2GEXA

Crystal structure of snoal2 a putative hydroxylase from streptomyces nogalater
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
b'STTANKERCLEMVAAWNRWDVSGVVAHWAPDVVHYDDEDKPVSAEEVVRRMNSAVEAFPDLRLDVRSIVGEGDRVMLRITCSATHQGVFMGIAPTGRKVRWTYLEELRFSEAGKVVEHWDVFNFSPLFRDLGVVPDGLKLAAALEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SnoL
publication title Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
total genus 41
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gexA00
2B24B 2BMRB 4HM2B 2I9WA 4HKVB 2QIYA 3GZBA 3JUMA 5AIGA 2CKFB 4LGQA 5IG0A 5BXQA 4KVHA 3S5CA 3DXOA 3UJMA 5D81A 1O7GB 3JUNA 1STDA 3K7CA 3FH1A 3DZLA 1UUWB 1U5OA 3FF2A 4K1UA 1HKXA 1EA2A 3HZPA 3FZWA 4XDWA 3FGYA 4CDLA 1QJGA 5JPPA 5IG5A 3F8XA 3FLJA 3NHXA 3OWUA 5FW5A 3EBTA 2IMJA 4HJLB 3CNXA 1W6YA 3NV0B 1NWWA 3EN8A 3NM2A 3B8LA 4R1KA 2GBXB 3OXAA 3H51A 5IEOA 4MJDA 2XR8B 4GB5A 7STDA 3BB9A 4FCJA 1OH0A 4N3VA 6STDA 1UUVB 3H3HA 4XM4A 1O7HB 4WP5A 3MSOA 1Z1SA 3B4OA 3EBYA 3IPTA 3E99A 3GRDA 3NV0A 3RGRA 2HMKB 1W00A 2STDA 1OHSA 4HM7B 1QMAA 2K54A 2R4IA 3D9RA 1OCVA 4LEHA 5CF1A 1JN5B 1W01A 5AEUB 2GEYA 3VSYA 5DREA 5IG4A 3A76A 4J8TA 5EVHA 2HMMB 1OHPA 1DMNA 2QGUA 4X2OA 3RGAA 3DUKA 1EG9B 5DRVA 3VGNA 1Q40B 1NDOB 2F98A 1S5AA 3WMDA 4L8PA 4HZ9B 1JB5A 1K41A 2F99A 5KP4A 1NU3A 4R9LA 4XB5A 1JN5A 5JPUA 4HZBB 4WYKA 3K0ZA 3FKAA 1JB4A 3HK4A 4HM0B 3OWYA 3GZRA 2BNGA 2XRXB 3F7XA 4XBXA 4OUQA 4LMIA 3SEDA 1TP6A 3MKIA 1GS3A 4Q53A 3MYTA 1Q40A 4PEJA 2BMQB 3G16A 4HM5B 1ISKA 3NXJA 5AI1A 3KKGA 1OGXA 5IERA 3OV4A 8CHOA 2GEXA 1OPYA 4WWUC 4OVMA 3NUVA 2CHCA 2INXA 5HGRA 5G2GA 4XDVA 1GYBA 1BUQA 3FF0A 1AR0A 2HMLB 5AIIA 1C7HA 2F86B 4XBYA 3F40A 4U13A 3MG3A 1SJWA 3I0YA 4L8OA 1ULIB 3OWSA 3B4PA 2W2CA 3GZXB 1Q42A 3ER7A 1ULJB 2YFLB 4J9AA 2PZVA 3G8ZA 2GBWB 2JQ5A 2XSHB 5AIHA 3G0KA 1O7WB 4L7KA 3DMCA 3F7SA 3LZAA 4HM4B 3MHEA 3GZYB 3EX9A 1E97A 3CU3A 3B7CA 3CPOA 2YFIB 3LYGA 5AEWB 2A15A 4WYKB 1OHOA 2YFJB 2BMOB 2HMJB 5CLKA 4IIAA 2GXFA 3M8CA 3EQQB 3T8UA 3EC9A 2XSOB 1DMQA 1W02A 3F9SA 1OUNA 4RZMA 3EF8A 4HM3B 4I4KA 3MG2A 3F8HA 2Z77A 3JUPA 2UX0A 3BLZA 1VZZA 1CQSA 5IF6A 4K1VA 1ASKA 3SOYA 1TUHA 2HMNB 5KP1A 3DM8A 2B1XB 1ZX2A 3SOAA 1WQLB 2Z76A 1O7PB 5AIFA 2OWPA 1GY7A 5IENA 2Z7AA 3ROBA 5CK6A 1DMMA 1ZO2A 4HM8B 1GY5A 1JKGB 4HVNA 3FSDA 1E3RA 3CNMA 3KZTA 3MG1A 4FCMA 1O7NB 1OF5B 3F14A 4HM1B 5IG3A 4ORLA 3HX8A 3GWRA 1O7MB 5D82A 4HM6B 3EHCA 1OGZA 2RGQA 3T8NA 5STDA 2RCDA 4X2HA 5IEPA 5TGNA 3UNLA 3KSPA 1JKGA 3ECFA 2RFRA 3KE7A 3JUQA 3OX9A 3JUOA 5D83A 3STDA 1OF5A 1A2KA 5KP3A 4H3UA 4STDA 1JB2A 3EN1B 3Q90A 1GY6A 5CF2A 5CXOA 3EJVA 4XBTA 5BVBA 1E3VA 1IDPA 4R9KA 2HMOB 3NBRA
chains in the Genus database with same CATH superfamily
3BNDA 4GL6A 2ZHXB 1DYUA 2SBLA 3UB1A 1FGTA 2B24B 2BMRB 4HM2B 2I9WA 1I3FA 4HKVB 2QIYA 3GZBA 2CFGA 3JUMA 5AIGA 1YJ93 5M18A 2CKFB 3NBBA 2C11A 2E2UA 4LGQA 5IG0A 4N6V0 3UL5A 1GMRA 5BXQA 3OW22 4KVHA 1UGHI 2KF6A 3RNTA 3CME3 8RNTA 3S5CA 1KSIA 1RN1A 2KF5A 1TU5A 1K734 2H0HA 4LSOA 5G1LA 3DXOA 3UJMA 1IYYA 1FZUA 1RHLA 5D81A 1O7GB 1CYVA 3S27A 2P05A 1W2ZA 3JUNA 1X1UA 1YJN3 3A5EA 5AYSC 2OTL3 4G1MB 1STDA 3CCR3 3K7CA 3FH1A 3LT9A 3DZLA 1VQP3 2IUJA 4AEQA 3VF1A 4BL3A 1UUWB 1RGLA 1U5OA 3LTBA 2RBIA 1LXEA 3MWZA 3FF2A 2R41A 1BNFA 1HYFA 4K1UA 1HKXA 1EA2A 3HZPA 3CCE3 1B3SA 1EKMA 3FZWA 1UI8A 4XDWA 1JRQA 1RMSA 3PYJA 3WA2X 3FGYA 1MNLA 1K8A4 3KN4A 1YVBI 4CDLA 1BRJA 3D5GA 5A0OB 5FGOA 2MF7A 1QJGA 3BIRA 5JPPA 3L0RA 4MMZB 2RNTA 5IG5A 1EQKA 3F8XA 3FLJA 3NHXA 1A2VA 3OWUA 1ROVA 3S28A 2XEPA 3QK9A 1RN4A 4JF8A 3AGNA 2LYXA 1RSNA 5FW5A 1GD3A 3PZWA 3MPHA 3EBTA 1FGQA 2IMJA 5GSPA 4HJLB 1RGKA 1LOWA 3CC73 3CNXA 1W6YA 1IVVA 2C10A 4AKZA 1LOVA 2FXTA 1FUWA 4MMYB 1R4CA 5M1AA 1FYSA 3NV0B 1NWWA 3EN8A 3PXMA 1J2BA 1JBSA 4LZIA 3NM2A 1FUSA 3B8LA 3FG1A 4R1KA 2GBXB 1STFI 4WFOA 3OXAA 1VQQA 3H51A 2LQVA 4MJDA 5IEOA 2GU3A 2XR8B 2Y74A 1DETA 1WMNA 3X3ZA 3CCJ3 4K61A 2K3DA 4GB5A 3LT8A 5G1KA 7STDA 5HOHA 3BB9A 2KF3A 1RCLA 2CFLA 2CX0A 3AHWA 1BSAA 4FCJA 2P0MA 1OH0A 4N3VA 1VQ43 2ML5A 6STDA 1M1XB 1SARA 3U97A 1UUVB 1I2FA 2ML6A 3H3HA 4XM4A 3CCU3 1VQM3 2Z6BA 2YX9A 3DGOA 1BNEA 3V92A 3FCSB 3LTDA 4ILFA 5IW9A 1O7HB 2CWVA 5EEOA 4WP5A 3MSOA 4BU4A 1VQ63 1ZGXA 1JZDA 1Z1SA 2BU4A 3B4OA 1MGWA 2CG0A 2KRTA 2XFTA 3EBYA 4NHFA 3WDGB 3I563 1G0TA 2CC3A 5ELJA 1IK3A 3HIIA 4HAAA 1JNQA 3E99A 3IPTA 4FR9A 