1VQP3

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqp300
1Q7Y4 3CC73 1VQO3 3CCR3 1VQ53 1KC84 3CCE3 3G6E3 1YI23 1YJN3 1Q824 3G4S3 1Q814 3I553 1YJW3 3CXC2 3CCJ3 3CCQ3 3I563 3CC23 1QVG2 1VQ43 1VQN3 1N8R4 1YIT3 3CC43 3CCL3 1W2B2 1NJI4 1YJ93 1VQ93 3OW22 1KQS2 1YHQ3 1KD14 1Q864 3CPW2 2QA43 1YIJ3 1M904 1JJ22 2OTJ3 1QVF2 3G713 1VQM3 1S723 1VQ83 1VQK3 1VQP3 1VQ73 2OTL3 3CCU3 2QEX3 1M1K4 1VQ63 3CCS3 1VQL3 1K9M4 3CME3 1K8A4 3CMA3 1K734 3CD63 3CCM3 3CCV3
chains in the Genus database with same CATH superfamily
2SBLA 1WQLB 4LGQA 1BOXA 1R4CA 3EJVA 3KZTA 2GU3A 1JBSA 2RFRA 4EW5A 1IQ8A 2M7OA 3WOFB 2WOHA 4HVNA 4J8TA 2BO9B 1YJW3 1FUSA 3CCQ3 5I97A 1BSAA 2F5WA 5DREA 1O7PB 1UDII 1G96A 2FNQA 3LOYA 3WOEB 2GEYA 5EVHA 2PNCA 4K61A 1LVNA 1KD14 1BIRA 1MGRA 4LSOA 1S723 1IVVA 1TUHA 1TRQA 2O3OA 3UL6A 1IV7A 1M904 4HZ9B 3Q90A 3BNBA 1SIIA 1NO3A 3CMA3 1QAFA 1YNVX 3CCM3 4BTXA 1FUTA 3BIRA 1GOUA 5D81A 4GL6A 4HM2B 3D4AA 3KKGA 3LYGA 3N9HA 1B21A 1W02A 4LYLB 1IVXA 2UX0A 3E99A 5G2GA 3NUVA 1GY5A 5CF1A 1BRHA 3PCRA 3KSED 2CHCA 2E2UA 2RGQA 2GBXB 3F40A 3LT8A 1NB5I 3OWUA 1SJWA 3BB9A 4AKYA 1MWSA 2W56B 2XH9A 1TJDA 3Q1CA 1BRJA 1DMMA 1F8NA 2HMOB 2ML5A 2WGOA 3JUOA 4HOHA 1FUWA 1U8CB 2IYJA 1K8A4 1J2BA 3UB1A 2CX1A 1MWTA 3WMDA 3LTBA 4CJNA 1B20A 3AHSA 3OXAA 4BTWA 3LXUX 1UCJA 4I4KA 3FH1A 2CX0A 1S5AA 4LMIA 4STDA 1T2IA 3CCJ3 3DGNA 1EKMA 3HK4A 4CCVA 1O7HB 2P09A 4U13A 3MG3A 4R4KA 1RRLA 2J8XB 5KP3A 5BXQA 2GBWB 1I0XA 1U5OA 1D6ZA 2F86B 1NB3I 5G1LA 3L0RA 5DRVA 1RNBA 1ZO2A 2AAEA 1JZOA 3EBYA 4L8PA 4NPBA 3ZG0A 3U1WA 1N5PA 1JB4A 2L1SA 1Q42A 4CDLA 1VQ73 1VQ63 3CPOA 1AR0A 3FZWA 3ECFA 1I70A 2P0XA 1A67A 4OVMA 1UCKA 4NREA 1BNIA 8RNTA 1TP6A 1LQMB 2LYXA 4HBRA 5IG3A 2Q07A 2W03A 3MG2A 1N5HA 4IT7A 4JRFA 1OGXA 2XGLA 1Q7HA 1AV4A 4FMBA 2IMJA 2B1XB 4R9LA 2CIUA 1NDOB 1IDPA 1ZX2A 1PFPA 2MF7A 3VGNA 1W4NA 2BIRA 1BGSA 1G02A 3CC23 1GD3A 1B2XA 2BNGA 2ZDJA 1UI8A 3MHEA 2YFJB 3GZYB 3B4PA 1PYLA 5BIRA 1KQS2 3SEDA 1Q40A 1A2VA 2CC3A 1GOYA 1LRAA 2IUJA 6RNTA 1MGWA 3CNXA 2GEXA 1HYFA 1FGTA 3BU4A 1BUQA 3J7Yd 2CFWA 3FLJA 1EA2A 2HOHA 4IPBA 9RNTA 2GSPA 2CWUA 4K1VA 4WP5A 2YFLB 3VF1A 7RNTA 1TU5A 1T3BA 3NXJA 4L8OA 1K41A 5EEOA 4EXRA 1RGAA 2HMNB 1YI23 3X3ZA 1RCLA 4H3UA 4OK0A 4MJDA 2CK3H 2F99A 3D79A 3K0ZA 3LTAA 2OOVC 4RNYA 1EEJA 1VQN3 3LMLA 3X40A 1VQ93 2C4BA 3N8BA 2D42A 2KRTA 3S5CA 3LZAA 1RSNA 1VZZA 8CHOA 3DMCA 3KE7A 3CPW2 3MWZA 1RHLA 3V92A 1MOLA 1BANA 3Q2PA 5ELUA 4RNTA 3CCU3 2CG0A 1I2FA 5TGNA 2C11A 3A76A 3LT9A 7STDA 4LZIA 1Q814 5LC6A 3AGNA 1ZGXA 4EV5A 4WYKA 1Q9EA 3HZPA 1BRNL 1M1XB 3IJEB 2XF3A 2CFKA 1WMPA 3X3YA 1OUNA 1DMNA 3DUKA 3DH2A 4BL3A 2D1WA 3GZRA 4N6LA 2WOFA 3NBRA 4O02B 6GSPA 1DVCA 5D83A 5CLKA 4EYCA 1RMSA 4MEIA 1DVDA 4R9KA 1IT8A 1O7MB 1BNEA 1Q40B 4I5QA 1ROAA 4ZM8A 1BNGA 1RN1A 4XBYA 2CFGA 3DY5A 3F8HA 1A90A 3BNEA 2Z7AA 3GSPA 2Z76A 2QEX3 4HM6B 4AEQA 1RTUA 1K9M4 2HMMB 5IG0A 4KVHA 1CEWI 2HMKB 3D9RA 3SXXA 1K734 3DM8A 3LH4A 1JN5A 1RKYA 1YVSA 1LNHA 3CC73 1MNLA 1VQ53 1IVWA 2H0GA 1AVKA 1CYVA 1NNVA 2W6JH 3S67A 5KP1A 1UGHI 1W5ZA 2Y74A 2CFLA 3GZXB 3ZFZA 2BU4A 5AEWB 1UW1A 1I3FA 1W01A 3JUMA 3QRDA 1YJ93 3EBTA 5BU4A 3F9SA 1RGCA 2RSXA 4N6V0 1M9GA 2XEPA 1JJ22 1T2HA 3DXOA 3HOHA 3KSPA 1QVF2 1N8QA 2XRXB 2UGIA 3V99A 1TTOA 1VQK3 2I9WA 1BSBA 2KCDA 3SX1A 1OCVA 5IEPA 1X1WA 3GRDA 2JDIH 4H61A 2Z6BA 1KWIA 1E3VA 1G0TA 1OHOA 1A2PA 1VQO3 5IW9A 4KFDA 3FCSB 4XDWA 3S28A 4GHOA 1RGGA 3HI7A 1UUVB 1B2UA 5CK6A 3STDA 2BMOB 1EG9B 3EX9A 2HMLB 5M19A 3AGOA 2KXGA 2W9PA 4HM1B 4IIAA 4RZMA 4XB5A 2BHMA 3D5GA 3M8CA 3T8UA 1IYYA 1GSPA 1IU7A 3B4OA 4O2HA 2KAAA 1I0VA 1LOVA 2WO0A 3EN1B 3DGMA 3WODG 1UUGB 1VQ83 5GSPA 1VQP3 3K63A 1BVIA 3O8YA 1VQL3 3K7CA 1X1UA 2F4YA 1JN5B 1YVBI 2CWVA 3KN4A 1BSDA 3URPA 1JNQA 2CKFB 2W04A 