2GEXA

Crystal structure of snoal2 a putative hydroxylase from streptomyces nogalater
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
STTANKERCLEMVAAWNRWDVSGVVAHWAPDVVHYDDEDKPVSAEEVVRRMNSAVEAFPDLRLDVRSIVGEGDRVMLRITCSATHQGVFMGIAPTGRKVRWTYLEELRFSEAGKVVEHWDVFNFSPLFRDLGVVPDGLKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SnoL
publication title Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics
pubmed doi rcsb
source organism Streptomyces nogalater
total genus 41
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gexA00
1TUHA 4OVMA 3ER7A 5AIFA 3CU3A 2CHCA 2YFJB 5AIHA 1JB2A 2HMMB 1Q40A 3G0KA 4PEJA 2RGQA 3I0YA 2RCDA 2PZVA 2XRXB 3KSPA 3EBYA 3BLZA 2R4IA 3F8HA 3MKIA 3NHXA 4HZBB 1Q40B 2HMJB 1NWWA 5IERA 1DMMA 3B4OA 4LEHA 3SEDA 2UX0A 2XSOB 3JUNA 3EX9A 1HKXA 4J9AA 3K0ZA 5CLKA 4L8OA 1GY7A 2Z77A 3FF0A 1ZX2A 1QMAA 1ULIB 4MJDA 5D83A 3LZAA 2STDA 3EN1B 3FZWA 3F7SA 3CNMA 4FCMA 1C7HA 2YFIB 1JB4A 5IG0A 3NXJA 1O7GB 3F14A 1GYBA 3H51A 1O7MB 3DMCA 3BB9A 4XBTA 3KE7A 1GY6A 5DREA 3KKGA 1OF5A 1OCVA 3JUOA 4STDA 1JKGA 3VGNA 1Z1SA 2GXFA 3ECFA 4I4KA 1ISKA 3NV0B 2JQ5A 1UUVB 5IEPA 1OHSA 4CDLA 3B4PA 4LMIA 3JUQA 1BUQA 3EQQB 2OWPA 2BNGA 3CPOA 6STDA 3M8CA 1QJGA 4WYKB 1OF5B 3VSYA 3G8ZA 3SOYA 2XR8B 2HMNB 5JPUA 3JUPA 5BVBA 1S5AA 3DM8A 2HMOB 1U5OA 2GBXB 1OH0A 3FSDA 4GB5A 1OPYA 3F7XA 2BMRB 4K1UA 3F9SA 1K41A 3CNXA 3MHEA 4L8PA 4K1VA 2XSHB 3FKAA 1JN5A 2INXA 4WWUC 1W6YA 3S5CA 3EC9A 1CQSA 2BMOB 5HGRA 2B1XB 3OX9A 4HM1B 4XDVA 4KVHA 1ASKA 1Q42A 5CK6A 3HK4A 5KP4A 4HVNA 3MSOA 3B8LA 3HX8A 3G16A 2Z76A 3IPTA 1JN5B 1W02A 1E3VA 2F99A 1A2KA 5IEOA 5AIGA 5TGNA 5CXOA 4HM6B 3EHCA 3OWSA 4RZMA 1OGXA 4R1KA 3GRDA 1O7HB 4X2HA 3WMDA 3MYTA 7STDA 3OWYA 5D82A 1ULJB 2F98A 3H3HA 2GEXA 2A15A 2B24B 5STDA 3JUMA 3GZBA 1O7WB 5IF6A 4WP5A 3MG2A 4IIAA 4N3VA 5DRVA 3K7CA 3EBTA 5IG5A 1TP6A 4HM4B 4HZ9B 3FH1A 1AR0A 4XBYA 3F8XA 4LGQA 3GWRA 3Q90A 4R9KA 