1RJOA 2OQEC 3KCHA 2WOHA 3GRDA 4EBGA 2BHMA 4EV2A 2O3OA 1BOXA 1B2ZA 1I70A 3NV0A 1JBRA 2XGNA 1A67A 3RGRA 2HMKB 3CXC2 2FGTA 2D42A 4EC6A 1UUGB 5BU4A 1BSBA 1W00A 1LOYA 2STDA 1I2EA 2F56A 1OHSA 2ZA4A 3NX0A 4HM7B 3G4S3 1D6ZA 1UCJA 1T5YA 2IA7A 3PGBA 4RNYA 3SXXA 1Q824 3SVAA 1LRAA 1RGGA 1QMAA 2K54A 2R4IA 3D9RA 1WMPA 1GOUA 2E2TA 4O2HA 4J5KA 1OCVA 3K5TA 1MOLA 4LEHA 5CF1A 1JN5B 1U8CB 3WR2A 1W01A 3CCV3 5AEUB 2GEYA 3VSYA 1DVCA 1G96A 1I3IA 4WHAA 5DREA 3TDGA 4RNTA 4ZM8A 5IG4A 1X1XA 3A76A 4J8TA 3ZG5A 3BNEA 5EVHA 1RGEA 3HOHA 1B2UA 3URPA 2HMMB 1OHPA 1DMNA 2QGUA 1F8NA 4X2OA 3RGAA 1FUTA 3DUKA 5AYRB 1EG9B 1KWIA 1QALA 3GAXA 5DRVA 3V99A 7GSPA 3VGNA 2Y73A 2RSXA 1Q40B 2UUGC 4O8SA 3G6E3 1MGRA 2SARA 3U1WA 1NDOB 1TFKA 1WTHA 2F98A 3O8YA 1M1K4 1S5AA 1ZS7A 3WMDA 3X42A 3LTCA 4L8PA 4HZ9B 1W6CA 1JB5A 1K41A 2F99A 2CWUA 5KP4A 1VQ83 4FMBA 2JDIH 1NU3A 1BANA 5BIRA 4R9LA 4XB5A 2GSPA 5LC7A 2XGLA 3WHOA 2H0IA 3RDEA 1JN5A 5JPUA 4BL2A 1WNHA 3Q1CA 4HZBB 4IPBA 4J5GA 3S29A 4WYKA 3K0ZA 3FKAA 3CCQ3 1JB4A 1RGFA 1RNBA 3HK4A 1GMPA 4HM0B 3OWYA 3J7Yd 3X40A 2KF4A 3GZRA 4MMXB 1PU4A 1BRNL 2BNGA 2H0GA 3HIGA 2XRXB 3F7XA 4XBXA 4OUQA 1QAKA 1BRIA 6RNTA 4LMIA 1MWTA 4FMCA 3SEDA 1B20A 1TP6A 3MKIA 1GS3A 2CG1A 4Q53A 3MYTA 1X1YA 3X41A 2E2VA 2KAAA 1Q40A 2XFSA 1KQS2 4EW5A 1PY3A 3NQYA 4NPBA 4PEJA 4R4KA 2BMQB 3G16A 4HM5B 1I0XA 1KD14 4O3VA 2Q07A 1ISKA 3NXJA 2P38A 2P09A 5AI1A 1PFPA 4LYLB 3KKGA 1AQZA 1OGXA 4AKYA 1CH0A 1RCKA 3X3XA 5IERA 3HI7A 2CFKA 3OV4A 8CHOA 2GEXA 3LH4A 2KCDA 3DGMA 1OPYA 1AV4A 1HU9A 2BIRA 2F5WA 2W0QA 3KFQC 4WWUC 1A2PA 2W9QA 2W04A 4OVMA 3NUVA 2CHCA 2L4VA 2INXA 5HGRA 4DKIA 5G2GA 3CC23 3S67A 2F4YA 1T3BA 1SIHA 1N9EA 1RGAA 3DGLA 4FCZA 4XDVA 3G713 1GYBA 1MWRA 1BUQA 2OOVA 3FF0A 1AR0A 1I8VA 1N5PA 2HMLB 4GSPA 1C7HA 4I5QA 2F86B 1ROAA 4XBYA 1X1WA 3F40A 1NB3I 5AIIA 3CCS3 3GSPA 4N6MA 1FW7A 4U13A 1QAFA 3DY5A 1BRKA 2WOFA 3MG3A 1FGMA 1I2GA 1SJWA 3N8BA 1RGHA 1UCKA 3I0YA 4L8OA 4BTXA 1ULIB 3OWSA 3FG4A 1VQ93 1EUIC 3B4PA 2W2CA 1B2SA 2ZDJA 3GZXB 2WGQA 2QA43 3ZG0A 1GOVA 1Q42A 1IT8A 4H61A 3AMOB 3ER7A 3N54B 1TJDA 1ULJB 2YFLB 2P0XA 4J9AA 1IVXA 3BU4A 2PZVA 3PCSA 3G8ZA 4EV5A 2GBWB 3D79A 1BVIA 2JQ5A 3N9HA 2XSHB 4O02B 1N5HA 3G0KA 1O7WB 4L7KA 5AIHA 3SLUA 3LMLA 3DMCA 4CJNA 1W2B2 1VQO3 3K63A 4EYCA 3F7SA 1K28A 3KIIA 1TRQA 1BNJA 3LZAA 3IMAB 4HM4B 3ALAA 1YGEA 1YI23 4QWTA 9RNTA 1W4NA 3MHEA 3GZYB 2KXGA 3EX9A 1E97A 1Y4KA 3CU3A 1BGSA 3B7CA 1FGOA 3DGYA 3V98A 3CPOA 1LNHA 2YFIB 1B2MA 2CK3H 2CW9A 1AVLA 1BU4A 1W5ZA 2M7OA 1TRPA 3LYGA 1YIJ3 5AEWB 2A15A 4WYKB 1IQ8A 1OHOA 1AVKA 2YFJB 1DVDA 3AMOA 2WO0A 2D1WA 4N6UA 2O9UX 1BSDA 1S723 1VQL3 3AGOA 2BMOB 1RGCA 2HMJB 4CPKA 1IV9A 7RNTA 2W9PA 5CLKA 3D3LA 4IIAA 1BUJA 1BSEA 3CCL3 1V74A 2F5MA 3K9MC 3DH2A 2CFDA 1FA3A 1MWSA 1BNIA 4RBNA 4EXRA 2GXFA 1N9JA 1Q9EA 1RKYA 1JV2B 1DE3A 3M8CA 3EQQB 3T8UA 3EC9A 1NJI4 1KC84 2XSOB 1K9M4 1BRHA 1IV7A 2ZL8A 1DMQA 5JBSA 2BT3A 3ZFZA 1W02A 3F9SA 1OUNA 4RZMA 1IT7A 3EF8A 4HM3B 4I4KA 2HOHA 3EB8A 1FGRA 3MG2A 3NM7A 3F8HA 3WODG 2Z77A 1OACA 5ELUA 1TFOA 1US1A 3LTAA 2CIUA 1N8R4 3JUPA 1A90A 1IQYA 3D4AA 2UX0A 3BLZA 1VZZA 1YNVX 1CQSA 3LOYA 1SPUA 2AADA 1RNTA 4K1VA 1ASKA 3SOYA 3SX1A 5IF6A 1TUHA 1Q7HA 2HMNB 4N6OB 5KP1A 1QVF2 3DM8A 1PYLA 4BTWA 1LQGC 1YVSA 3IJEB 2QEX3 4OK0A 1R4YA 1I0VA 2J8XB 1JBTA 4FMAA 2W56B 1YGWA 2B1XB 1IU7A 1ZX2A 2AAEA 3BNBA 3PS8A 1L5GB 3LXUX 3SOAA 4BTYA 1WQLB 1B27A 2Z76A 1CEWI 1JJ22 1LOXA 1CYUA 1BNRA 4IT7A 2C4BA 1C54A 1O7PB 2CH9A 1BNGA 1WMOA 5AIFA 1V58A 2OWPA 1GMQA 4N6LA 2K0MA 2CX1A 4HOHA 4HBRA 1W7CA 3I553 3KSED 1IVUA 3WOFB 4NREA 1LNIA 2W6JH 3CPW2 1GY7A 5IENA 5I97A 2MC8A 1B21A 2Z7AA 1LVNA 4KFEA 4R80A 1G02A 1IVWA 3ROBA 2W03A 5CK6A 1GD4A 1DMMA 1ZO2A 4HM8B 1GY5A 1MWUA 1JKGB 2CWTA 4HVNA 2OQEA 1SIIA 1E3RA 1HZ1A 1LQMB 3CNMA 3FSDA 4GHOA 4JRFA 1Q864 3KZTA 4MEIA 1D6YA 5LC6A 1RN7A 2OCTA 3MG1A 4KFDA 1NB5I 3FG3A 4FCMA 1BAOA 1BIRA 1UCLA 3CD63 3BNCA 1RRLA 2PNCA 2W56A 1O7NB 1OF5B 2UGIA 2GU1A 3F14A 4HYZA 4HM1B 1NNVA 2XH9A 3EE1A 4TX4A 1JZOA 1VQN3 5IG3A 1T2HA 4ORLA 3HX8A 3GWRA 1QVG2 1O7MB 1RDSA 5D82A 3SYUA 6GSPA 1W6GA 4HM6B 3EHCA 1Q7Y4 1SQWA 1OGZA 2RGQA 3X3YA 3T8NA 1YJW3 5STDA 1RTUA 3CCM3 5RNTA 1M9GA 1IQXA 3WOEB 2RCDA 2WGOA 4K90B 3WA3A 1B2XA 1UI7A 4X2HA 5IEPA 4RNZA 1RLSA 5TGNA 5EQLA 3UNLA 4BIRA 1D6UA 3Q3FA 2BO9B 3KSPA 2L1SA 2V1LA 3NQZA 1JKGA 3ECFA 2OTJ3 2RFRA 3KE7A 1BNSA 1N8QA 2IYJA 4KT3B 2OOVC 3JUQA 3OX9A 2XF3A 4N6NB 1GSPA 3QRDA 3CC43 3CMA3 1V57A 2IUKA 1YIT3 3JUOA 5D83A 1YHQ3 1TTOA 3STDA 4CCVA 1OF5A 1A2KA 1RRHA 2IY2A 5KP3A 4H3UA 1M904 3UL6A 4STDA 1Q814 1JB2A 1UW1A 3D5IA 1BRSA 5M19A 1UCIA 3EN1B 3AHSA 1BRGA 1GOYA 3PCRA 3Q90A 1EEJA 1VQK3 1GY6A 1UGIA 3DGNA 5CXOA 1AY7A 3NBJA 4KFFA 3EJVA 5CF2A 4XBTA 1T2IA 1NO3A 4KZ1A 3JVCA 5BVBA 1TIJA 1BSCA 1E3VA 2CFWA 4N6TA 3Q2PA 3T0UA 1IDPA 4R9KA 2HMOB 2FNQA 1VQ53 1VQ73 3NBRA 4FMDA 1UDII
