRA 3DGNA 3SEDA 3GSPA 4N6MA 3D79A 1JN5B 1MWSA 1X1UA 3G8ZA 3UJMA 1Q814 3CU3A 1AVLA 1DYUA 3NBRA 1LOYA 1T2HA 2H0IA 2OWPA 3HIIA 1VQP3 4FMCA 3T8NA 1G96A 5ELJA 6GSPA 1EQKA 1GYBA 1O7HB 5CF2A 3AHSA 2L1SA 3FG1A 1VQM3 2J8XB 4HM4B 1TUHA 2QIYA 1JV2B 2F99A 3RNTA 1I3FA 4OUQA 2GSPA 3K63A 5D81A 4LMIA 5D82A 1W2ZA 2UGIA 1T2IA 4G1MB 1YIT3 5JBSA 1BVIA 3BNEA 1V74A 2P38A 3FLJA 1DETA 1OGXA 2XSOB 1O7MB 3FGYA 2H0GA 5EQLA 4JF8A 3N54B 2BIRA 2LQVA 1RNTA 3JUNA 4N6TA 3SLUA 1K8A4 5LC7A 5ELUA 5AYRB 2CFWA 2WGQA 3DGMA 2BO9B 1B27A 3HK4A 1X1WA 1K28A 2XFSA 2YX9A 4PEJA 3AHWA 4GHOA 2W2CA 2XGLA 1UCJA 3FF0A 1KD14 1RN4A 1K9M4 1J2BA 5EEOA 2ZA4A 2F4YA 1HZ1A 3KFQC 1AR0A 4L8OA 2IYJA 4WP5A 3X3YA 3CCM3 1US1A 2F56A 1W7CA 3GRDA 3HX8A 2BMOB 2HOHA 1V58A 2PNCA 1RNBA 1BAOA 3CCR3 4HM1B 3OX9A 3TDGA 2W04A 2YFLB 3G6E3 1LOXA 1DE3A 3KIIA 1SIHA 3WMDA 3D5GA 1RGHA 1I70A 1RGKA 3A76A 1QJGA 4FMAA 2GBXB 3ROBA 7GSPA 1FZUA 2CX1A 3G0KA 4L8PA 2KF4A 4J8TA 4LYLB 1JB5A 1A2KA 1TTOA 2A15A 1M1K4 4OVMA 7RNTA 3AGOA 5M19A 4J9AA 1AQZA 3SX1A 5FGOA 2GBWB 1N9EA 1JRQA 1BRSA 1K734 1NB5I 2W9QA 2STDA 3DH2A 1JBTA 3GAXA 3EB8A 4O2HA 4HOHA 1Q7Y4 5A0OB 3O8YA 1D6YA 2KF3A 4WYKB 1VQN3 1PFPA 2K54A 5M1AA 1W6GA 3JUPA 2CFGA 3I563 3RGAA 1N5PA 2WO0A 1B21A 1JB2A 3K5TA 1GS3A 1RDSA 1RLSA 5IERA 3IJEB 2FXTA 2HMKB 1RTUA 2Z77A 5AI1A 1OGZA 5JPUA 1Q40B 1BIRA 2XH9A 3NV0B 4OK0A 3X41A 1BRNL 5G1LA 2B1XB 1YJN3 1ZO2A 3D4AA 3OWYA 2L4VA 1GY6A 2P0MA 1B3SA 3CCV3
chains in the Genus database with same CATH topology
1BNGA 1GOVA 1C54A 1GMPA 1I3IA 1I2FA 3A5EA 4HAAA 1PYLA 2RBIA 1AY7A 1GOUA 1I8VA 1BNIA 5BIRA 1BSAA 1MGWA 1X1XA 1I2GA 1BNFA 1RCLA 1RGLA 1R4YA 9RNTA 1MGRA 3AGNA 3GSPA 1FW7A 1X1UA 1YGWA 1BU4A 1PY3A 3Q3FA 2AAEA 5BU4A 5HOHA 1JBRA 1LOYA 1T2HA 6RNTA 2F5MA 1HYFA 3BU4A 2SARA 1Q9EA 1BANA 6GSPA 1JBSA 3AHSA 4BU4A 3SYUA 1FYSA 1BRHA 1BRIA 1RGFA 1BSEA 3RNTA 1RGGA 1I3FA 2GSPA 1GMQA 1A2PA 1B2UA 1CH0A 1B2MA 1I2EA 1LRAA 1T2IA 4J5KA 5GSPA 1BUJA 1BVIA 1BNEA 1LNIA 5RNTA 1DETA 1IYYA 1SARA 