3MG3A 1JKGB 3D9RA 2CKFB 1ZO2A 3NUVA 1OGZA 1DMNA 8CHOA 2HMLB 5AEUB 3LYGA 1UUWB 4HJLB 3RGAA 1VZZA 2GEYA 2K54A 4J8TA 2Z7AA 2HMKB 3NBRA 5IENA 5D81A 5KP3A 1OHOA 3MG1A 2I9WA 4HM7B 5EVHA 2F86B 1EG9B 1O7PB 4HM8B 5AI1A 5BXQA 4H3UA 1O7NB 2BMQB 5KP1A 5FW5A 3GZXB 5CF2A 2QGUA 2IMJA 3E99A 1W00A 3UJMA 1W01A 5IG4A 1GS3A 1NU3A 3FLJA 4ORLA 4XB5A 3RGRA 3FGYA 3DZLA 3KZTA 3DUKA 3EN8A 3T8UA 3ROBA 4HKVB 2RFRA 4OUQA 1OUNA 3UNLA 3GZRA 5CF1A 5AIIA 4XM4A 3OXAA 4HM2B 3OV4A 4XBXA 1OHPA 3OWUA 3B7CA 3NM2A 3NV0A 3GZYB 3EF8A 1WQLB 4XDWA 3T8NA 5IG3A 3A76A 1EA2A 1NDOB 1DMQA 2QIYA 3STDA 3EJVA 1E97A 3HZPA 1IDPA 4WYKA 1STDA 3F40A 4U13A 2W2CA 4FCJA 4R9LA 3SOAA 4Q53A 4L7KA 1GY5A 3FF2A 4X2OA 4HM5B 1SJWA 5G2GA 3DXOA 4HM3B 2YFLB 1JB5A 5JPPA 1E3RA 2GBWB 5AEWB 4HM0B
chains in the Genus database with same CATH superfamily
1TUHA 4OVMA 3ER7A 5AIFA 3CU3A 1Y4KA 8RNTA 1I3FA 2KF3A 3O8YA 2CHCA 2YFJB 5AIHA 4GSPA 4LSOA 1A67A 4DKIA 2ZL8A 1JB2A 4KFFA 2CX0A 2HMMB 2IUJA 1Q40A 1Q7HA 3G0KA 1UCJA 4QWTA 1BNIA 1CEWI 1QVF2 4PEJA 5G1KA 3LMLA 4WHAA 3LTBA 2BHMA 2CWUA 1FGQA 1K734 4N6MA 2RGQA 3PYJA 1FGTA 3Q1CA 1KWIA 3I0YA 3QK9A 3LH4A 1RN4A 2Z6BA 3NQZA 1VQO3 6GSPA 4EV2A 2RCDA 2PZVA 1LVNA 1M9GA 2XRXB 3KSPA 3ZG5A 4GHOA 3EBYA 3G713 3BLZA 1YJW3 2CW9A 2R4IA 3F8HA 1QAKA 1RGCA 3V99A 3SXXA 1VQQA 3CCV3 3DGNA 3KN4A 3MKIA 3DH2A 3NHXA 2P0XA 4HZBB 1Q40B 2W56A 4RNYA 1YNVX 1MNLA 2KF4A 4JF8A 2HMJB 3N54B 3CCL3 1NWWA 1W2B2 1BNEA 5IERA 1DMMA 1W4NA 1YJN3 1FUSA 1JNQA 3B4OA 3LT9A 3HIIA 4LEHA 2F56A 3SEDA 2UX0A 2XSOB 2WO0A 1BU4A 3EX9A 3JUNA 2ML5A 3J7Yd 1SARA 2LQVA 4BTWA 1I2GA 1FGMA 1A90A 2CFWA 1BRHA 1HKXA 3N9HA 2WGQA 4J9AA 1B2ZA 3MWZA 4R80A 2KF5A 3K0ZA 4KFEA 5G1LA 5CLKA 1FGRA 2CWTA 2KF6A 4CCVA 4L8OA 1SPUA 1GY7A 1VQ53 2Z77A 3SYUA 1IT7A 3FF0A 1YIT3 1IVXA 1B2MA 1VQP3 1ZX2A 1IV7A 1QMAA 3HI7A 1IYYA 3D3LA 2OTL3 2W56B 5GSPA 2R41A 1JRQA 1BNRA 1V57A 2H0GA 1YGEA 2PNCA 1UGHI 2GU1A 1ULIB 