chains in the Genus database with same CATH topology
3BNDA 4GL6A 1DYUA 2SBLA 3UB1A 1FGTA 2B24B 2BMRB 4HM2B 2I9WA 4HKVB 2QIYA 3GZBA 2CFGA 3JUMA 5AIGA 1YJ93 2CKFB 3NBBA 2C11A 2E2UA 4LGQA 5IG0A 4N6V0 3UL5A 5BXQA 3OW22 4KVHA 3CME3 3S5CA 1KSIA 1TU5A 1K734 4LSOA 3DXOA 3UJMA 5D81A 1O7GB 1CYVA 3S27A 2P05A 1W2ZA 3JUNA 1YJN3 5AYSC 2OTL3 4G1MB 1STDA 3CCR3 3K7CA 3FH1A 3LT9A 3DZLA 1VQP3 2IUJA 4AEQA 3VF1A 1UUWB 1U5OA 3LTBA 1LXEA 3MWZA 3FF2A 4K1UA 1HKXA 1EA2A 3HZPA 3CCE3 1EKMA 3FZWA 1UI8A 4XDWA 1JRQA 3PYJA 3WA2X 3FGYA 1MNLA 1K8A4 3KN4A 1YVBI 4CDLA 5A0OB 5FGOA 2MF7A 1QJGA 5JPPA 3L0RA 4MMZB 5IG5A 1EQKA 3F8XA 3FLJA 3NHXA 1A2VA 3OWUA 1ROVA 3S28A 2XEPA 3QK9A 4JF8A 2LYXA 5FW5A 1GD3A 3PZWA 3MPHA 3EBTA 1FGQA 2IMJA 4HJLB 3CC73 3CNXA 1W6YA 1IVVA 2C10A 4AKZA 2FXTA 1FUWA 4MMYB 1R4CA 3PXMA 3NV0B 1NWWA 3EN8A 1J2BA 4LZIA 3NM2A 3B8LA 4R1KA 3FG1A 2GBXB 1STFI 4WFOA 3OXAA 3H51A 2LQVA 4MJDA 5IEOA 2GU3A 2XR8B 2Y74A 3X3ZA 1WMNA 3CCJ3 4K61A 4GB5A 3LT8A 7STDA 3BB9A 2CFLA 4FCJA 2P0MA 1OH0A 4N3VA 1VQ43 2ML5A 6STDA 1M1XB 3U97A 1UUVB 3CCU3 2ML6A 3H3HA 4XM4A 1VQM3 2Z6BA 2YX9A 3DGOA 3V92A 3FCSB 3LTDA 5IW9A 1O7HB 2CWVA 5EEOA 4WP5A 3MSOA 1VQ63 1Z1SA 3B4OA 4NHFA 3EBYA 2KRTA 2CG0A 2XFTA 3WDGB 3I563 2CC3A 5ELJA 1IK3A 3HIIA 1JNQA 3E99A 3IPTA 4FR9A 1RJOA 2OQEC 2WOHA 3GRDA 4EBGA 2BHMA 4EV2A 2O3OA 3NV0A 2XGNA 1A67A 3RGRA 2HMKB 3CXC2 2FGTA 2D42A 4EC6A 1W00A 2STDA 3G4S3 1OHSA 3NX0A 4HM7B 1D6ZA 1T5YA 2IA7A 3PGBA 4RNYA 3SXXA 1Q824 3SVAA 1QMAA 2K54A 2R4IA 3D9RA 1WMPA 2E2TA 4O2HA 1OCVA 3K5TA 1MOLA 4LEHA 5CF1A 1JN5B 1U8CB 1W01A 3CCV3 5AEUB 2GEYA 3VSYA 1DVCA 1G96A 4WHAA 5DREA 3TDGA 4ZM8A 5IG4A 3A76A 4J8TA 3BNEA 5EVHA 2HMMB 1OHPA 1DMNA 2QGUA 1F8NA 4X2OA 3RGAA 3DUKA 5AYRB 1EG9B 1KWIA 1QALA 3GAXA 5DRVA 3V99A 3VGNA 2Y73A 2RSXA 1Q40B 4O8SA 3G6E3 3U1WA 1NDOB 1TFKA 1WTHA 2F98A 3O8YA 1M1K4 1S5AA 3WMDA 3X42A 3LTCA 4L8PA 4HZ9B 1W6CA 1JB5A 1K41A 2F99A 2CWUA 5KP4A 1VQ83 4FMBA 2JDIH 1NU3A 4R9LA 4XB5A 5LC7A 2XGLA 3RDEA 1JN5A 5JPUA 1WNHA 3Q1CA 4HZBB 4IPBA 3S29A 4WYKA 3K0ZA 3FKAA 3CCQ3 1JB4A 3HK4A 4HM0B 3OWYA 3J7Yd 3X40A 3GZRA 4MMXB 1PU4A 2BNGA 3HIGA 2XRXB 3F7XA 4XBXA 4OUQA 1QAKA 4LMIA 4FMCA 3SEDA 1TP6A 3MKIA 1GS3A 2CG1A 4Q53A 3MYTA 3X41A 2E2VA 2XFSA 1Q40A 1KQS2 3NQYA 4PEJA 4R4KA 2BMQB 3G16A 4HM5B 1KD14 4O3VA 2Q07A 1ISKA 3NXJA 2P38A 2P09A 5AI1A 1PFPA 3KKGA 1OGXA 4AKYA 3X3XA 5IERA 3HI7A 2CFKA 3OV4A 8CHOA 2GEXA 3LH4A 2KCDA 3DGMA 1OPYA 1AV4A 1HU9A 2W0QA 3KFQC 4WWUC 2W9QA 2W04A 4OVMA 3NUVA 2CHCA 2L4VA 2INXA 5HGRA 5G2GA 3S67A 1SIHA 3CC23 1N9EA 3DGLA 4FCZA 4XDVA 3G713 1GYBA 1BUQA 2OOVA 3FF0A 1AR0A 1N5PA 2HMLB 5AIIA 1C7HA 2F86B 1ROAA 4XBYA 3F40A 3CCS3 1NB3I 4N6MA 4U13A 1QAFA 3DY5A 2WOFA 3MG3A 1FGMA 1SJWA 3N8BA 3I0YA 4L8OA 4BTXA 1ULIB 3OWSA 3FG4A 1VQ93 3B4PA 2W2CA 3GZXB 2ZDJA 2WGQA 2QA43 1Q42A 1IT8A 4H61A 3AMOB 3ER7A 3N54B 1ULJB 2YFLB 2P0XA 4J9AA 1IVXA 2PZVA 3PCSA 3G8ZA 4EV5A 2GBWB 4O02B 2JQ5A 3N9HA 2XSHB 3SLUA 1N5HA 3G0KA 1O7WB 4L7KA 5AIHA 1W2B2 3LMLA 3DMCA 1VQO3 3K63A 4EYCA 3F7SA 1K28A 3KIIA 3LZAA 4HM4B 3IMAB 3ALAA 1YGEA 1YI23 4QWTA 1W4NA 3MHEA 3GZYB 2KXGA 3EX9A 1E97A 1Y4KA 3CU3A 3B7CA 1FGOA 3V98A 3CPOA 1LNHA 2YFIB 2CK3H 2CW9A 1AVLA 1W5ZA 2M7OA 3LYGA 1YIJ3 5AEWB 2A15A 4WYKB 1IQ8A 1OHOA 1AVKA 2YFJB 1DVDA 3AMOA 2WO0A 2D1WA 4N6UA 2O9UX 1S723 1VQL3 2BMOB 2HMJB 1IV9A 2W9PA 5CLKA 3D3LA 4IIAA 3CCL3 1V74A 3K9MC 2CFDA 1FA3A 4RBNA 4EXRA 2GXFA 1N9JA 1RKYA 1JV2B 3M8CA 3EQQB 3T8UA 3EC9A 1NJI4 1KC84 2XSOB 1K9M4 1IV7A 2ZL8A 1DMQA 5JBSA 2BT3A 1W02A 3F9SA 1OUNA 4RZMA 1IT7A 3EF8A 4HM3B 4I4KA 3EB8A 1FGRA 3MG2A 3NM7A 3F8HA 3WODG 2Z77A 1OACA 5ELUA 1TFOA 1US1A 3LTAA 2CIUA 1N8R4 3JUPA 1A90A 1IQYA 2UX0A 3BLZA 1VZZA 1CQSA 3LOYA 1SPUA 3SX1A 4K1VA 5IF6A 1ASKA 3SOYA 1TUHA 2HMNB 4N6OB 5KP1A 1QVF2 3DM8A 4BTWA 3IJEB 2QEX3 4OK0A 4FMAA 2W56B 2B1XB 1IU7A 1ZX2A 