2BIRA 1RNTA 1BRGA 1BOXA 1FUTA 1I0XA 1B27A 1X1WA 2KAAA 1RGAA 3AHWA 4GHOA 1UCJA 1RN4A 4J5GA 2ZA4A 1BRKA 1FUSA 2BU4A 1HZ1A 2F4YA 1BNRA 1LOVA 2F5WA 1X1YA 1G02A 1RMSA 2F56A 4RNTA 3URPA 1RGEA 2KF6A 1GOYA 2HOHA 1GSPA 1I0VA 1YVSA 1RNBA 1BAOA 1BSBA 1DE3A 2RNTA 1UCIA 3D5GA 1UCLA 3D5IA 1RGHA 1BSCA 1I70A 1RGKA 2AADA 3WR2A 7GSPA 3DGYA 1FZUA 1B2ZA 1TRQA 1BGSA 1RN1A 2KF4A 4BIRA 1RHLA 1B20A 1GMRA 1TTOA 1ZGXA 7RNTA 3AGOA 1BRJA 1AQZA 1TRPA 8RNTA 1BRSA 1RGCA 1BNJA 1JBTA 3DH2A 3BIRA 4HOHA 1B2XA 3KCHA 2C4BA 2KF3A 1RCKA 1UCKA 1B21A 1B2SA 1BSDA 1RDSA 1RLSA 2KF5A 4GSPA 3WHOA 1BNSA 1LOWA 1RSNA 1RTUA 1YNVX 1BRNL 1BIRA 3HOHA 3D4AA 1B3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNG A;  1GOV A;  1C54 A;  1GMP A;  1I3I A;  1I2F A;  3A5E A;  4HAA A;  1PYL A;  2RBI A;  1AY7 A;  1GOU A;  1I8V A;  1BNI A;  5BIR A;  1BSA A;  1MGW A;  1X1X A;  1I2G A;  1BNF A;  1RCL A;  1RGL A;  1R4Y A;  9RNT A;  1MGR A;  3AGN A;  3GSP A;  1FW7 A;  1X1U A;  1YGW A;  1BU4 A;  1PY3 A;  3Q3F A;  2AAE A;  5BU4 A;  5HOH A;  1JBR A;  1LOY A;  1T2H A;  6RNT A;  2F5M A;  1HYF A;  3BU4 A;  2SAR A;  1Q9E A;  1BAN A;  6GSP A;  1JBS A;  3AHS A;  4BU4 A;  3SYU A;  1FYS A;  1BRH A;  1BRI A;  1RGF A;  1BSE A;  3RNT A;  1RGG A;  1I3F A;  2GSP A;  1GMQ A;  1A2P A;  1B2U A;  1CH0 A;  1B2M A;  1I2E A;  1LRA A;  1T2I A;  4J5K A;  5GSP A;  1BUJ A;  1BVI A;  1BNE A;  1LNI A;  5RNT A;  1DET A;  1IYY A;  1SAR A;  2BIR A;  1RNT A;  1BRG A;  1BOX A;  1FUT A;  1I0X A;  1B27 A;  1X1W A;  2KAA A;  1RGA A;  3AHW A;  4GHO A;  1UCJ A;  1RN4 A;  4J5G A;  2ZA4 A;  1BRK A;  1FUS A;  2BU4 A;  1HZ1 A;  2F4Y A;  1BNR A;  1LOV A;  2F5W A;  1X1Y A;  1G02 A;  1RMS A;  2F56 A;  4RNT A;  3URP A;  1RGE A;  2KF6 A;  1GOY A;  2HOH A;  1GSP A;  1I0V A;  1YVS A;  1RNB A;  1BAO A;  1BSB A;  1DE3 A;  2RNT A;  1UCI A;  3D5G A;  1UCL A;  3D5I A;  1RGH A;  1BSC A;  1I70 A;  1RGK A;  2AAD A;  3WR2 A;  7GSP A;  3DGY A;  1FZU A;  1B2Z A;  1TRQ A;  1BGS