4MJDA 1FZUA 1TRPA 4NREA 3LZAA 5D83A 2BO9B 2STDA 3EN1B 1VQ63 1BUJA 3NX0A 3FZWA 2XFTA 3F7SA 3CNMA 3K9MC 4FCMA 4ILFA 1C7HA 2YFIB 3PS8A 1JB4A 1UI7A 1N9JA 5IG0A 1IVVA 2W6JH 2E2UA 3NXJA 4EBGA 1UI8A 1O7GB 2K3DA 1AQZA 4J5KA 3F14A 4GL6A 1DE3A 1GYBA 1X1XA 1LRAA 1T2IA 3H51A 1AVKA 2ZDJA 2M7OA 1O7MB 2O9UX 4BTXA 1JBTA 3DMCA 1IQYA 1F8NA 4FMCA 1A2PA 1DVDA 1VQN3 2IUKA 2XGNA 2KXGA 3FG3A 3LTAA 1G0TA 3LOYA 3BB9A 3DGMA 3WA3A 4XBTA 3KE7A 4TX4A 1NJI4 1GY6A 1BNGA 3KSED 3GAXA 3KKGA 5DREA 1J2BA 1OF5A 1OCVA 1RGGA 3JUOA 4STDA 2BU4A 3QRDA 1JKGA 3VGNA 3DGOA 1Z1SA 2GXFA 3ECFA 4I4KA 1TRQA 2P05A 1ISKA 3NV0B 2JQ5A 1UUVB 1LNHA 1BNJA 3D5IA 5EQLA 3URPA 3X3ZA 5IEPA 1OHSA 2Q07A 4CDLA 3G6E3 3B4PA 1US1A 3BNDA 5RNTA 2XF3A 1RNBA 1IT8A 2CFDA 4LMIA 3WHOA 3PGBA 3UL6A 3CC23 3JUQA 4WFOA 1BUQA 1X1WA 3EQQB 3HIGA 2OWPA 1R4YA 2BNGA 3CPOA 3RNTA 2AADA 6STDA 3M8CA 4N6OB 1TU5A 1AV4A 1W5ZA 6RNTA 1RHLA 4MMYB 1PU4A 1LOXA 1UCKA 2YX9A 1QJGA 4WYKB 2AAEA 1OF5B 1CYVA 1UCLA 3VSYA 1WMNA 1MWSA 2CH9A 4EXRA 3ALAA 3CCU3 2IA7A 3KCHA 2F5WA 1JJ22 4HOHA 1I8VA 3G8ZA 4R4KA 2XR8B 2HMNB 3SOYA 4BTYA 1VQK3 1IV9A 5JPUA 3JUPA 5BVBA 5BU4A 1RDSA 1S5AA 1LOYA 3DM8A 1W2ZA 1BGSA 2K0MA 1IVUA 3D4AA 3ZG0A 1FW7A 2HMOB 1U5OA 4RNZA 3CCQ3 1VQ73 4O3VA 4BU4A 1FYSA 1IQXA 1ROAA 2MC8A 2GBXB 3U97A 1LXEA 1OH0A 2W03A 3TDGA 1I2EA 1RGFA 3FSDA 1S723 4N6UA 5EEOA 4GB5A 4O02B 1QAFA 2CK3H 1GSPA 1OPYA 1QALA 3F7XA 1K9M4 2P09A 1GMQA 5ELUA 2BMRB 4K1UA 4N6V0 3AGOA 3F9SA 4BIRA 1K41A 3CNXA 3MHEA 1N8QA 1RMSA 1BSAA 3BIRA 4L8PA 1VQ83 3DGYA 3GSPA 4K1VA 2XSHB 3FKAA 1JN5A 1K28A 4MMZB 4EYCA 2INXA 1CYUA 4WWUC 3VF1A 1UW1A 1W6YA 4RBNA 1NB3I 3S5CA 2W04A 3RDEA 1LOVA 3ZFZA 3EE1A 3CCS3 1TFOA 1I0VA 3EC9A 1CQSA 2BMOB 2ZHXB 3CC73 1WNHA 3X3XA 1N5PA 5HGRA 1CH0A 2B1XB 1KC84 1LQGC 3OX9A 2FNQA 4HM1B 2SARA 4XDVA 4AEQA 2CX1A 4KVHA 2XFSA 1ASKA 1Q42A 3BNEA 3HK4A 1RGHA 1BRKA 5CK6A 5KP4A 1ROVA 1T5YA 4HVNA 3MSOA 4O2HA 2MF7A 3B8LA 