3G6E3 3WA3A 4HJLB 4WHAA 3EHCA 3U97A 1GMRA 1AY7A 7GSPA 1GY7A 2XSHB 4J5KA 4KZ1A 1KSIA 2QGUA 3HIGA 4N6TA 2XFTA 4O8SA 1DE3A 4J9AA 1D6YA 1FGMA 3HX8A 4G1MB 3QK9A 1LOWA 3G8ZA 3KCHA 3SVAA 1TRPA 3CC43 2OOVA 3OW22 3X3XA 1OACA 1SPUA 3NBBA 3OWSA 4N3VA 1SIHA 4K90B 4OUQA 3SYUA 2K54A 1BNJA 2ML6A 2OTL3 1CQSA 1STFI 3I0YA 5LC7A 3DZLA 3CME3 3CD63 1LQGC 5AIFA 1K28A 4HYZA 3EF8A 6STDA 2ZHXB 3HIIA 1WNHA 1TFKA 3FKAA 2BT3A 5EQLA 3CCE3 1E3RA 2WGQA 4XDVA 5HOHA 2F5MA 3I553 1RN4A 2H0HA 3F7SA 4KFFA 1BRIA 2W9QA 4X2OA 4GB5A 4AKZA 2ZL8A 1NJI4 5STDA 4MMYB 1Y4KA 3KIIA 3VSYA 5IG4A 1CYUA 4EV2A 4J5GA 4N6OB 3RGRA 1BRKA 3MG1A 1RN7A 1ISKA 3ER7A 3CNMA 4RNZA 1ULJB 4FCZA 1B2SA 3LTDA 3WDGB 4LEHA 3ROBA 4EC6A 3PCSA 1YGEA 4FMCA 4EBGA 1BRGA 1GOVA 3PXMA 5AYRB 1O7WB 1FYSA 5A0OB 5IG5A 3G16A 4XBTA 3MSOA 4L7KA 2FXTA 2FGTA 1V57A 3F14A 1QVG2 3WA2X 1AVLA 2YFIB 4HZBB 1W6GA 3EB8A 1YIT3 1JKGA 3NBJA 1JBTA 1W7CA 1JB5A 1ULIB 1W2ZA 5KP4A 3H3HA 1OF5A 4DKIA 1A2KA 1PU4A 1X1XA 3FG4A 1OPYA 4HM4B 5IEOA 5IF6A 1D6UA 1PY3A 2OWPA 3DGOA 2RNTA 2CWTA 2XR8B 1W2B2 2BMRB 2CH9A 1YGWA 1O7NB 3G0KA 1B2MA 1OHPA 1RCKA 5AIGA 4WWUC 2CG1A 3UNLA 1L5GB 3BLZA 1JZDA 2Y73A 3IMAB 2K3DA 3FF0A 5HGRA 1YJN3 3NV0A 5D82A 1RGFA 2RCDA 4BU4A 2INXA 3JUQA 4BTYA 3NM7A 3SOAA 1AQZA 1FW7A 2IY2A 1HZ1A 1NWWA 2W2CA 3F7XA 3KFQC 3GZBA 4PEJA 3X42A 5RNTA 1GS3A 3OX9A 1LXEA 4R80A 2BMQB 3WR2A 5M18A 2IUKA 3CCL3 1DMQA 3X41A 1UGIA 1BNFA 1YIJ3 1FA3A 3K5TA 3G713 1I2EA 2F98A 1OGZA 1IQXA 2E2TA 3BNCA 1ROVA 1W6YA 4FMDA 1R4YA 3MYTA 1FZUA 3T8NA 3PYJA 4WYKB 3UJMA 1JRQA 4JF8A 1IV9A 1MWUA 4ILFA 3MPHA 1N9JA 1IT7A 1GYBA 1GD4A 2OCTA 3OWYA 3RNTA 1B2ZA 2F56A 1DETA 5M1AA 2RBIA 4TX4A 4BL2A 4MMXB 1C7HA 5ELJA 3GAXA 1VQQA 1T5YA 1JKGB 1RGLA 2AADA 5IENA 1BU4A 1QAKA 1OF5B 4XBXA 1BNSA 5IERA 4HM0B 3JVCA 1YHQ3 1BSCA 1HKXA 3NM2A 2XGNA 1WTHA 1W6CA 3ALAA 3PZWA 1STDA 3NHXA 4X2HA 5AIHA 1GMPA 5FGOA 1RJOA 1NU3A 4HAAA 2HMJB 4R1KA 3S29A 4ORLA 4WFOA 1EQKA 3NX0A 1C54A 2QIYA 1I8VA 2PZVA 1RGHA 3Q3FA 4Q53A 3CCV3 1UI7A 1EUIC 2P38A 2SARA 4FR9A 1FGOA 4N6UA 2LQVA 3NV0B 3EQQB 1BRSA 3NQZA 4CPKA 3S27A 1WMOA 2Z77A 4N6MA 4BIRA 1X1YA 1UCIA 1E97A 2XSOB 2E2VA 4QWTA 1MWRA 3AMOA 2MC8A 4N6NB 3EC9A 3I563 1CH0A 3B7CA 2R41A 3UL5A 2KF5A 4HM5B 5AIIA 2XFSA 3A5EA 2CW9A 2GU1A 4GSPA 3PGBA 3EN8A 1WMNA 4HM3B 1LOXA 2OQEA 3RGAA 3F8XA 2KF3A 2ZA4A 3DGLA 1M1K4 3CU3A 3CCS3 1B27A 2L4VA 1IQYA 4HM7B 4KFEA 1JBRA 2R4IA 3DGYA 3OV4A 1Z1SA 1I2GA 3JUNA 4HM8B 1QALA 3RDEA 3CCR3 1KC84 4K1UA 3K9MC 4KT3B 1FGQA 1V74A 3B8LA 1BAOA 3FF2A 2JQ5A 2GXFA 2O9UX 1RDSA 2P0MA 4O3VA 3D3LA 3PS8A 1SQWA 2A15A 3FG1A 3EE1A 5BVBA 1RLSA 2P05A 2OQEC 1RGEA 3JUPA 1BSEA 2QA43 1O7GB 2KF4A 3T0UA 1IK3A 1VQM3 1OH0A 2STDA 1QMAA 2YX9A 1BNRA 1IVUA 5JPUA 2K0MA 5CF2A 3H51A 3IPTA 1GY6A 3TDGA 5AI1A 1Q864 1RRHA 3NQYA 3BNDA 1Q7Y4 1W00A 1UUWB 1JB2A 4HKVB 2V1LA 3ZG5A 3SLUA 2C10A 1GMQA 2H0IA 2IA7A 3N54B 1Q824 3FGYA 3G4S3 4MMZB 3AMOB 1LOYA 1N9EA 1UCLA 3SOYA 3CXC2 2W0QA 1VQ43 1B3SA 1TIJA 1ZS7A 1DYUA 4FMAA 1TFOA 1N8R4 1RGKA 3D5IA 5FW5A 3GWRA 1JV2B 3AHWA 2KF6A 3FG3A 5JPPA 5CXOA 1FGRA 4XM4A 3FSDA 2OTJ3 1BUJA 4NHFA 1OHSA 1I3IA 1V58A 2W56A 3LTCA 1HU9A 5AYSC 5JBSA 2UUGC 2CFDA 4FCJA 5AEUB 1US1A 1SARA 4FCMA 3WHOA 1QJGA 1RNTA 5G1KA 3V98A 2B24B 1LNIA 4RBNA 3MKIA 1ASKA
chains in the Genus database with same CATH topology