A;  1RN1 A;  2KF4 A;  4BIR A;  1RHL A;  1B20 A;  1GMR A;  1TTO A;  1ZGX A;  7RNT A;  3AGO A;  1BRJ A;  1AQZ A;  1TRP A;  8RNT A;  1BRS A;  1RGC A;  1BNJ A;  1JBT A;  3DH2 A;  3BIR A;  4HOH A;  1B2X A;  3KCH A;  2C4B A;  2KF3 A;  1RCK A;  1UCK A;  1B21 A;  1B2S A;  1BSD A;  1RDS A;  1RLS A;  2KF5 A;  4GSP A;  3WHO A;  1BNS A;  1LOW A;  1RSN A;  1RTU A;  1YNV X;  1BRN L;  1BIR A;  3HOH A;  3D4A A;  1B3S A; 
#chains in the Genus database with same CATH topology
 1BNG A;  1NO3 A;  2BHM A;  4MMX B;  4ORL A;  3PXM A;  4LEH A;  2HMM B;  4O8S A;  5IF6 A;  1GMP A;  2CX0 A;  5KP4 A;  4H61 A;  4HAA A;  4K1V A;  1FGT A;  1VQK 3;  2CG1 A;  3WA3 A;  3H3H A;  5IW9 A;  1UUG B;  1NU3 A;  1AY7 A;  1LXE A;  1MOL A;  1BNI A;  5BIR A;  5CK6 A;  1AVK A;  1E97 A;  3JUO A;  2W56 A;  2OQE C;  3AMO A;  1RJO A;  2IA7 A;  5BVB A;  4N6N B;  1WMP A;  3X3X A;  1MWR A;  2CWU A;  2Y74 A;  3AGN A;  1OF5 A;  1Z1S A;  1JNQ A;  1F8N A;  1PY3 A;  3Q3F A;  4ZM8 A;  2CK3 H;  2XEP A;  2GEX A;  1JBR A;  1QVG 2;  1RKY A;  3K9M C;  2CG0 A;  4XBT A;  4EV2 A;  2XR8 B;  4RNZ A;  3MSO A;  3RGR A;  4FMB A;  3KE7 A;  1JJ2 2;  2WOF A;  3Q2P A;  5CLK A;  1N5H A;  3FKA A;  1RGF A;  1WNH A;  3E99 A;  4K1U A;  3CXC 2;  2UUG C;  4N6L A;  1A2P A;  1CH0 A;  1HKX A;  1OHP A;  1I2E A;  3B7C A;  4R9K A;  1B2M A;  2QGU A;  1GD4 A;  1RRH A;  2FNQ A;  3DMC A;  1BUJ A;  4BTW A;  5G2G A;  5RNT A;  2HMO B;  2ZHX B;  3ZFZ A;  2OTL 3;  5DRE A;  1TJD A;  3NXJ A;  1UI7 A;  1S5A A;  1BRG A;  3GZR A;  4FCJ A;  4XM4 A;  1BOX A;  1WMO A;  1Q7H A;  4HM8 B;  3N9H A;  1HU9 A;  3NUV A;  1ISK A;  3S28 A;  3PGB A;  1RGA A;  5FW5 A;  2E2V A;  3CPO A;  4HM0 B;  3LTA A;  3GZY B;  1W2B 2;  1OPY A;  1FUS A;  2W9P A;  1FA3 A;  4CPK A;  2OQE A;  1IYY A;  5IG0 A;  2M7O A;  1G02 A;  3FG3 A;  3EF8 A;  5IG5 A;  1GY5 A;  3LT9 A;  1RGE A;  1A90 A;  1YHQ 3;  1NNV A;  2CC3 A;  3NBJ A;  5IG3 A;  1GSP A;  1YVS A;  1EG9 B;  3STD A;  3JUQ A;  1W5Z A;  