3BNBA 3PS8A 1L5GB 3SOAA 3LXUX 4BTYA 1WQLB 2Z76A 1CEWI 1JJ22 1LOXA 1CYUA 4IT7A 1O7PB 2CH9A 1WMOA 5AIFA 2OWPA 4N6LA 2K0MA 4HBRA 1W7CA 3I553 3KSED 1IVUA 3WOFB 4NREA 2W6JH 3CPW2 1GY7A 5IENA 5I97A 2MC8A 2Z7AA 1LVNA 4KFEA 4R80A 1IVWA 3ROBA 2W03A 5CK6A 1GD4A 1DMMA 1ZO2A 4HM8B 1GY5A 1JKGB 2CWTA 4HVNA 2OQEA 1SIIA 1E3RA 3FSDA 3CNMA 4JRFA 1Q864 3KZTA 4MEIA 1D6YA 5LC6A 1RN7A 2OCTA 3MG1A 4KFDA 1NB5I 3FG3A 4FCMA 3CD63 3BNCA 1RRLA 2PNCA 2W56A 1O7NB 1OF5B 3F14A 2GU1A 4HYZA 4HM1B 2XH9A 4TX4A 3EE1A 1VQN3 5IG3A 1QVG2 4ORLA 3HX8A 3GWRA 1O7MB 5D82A 1W6GA 4HM6B 3EHCA 1Q7Y4 1SQWA 1OGZA 2RGQA 3X3YA 3T8NA 1YJW3 5STDA 3CCM3 1M9GA 1IQXA 3WOEB 2RCDA 2WGOA 4K90B 3WA3A 1UI7A 4X2HA 5IEPA 4RNZA 5TGNA 5EQLA 3UNLA 1D6UA 2BO9B 3KSPA 2V1LA 3NQZA 1JKGA 3ECFA 2OTJ3 2RFRA 3KE7A 1N8QA 2OOVC 3JUQA 3OX9A 2XF3A 4N6NB 3CC43 3QRDA 3CMA3 2IUKA 1YIT3 3JUOA 5D83A 1YHQ3 3STDA 4CCVA 1OF5A 1A2KA 1RRHA 5KP3A 4H3UA 1M904 3UL6A 4STDA 1Q814 1JB2A 1UW1A 3EN1B 3PCRA 3Q90A 1VQK3 1GY6A 5CF2A 3DGNA 5CXOA 3NBJA 4KFFA 3EJVA 4XBTA 1NO3A 4KZ1A 3JVCA 5BVBA 1TIJA 1E3VA 2CFWA 4N6TA 3Q2PA 3T0UA 1IDPA 4R9KA 2HMOB 2FNQA 1VQ53 1VQ73 3NBRA 4FMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B24 B;  2BMR B;  4HM2 B;  2I9W A;  4HKV B;  2QIY A;  3GZB A;  3JUM A;  5AIG A;  2CKF B;  4LGQ A;  5IG0 A;  5BXQ A;  4KVH A;  3S5C A;  3DXO A;  3UJM A;  5D81 A;  1O7G B;  3JUN A;  1STD A;  3K7C A;  3FH1 A;  3DZL A;  1UUW B;  1U5O A;  3FF2 A;  4K1U A;  1HKX A;  1EA2 A;  3HZP A;  3FZW A;  4XDW A;  3FGY A;  4CDL A;  1QJG A;  5JPP A;  5IG5 A;  3F8X A;  3FLJ A;  3NHX A;  3OWU A;  5FW5 A;  3EBT A;  2IMJ A;  4HJL B;  3CNX A;  1W6Y A;  3NV0 B;  1NWW A;  3EN8 A;  3NM2 A;  3B8L A;  4R1K A;  2GBX B;  3OXA A;  3H51 A;  5IEO A;  4MJD A;  2XR8 B;  4GB5 A;  7STD A;  3BB9 A;  4FCJ A;  1OH0 A;  4N3V A;  6STD A;  1UUV B;  3H3H A;  4XM4 A;  1O7H B;  4WP5 A;  3MSO A;  1Z1S A;  3B4O A;  3EBY A;  3IPT A;  3E99 A;  3GRD A;  3NV0 A;  3RGR A;  2HMK B;  1W00 A;  2STD A;  1OHS A;  4HM7 B;  1QMA A;  2K54 A;  2R4I A;  3D9R A;  1OCV A;  4LEH A;  5CF1 A;  1JN5 B;  1W01 A;  5AEU B;  2GEY A;  3VSY A;  5DRE A;  5IG4 A;  3A76 A;  4J8T A;  5EVH A;  2HMM B;  1OHP A;  1DMN A;  2QGU A;  4X2O A;  3RGA A;  3DUK A;  1EG9 B;  5DRV A;  3VGN A;  1Q40 B;  1NDO B;  2F98 A;  1S5A A;  3WMD A;  4L8P A;  4HZ9 B;  1JB5 A;  1K41 A;  2F99 A;  5KP4 A;  1NU3 A;  4R9L A;  4XB5 A;  1JN5 A;  5JPU A;  4HZB B;  4WYK A;  3K0Z A;  3FKA A;  1JB4 A;  3HK4 A;  4HM0 B;  3OWY A;  3GZR A;  2BNG A;  2XRX B;  3F7X A;  4XBX A;  4OUQ A;  4LMI A;  3SED A;  1TP6 A;  3MKI A;  1GS3 A;  4Q53 A;  3MYT A;  1Q40 A;  4PEJ A;  2BMQ B;  3G16 A;  4HM5 B;  1ISK A;  3NXJ A;  5AI1 A;  3KKG A;  1OGX A;  5IER A;  3OV4 A;  8CHO A;  2GEX A;  1OPY A;  4WWU C;  4OVM A;  3NUV A;  2CHC A;  2INX A;  5HGR A;  5G2G A;  4XDV A;  1GYB A;  1BUQ A;  3FF0 A;  1AR0 A;  2HML B;  5AII A;  1C7H A;  2F86 B;  4XBY A;  3F40 A;  4U13 A;  3MG3 A;  1SJW A;  3I0Y A;  4L8O A;  1ULI B;  3OWS A;  3B4P A;  2W2C A;  3GZX B;  1Q42 A;  3ER7 A;  1ULJ B;  2YFL B;  4J9A A;  2PZV A;  3G8Z A;  2GBW B;  2JQ5 A;  2XSH B;  5AIH A;  3G0K A;  1O7W B;  4L7K A;  3DMC A;  3F7S A;  3LZA A;  4HM4 B;  3MHE A;  3GZY B;  3EX9 A;  1E97 A;  3CU3 A;  3B7C A;  3CPO A;  2YFI B;  3LYG A;  5AEW B;  2A15 A;  4WYK B;  1OHO A;  2YFJ B;  2BMO B;  2HMJ B;  5CLK A;  4IIA A;  2GXF A;  3M8C A;  3EQQ B;  3T8U A;  3EC9 A;  2XSO B;  1DMQ A;  1W02 A;  3F9S A;  1OUN A;  4RZM A;  3EF8 A;  4HM3 B;  4I4K A;  3MG2 A;  3F8H A;  2Z77 A;  3JUP A;  2UX0 A;  3BLZ A;  1VZZ A;  1CQS A;  5IF6 A;  4K1V A;  1ASK A;  3SOY A;  1TUH A;  2HMN B;  5KP1 A;  3DM8 A;  2B1X B;  1ZX2 A;  3SOA A;  1WQL B;  2Z76 A;  1O7P B;  5AIF A;  2OWP A;  1GY7 A;  5IEN A;  2Z7A A;  3ROB A;  5CK6 A;  1DMM A;  1ZO2 A;  4HM8 B;  1GY5 A;  1JKG B;  4HVN A;  3FSD A;  1E3R A;  3CNM A;  3KZT A;  3MG1 A;  4FCM A;  1O7N B;  1OF5 B;  3F14 A;  4HM1 B;  5IG3 A;  4ORL A;  3HX8 A;  3GWR A;  1O7M B;  5D82 A;  4HM6 B;  3EHC A;  1OGZ A;  2RGQ A;  3T8N A;  5STD A;  2RCD A;  4X2H A;  5IEP A;  5TGN A;  3UNL A;  3KSP A;  1JKG A;  3ECF A;  2RFR A;  3KE7 A;  3JUQ A;  3OX9 A;  3JUO A;  5D83 A;  3STD A;  1OF5 A;  1A2K A;  5KP3 A;  4H3U A;  4STD A;  1JB2 A;  3EN1 B;  3Q90 A;  1GY6 A;  5CF2 A;  5CXO A;  3EJV A;  4XBT A;  5BVB A;  1E3V A;  1IDP A;  4R9K A;  2HMO B;  3NBR A; 