2SBLA 1WQLB 4LGQA 1R4CA 3EJVA 3KZTA 2GU3A 2RFRA 1IQ8A 2M7OA 3WOFB 2WOHA 4HVNA 4J8TA 2BO9B 1YJW3 3CCQ3 5I97A 5DREA 1O7PB 1G96A 2FNQA 3LOYA 3WOEB 2GEYA 5EVHA 2PNCA 4K61A 1LVNA 1KD14 4LSOA 1S723 1IVVA 1TUHA 2O3OA 3UL6A 1IV7A 4HZ9B 3Q90A 3BNBA 1SIIA 1NO3A 3CMA3 1QAFA 3CCM3 4BTXA 5D81A 4GL6A 4HM2B 3LYGA 3KKGA 3N9HA 1W02A 1IVXA 2UX0A 3E99A 5G2GA 3NUVA 1GY5A 5CF1A 3PCRA 3KSED 2CHCA 2E2UA 2RGQA 2GBXB 3F40A 3LT8A 1NB5I 3OWUA 1SJWA 3BB9A 4AKYA 2W56B 2XH9A 3Q1CA 1DMMA 1F8NA 2HMOB 2ML5A 2WGOA 3JUOA 1FUWA 1U8CB 1K8A4 1J2BA 3UB1A 3WMDA 3LTBA 3OXAA 4BTWA 3LXUX 4I4KA 3FH1A 4LMIA 1S5AA 4STDA 3CCJ3 3DGNA 1EKMA 3HK4A 4CCVA 1O7HB 2P09A 4U13A 3MG3A 4R4KA 1RRLA 5BXQA 5KP3A 2GBWB 1U5OA 1D6ZA 2F86B 1NB3I 3L0RA 5DRVA 1ZO2A 3EBYA 4L8PA 4CDLA 1VQ73 3U1WA 1N5PA 1JB4A 1Q42A 1VQ63 3CPOA 1AR0A 3FZWA 3ECFA 2P0XA 1A67A 4OVMA 4NREA 1TP6A 4HBRA 2LYXA 5IG3A 2Q07A 2W03A 3MG2A 1N5HA 4IT7A 4JRFA 1OGXA 2XGLA 1AV4A 4FMBA 2IMJA 2B1XB 4R9LA 2CIUA 1NDOB 1IDPA 1ZX2A 1PFPA 2MF7A 3VGNA 1W4NA 3CC23 1GD3A 2BNGA 2ZDJA 1UI8A 3MHEA 2YFJB 3GZYB 3B4PA 1KQS2 3SEDA 1Q40A 1A2VA 2CC3A 2IUJA 3CNXA 2GEXA 1FGTA 1BUQA 3J7Yd 2CFWA 3FLJA 1EA2A 4IPBA 2CWUA 4K1VA 4WP5A 2YFLB 3VF1A 1TU5A 3NXJA 4L8OA 1K41A 5EEOA 4EXRA 2HMNB 1YI23 3X3ZA 4H3UA 4OK0A 4MJDA 2CK3H 2F99A 3LTAA 3K0ZA 4RNYA 2OOVC 1VQN3 3LMLA 3X40A 1VQ93 3N8BA 2D42A 2KRTA 3S5CA 3LZAA 1VZZA 8CHOA 3DMCA 3KE7A 3CPW2 3MWZA 3V92A 1MOLA 3Q2PA 5ELUA 3CCU3 2CG0A 5TGNA 2C11A 3A76A 3LT9A 7STDA 4LZIA 1Q814 5LC6A 4EV5A 4WYKA 3HZPA 1M1XB 3IJEB 2XF3A 2CFKA 1WMPA 3X3YA 1OUNA 1DMNA 3DUKA 2D1WA 3GZRA 4N6LA 2WOFA 3NBRA 4O02B 1DVCA 5D83A 5CLKA 4EYCA 4MEIA 1DVDA 4R9KA 1IT8A 1O7MB 1Q40B 1ROAA 4ZM8A 4XBYA 2CFGA 3DY5A 3F8HA 1A90A 3BNEA 2Z7AA 2Z76A 2QEX3 4HM6B 4AEQA 1K9M4 2HMMB 5IG0A 4KVHA 1CEWI 2HMKB 3D9RA 3SXXA 1K734 3DM8A 3LH4A 1JN5A 1RKYA 1LNHA 3CC73 1MNLA 1VQ53 1IVWA 1AVKA 1CYVA 2W6JH 3S67A 5KP1A 1W5ZA 2Y74A 2CFLA 3GZXB 5AEWB 1UW1A 1W01A 3JUMA 3QRDA 1YJ93 3EBTA 3F9SA 2RSXA 4N6V0 1M9GA 2XEPA 1JJ22 3DXOA 3KSPA 1QVF2 1N8QA 2XRXB 3V99A 1VQK3 2I9WA 2KCDA 3SX1A 1OCVA 5IEPA 3GRDA 2JDIH 4H61A 2Z6BA 1KWIA 1E3VA 1OHOA 1VQO3 5IW9A 4KFDA 3FCSB 4XDWA 3S28A 3HI7A 1UUVB 5CK6A 3STDA 2BMOB 1EG9B 3EX9A 2HMLB 2KXGA 2W9PA 4HM1B 4IIAA 4RZMA 4XB5A 2BHMA 3T8UA 3M8CA 1IU7A 3B4OA 4O2HA 2WO0A 3EN1B 3DGMA 3WODG 1VQ83 1VQP3 3K63A 3O8YA 1VQL3 3K7CA 1JN5B 1YVBI 2CWVA 3KN4A 1JNQA 2W04A 2CKFB 3G6E3 3WA3A 4HJLB 4WHAA 3EHCA 3U97A 1GY7A 2XSHB 4KZ1A 1KSIA 2QGUA 3HIGA 4N6TA 2XFTA 4O8SA 4J9AA 1D6YA 1FGMA 3HX8A 4G1MB 3QK9A 3G8ZA 3SVAA 3CC43 2OOVA 3OW22 3X3XA 1OACA 1SPUA 3NBBA 3OWSA 4N3VA 1SIHA 4K90B 4OUQA 2K54A 2ML6A 2OTL3 1CQSA 1STFI 3I0YA 5LC7A 3DZLA 3CME3 3CD63 5AIFA 1K28A 4HYZA 3EF8A 6STDA 3HIIA 1WNHA 1TFKA 3FKAA 2BT3A 5EQLA 3CCE3 1E3RA 2WGQA 4XDVA 3I553 3F7SA 4KFFA 2W9QA 4X2OA 4GB5A 4AKZA 2ZL8A 1NJI4 5STDA 4MMYB 1Y4KA 3KIIA 3VSYA 5IG4A 1CYUA 4EV2A 4N6OB 3RGRA 3MG1A 1RN7A 1ISKA 3ER7A 3CNMA 4RNZA 1ULJB 4FCZA 3LTDA 3WDGB 4LEHA 3ROBA 4EC6A 3PCSA 1YGEA 4FMCA 4EBGA 3PXMA 5AYRB 1O7WB 5A0OB 5IG5A 3G16A 4XBTA 3MSOA 4L7KA 2FXTA 2FGTA 3F14A 1QVG2 3WA2X 1AVLA 2YFIB 4HZBB 1W6GA 3EB8A 1YIT3 1JKGA 3NBJA 1W7CA 1JB5A 1ULIB 1W2ZA 5KP4A 3H3HA 1OF5A 1A2KA 1PU4A 3FG4A 1OPYA 4HM4B 5IEOA 5IF6A 1D6UA 2OWPA 3DGOA 2CWTA 2XR8B 1W2B2 2BMRB 2CH9A 1O7NB 3G0KA 1OHPA 5AIGA 2CG1A 4WWUC 3UNLA 1L5GB 3BLZA 2Y73A 3IMAB 3FF0A 1YJN3 5HGRA 3NV0A 5D82A 2RCDA 4BTYA 2INXA 3JUQA 3NM7A 3SOAA 2W2CA 3F7XA 1NWWA 3X42A 3KFQC 4PEJA 3GZBA 1GS3A 3OX9A 1LXEA 4R80A 2BMQB 3CCL3 2IUKA 1DMQA 3X41A 1YIJ3 1FA3A 3K5TA 3G713 2F98A 1OGZA 1IQXA 2E2TA 3BNCA 1ROVA 1W6YA 4FMDA 3MYTA 3T8NA 3PYJA 4WYKB 3UJMA 1JRQA 4JF8A 1IV9A 3MPHA 1N9JA 1IT7A 1GYBA 1GD4A 2OCTA 3OWYA 4TX4A 4MMXB 1C7HA 5ELJA 3GAXA 1T5YA 1JKGB 5IENA 1QAKA 1OF5B 4XBXA 5IERA 4HM0B 3JVCA 1YHQ3 1HKXA 3NM2A 2XGNA 1WTHA 1W6CA 3ALAA 3PZWA 1STDA 3NHXA 4X2HA 5AIHA 5FGOA 1RJOA 1NU3A 2HMJB 4R1KA 3S29A 4ORLA 4WFOA 1EQKA 3NX0A 2QIYA 4Q53A 2PZVA 3CCV3 1UI7A 2P38A 4FR9A 1FGOA 4N6UA 2LQVA 3NV0B 3EQQB 3NQZA 3S27A 1WMOA 2Z77A 4N6MA 1E97A 2XSOB 2E2VA 4QWTA 3AMOA 2MC8A 4N6NB 3EC9A 3I563 3B7CA 3UL5A 4HM5B 5AIIA 2XFSA 2CW9A 2GU1A 3PGBA 