5KP3 A;  1SPU A;  1FUW A;  4FR9 A;  4STD A;  1IT8 A;  1UI8 A;  1UCL A;  1RN7 A;  1Q42 A;  1LQM B;  2PZV A;  4MMZ B;  2XF3 A;  3PYJ A;  2D1W A;  1AV4 A;  1K41 A;  2B24 B;  3OWU A;  1TRQ A;  5M18 A;  2CH9 A;  3FG4 A;  3KSP A;  1B20 A;  1JN5 A;  1GMR A;  3MKI A;  1WTH A;  3MWZ A;  4BIR A;  4EXR A;  1N8R 4;  5D83 A;  3LTC A;  1ZGX A;  3NQY A;  4KFF A;  4XDV A;  1A2V A;  3SXX A;  5AEU B;  3CNX A;  2K0M A;  2F86 B;  2QEX 3;  1RGC A;  4HM7 B;  4QWT A;  3BIR A;  1IVW A;  3EE1 A;  2IY2 A;  2C4B A;  1WQL B;  1STF I;  3S67 A;  3CCU 3;  1UW1 A;  5CF1 A;  4L7K A;  1UCK A;  1YJW 3;  3T8U A;  3FSD A;  4FCZ A;  1B2S A;  3ZG5 A;  1E3R A;  1MNL A;  3RDE A;  2JQ5 A;  2KCD A;  1JB4 A;  3F40 A;  5IEP A;  1U8C B;  4GSP A;  3WHO A;  2D42 A;  2O3O A;  1BNS A;  4BTY A;  1YVB I;  1QAK A;  1RRL A;  1OUN A;  4NPB A;  3WOD G;  3B8L A;  3I0Y A;  1NDO B;  3LZA A;  1IK3 A;  1GOV A;  1YGE A;  2LYX A;  2XGN A;  4X2O A;  4HM5 B;  1WMN A;  3CNM A;  1I3I A;  2Q07 A;  3K0Z A;  3ER7 A;  3CME 3;  4FCM A;  3NHX A;  1DVC A;  1OH0 A;  1PYL A;  2RBI A;  3Q90 A;  1GOU A;  2XFT A;  1M1X B;  4CJN A;  1BSA A;  2GEY A;  1L5G B;  1R4Y A;  3MPH A;  3B4P A;  3G4S 3;  1ZX2 A;  2BNG A;  5AIH A;  3UL5 A;  1S72 3;  2RSX A;  3F7X A;  5KP1 A;  4I5Q A;  4EBG A;  4AKY A;  1A67 A;  4NRE A;  1YGW A;  1BU4 A;  1JKG A;  1SII A;  5I97 A;  1KC8 4;  1VQQ A;  1VQ8 3;  3IPT A;  1DMN A;  1D6Z A;  2F5M A;  1HYF A;  2RFR A;  3L0R A;  3WA2 X;  1Q82 4;  2SAR A;  4JRF A;  3VF1 A;  4K61 A;  1UGH I;  4BU4 A;  1BRH A;  4FMD A;  3WOE B;  1W00 A;  4N6V 0;  1BRI A;  3I55 3;  2GU3 A;  3NBB A;  3QK9 A;  4O02 B;  4XBY A;  1OCV A;  1B2U A;  1DMQ A;  2KXG A;  4GB5 A;  1SQW A;  8CHO A;  1V57 A;  4WYK A;  5IEN A;  3NM7 A;  4J5K A;  4KVH A;  4U13 A;  2BT3 A;  1O7W B;  1BNE A;  3FZW A;  2C10 A;  3OV4 A;  3UNL A;  2XSH B;  1U5O A;  1SAR A;  3EN1 B;  1M90 4;  3ECF A;  3BNB A;  3PCR A;  4HKV B;  1I0X A;  4HVN A;  4MMY B;  1OHS A;  2WOH A;  1FGR