3HX8A 3G16A 2Z76A 5M18A 3X3YA 4IPBA 3IPTA 1JN5B 1W02A 4FMDA 1E3VA 1M1XB 3AHWA 2F99A 1YHQ3 1A2KA 2ZA4A 3S27A 3WDGB 5IEOA 1I0XA 5AIGA 1MOLA 1RCKA 5TGNA 3CXC2 3KIIA 3OW22 3UL5A 7RNTA 7GSPA 3PCSA 5CXOA 3WOFB 3X41A 1I70A 5HOHA 1JBRA 3BU4A 4HM6B 1Q824 3EHCA 3K63A 2RBIA 3OWSA 4CJNA 4RZMA 1OGXA 1KQS2 4R1KA 1D6ZA 1X1UA 1BSBA 3GRDA 1K8A4 2KRTA 3CMA3 1HU9A 1T2HA 1O7HB 4AKYA 4ZM8A 4X2HA 2RSXA 3N8BA 1UCIA 4I5QA 3WMDA 1GOVA 2Y74A 2UGIA 3MYTA 2QEX3 7STDA 1FA3A 1YGWA 3OWYA 5D82A 1LQMB 1HYFA 1ULJB 2F98A 2RNTA 2W9PA 2WOHA 2CC3A 3MPHA 3H3HA 2GEXA 1UGIA 2A15A 1KSIA 2BIRA 2V1LA 2E2VA 2B24B 1N8R4 4FCZA 1GD4A 1YVSA 5STDA 3JUMA 3GZBA 1O7WB 1AY7A 4WP5A 5IF6A 3MG2A 4IIAA 4N6NB 4N3VA 4N6TA 5DRVA 3K7CA 1N5HA 3EBTA 2ML6A 5IG5A 1TP6A 2D1WA 1Q864 3CC43 2CG1A 4HM4B 1G96A 3AGNA 4HZ9B 3AMOA 3FH1A 1AR0A 4HYZA 3FG1A 3I553 1BSEA 1TTOA 1RGAA 2KAAA 4G1MB 3X40A 1G02A 4XBYA 4JRFA 3F8XA 4LGQA 3GWRA 3Q90A 3JVCA 4R9KA 4N6LA 1NO3A 3G4S3 2P0MA 3CCJ3 3MG3A 1JKGB 3D9RA 1IU7A 1TJDA 2CKFB 5IW9A 1ZO2A 3NUVA 1BIRA 1OGZA 3WODG 4BL3A 3CME3 1DMNA 1Q7Y4 3PXMA 8CHOA 2HMLB 1WMPA 1BSCA 3NQYA 4KFDA 1B3SA 1PYLA 3A5EA 5AEUB 1LOWA 1PY3A 1X1YA 3KFQC 3LYGA 3V98A 1UUWB 1VQ93 1JZDA 1T3BA 4HJLB 2CFKA 1VZZA 3RGAA 1KD14 1BAOA 2GEYA 2XH9A 3LXUX 2K54A 1L5GB 4J8TA 2Z7AA 2WGOA 2C4BA 2Y73A 2CWVA 4CPKA 2OQEA 1BNSA 4O8SA 3CCE3 1WTHA 1OACA 2HMKB 2SBLA 3NBRA 5IENA 5D81A 1V74A 1JZOA 2FGTA 4NHFA 4EV5A 1M1K4 1B2SA 5KP3A 1OHOA 3MG1A 1MWRA 2C10A 2QA43 1EUIC 4NPBA 2H0HA 4AKZA 2I9WA 4HBRA 1SIIA 4HM7B 5EVHA 2F86B 2GU3A 1EG9B 2IYJA 2XGLA 4KZ1A 1TIJA 2H0IA 4K90B 1O7PB 1HZ1A 1GMRA 4HM8B 5AI1A 3SX1A 4H3UA 5BXQA 1M904 1O7NB 1MGRA 1UUGB 4EW5A 1DYUA 2L4VA 3DY5A 2C11A 2BMQB 3IJEB 1RJOA 4H61A 1MWUA 5ELJA 5KP1A 3U1WA 5FW5A 1RKYA 3GZXB 3NM7A 2IY2A 4OK0A 5A0OB 1FGOA 1YVBI 2J8XB 1MGWA 1C54A 2JDIH 5CF2A 1DETA 2QGUA 2IMJA 3CD63 4KT3B 2CFGA 3SVAA 1IQ8A 3E99A 1BRIA 1BOXA 4HAAA 1W00A 