3EN8A 1WMNA 4HM3B 1LOXA 2OQEA 3RGAA 3F8XA 3DGLA 1M1K4 3CU3A 3CCS3 2L4VA 1IQYA 4HM7B 4KFEA 2R4IA 3OV4A 1Z1SA 3JUNA 4HM8B 1QALA 3RDEA 3CCR3 1KC84 4K1UA 3K9MC 1FGQA 1V74A 3B8LA 3FF2A 2JQ5A 2GXFA 2O9UX 4O3VA 2P0MA 3D3LA 3PS8A 1SQWA 2A15A 3FG1A 3EE1A 5BVBA 2P05A 2OQEC 3JUPA 2QA43 1O7GB 3T0UA 1VQM3 1IK3A 1OH0A 2STDA 1QMAA 2YX9A 1IVUA 5JPUA 2K0MA 5CF2A 3H51A 3IPTA 1GY6A 3TDGA 5AI1A 1Q864 1RRHA 3NQYA 3BNDA 1Q7Y4 1W00A 1UUWB 1JB2A 4HKVB 2V1LA 3SLUA 2C10A 3N54B 2IA7A 1Q824 3FGYA 3G4S3 4MMZB 3AMOB 1N9EA 3SOYA 3CXC2 2W0QA 1VQ43 1TIJA 4FMAA 1DYUA 1TFOA 1N8R4 5FW5A 3GWRA 1JV2B 5JPPA 3FG3A 5CXOA 1FGRA 4XM4A 3FSDA 2OTJ3 4NHFA 1OHSA 5AYSC 3LTCA 2W56A 5JBSA 1HU9A 1M904 2CFDA 4FCJA 5AEUB 1US1A 4FCMA 1QJGA 3V98A 2B24B 4RBNA 3MKIA 1ASKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y 4;  3CC7 3;  1VQO 3;  3CCR 3;  1VQ5 3;  1KC8 4;  3CCE 3;  3G6E 3;  1YI2 3;  1YJN 3;  1Q82 4;  3G4S 3;  1Q81 4;  3I55 3;  1YJW 3;  3CXC 2;  3CCJ 3;  3CCQ 3;  3I56 3;  3CC2 3;  1QVG 2;  1VQ4 3;  1VQN 3;  1N8R 4;  1YIT 3;  3CC4 3;  3CCL 3;  1W2B 2;  1NJI 4;  1YJ9 3;  1VQ9 3;  3OW2 2;  1KQS 2;  1YHQ 3;  1KD1 4;  1Q86 4;  3CPW 2;  2QA4 3;  1YIJ 3;  1M90 4;  1JJ2 2;  2OTJ 3;  1QVF 2;  3G71 3;  1VQM 3;  1S72 3;  1VQ8 3;  1VQK 3;  1VQP 3;  1VQ7 3;  2OTL 3;  3CCU 3;  2QEX 3;  1M1K 4;  1VQ6 3;  3CCS 3;  1VQL 3;  1K9M 4;  3CME 3;  1K8A 4;  3CMA 3;  1K73 4;  3CD6 3;  3CCM 3;  3CCV 3; 
#chains in the Genus database with same CATH topology
 2SBL A;  1WQL B;  4LGQ A;  1BOX A;  1R4C A;  3EJV A;  3KZT A;  2GU3 A;  1JBS A;  2RFR A;  4EW5 A;  1IQ8 A;  2M7O A;  3WOF B;  2WOH A;  4HVN A;  4J8T A;  2BO9 B;  1YJW 3;  1FUS A;  3CCQ 3;  5I97 A;  1BSA A;  2F5W A;  5DRE A;  1O7P B;  1UDI I;  1G96 A;  2FNQ A;  3LOY A;  3WOE B;  2GEY A;  5EVH A;  2PNC A;  4K61 A;  1LVN A;  1KD1 4;  1BIR A;  1MGR A;  4LSO A;  1S72 3;  1IVV A;  1TUH A;  1TRQ A;  2O3O A;  3UL6 A;  1IV7 A;  1M90 4;  4HZ9 B;  3Q90 A;  3BNB A;  1SII A;  1NO3 A;  3CMA 3;  1QAF A;  1YNV X;  3CCM 3;  4BTX A;  1FUT A;  3BIR A;  1GOU A;  5D81 A;  4GL6 A;  4HM2 B;  3D4A A;  3KKG A;  3LYG A;  3N9H A;  1B21 A;  1W02 A;  4LYL B;  1IVX A;  2UX0 A;  3E99 A;  5G2G A;  3NUV A;  1GY5 A;  5CF1 A;  1BRH A;  3PCR A;  3KSE D;  2CHC A;  2E2U A;  2RGQ A;  2GBX B;  3F40 A;  3LT8 A;  1NB5 I;  3OWU A;  1SJW A;  3BB9 A;  4AKY A;  1MWS A;  2W56 B;  2XH9 A;  1TJD A;  3Q1C A;  1BRJ A;  1DMM A;  1F8N A;  2HMO B;  2ML5 A;  2WGO A;  3JUO A;  4HOH A;  1FUW A;  1U8C B;  2IYJ A;  1K8A 4;  1J2B A;  3UB1 A;  2CX1 A;  1MWT A;  3WMD A;  3LTB A;  4CJN A;  1B20 A;  3AHS A;  3OXA A;  4BTW A;  3LXU X;  1UCJ A;  4I4K A;  3FH1 A;  2CX0 A;  1S5A A;  4LMI A;  4STD A;  1T2I A;  3CCJ 3;  3DGN A;  1EKM A;  3HK4 A;  4CCV A;  1O7H B;  2P09 A;  4U13 A;  3MG3 A;  4R4K A;  1RRL A;  2J8X B;  5KP3 A;  5BXQ A;  2GBW B;  1I0X A;  1U5O A;  1D6Z A;  2F86 B;  1NB3 I;  5G1L A;  3L0R A;  5DRV A;  1RNB A;  1ZO2 A;  2AAE A;  1JZO A;  3EBY A;  4L8P A;  4NPB A;  3ZG0 A;  3U1W A;  1N5P A;  1JB4 A;  2L1S A;  1Q42 A;  4CDL A;  1VQ7 3;  1VQ6 3;  3CPO A;  1AR0 A;  3FZW A;  3ECF A;  1I70 A;  2P0X A;  1A67 A;  4OVM A;  1UCK A;  4NRE A;  1BNI A;  8RNT A;  1TP6 A;  1LQM B;  2LYX A;  4HBR A;  5IG3 A;  2Q07 A;  2W03 A;  3MG2 A;  1N5H A;  4IT7 A;  4JRF A;  1OGX A;  2XGL A;  1Q7H A;  1AV4 A;  4FMB A;  2IMJ A;  2B1X B;  4R9L A;  2CIU A;  1NDO B;  1IDP A;  1ZX2 A;  1PFP A;  2MF7 A;  3VGN A;  1W4N A;  2BIR A;  1BGS A;  1G02 A;  3CC2 3;  1GD3 A;  1B2X A;  2BNG A;  2ZDJ A;  1UI8 A;  3MHE A;  2YFJ B;  3GZY B;  3B4P A;  1PYL A;  5BIR A;  1KQS 2;  3SED A;  1Q40 A;  1A2V A;  2CC3 A;  1GOY A;  1LRA A;  2IUJ A;  6RNT A;  1MGW A;  3CNX A;  2GEX A;  