A;  1Q40 A;  2BMQ B;  3NV0 A;  3CMA 3;  2KAA A;  5CXO A;  3D3L A;  1IU7 A;  1QAF A;  3KSE D;  1CQS A;  2YFJ B;  3LH4 A;  4J5G A;  3KKG A;  1YIJ 3;  1IV9 A;  1BRK A;  2CFD A;  2INX A;  1VQ4 3;  3CC4 3;  1BNR A;  3EBT A;  1KWI A;  1O7N B;  1LOV A;  4NHF A;  2Z6B A;  2F5W A;  3MHE A;  4RNT A;  5JPP A;  4R9L A;  3CCE 3;  4IT7 A;  2KF6 A;  1GOY A;  2W03 A;  1TP6 A;  1DMM A;  3OWS A;  1BSB A;  1UDI I;  2E2U A;  1NJI 4;  1VZZ A;  2Y73 A;  3JUM A;  4XBX A;  3Q1C A;  2AAD A;  3PCS A;  4N3V A;  2KRT A;  3DGY A;  1PU4 A;  3F14 A;  3OXA A;  3HI7 A;  1STD A;  1RN1 A;  3CD6 3;  2UX0 A;  1QMA A;  2Z76 A;  3X40 A;  1TFK A;  4DKI A;  2P0X A;  3FF2 A;  4HYZ A;  2GXF A;  2MF7 A;  3JVC A;  1BRJ A;  1TRP A;  3F8H A;  1ROA A;  8RNT A;  1UUW B;  1IQ8 A;  3D9R A;  4RZM A;  2E2T A;  1BNJ A;  3PS8 A;  3S29 A;  2WGO A;  1FGO A;  3DXO A;  1D6U A;  1E3V A;  3PZW A;  3DGL A;  2HMN B;  4HZ9 B;  4O3V A;  4XB5 A;  5TGN A;  1VQ5 3;  3J7Y d;  1CYU A;  1JZD A;  2ML6 A;  5AEW B;  4MJD A;  1KSI A;  1VQL 3;  1OHO A;  3H51 A;  3KZT A;  1VQO 3;  2KF5 A;  3MG2 A;  3V98 A;  3BLZ A;  2CFK A;  2Z7A A;  4R1K A;  2I9W A;  1LVN A;  3LT8 A;  3HOH A;  2YFI B;  4KFD A;  5BXQ A;  1Q86 4;  5AIG A;  1IQY A;  3K7C A;  5EVH A;  4EV5 A;  4CDL A;  3OW2 2;  3UB1 A;  2OTJ 3;  1OAC A;  3GZB A;  3LML A;  4R80 A;  4WHA A;  3WDG B;  1I2F A;  3A5E A;  2OOV C;  5DRV A;  4HM3 B;  1N9J A;  4H3U A;  1QVF 2;  1DVD A;  3F8X A;  1ULJ B;  3FCS B;  1MGW A;  1X1X A;  3LYG A;  4AKZ A;  1I2G A;  1BNF A;  1RCL A;  1RGL A;  3GWR A;  2ML5 A;  3NM2 A;  1W6C A;  3EBY A;  2GU1 A;  3CCL 3;  4HZB B;  4TX4 A;  1W6Y A;  1YJ9 3;  2W6J H;  1TFO A;  3MG3 A;  4AEQ A;  4EC6 A;  1FW7 A;  2AAE A;  2IUJ A;  5BU4 A;  2CW9 A;  3S27 A;  5HOH A;  2IMJ A;  3HIG A;  3SOY A;  6RNT A;  1EEJ A;  3QRD A;  5G1K A;  3BU4 A;  5HGR A;  1Q9E A;  2XRX B;  1BAN A;  2CKF B;  1JBS A;  1O7G B;  3ALA A;  3NQZ A;  3SYU A;  1FYS A;  1W4N A;  4KFE A;  3LTB A;  1FGM A;  