#chains in the Genus database with same CATH topology
 3BND A;  4GL6 A;  2ZHX B;  1DYU A;  2SBL A;  3UB1 A;  1FGT A;  2B24 B;  2BMR B;  4HM2 B;  2I9W A;  1I3F A;  4HKV B;  2QIY A;  3GZB A;  2CFG A;  3JUM A;  5AIG A;  1YJ9 3;  5M18 A;  2CKF B;  3NBB A;  2C11 A;  2E2U A;  4LGQ A;  5IG0 A;  4N6V 0;  3UL5 A;  1GMR A;  5BXQ A;  3OW2 2;  4KVH A;  1UGH I;  2KF6 A;  3RNT A;  3CME 3;  8RNT A;  3S5C A;  1KSI A;  1RN1 A;  2KF5 A;  1TU5 A;  1K73 4;  2H0H A;  4LSO A;  5G1L A;  3DXO A;  3UJM A;  1IYY A;  1FZU A;  1RHL A;  5D81 A;  1O7G B;  1CYV A;  3S27 A;  2P05 A;  1W2Z A;  3JUN A;  1X1U A;  1YJN 3;  3A5E A;  5AYS C;  2OTL 3;  4G1M B;  1STD A;  3CCR 3;  3K7C A;  3FH1 A;  3LT9 A;  3DZL A;  1VQP 3;  2IUJ A;  4AEQ A;  3VF1 A;  4BL3 A;  1UUW B;  1RGL A;  1U5O A;  3LTB A;  2RBI A;  1LXE A;  3MWZ A;  3FF2 A;  2R41 A;  1BNF A;  1HYF A;  4K1U A;  1HKX A;  1EA2 A;  3HZP A;  3CCE 3;  1B3S A;  1EKM A;  3FZW A;  1UI8 A;  4XDW A;  1JRQ A;  1RMS A;  3PYJ A;  3WA2 X;  3FGY A;  1MNL A;  1K8A 4;  3KN4 A;  1YVB I;  4CDL A;  1BRJ A;  3D5G A;  5A0O B;  5FGO A;  2MF7 A;  1QJG A;  3BIR A;  5JPP A;  3L0R A;  4MMZ B;  2RNT A;  5IG5 A;  1EQK A;  3F8X A;  3FLJ A;  3NHX A;  1A2V A;  3OWU A;  1ROV A;  3S28 A;  2XEP A;  3QK9 A;  1RN4 A;  4JF8 A;  3AGN A;  2LYX A;  1RSN A;  5FW5 A;  1GD3 A;  3PZW A;  3MPH A;  3EBT A;  1FGQ A;  2IMJ A;  5GSP A;  4HJL B;  1RGK A;  1LOW A;  3CC7 3;  3CNX A;  1W6Y A;  1IVV A;  2C10 A;  4AKZ A;  1LOV A;  2FXT A;  1FUW A;  4MMY B;  1R4C A;  5M1A A;  1FYS A;  3NV0 B;  1NWW A;  3EN8 A;  3PXM A;  1J2B A;  1JBS A;  4LZI A;  3NM2 A;  1FUS A;  3B8L A;  3FG1 A;  4R1K A;  2GBX B;  1STF I;  4WFO A;  3OXA A;  1VQQ A;  3H51 A;  2LQV A;  4MJD A;  5IEO A;  2GU3 A;  2XR8 B;  2Y74 A;  1DET A;  1WMN A;  3X3Z A;  3CCJ 3;  4K61 A;  2K3D A;  4GB5 A;  3LT8 A;  5G1K A;  7STD A;  5HOH A;  3BB9 A;  2KF3 A;  1RCL A;  2CFL A;  2CX0 A;  3AHW A;  1BSA A;  4FCJ A;  2P0M A;  1OH0 A;  4N3V A;  1VQ4 3;  2ML5 A;  6STD A;  1M1X B;  1SAR A;  3U97 A;  1UUV B;  1I2F A;  2ML6 A;  3H3H A;  4XM4 A;  3CCU 3;  1VQM 3;  2Z6B A;  2YX9 A;  3DGO A;  1BNE A;  3V92 A;  3FCS B;  3LTD A;  4ILF A;  5IW9 A;  1O7H B;  2CWV A;  5EEO A;  4WP5 A;  3MSO A;  4BU4 A;  1VQ6 3;  1ZGX A;  1JZD A;  1Z1S A;  2BU4 A;  3B4O A;  1MGW A;  2CG0 A;  2KRT A;  2XFT A;  3EBY A;  4NHF A;  3WDG B;  3I56 3;  1G0T A;  2CC3 A;  5ELJ A;  1IK3 A;  3HII A;  4HAA A;  1JNQ A;  3E99 A;  3IPT A;  4FR9 A;  1RJO A;  2OQE C;  3KCH A;  2WOH A;  3GRD A;  4EBG A;  2BHM A;  4EV2 A;  2O3O A;  1BOX A;  1B2Z A;  1I70 A;  3NV0 A;  1JBR A;  2XGN A;  1A67 A;  3RGR A;  2HMK B;  3CXC 2;  2FGT A;  2D42 A;  4EC6 A;  1UUG B;  5BU4 A;  1BSB A;  1W00 A;  1LOY A;  2STD A;  1I2E A;  2F56 A;  1OHS A;  2ZA4 A;  3NX0 A;  4HM7 B;  3G4S 3;  1D6Z A;  1UCJ A;  1T5Y A;  2IA7 A;  3PGB A;  4RNY A;  3SXX A;  1Q82 4;  3SVA A;  1LRA A;  1RGG A;  1QMA A;  2K54 A;  2R4I A;  3D9R A;  1WMP A;  1GOU A;  2E2T A;  4O2H A;  4J5K A;  1OCV A;  3K5T A;  1MOL A;  4LEH A;  5CF1 A;  1JN5 B;  1U8C B;  3WR2 A;  1W01 A;  3CCV 3;  5AEU B;  2GEY A;  3VSY A;  1DVC A;  1G96 A;  1I3I A;  4WHA A;  5DRE A;  3TDG A;  4RNT A;  4ZM8 A;  5IG4 A;  1X1X A;  3A76 A;  4J8T A;  3ZG5 A;  3BNE A;  5EVH A;  1RGE A;  3HOH A;  1B2U A;  3URP A;  2HMM B;  1OHP A;  1DMN A;  2QGU A;  1F8N A;  4X2O A;  3RGA A;  1FUT A;  3DUK A;  5AYR B;  1EG9 B;  1KWI A;  1QAL A;  3GAX A;  5DRV A;  3V99 A;  7GSP A;  3VGN A;  2Y73 A;  2RSX A;  1Q40 B;  2UUG C;  4O8S A;  3G6E 3;  1MGR A;  2SAR A;  3U1W A;  1NDO B;  1TFK A;  1WTH A;  2F98 A;  3O8Y A;  1M1K 4;  1S5A A;  1ZS7 A;  3WMD A;  3X42 A;  3LTC A;  4L8P A;  4HZ9 B;  1W6C A;  1JB5 A;  1K41 A;  2F99 A;  2CWU A;  5KP4 A;  1VQ8 3;  4FMB A;  2JDI H;  1NU3 A;  1BAN A;  5BIR A;  4R9L A;  4XB5 A;  2GSP A;  5LC7 A;  2XGL A;  3WHO A;  2H0I A;  3RDE A;  1JN5 A;  5JPU A;  4BL2 A;  1WNH A;  3Q1C A;  4HZB B;  4IPB A;  4J5G A;  3S29 A;  4WYK A;  3K0Z A;  3FKA A;  3CCQ 3;  1JB4 A;  1RGF A;  1RNB A;  3HK4 A;  1GMP A;  4HM0 B;  3OWY A;  3J7Y d;  3X40 A;  2KF4 A;  3GZR A;  4MMX B;  1PU4 A;  1BRN L;  2BNG A;  2H0G A;  3HIG A;  2XRX B;  3F7X A;  4XBX A;  4OUQ A;  1QAK A;  1BRI A;  6RNT A;  4LMI