1HYF A;  1FGT A;  3BU4 A;  1BUQ A;  3J7Y d;  2CFW A;  3FLJ A;  1EA2 A;  2HOH A;  4IPB A;  9RNT A;  2GSP A;  2CWU A;  4K1V A;  4WP5 A;  2YFL B;  3VF1 A;  7RNT A;  1TU5 A;  1T3B A;  3NXJ A;  4L8O A;  1K41 A;  5EEO A;  4EXR A;  1RGA A;  2HMN B;  1YI2 3;  3X3Z A;  1RCL A;  4H3U A;  4OK0 A;  4MJD A;  2CK3 H;  2F99 A;  3D79 A;  3K0Z A;  3LTA A;  2OOV C;  4RNY A;  1EEJ A;  1VQN 3;  3LML A;  3X40 A;  1VQ9 3;  2C4B A;  3N8B A;  2D42 A;  2KRT A;  3S5C A;  3LZA A;  1RSN A;  1VZZ A;  8CHO A;  3DMC A;  3KE7 A;  3CPW 2;  3MWZ A;  1RHL A;  3V92 A;  1MOL A;  1BAN A;  3Q2P A;  5ELU A;  4RNT A;  3CCU 3;  2CG0 A;  1I2F A;  5TGN A;  2C11 A;  3A76 A;  3LT9 A;  7STD A;  4LZI A;  1Q81 4;  5LC6 A;  3AGN A;  1ZGX A;  4EV5 A;  4WYK A;  1Q9E A;  3HZP A;  1BRN L;  1M1X B;  3IJE B;  2XF3 A;  2CFK A;  1WMP A;  3X3Y A;  1OUN A;  1DMN A;  3DUK A;  3DH2 A;  4BL3 A;  2D1W A;  3GZR A;  4N6L A;  2WOF A;  3NBR A;  4O02 B;  6GSP A;  1DVC A;  5D83 A;  5CLK A;  4EYC A;  1RMS A;  4MEI A;  1DVD A;  4R9K A;  1IT8 A;  1O7M B;  1BNE A;  1Q40 B;  4I5Q A;  1ROA A;  4ZM8 A;  1BNG A;  1RN1 A;  4XBY A;  2CFG A;  3DY5 A;  3F8H A;  1A90 A;  3BNE A;  2Z7A A;  3GSP A;  2Z76 A;  2QEX 3;  4HM6 B;  4AEQ A;  1RTU A;  1K9M 4;  2HMM B;  5IG0 A;  4KVH A;  1CEW I;  2HMK B;  3D9R A;  3SXX A;  1K73 4;  3DM8 A;  3LH4 A;  1JN5 A;  1RKY A;  1YVS A;  1LNH A;  3CC7 3;  1MNL A;  1VQ5 3;  1IVW A;  2H0G A;  1AVK A;  1CYV A;  1NNV A;  2W6J H;  3S67 A;  5KP1 A;  1UGH I;  1W5Z A;  2Y74 A;  2CFL A;  3GZX B;  3ZFZ A;  2BU4 A;  5AEW B;  1UW1 A;  1I3F A;  1W01 A;  3JUM A;  3QRD A;  1YJ9 3;  3EBT A;  5BU4 A;  3F9S A;  1RGC A;  2RSX A;  4N6V 0;  1M9G A;  2XEP A;  1JJ2 2;  1T2H A;  3DXO A;  3HOH A;  3KSP A;  1QVF 2;  1N8Q A;  2XRX B;  2UGI A;  3V99 A;  1TTO A;  1VQK 3;  2I9W A;  1BSB A;  2KCD A;  3SX1 A;  1OCV A;  5IEP A;  1X1W A;  3GRD A;  2JDI H;  4H61 A;  2Z6B A;  1KWI A;  1E3V A;  1G0T A;  1OHO A;  1A2P A;  1VQO 3;  5IW9 A;  4KFD A;  3FCS B;  4XDW A;  3S28 A;  4GHO A;  1RGG A;  3HI7 A;  1UUV B;  1B2U A;  5CK6 A;  3STD A;  2BMO B;  1EG9 B;  3EX9 A;  2HML B;  5M19 A;  3AGO A;  2KXG A;  2W9P A;  4HM1 B;  4IIA A;  4RZM A;  4XB5 A;  2BHM A;  3D5G A;  3M8C A;  3T8U A;  1IYY A;  1GSP A;  1IU7 A;  3B4O A;  4O2H A;  2KAA A;  1I0V A;  1LOV A;  2WO0 A;  3EN1 B;  3DGM A;  3WOD G;  1UUG B;  1VQ8 3;  5GSP A;  1VQP 3;  3K63 A;  1BVI A;  3O8Y A;  1VQL 3;  3K7C A;  1X1U A;  2F4Y A;  1JN5 B;  1YVB I;  2CWV A;  3KN4 A;  1BSD A;  3URP A;  1JNQ A;  2CKF B;  2W04 A;  3G6E 3;  3WA3 A;  4HJL B;  4WHA A;  3EHC A;  3U97 A;  1GMR A;  1AY7 A;  7GSP A;  1GY7 A;  2XSH B;  4J5K A;  4KZ1 A;  1KSI A;  2QGU A;  3HIG A;  4N6T A;  2XFT A;  4O8S A;  1DE3 A;  4J9A A;  1D6Y A;  1FGM A;  3HX8 A;  4G1M B;  3QK9 A;  1LOW A;  3G8Z A;  3KCH A;  3SVA A;  1TRP A;  3CC4 3;  2OOV A;  3OW2 2;  3X3X A;  1OAC A;  1SPU A;  3NBB A;  3OWS A;  4N3V A;  1SIH A;  4K90 B;  4OUQ A;  3SYU A;  2K54 A;  1BNJ A;  2ML6 A;  2OTL 3;  1CQS A;  1STF I;  3I0Y A;  5LC7 A;  3DZL A;  3CME 3;  3CD6 3;  1LQG C;  5AIF A;  1K28 A;  4HYZ A;  3EF8 A;  6STD A;  2ZHX B;  3HII A;  1WNH A;  1TFK A;  3FKA A;  2BT3 A;  5EQL A;  3CCE 3;  1E3R A;  2WGQ A;  4XDV A;  5HOH A;  2F5M A;  3I55 3;  1RN4 A;  2H0H A;  3F7S A;  4KFF A;  1BRI A;  2W9Q A;  4X2O A;  4GB5 A;  4AKZ A;  2ZL8 A;  1NJI 4;  5STD A;  4MMY B;  1Y4K A;  3KII A;  3VSY A;  5IG4 A;  1CYU A;  4EV2 A;  4J5G A;  4N6O B;  3RGR A;  1BRK A;  3MG1 A;  1RN7 A;  1ISK A;  3ER7 A;  3CNM A;  4RNZ A;  1ULJ B;  4FCZ A;  1B2S A;  3LTD A;  3WDG B;  4LEH A;  3ROB A;  4EC6 A;  3PCS A;  1YGE A;  4FMC A;  4EBG A;  1BRG A;  1GOV A;  3PXM A;  5AYR B;  1O7W B;  1FYS A;  5A0O B;  5IG5 