1BSE A;  3DUK A;  1RGG A;  3BNC A;  1LNH A;  1GMQ A;  1ASK A;  4KT3 B;  5IG4 A;  1LRA A;  1UUV B;  3S5C A;  3SOA A;  4XDW A;  3ZG0 A;  5GSP A;  5IEO A;  1LNI A;  1SJW A;  5AIF A;  1MWT A;  3T0U A;  1CYV A;  3WOF B;  1KQS 2;  2CIU A;  4LGQ A;  2K3D A;  1UGI A;  1JKG B;  2CHC A;  2V1L A;  1FUT A;  3GZX B;  3HZP A;  2OOV A;  3LXU X;  2MC8 A;  4BL3 A;  1IVX A;  4IIA A;  1VQ7 3;  4EYC A;  1YI2 3;  2ZDJ A;  3LTD A;  1O7P B;  4N6O B;  2SBL A;  1JZO A;  1T5Y A;  3CPW 2;  2BU4 A;  2RGQ A;  2ZL8 A;  1IT7 A;  4HM2 B;  1M9G A;  3DM8 A;  2HMJ B;  1LQG C;  1X1Y A;  1RMS A;  3URP A;  3MYT A;  3M8C A;  1GY7 A;  1QAL A;  4CCV A;  4HBR A;  3DZL A;  3VGN A;  1GD3 A;  1I0V A;  3EX9 A;  2W56 B;  3MG1 A;  4K90 B;  3SVA A;  3AMO B;  3CCQ 3;  2RNT A;  2CFL A;  2R4I A;  1UCI A;  2P09 A;  3IMA B;  3D5I A;  2W0Q A;  1BSC A;  3VSY A;  2BMR B;  2OCT A;  1IDP A;  3U1W A;  3G16 A;  3WR2 A;  1TIJ A;  2P05 A;  1OF5 B;  1B2Z A;  4BTX A;  1VQ9 3;  1BGS A;  1RHL A;  2C11 A;  2IUK A;  4BL2 A;  1NWW A;  1Y4K A;  4WWU C;  4X2H A;  3F9S A;  2R41 A;  1EA2 A;  1G0T A;  1C7H A;  4MEI A;  3X3Z A;  2JDI H;  4I4K A;  4R4K A;  3CC7 3;  4N6U A;  1B2X A;  1IQX A;  1CEW I;  1ULI B;  3KCH A;  4RNY A;  4Q53 A;  3N8B A;  1N8Q A;  1W02 A;  1T3B A;  3FH1 A;  4LSO A;  1RCK A;  1IVV A;  5LC6 A;  1EUI C;  3CCS 3;  3DY5 A;  1TU5 A;  6STD A;  1BSD A;  3U97 A;  3CCJ 3;  1MWU A;  1IV7 A;  3B4O A;  4EW5 A;  3UL6 A;  5AII A;  3X42 A;  1W01 A;  1ROV A;  1LOW A;  1RSN A;  1YNV X;  1BUQ A;  3EHC A;  3BND A;  3EQQ B;  2H0H A;  4WFO A;  2F98 A;  3CC2 3;  1FGQ A;  2O9U X;  3V92 A;  2FGT A;  1IVU A;  3DGO A;  3KN4 A;  2CWT A;  4IPB A;  1C54 A;  4LZI A;  3EJV A;  3G71 3;  1EKM A;  5AYS C;  4GL6 A;  4HJL B;  1ZS7 A;  3EN8 A;  2CWV A;  1VQ6 3;  1R4C A;  3V99 A;  3EC9 A;  1I8V A;  4HM6 B;  3LOY A;  2QA4 3;  5STD A;  4KZ1 A;  4ILF A;  1NB3 I;  2RCD A;  3NX0 A;  4RBN A;  3F7S A;  7STD A;  9RNT A;  3BB9 A;  2HML B;  1MGR A;  3DGN