A;  1MWT A;  4FMC A;  3SED A;  1B20 A;  1TP6 A;  3MKI A;  1GS3 A;  2CG1 A;  4Q53 A;  3MYT A;  1X1Y A;  3X41 A;  2E2V A;  2KAA A;  1Q40 A;  2XFS A;  1KQS 2;  4EW5 A;  1PY3 A;  3NQY A;  4NPB A;  4PEJ A;  4R4K A;  2BMQ B;  3G16 A;  4HM5 B;  1I0X A;  1KD1 4;  4O3V A;  2Q07 A;  1ISK A;  3NXJ A;  2P38 A;  2P09 A;  5AI1 A;  1PFP A;  4LYL B;  3KKG A;  1AQZ A;  1OGX A;  4AKY A;  1CH0 A;  1RCK A;  3X3X A;  5IER A;  3HI7 A;  2CFK A;  3OV4 A;  8CHO A;  2GEX A;  3LH4 A;  2KCD A;  3DGM A;  1OPY A;  1AV4 A;  1HU9 A;  2BIR A;  2F5W A;  2W0Q A;  3KFQ C;  4WWU C;  1A2P A;  2W9Q A;  2W04 A;  4OVM A;  3NUV A;  2CHC A;  2L4V A;  2INX A;  5HGR A;  4DKI A;  5G2G A;  3CC2 3;  3S67 A;  2F4Y A;  1T3B A;  1SIH A;  1N9E A;  1RGA A;  3DGL A;  4FCZ A;  4XDV A;  3G71 3;  1GYB A;  1MWR A;  1BUQ A;  2OOV A;  3FF0 A;  1AR0 A;  1I8V A;  1N5P A;  2HML B;  4GSP A;  1C7H A;  4I5Q A;  2F86 B;  1ROA A;  4XBY A;  1X1W A;  3F40 A;  1NB3 I;  5AII A;  3CCS 3;  3GSP A;  4N6M A;  1FW7 A;  4U13 A;  1QAF A;  3DY5 A;  1BRK A;  2WOF A;  3MG3 A;  1FGM A;  1I2G A;  1SJW A;  3N8B A;  1RGH A;  1UCK A;  3I0Y A;  4L8O A;  4BTX A;  1ULI B;  3OWS A;  3FG4 A;  1VQ9 3;  1EUI C;  3B4P A;  2W2C A;  1B2S A;  2ZDJ A;  3GZX B;  2WGQ A;  2QA4 3;  3ZG0 A;  1GOV A;  1Q42 A;  1IT8 A;  4H61 A;  3AMO B;  3ER7 A;  3N54 B;  1TJD A;  1ULJ B;  2YFL B;  2P0X A;  4J9A A;  1IVX A;  3BU4 A;  2PZV A;  3PCS A;  3G8Z A;  4EV5 A;  2GBW B;  3D79 A;  1BVI A;  2JQ5 A;  3N9H A;  2XSH B;  4O02 B;  1N5H A;  3G0K A;  1O7W B;  4L7K A;  5AIH A;  3SLU A;  3LML A;  3DMC A;  4CJN A;  1W2B 2;  1VQO 3;  3K63 A;  4EYC A;  3F7S A;  1K28 A;  3KII A;  1TRQ A;  1BNJ A;  3LZA A;  3IMA B;  4HM4 B;  3ALA A;  1YGE A;  1YI2 3;  4QWT A;  9RNT A;  1W4N A;  3MHE A;  3GZY B;  2KXG A;  3EX9 A;  1E97 A;  1Y4K A;  3CU3 A;  1BGS A;  3B7C A;  1FGO A;  3DGY A;  3V98 A;  3CPO A;  1LNH A;  2YFI B;  1B2M A;  2CK3 H;  2CW9 A;  1AVL A;  1BU4 A;  1W5Z A;  2M7O A;  1TRP A;  3LYG A;  1YIJ 3;  5AEW B;  2A15 A;  4WYK B;  1IQ8 A;  1OHO A;  1AVK A;  2YFJ B;  1DVD A;  3AMO A;  2WO0 A;  2D1W A;  4N6U A;  2O9U X;  1BSD A;  1S72 3;  1VQL 3;  3AGO A;  2BMO B;  1RGC A;  2HMJ B;  4CPK A;  1IV9 A;  7RNT A;  2W9P A;  5CLK A;  3D3L A;  4IIA A;  1BUJ A;  1BSE A;  3CCL 3;  1V74 A;  2F5M A;  3K9M C;  3DH2 A;  2CFD A;  1FA3 A;  1MWS A;  1BNI A;  4RBN A;  4EXR A;  2GXF A;  1N9J A;  1Q9E A;  1RKY A;  1JV2 B;  1DE3 A;  3M8C A;  3EQQ B;  3T8U A;  3EC9 A;  1NJI 4;  1KC8 4;  2XSO B;  1K9M 4;  1BRH A;  1IV7 A;  2ZL8 A;  1DMQ A;  5JBS A;  2BT3 A;  3ZFZ A;  1W02 A;  3F9S A;  1OUN A;  4RZM A;  1IT7 A;  3EF8 A;  4HM3 B;  4I4K A;  2HOH A;  3EB8 A;  1FGR A;  3MG2 A;  3NM7 A;  3F8H A;  3WOD G;  2Z77 A;  1OAC A;  5ELU A;  1TFO A;  1US1 A;  3LTA A;  2CIU A;  1N8R 4;  3JUP A;  1A90 A;  1IQY A;  3D4A A;  2UX0 A;  3BLZ A;  1VZZ A;  1YNV X;  1CQS A;  3LOY A;  1SPU A;  2AAD A;  1RNT A;  4K1V A;  1ASK A;  3SOY A;  3SX1 A;  5IF6 A;  1TUH A;  1Q7H A;  2HMN B;  4N6O B;  5KP1 A;  1QVF 2;  3DM8 A;  1PYL A;  4BTW A;  1LQG C;  1YVS A;  3IJE B;  2QEX 3;  4OK0 A;  1R4Y A;  1I0V A;  2J8X B;  1JBT A;  4FMA A;  2W56 B;  1YGW A;  2B1X B;  1IU7 A;  1ZX2 A;  2AAE A;  3BNB A;  3PS8 A;  1L5G B;  3LXU X;  3SOA A;  4BTY A;  1WQL B;  1B27 A;  2Z76 A;  1CEW I;  1JJ2 2;  1LOX A;  1CYU A;  1BNR A;  4IT7 A;  2C4B A;  1C54 A;  1O7P B;  2CH9 A;  1BNG A;  1WMO A;  5AIF A;  1V58 A;  2OWP A;  1GMQ A;  4N6L A;  2K0M A;  2CX1 A;  4HOH A;  4HBR A;  1W7C A;  3I55 3;  3KSE D;  1IVU A;  3WOF B;  4NRE A;  1LNI A;  2W6J H;  3CPW 2;  1GY7 A;  5IEN A;  5I97 A;  2MC8 A;  1B21 A;  2Z7A A;  1LVN A;  4KFE A;  4R80 A;  1G02 A;  1IVW A;  3ROB A;  2W03 A;  5CK6 A;  1GD4 A;  1DMM A;  1ZO2 A;  4HM8 B;  1GY5 A;  1MWU A;  1JKG B;  2CWT A;  4HVN A;  2OQE A;  1SII A;  1E3R A;  1HZ1 A;  1LQM B;  3CNM A;  3FSD A;  4GHO A;  4JRF A;  1Q86 4;  3KZT A;  4MEI A;  1D6Y A;  5LC6 A;  1RN7 A;  2OCT A;  3MG1 A;  4KFD A;  1NB5 I;  3FG3 A;  4FCM A;  1BAO A;  1BIR A;  1UCL A;  3CD6 3;  3BNC A;  1RRL A;  2PNC A;  2W56 A;  1O7N B;  1OF5 B;  2UGI A;  2GU1 A;  3F14 A;  4HYZ A;  4HM1 B;  1NNV A;  2XH9 A;  3EE1 A;  4TX4 A;  1JZO A;  1VQN 3;  5IG3 A;  1T2H A;  4ORL A;  3HX8 A;  3GWR A;  1QVG 2;  1O7M B;  1RDS A;  5D82 A;  3SYU A;  6GSP A;  