A;  3G16 A;  4XBT A;  3MSO A;  4L7K A;  2FXT A;  2FGT A;  1V57 A;  3F14 A;  1QVG 2;  3WA2 X;  1AVL A;  2YFI B;  4HZB B;  1W6G A;  3EB8 A;  1YIT 3;  1JKG A;  3NBJ A;  1JBT A;  1W7C A;  1JB5 A;  1ULI B;  1W2Z A;  5KP4 A;  3H3H A;  1OF5 A;  4DKI A;  1A2K A;  1PU4 A;  1X1X A;  3FG4 A;  1OPY A;  4HM4 B;  5IEO A;  5IF6 A;  1D6U A;  1PY3 A;  2OWP A;  3DGO A;  2RNT A;  2CWT A;  2XR8 B;  1W2B 2;  2BMR B;  2CH9 A;  1YGW A;  1O7N B;  3G0K A;  1B2M A;  1OHP A;  1RCK A;  5AIG A;  4WWU C;  2CG1 A;  3UNL A;  1L5G B;  3BLZ A;  1JZD A;  2Y73 A;  3IMA B;  2K3D A;  3FF0 A;  5HGR A;  1YJN 3;  3NV0 A;  5D82 A;  1RGF A;  2RCD A;  4BU4 A;  2INX A;  3JUQ A;  4BTY A;  3NM7 A;  3SOA A;  1AQZ A;  1FW7 A;  2IY2 A;  1HZ1 A;  1NWW A;  2W2C A;  3F7X A;  3KFQ C;  3GZB A;  4PEJ A;  3X42 A;  5RNT A;  1GS3 A;  3OX9 A;  1LXE A;  4R80 A;  2BMQ B;  3WR2 A;  5M18 A;  2IUK A;  3CCL 3;  1DMQ A;  3X41 A;  1UGI A;  1BNF A;  1YIJ 3;  1FA3 A;  3K5T A;  3G71 3;  1I2E A;  2F98 A;  1OGZ A;  1IQX A;  2E2T A;  3BNC A;  1ROV A;  1W6Y A;  4FMD A;  1R4Y A;  3MYT A;  1FZU A;  3T8N A;  3PYJ A;  4WYK B;  3UJM A;  1JRQ A;  4JF8 A;  1IV9 A;  1MWU A;  4ILF A;  3MPH A;  1N9J A;  1IT7 A;  1GYB A;  1GD4 A;  2OCT A;  3OWY A;  3RNT A;  1B2Z A;  2F56 A;  1DET A;  5M1A A;  2RBI A;  4TX4 A;  4BL2 A;  4MMX B;  1C7H A;  5ELJ A;  3GAX A;  1VQQ A;  1T5Y A;  1JKG B;  1RGL A;  2AAD A;  5IEN A;  1BU4 A;  1QAK A;  1OF5 B;  4XBX A;  1BNS A;  5IER A;  4HM0 B;  3JVC A;  1YHQ 3;  1BSC A;  1HKX A;  3NM2 A;  2XGN A;  1WTH A;  1W6C A;  3ALA A;  3PZW A;  1STD A;  3NHX A;  4X2H A;  5AIH A;  1GMP A;  5FGO A;  1RJO A;  1NU3 A;  4HAA A;  2HMJ B;  4R1K A;  3S29 A;  4ORL A;  4WFO A;  1EQK A;  3NX0 A;  1C54 A;  2QIY A;  1I8V A;  2PZV A;  1RGH A;  3Q3F A;  4Q53 A;  3CCV 3;  1UI7 A;  1EUI C;  2P38 A;  2SAR A;  4FR9 A;  1FGO A;  4N6U A;  2LQV A;  3NV0 B;  3EQQ B;  1BRS A;  3NQZ A;  4CPK A;  3S27 A;  1WMO A;  2Z77 A;  4N6M A;  4BIR A;  1X1Y A;  1UCI A;  1E97 A;  2XSO B;  2E2V A;  4QWT A;  1MWR A;  3AMO A;  2MC8 A;  4N6N B;  3EC9 A;  3I56 3;  1CH0 A;  3B7C A;  2R41 A;  3UL5 A;  2KF5 A;  4HM5 B;  5AII A;  2XFS A;  3A5E A;  2CW9 A;  2GU1 A;  4GSP A;  3PGB A;  3EN8 A;  1WMN A;  4HM3 B;  1LOX A;  2OQE A;  3RGA A;  3F8X A;  2KF3 A;  2ZA4 A;  3DGL A;  1M1K 4;  3CU3 A;  3CCS 3;  1B27 A;  2L4V A;  1IQY A;  4HM7 B;  4KFE A;  1JBR A;  2R4I A;  3DGY A;  3OV4 A;  1Z1S A;  1I2G A;  3JUN A;  4HM8 B;  1QAL A;  3RDE A;  3CCR 3;  1KC8 4;  4K1U A;  3K9M C;  4KT3 B;  1FGQ A;  1V74 A;  3B8L A;  1BAO A;  3FF2 A;  2JQ5 A;  2GXF A;  2O9U X;  1RDS A;  2P0M A;  4O3V A;  3D3L A;  3PS8 A;  1SQW A;  2A15 A;  3FG1 A;  3EE1 A;  5BVB A;  1RLS A;  2P05 A;  2OQE C;  1RGE A;  3JUP A;  1BSE A;  2QA4 3;  1O7G B;  2KF4 A;  3T0U A;  1IK3 A;  1VQM 3;  1OH0 A;  2STD A;  1QMA A;  2YX9 A;  1BNR A;  1IVU A;  5JPU A;  2K0M A;  5CF2 A;  3H51 A;  3IPT A;  1GY6 A;  3TDG A;  5AI1 A;  1Q86 4;  1RRH A;  3NQY A;  3BND A;  1Q7Y 4;  1W00 A;  1UUW B;  1JB2 A;  4HKV B;  2V1L A;  3ZG5 A;  3SLU A;  2C10 A;  1GMQ A;  2H0I A;  2IA7 A;  3N54 B;  1Q82 4;  3FGY A;  3G4S 3;  4MMZ B;  3AMO B;  1LOY A;  1N9E A;  1UCL A;  3SOY A;  3CXC 2;  2W0Q A;  1VQ4 3;  1B3S A;  1TIJ A;  1ZS7 A;  1DYU A;  4FMA A;  1TFO A;  1N8R 4;  1RGK A;  3D5I A;  5FW5 A;  3GWR A;  1JV2 B;  3AHW A;  2KF6 A;  3FG3 A;  5JPP A;  5CXO A;  1FGR A;  4XM4 A;  3FSD A;  2OTJ 3;  1BUJ A;  4NHF A;  1OHS A;  1I3I A;  1V58 A;  2W56 A;  3LTC A;  1HU9 A;  5AYS C;  5JBS A;  2UUG C;  2CFD A;  4FCJ A;  5AEU B;  1US1 A;  1SAR A;  4FCM A;  3WHO A;  1QJG A;  1RNT A;  5G1K A;  3V98 A;  2B24 B;  1LNI A;  4RBN A;  3MKI A;  1ASK A; 
#chains in the Genus database with same CATH homology