A;  3SED A;  3GSP A;  4N6M A;  3D79 A;  1JN5 B;  1MWS A;  1X1U A;  3G8Z A;  3UJM A;  1Q81 4;  3CU3 A;  1AVL A;  1DYU A;  3NBR A;  1LOY A;  1T2H A;  2H0I A;  2OWP A;  3HII A;  1VQP 3;  4FMC A;  3T8N A;  1G96 A;  5ELJ A;  6GSP A;  1EQK A;  1GYB A;  1O7H B;  5CF2 A;  3AHS A;  2L1S A;  3FG1 A;  1VQM 3;  2J8X B;  4HM4 B;  1TUH A;  2QIY A;  1JV2 B;  2F99 A;  3RNT A;  1I3F A;  4OUQ A;  2GSP A;  3K63 A;  5D81 A;  4LMI A;  5D82 A;  1W2Z A;  2UGI A;  1T2I A;  4G1M B;  1YIT 3;  5JBS A;  1BVI A;  3BNE A;  1V74 A;  2P38 A;  3FLJ A;  1DET A;  1OGX A;  2XSO B;  1O7M B;  3FGY A;  2H0G A;  5EQL A;  4JF8 A;  3N54 B;  2BIR A;  2LQV A;  1RNT A;  3JUN A;  4N6T A;  3SLU A;  1K8A 4;  5LC7 A;  5ELU A;  5AYR B;  2CFW A;  2WGQ A;  3DGM A;  2BO9 B;  1B27 A;  3HK4 A;  1X1W A;  1K28 A;  2XFS A;  2YX9 A;  4PEJ A;  3AHW A;  4GHO A;  2W2C A;  2XGL A;  1UCJ A;  3FF0 A;  1KD1 4;  1RN4 A;  1K9M 4;  1J2B A;  5EEO A;  2ZA4 A;  2F4Y A;  1HZ1 A;  3KFQ C;  1AR0 A;  4L8O A;  2IYJ A;  4WP5 A;  3X3Y A;  3CCM 3;  1US1 A;  2F56 A;  1W7C A;  3GRD A;  3HX8 A;  2BMO B;  2HOH A;  1V58 A;  2PNC A;  1RNB A;  1BAO A;  3CCR 3;  4HM1 B;  3OX9 A;  3TDG A;  2W04 A;  2YFL B;  3G6E 3;  1LOX A;  1DE3 A;  3KII A;  1SIH A;  3WMD A;  3D5G A;  1RGH A;  1I70 A;  1RGK A;  3A76 A;  1QJG A;  4FMA A;  2GBX B;  3ROB A;  7GSP A;  1FZU A;  2CX1 A;  3G0K A;  4L8P A;  2KF4 A;  4J8T A;  4LYL B;  1JB5 A;  1A2K A;  1TTO A;  2A15 A;  1M1K 4;  4OVM A;  7RNT A;  3AGO A;  5M19 A;  4J9A A;  1AQZ A;  3SX1 A;  5FGO A;  2GBW B;  1N9E A;  1JRQ A;  1BRS A;  1K73 4;  1NB5 I;  2W9Q A;  2STD A;  3DH2 A;  1JBT A;  3GAX A;  3EB8 A;  4O2H A;  4HOH A;  1Q7Y 4;  5A0O B;  3O8Y A;  1D6Y A;  2KF3 A;  4WYK B;  1VQN 3;  1PFP A;  2K54 A;  5M1A A;  1W6G A;  3JUP A;  2CFG A;  3I56 3;  3RGA A;  1N5P A;  2WO0 A;  1B21 A;  1JB2 A;  3K5T A;  1GS3 A;  1RDS A;  1RLS A;  5IER A;  3IJE B;  2FXT A;  2HMK B;  1RTU A;  2Z77 A;  5AI1 A;  1OGZ A;  5JPU A;  1Q40 B;  1BIR A;  2XH9 A;  3NV0 B;  4OK0 A;  3X41 A;  1BRN L;  5G1L A;  2B1X B;  1YJN 3;  1ZO2 A;  3D4A A;  3OWY A;  2L4V A;  1GY6 A;  2P0M A;  1B3S A;  3CCV 3; 