1W6G A;  4HM6 B;  3EHC A;  1Q7Y 4;  1SQW A;  1OGZ A;  2RGQ A;  3X3Y A;  3T8N A;  1YJW 3;  5STD A;  1RTU A;  3CCM 3;  5RNT A;  1M9G A;  1IQX A;  3WOE B;  2RCD A;  2WGO A;  4K90 B;  3WA3 A;  1B2X A;  1UI7 A;  4X2H A;  5IEP A;  4RNZ A;  1RLS A;  5TGN A;  5EQL A;  3UNL A;  4BIR A;  1D6U A;  3Q3F A;  2BO9 B;  3KSP A;  2L1S A;  2V1L A;  3NQZ A;  1JKG A;  3ECF A;  2OTJ 3;  2RFR A;  3KE7 A;  1BNS A;  1N8Q A;  2IYJ A;  4KT3 B;  2OOV C;  3JUQ A;  3OX9 A;  2XF3 A;  4N6N B;  1GSP A;  3QRD A;  3CC4 3;  3CMA 3;  1V57 A;  2IUK A;  1YIT 3;  3JUO A;  5D83 A;  1YHQ 3;  1TTO A;  3STD A;  4CCV A;  1OF5 A;  1A2K A;  1RRH A;  2IY2 A;  5KP3 A;  4H3U A;  1M90 4;  3UL6 A;  4STD A;  1Q81 4;  1JB2 A;  1UW1 A;  3D5I A;  1BRS A;  5M19 A;  1UCI A;  3EN1 B;  3AHS A;  1BRG A;  1GOY A;  3PCR A;  3Q90 A;  1EEJ A;  1VQK 3;  1GY6 A;  1UGI A;  3DGN A;  5CXO A;  1AY7 A;  3NBJ A;  4KFF A;  3EJV A;  5CF2 A;  4XBT A;  1T2I A;  1NO3 A;  4KZ1 A;  3JVC A;  5BVB A;  1TIJ A;  1BSC A;  1E3V A;  2CFW A;  4N6T A;  3Q2P A;  3T0U A;  1IDP A;  4R9K A;  2HMO B;  2FNQ A;  1VQ5 3;  1VQ7 3;  3NBR A;  4FMD A;  1UDI I; 
#chains in the Genus database with same CATH homology
 3BND A;  4GL6 A;  1DYU A;  2SBL A;  3UB1 A;  1FGT A;  2B24 B;  2BMR B;  4HM2 B;  2I9W A;  4HKV B;  2QIY A;  3GZB A;  2CFG A;  3JUM A;  5AIG A;  1YJ9 3;  2CKF B;  3NBB A;  2C11 A;  2E2U A;  4LGQ A;  5IG0 A;  4N6V 0;  3UL5 A;  5BXQ A;  3OW2 2;  4KVH A;  3CME 3;  3S5C A;  1KSI A;  1TU5 A;  1K73 4;  4LSO A;  3DXO A;  3UJM A;  5D81 A;  1O7G B;  1CYV A;  3S27 A;  2P05 A;  1W2Z A;  3JUN A;  1YJN 3;  5AYS C;  2OTL 3;  4G1M B;  1STD A;  3CCR 3;  3K7C A;  3FH1 A;  3LT9 A;  3DZL A;  1VQP 3;  2IUJ A;  4AEQ A;  3VF1 A;  1UUW B;  1U5O A;  3LTB A;  1LXE A;  3MWZ A;  3FF2 A;  4K1U A;  1HKX A;  1EA2 A;  3HZP A;  3CCE 3;  1EKM A;  3FZW A;  1UI8 A;  4XDW A;  1JRQ A;  3PYJ A;  3WA2 X;  3FGY A;  1MNL A;  1K8A 4;  3KN4 A;  1YVB I;  4CDL A;  5A0O B;  5FGO A;  2MF7 A;  1QJG A;  5JPP A;  3L0R A;  4MMZ B;  5IG5 A;  1EQK A;  3F8X A;  3FLJ A;  3NHX A;  1A2V A;  3OWU A;  1ROV A;  3S28 A;  2XEP A;  3QK9 A;  4JF8 A;  2LYX A;  5FW5 A;  1GD3 A;  3PZW A;  3MPH A;  3EBT A;  1FGQ A;  2IMJ A;  4HJL B;  3CC7 3;  3CNX A;  1W6Y A;  1IVV A;  2C10 A;  4AKZ A;  2FXT A;  1FUW A;  4MMY B;  1R4C A;  3PXM A;  3NV0 B;  1NWW A;  3EN8 A;  1J2B A;  4LZI A;  3NM2 A;  3B8L A;  4R1K A;  3FG1 A;  2GBX B;  1STF I;  4WFO A;  3OXA A;  3H51 A;  2LQV A;  4MJD A;  5IEO A;  2GU3 A;  2XR8 B;  2Y74 A;  3X3Z A;  1WMN A;  3CCJ 3;  4K61 A;  4GB5 A;  3LT8 A;  7STD A;  3BB9 A;  2CFL A;  4FCJ A;  2P0M A;  1OH0 A;  4N3V A;  1VQ4 3;  2ML5 A;  6STD A;  1M1X B;  3U97 A;  1UUV B;  3CCU 3;  2ML6 A;  3H3H A;  4XM4 A;  1VQM 3;  2Z6B A;  2YX9 A;  3DGO A;  3V92 A;  3FCS B;  3LTD A;  5IW9 A;  1O7H B;  2CWV A;  5EEO A;  4WP5 A;  3MSO A;  1VQ6 3;  1Z1S A;  3B4O A;  4NHF A;  3EBY A;  2KRT A;  2CG0 A;  2XFT A;  3WDG B;  3I56 3;  2CC3 A;  5ELJ A;  1IK3 A;  3HII A;  1JNQ A;  3E99 A;  3IPT A;  4FR9 A;  1RJO A;  2OQE C;  2WOH A;  3GRD A;  4EBG A;  2BHM A;  4EV2 A;  2O3O A;  3NV0 A;  2XGN A;  1A67 A;  3RGR A;  2HMK B;  3CXC 2;  2FGT A;  2D42 A;  4EC6 A;  1W00 A;  2STD A;  3G4S 3;  1OHS A;  3NX0 A;  4HM7 B;  1D6Z A;  1T5Y A;  2IA7 A;  3PGB A;  4RNY A;  3SXX A;  1Q82 4;  3SVA A;  1QMA A;  2K54 A;  2R4I A;  3D9R A;  1WMP A;  2E2T A;  4O2H A;  1OCV A;  3K5T A;  1MOL A;  4LEH A;  5CF1 A;  1JN5 B;  1U8C B;  1W01 A;  3CCV 3;  5AEU B;  2GEY A;  3VSY A;  1DVC A;  1G96 A;  4WHA A;  5DRE A;  3TDG A;  4ZM8 A;  5IG4 A;  3A76 A;  4J8T A;  3BNE A;  5EVH A;  2HMM B;  1OHP A;  1DMN A;  2QGU A;  1F8N A;  4X2O A;  3RGA A;  3DUK A;  5AYR B;  1EG9 B;  1KWI A;  1QAL A;  3GAX A;  5DRV A;  3V99 A;  3VGN A;  2Y73 A;  2RSX A;  1Q40 B;  4O8S A;  3G6E 3;  3U1W A;  1NDO B;  1TFK A;  1WTH A;  2F98 A;  3O8Y A;  1M1K 4;  1S5A A;  3WMD A;  3X42 A;  3LTC A;  4L8P A;  4HZ9 B;  1W6C A;  1JB5 A;  1K41 A;  2F99 A;  2CWU A;  5KP4 A;  1VQ8 3;  4FMB A;  2JDI H;  1NU3 A;  4R9L A;  4XB5 A;  5LC7 A;  2XGL A;  3RDE A;  1JN5 A;  5JPU A;  1WNH A;  3Q1C A;  4HZB B;  4IPB A;  3S29 A;  4WYK A;  3K0Z A;  3FKA A;  3CCQ 3;  1JB4 A;  3HK4 A;  4HM0 B;  3OWY A;  3J7Y d;  3X40 A;  3GZR A;  4MMX B;  1PU4 A;  2BNG A;  3HIG A;  2XRX B;  