 2SBL A;  1WQL B;  4LGQ A;  1R4C A;  3EJV A;  3KZT A;  2GU3 A;  2RFR A;  1IQ8 A;  2M7O A;  3WOF B;  2WOH A;  4HVN A;  4J8T A;  2BO9 B;  1YJW 3;  3CCQ 3;  5I97 A;  5DRE A;  1O7P B;  1G96 A;  2FNQ A;  3LOY A;  3WOE B;  2GEY A;  5EVH A;  2PNC A;  4K61 A;  1LVN A;  1KD1 4;  4LSO A;  1S72 3;  1IVV A;  1TUH A;  2O3O A;  3UL6 A;  1IV7 A;  4HZ9 B;  3Q90 A;  3BNB A;  1SII A;  1NO3 A;  3CMA 3;  1QAF A;  3CCM 3;  4BTX A;  5D81 A;  4GL6 A;  4HM2 B;  3LYG A;  3KKG A;  3N9H A;  1W02 A;  1IVX A;  2UX0 A;  3E99 A;  5G2G A;  3NUV A;  1GY5 A;  5CF1 A;  3PCR A;  3KSE D;  2CHC A;  2E2U A;  2RGQ A;  2GBX B;  3F40 A;  3LT8 A;  1NB5 I;  3OWU A;  1SJW A;  3BB9 A;  4AKY A;  2W56 B;  2XH9 A;  3Q1C A;  1DMM A;  1F8N A;  2HMO B;  2ML5 A;  2WGO A;  3JUO A;  1FUW A;  1U8C B;  1K8A 4;  1J2B A;  3UB1 A;  3WMD A;  3LTB A;  3OXA A;  4BTW A;  3LXU X;  4I4K A;  3FH1 A;  4LMI A;  1S5A A;  4STD A;  3CCJ 3;  3DGN A;  1EKM A;  3HK4 A;  4CCV A;  1O7H B;  2P09 A;  4U13 A;  3MG3 A;  4R4K A;  1RRL A;  5BXQ A;  5KP3 A;  2GBW B;  1U5O A;  1D6Z A;  2F86 B;  1NB3 I;  3L0R A;  5DRV A;  1ZO2 A;  3EBY A;  4L8P A;  4CDL A;  1VQ7 3;  3U1W A;  1N5P A;  1JB4 A;  1Q42 A;  1VQ6 3;  3CPO A;  1AR0 A;  3FZW A;  3ECF A;  2P0X A;  1A67 A;  4OVM A;  4NRE A;  1TP6 A;  4HBR A;  2LYX A;  5IG3 A;  2Q07 A;  2W03 A;  3MG2 A;  1N5H A;  4IT7 A;  4JRF A;  1OGX A;  2XGL A;  1AV4 A;  4FMB A;  2IMJ A;  2B1X B;  4R9L A;  2CIU A;  1NDO B;  1IDP A;  1ZX2 A;  1PFP A;  2MF7 A;  3VGN A;  1W4N A;  3CC2 3;  1GD3 A;  2BNG A;  2ZDJ A;  1UI8 A;  3MHE A;  2YFJ B;  3GZY B;  3B4P A;  1KQS 2;  3SED A;  1Q40 A;  1A2V A;  2CC3 A;  2IUJ A;  3CNX A;  2GEX A;  1FGT A;  1BUQ A;  3J7Y d;  2CFW A;  3FLJ A;  1EA2 A;  4IPB A;  2CWU A;  4K1V A;  4WP5 A;  2YFL B;  3VF1 A;  1TU5 A;  3NXJ A;  4L8O A;  1K41 A;  5EEO A;  4EXR A;  2HMN B;  1YI2 3;  3X3Z A;  4H3U A;  4OK0 A;  4MJD A;  2CK3 H;  2F99 A;  3LTA A;  3K0Z A;  4RNY A;  2OOV C;  1VQN 3;  3LML A;  3X40 A;  1VQ9 3;  3N8B A;  2D42 A;  2KRT A;  3S5C A;  3LZA A;  1VZZ A;  8CHO A;  3DMC A;  3KE7 A;  3CPW 2;  3MWZ A;  3V92 A;  1MOL A;  3Q2P A;  5ELU A;  3CCU 3;  2CG0 A;  5TGN A;  2C11 A;  3A76 A;  3LT9 A;  7STD A;  4LZI A;  1Q81 4;  5LC6 A;  4EV5 A;  4WYK A;  3HZP A;  1M1X B;  3IJE B;  2XF3 A;  2CFK A;  1WMP A;  3X3Y A;  1OUN A;  1DMN A;  3DUK A;  2D1W A;  3GZR A;  4N6L A;  2WOF A;  3NBR A;  4O02 B;  1DVC A;  5D83 A;  5CLK A;  4EYC A;  4MEI A;  1DVD A;  4R9K A;  1IT8 A;  1O7M B;  1Q40 B;  1ROA A;  4ZM8 A;  4XBY A;  2CFG A;  3DY5 A;  3F8H A;  1A90 A;  3BNE A;  2Z7A A;  2Z76 A;  2QEX 3;  4HM6 B;  4AEQ A;  1K9M 4;  2HMM B;  5IG0 A;  4KVH A;  1CEW I;  2HMK B;  3D9R A;  3SXX A;  1K73 4;  3DM8 A;  3LH4 A;  1JN5 A;  1RKY A;  1LNH A;  3CC7 3;  1MNL A;  1VQ5 3;  1IVW A;  1AVK A;  1CYV A;  2W6J H;  3S67 A;  5KP1 A;  1W5Z A;  2Y74 A;  2CFL A;  3GZX B;  5AEW B;  1UW1 A;  1W01 A;  3JUM A;  3QRD A;  1YJ9 3;  3EBT A;  3F9S A;  2RSX A;  4N6V 0;  1M9G A;  2XEP A;  1JJ2 2;  3DXO A;  3KSP A;  1QVF 2;  1N8Q A;  2XRX B;  3V99 A;  1VQK 3;  2I9W A;  2KCD A;  3SX1 A;  1OCV A;  5IEP A;  3GRD A;  2JDI H;  4H61 A;  2Z6B A;  1KWI A;  1E3V A;  1OHO A;  1VQO 3;  5IW9 A;  4KFD A;  3FCS B;  4XDW A;  3S28 A;  3HI7 A;  1UUV B;  5CK6 A;  3STD A;  2BMO B;  1EG9 B;  3EX9 A;  2HML B;  2KXG A;  2W9P A;  4HM1 B;  4IIA A;  4RZM A;  4XB5 A;  2BHM A;  3T8U A;  3M8C A;  1IU7 A;  3B4O A;  4O2H A;  2WO0 A;  3EN1 B;  3DGM A;  3WOD G;  1VQ8 3;  1VQP 3;  3K63 A;  3O8Y A;  1VQL 3;  3K7C A;  1JN5 B;  1YVB I;  2CWV A;  3KN4 A;  1JNQ A;  2W04 A;  2CKF B;  3G6E 3;  3WA3 A;  4HJL B;  4WHA A;  3EHC A;  3U97 A;  1GY7 A;  2XSH B;  4KZ1 A;  1KSI A;  2QGU