#chains in the Genus database with same CATH homology
 1BNG A;  1GOV A;  1C54 A;  1GMP A;  1I3I A;  1I2F A;  3A5E A;  4HAA A;  1PYL A;  2RBI A;  1AY7 A;  1GOU A;  1I8V A;  1BNI A;  5BIR A;  1BSA A;  1MGW A;  1X1X A;  1I2G A;  1BNF A;  1RCL A;  1RGL A;  1R4Y A;  9RNT A;  1MGR A;  3AGN A;  3GSP A;  1FW7 A;  1X1U A;  1YGW A;  1BU4 A;  1PY3 A;  3Q3F A;  2AAE A;  5BU4 A;  5HOH A;  1JBR A;  1LOY A;  1T2H A;  6RNT A;  2F5M A;  1HYF A;  3BU4 A;  2SAR A;  1Q9E A;  1BAN A;  6GSP A;  1JBS A;  3AHS A;  4BU4 A;  3SYU A;  1FYS A;  1BRH A;  1BRI A;  1RGF A;  1BSE A;  3RNT A;  1RGG A;  1I3F A;  2GSP A;  1GMQ A;  1A2P A;  1B2U A;  1CH0 A;  1B2M A;  1I2E A;  1LRA A;  1T2I A;  4J5K A;  5GSP A;  1BUJ A;  1BVI A;  1BNE A;  1LNI A;  5RNT A;  1DET A;  1IYY A;  1SAR A;  2BIR A;  1RNT A;  1BRG A;  1BOX A;  1FUT A;  1I0X A;  1B27 A;  1X1W A;  2KAA A;  1RGA A;  3AHW A;  4GHO A;  1UCJ A;  1RN4 A;  4J5G A;  2ZA4 A;  1BRK A;  1FUS A;  2BU4 A;  1HZ1 A;  2F4Y A;  1BNR A;  1LOV A;  2F5W A;  1X1Y A;  1G02 A;  1RMS A;  2F56 A;  4RNT A;  3URP A;  1RGE A;  2KF6 A;  1GOY A;  2HOH A;  1GSP A;  1I0V A;  1YVS A;  1RNB A;  1BAO A;  1BSB A;  1DE3 A;  2RNT A;  1UCI A;  3D5G A;  1UCL A;  3D5I A;  1RGH A;  1BSC A;  1I70 A;  1RGK A;  2AAD A;  3WR2 A;  7GSP A;  3DGY A;  1FZU A;  1B2Z A;  1TRQ A;  1BGS A;  1RN1 A;  2KF4 A;  4BIR A;  1RHL A;  1B20 A;  1GMR A;  1TTO A;  1ZGX A;  7RNT A;  3AGO A;  1BRJ A;  1AQZ A;  1TRP A;  8RNT A;  1BRS A;  1RGC A;  1BNJ A;  1JBT A;  3DH2 A;  3BIR A;  4HOH A;  1B2X A;  3KCH A;  2C4B A;  2KF3 A;  1RCK A;  1UCK A;  1B21 A;  1B2S A;  1BSD A;  1RDS A;  1RLS A;  2KF5 A;  4GSP A;  3WHO A;  1BNS A;  1LOW A;  1RSN A;  1RTU A;  1YNV X;  1BRN L;  1BIR A;  3HOH A;  3D4A A;  1B3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...