3F7X A;  4XBX A;  4OUQ A;  1QAK A;  4LMI A;  4FMC A;  3SED A;  1TP6 A;  3MKI A;  1GS3 A;  2CG1 A;  4Q53 A;  3MYT A;  3X41 A;  2E2V A;  2XFS A;  1Q40 A;  1KQS 2;  3NQY A;  4PEJ A;  4R4K A;  2BMQ B;  3G16 A;  4HM5 B;  1KD1 4;  4O3V A;  2Q07 A;  1ISK A;  3NXJ A;  2P38 A;  2P09 A;  5AI1 A;  1PFP A;  3KKG A;  1OGX A;  4AKY A;  3X3X A;  5IER A;  3HI7 A;  2CFK A;  3OV4 A;  8CHO A;  2GEX A;  3LH4 A;  2KCD A;  3DGM A;  1OPY A;  1AV4 A;  1HU9 A;  2W0Q A;  3KFQ C;  4WWU C;  2W9Q A;  2W04 A;  4OVM A;  3NUV A;  2CHC A;  2L4V A;  2INX A;  5HGR A;  5G2G A;  3S67 A;  1SIH A;  3CC2 3;  1N9E A;  3DGL A;  4FCZ A;  4XDV A;  3G71 3;  1GYB A;  1BUQ A;  2OOV A;  3FF0 A;  1AR0 A;  1N5P A;  2HML B;  5AII A;  1C7H A;  2F86 B;  1ROA A;  4XBY A;  3F40 A;  3CCS 3;  1NB3 I;  4N6M A;  4U13 A;  1QAF A;  3DY5 A;  2WOF A;  3MG3 A;  1FGM A;  1SJW A;  3N8B A;  3I0Y A;  4L8O A;  4BTX A;  1ULI B;  3OWS A;  3FG4 A;  1VQ9 3;  3B4P A;  2W2C A;  3GZX B;  2ZDJ A;  2WGQ A;  2QA4 3;  1Q42 A;  1IT8 A;  4H61 A;  3AMO B;  3ER7 A;  3N54 B;  1ULJ B;  2YFL B;  2P0X A;  4J9A A;  1IVX A;  2PZV A;  3PCS A;  3G8Z A;  4EV5 A;  2GBW B;  4O02 B;  2JQ5 A;  3N9H A;  2XSH B;  3SLU A;  1N5H A;  3G0K A;  1O7W B;  4L7K A;  5AIH A;  1W2B 2;  3LML A;  3DMC A;  1VQO 3;  3K63 A;  4EYC A;  3F7S A;  1K28 A;  3KII A;  3LZA A;  4HM4 B;  3IMA B;  3ALA A;  1YGE A;  1YI2 3;  4QWT A;  1W4N A;  3MHE A;  3GZY B;  2KXG A;  3EX9 A;  1E97 A;  1Y4K A;  3CU3 A;  3B7C A;  1FGO A;  3V98 A;  3CPO A;  1LNH A;  2YFI B;  2CK3 H;  2CW9 A;  1AVL A;  1W5Z A;  2M7O A;  3LYG A;  1YIJ 3;  5AEW B;  2A15 A;  4WYK B;  1IQ8 A;  1OHO A;  1AVK A;  2YFJ B;  1DVD A;  3AMO A;  2WO0 A;  2D1W A;  4N6U A;  2O9U X;  1S72 3;  1VQL 3;  2BMO B;  2HMJ B;  1IV9 A;  2W9P A;  5CLK A;  3D3L A;  4IIA A;  3CCL 3;  1V74 A;  3K9M C;  2CFD A;  1FA3 A;  4RBN A;  4EXR A;  2GXF A;  1N9J A;  1RKY A;  1JV2 B;  3M8C A;  3EQQ B;  3T8U A;  3EC9 A;  1NJI 4;  1KC8 4;  2XSO B;  1K9M 4;  1IV7 A;  2ZL8 A;  1DMQ A;  5JBS A;  2BT3 A;  1W02 A;  3F9S A;  1OUN A;  4RZM A;  1IT7 A;  3EF8 A;  4HM3 B;  4I4K A;  3EB8 A;  1FGR A;  3MG2 A;  3NM7 A;  3F8H A;  3WOD G;  2Z77 A;  1OAC A;  5ELU A;  1TFO A;  1US1 A;  3LTA A;  2CIU A;  1N8R 4;  3JUP A;  1A90 A;  1IQY A;  2UX0 A;  3BLZ A;  1VZZ A;  1CQS A;  3LOY A;  1SPU A;  3SX1 A;  4K1V A;  5IF6 A;  1ASK A;  3SOY A;  1TUH A;  2HMN B;  4N6O B;  5KP1 A;  1QVF 2;  3DM8 A;  4BTW A;  3IJE B;  2QEX 3;  4OK0 A;  4FMA A;  2W56 B;  2B1X B;  1IU7 A;  1ZX2 A;  3BNB A;  3PS8 A;  1L5G B;  3SOA A;  3LXU X;  4BTY A;  1WQL B;  2Z76 A;  1CEW I;  1JJ2 2;  1LOX A;  1CYU A;  4IT7 A;  1O7P B;  2CH9 A;  1WMO A;  5AIF A;  2OWP A;  4N6L A;  2K0M A;  4HBR A;  1W7C A;  3I55 3;  3KSE D;  1IVU A;  3WOF B;  4NRE A;  2W6J H;  3CPW 2;  1GY7 A;  5IEN A;  5I97 A;  2MC8 A;  2Z7A A;  1LVN A;  4KFE A;  4R80 A;  1IVW A;  3ROB A;  2W03 A;  5CK6 A;  1GD4 A;  1DMM A;  1ZO2 A;  4HM8 B;  1GY5 A;  1JKG B;  2CWT A;  4HVN A;  2OQE A;  1SII A;  1E3R A;  3FSD A;  3CNM A;  4JRF A;  1Q86 4;  3KZT A;  4MEI A;  1D6Y A;  5LC6 A;  1RN7 A;  2OCT A;  3MG1 A;  4KFD A;  1NB5 I;  3FG3 A;  4FCM A;  3CD6 3;  3BNC A;  1RRL A;  2PNC A;  2W56 A;  1O7N B;  1OF5 B;  3F14 A;  2GU1 A;  4HYZ A;  4HM1 B;  2XH9 A;  4TX4 A;  3EE1 A;  1VQN 3;  5IG3 A;  1QVG 2;  4ORL A;  3HX8 A;  3GWR A;  1O7M B;  5D82 A;  1W6G A;  4HM6 B;  3EHC A;  1Q7Y 4;  1SQW A;  1OGZ A;  2RGQ A;  3X3Y A;  3T8N A;  1YJW 3;  5STD A;  3CCM 3;  1M9G A;  1IQX A;  3WOE B;  2RCD A;  2WGO A;  4K90 B;  3WA3 A;  1UI7 A;  4X2H A;  5IEP A;  4RNZ A;  5TGN A;  5EQL A;  3UNL A;  1D6U A;  2BO9 B;  3KSP A;  2V1L A;  3NQZ A;  1JKG A;  3ECF A;  2OTJ 3;  2RFR A;  3KE7 A;  1N8Q A;  2OOV C;  3JUQ A;  3OX9 A;  2XF3 A;  4N6N B;  3CC4 3;  3QRD A;  3CMA 3;  2IUK A;  1YIT 3;  3JUO A;  5D83 A;  1YHQ 3;  3STD A;  4CCV A;  1OF5 A;  1A2K A;  1RRH A;  5KP3 A;  4H3U A;  1M90 4;  3UL6 A;  4STD A;  1Q81 4;  1JB2 A;  1UW1 A;  3EN1 B;  3PCR A;  3Q90 A;  1VQK 3;  1GY6 A;  5CF2 A;  3DGN A;  5CXO A;  3NBJ A;  4KFF A;  3EJV A;  4XBT A;  1NO3 A;  4KZ1 A;  3JVC A;  5BVB A;  1TIJ A;  1E3V A;  2CFW A;  4N6T A;  3Q2P A;  3T0U A;  1IDP A;  4R9K A;  2HMO B;  2FNQ A;  1VQ5 3;  1VQ7 3;  3NBR A;  4FMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...