A;  3HIG A;  4N6T A;  2XFT A;  4O8S A;  4J9A A;  1D6Y A;  1FGM A;  3HX8 A;  4G1M B;  3QK9 A;  3G8Z A;  3SVA A;  3CC4 3;  2OOV A;  3OW2 2;  3X3X A;  1OAC A;  1SPU A;  3NBB A;  3OWS A;  4N3V A;  1SIH A;  4K90 B;  4OUQ A;  2K54 A;  2ML6 A;  2OTL 3;  1CQS A;  1STF I;  3I0Y A;  5LC7 A;  3DZL A;  3CME 3;  3CD6 3;  5AIF A;  1K28 A;  4HYZ A;  3EF8 A;  6STD A;  3HII A;  1WNH A;  1TFK A;  3FKA A;  2BT3 A;  5EQL A;  3CCE 3;  1E3R A;  2WGQ A;  4XDV A;  3I55 3;  3F7S A;  4KFF A;  2W9Q A;  4X2O A;  4GB5 A;  4AKZ A;  2ZL8 A;  1NJI 4;  5STD A;  4MMY B;  1Y4K A;  3KII A;  3VSY A;  5IG4 A;  1CYU A;  4EV2 A;  4N6O B;  3RGR A;  3MG1 A;  1RN7 A;  1ISK A;  3ER7 A;  3CNM A;  4RNZ A;  1ULJ B;  4FCZ A;  3LTD A;  3WDG B;  4LEH A;  3ROB A;  4EC6 A;  3PCS A;  1YGE A;  4FMC A;  4EBG A;  3PXM A;  5AYR B;  1O7W B;  5A0O B;  5IG5 A;  3G16 A;  4XBT A;  3MSO A;  4L7K A;  2FXT A;  2FGT A;  3F14 A;  1QVG 2;  3WA2 X;  1AVL A;  2YFI B;  4HZB B;  1W6G A;  3EB8 A;  1YIT 3;  1JKG A;  3NBJ A;  1W7C A;  1JB5 A;  1ULI B;  1W2Z A;  5KP4 A;  3H3H A;  1OF5 A;  1A2K A;  1PU4 A;  3FG4 A;  1OPY A;  4HM4 B;  5IEO A;  5IF6 A;  1D6U A;  2OWP A;  3DGO A;  2CWT A;  2XR8 B;  1W2B 2;  2BMR B;  2CH9 A;  1O7N B;  3G0K A;  1OHP A;  5AIG A;  2CG1 A;  4WWU C;  3UNL A;  1L5G B;  3BLZ A;  2Y73 A;  3IMA B;  3FF0 A;  1YJN 3;  5HGR A;  3NV0 A;  5D82 A;  2RCD A;  4BTY A;  2INX A;  3JUQ A;  3NM7 A;  3SOA A;  2W2C A;  3F7X A;  1NWW A;  3X42 A;  3KFQ C;  4PEJ A;  3GZB A;  1GS3 A;  3OX9 A;  1LXE A;  4R80 A;  2BMQ B;  3CCL 3;  2IUK A;  1DMQ A;  3X41 A;  1YIJ 3;  1FA3 A;  3K5T A;  3G71 3;  2F98 A;  1OGZ A;  1IQX A;  2E2T A;  3BNC A;  1ROV A;  1W6Y A;  4FMD A;  3MYT A;  3T8N A;  3PYJ A;  4WYK B;  3UJM A;  1JRQ A;  4JF8 A;  1IV9 A;  3MPH A;  1N9J A;  1IT7 A;  1GYB A;  1GD4 A;  2OCT A;  3OWY A;  4TX4 A;  4MMX B;  1C7H A;  5ELJ A;  3GAX A;  1T5Y A;  1JKG B;  5IEN A;  1QAK A;  1OF5 B;  4XBX A;  5IER A;  4HM0 B;  3JVC A;  1YHQ 3;  1HKX A;  3NM2 A;  2XGN A;  1WTH A;  1W6C A;  3ALA A;  3PZW A;  1STD A;  3NHX A;  4X2H A;  5AIH A;  5FGO A;  1RJO A;  1NU3 A;  2HMJ B;  4R1K A;  3S29 A;  4ORL A;  4WFO A;  1EQK A;  3NX0 A;  2QIY A;  4Q53 A;  2PZV A;  3CCV 3;  1UI7 A;  2P38 A;  4FR9 A;  1FGO A;  4N6U A;  2LQV A;  3NV0 B;  3EQQ B;  3NQZ A;  3S27 A;  1WMO A;  2Z77 A;  4N6M A;  1E97 A;  2XSO B;  2E2V A;  4QWT A;  3AMO A;  2MC8 A;  4N6N B;  3EC9 A;  3I56 3;  3B7C A;  3UL5 A;  4HM5 B;  5AII A;  2XFS A;  2CW9 A;  2GU1 A;  3PGB A;  3EN8 A;  1WMN A;  4HM3 B;  1LOX A;  2OQE A;  3RGA A;  3F8X A;  3DGL A;  1M1K 4;  3CU3 A;  3CCS 3;  2L4V A;  1IQY A;  4HM7 B;  4KFE A;  2R4I A;  3OV4 A;  1Z1S A;  3JUN A;  4HM8 B;  1QAL A;  3RDE A;  3CCR 3;  1KC8 4;  4K1U A;  3K9M C;  1FGQ A;  1V74 A;  3B8L A;  3FF2 A;  2JQ5 A;  2GXF A;  2O9U X;  4O3V A;  2P0M A;  3D3L A;  3PS8 A;  1SQW A;  2A15 A;  3FG1 A;  3EE1 A;  5BVB A;  2P05 A;  2OQE C;  3JUP A;  2QA4 3;  1O7G B;  3T0U A;  1VQM 3;  1IK3 A;  1OH0 A;  2STD A;  1QMA A;  2YX9 A;  1IVU A;  5JPU A;  2K0M A;  5CF2 A;  3H51 A;  3IPT A;  1GY6 A;  3TDG A;  5AI1 A;  1Q86 4;  1RRH A;  3NQY A;  3BND A;  1Q7Y 4;  1W00 A;  1UUW B;  1JB2 A;  4HKV B;  2V1L A;  3SLU A;  2C10 A;  3N54 B;  2IA7 A;  1Q82 4;  3FGY A;  3G4S 3;  4MMZ B;  3AMO B;  1N9E A;  3SOY A;  3CXC 2;  2W0Q A;  1VQ4 3;  1TIJ A;  4FMA A;  1DYU A;  1TFO A;  1N8R 4;  5FW5 A;  3GWR A;  1JV2 B;  5JPP A;  3FG3 A;  5CXO A;  1FGR A;  4XM4 A;  3FSD A;  2OTJ 3;  4NHF A;  1OHS A;  5AYS C;  3LTC A;  2W56 A;  5JBS A;  1HU9 A;  1M90 4;  2CFD A;  4FCJ A;  5AEU B;  1US1 A;  4FCM A;  1QJG A;  3V98 A;  2B24 B;  4RBN A;  3MKI A;  1ASK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...