3UJMA 5BIRA 3S67A 5AYSC 1I3IA 1R4CA 2OOVA 1EQKA 1W01A 1LNIA 3BNCA 3WR2A 1B2UA 3WOEB 5IG4A 1VQ43 1D6YA 1GS3A 1NU3A 2O3OA 4K61A 2XEPA 2OTJ3 3FLJA 1YIJ3 1BRSA 4ORLA 1RN1A 2F4YA 3Q3FA 1GOUA 3NBJA 4XB5A 5M1AA 1RTUA 4BL2A 3Q2PA 1D6UA 3RGRA 4J5GA 2UUGC 5AYRB 1BANA 1B21A 2WOFA 3FGYA 3DZLA 3X42A 3KZTA 3DUKA 3EN8A 3PCRA 3T8UA 1SQWA 1ZS7A 2OQEC 3ROBA 3EB8A 3CCM3 2E2TA 3L0RA 4HKVB 3SLUA 1VQM3 1Q9EA 1YJ93 1BNFA 2RFRA 4OUQA 1UDII 1V58A 1RN7A 3AHSA 1OUNA 3T0UA 1YI23 1FUWA 1BRJA 3K5TA 3UNLA 3GZRA 5CF1A 1NB5I 5AIIA 3NBBA 5LC7A 4XM4A 1DVCA 2P38A 1RGKA 5JBSA 3OXAA 1IK3A 3I563 1Q814 5FGOA 4FMBA 1A2VA 2W9QA 2GSPA 4LYLB 1U8CB 2OCTA 1EKMA 1RRHA 2CG0A 3OV4A 4HM2B 4XBXA 1OHPA 2KCDA 1ZGXA 3OWUA 1BRNL 1RSNA 1BVIA 1W6GA 4LZIA 1W7CA 3B7CA 3NM2A 3NV0A 3FCSB 3GZYB 1W6CA 4EC6A 2D42A 3EF8A 3LTDA 4IT7A 1WQLB 1IVWA 1GOYA 1N9EA 4XDWA 3T8NA 5IG3A 3A76A 3HOHA 5I97A 1EA2A 1NDOB 1TFKA 3UB1A 2L1SA 2F5MA 1RGEA 2OOVC 1JBSA 1DMQA 2QIYA 3S29A 3STDA 3EJVA 1E97A 1RRLA 4FMAA 3HZPA 1IDPA 1WMOA 4WYKA 1GD3A 1STDA 3F40A 2CIUA 3IMAB 4U13A 1BSDA 1PFPA 1SIHA 1JV2B 2W2CA 2W0QA 4FCJA 4R9LA 3S28A 3SOAA 3WA2X 4Q53A 9RNTA 1FUTA 4L7KA 1STFI 1GY5A 3FF2A 3D5GA 3D79A 4X2OA 4MMXB 1B2XA 3LTCA 1MWTA 1AVLA 1EEJA 1NNVA 2LYXA 4HM5B 1VQL3 1QVG2 1SJWA 3LT8A 1RLSA 5G2GA 2FXTA 3DXOA 4HM3B 2YFLB 1RCLA 4MEIA 2BT3A 3FG4A 1BRGA 1B20A 1JB5A 5LC6A 1RGLA 5JPPA 3V92A 3DGLA 3BNBA 1E3RA 4RNTA 2GBWB 3AMOB 1GMPA 1RNTA 1B27A 2HOHA 3PZWA 5AEWB 3CCR3 4FR9A 2CFLA 3CPW2 5M19A 4HM0B 1I2FA
chains in the Genus database with same CATH topology
1TUHA 4OVMA 3ER7A 5AIFA 3CU3A 1Y4KA 3O8YA 2CHCA 2YFJB 5AIHA 4LSOA 1A67A 2ZL8A 1JB2A 4KFFA 2HMMB 2IUJA 1Q40A 3G0KA 4QWTA 1CEWI 1QVF2 4PEJA 3LMLA 4WHAA 3LTBA 2BHMA 2CWUA 1FGQA 1K734 4N6MA 2RGQA 3PYJA 1FGTA 3Q1CA 1KWIA 3I0YA 3QK9A 3LH4A 3NQZA 2Z6BA 1VQO3 4EV2A 2RCDA 2PZVA 1LVNA 1M9GA 2XRXB 3KSPA 3EBYA 3G713 3BLZA 1YJW3 2CW9A 2R4IA 3F8HA 1QAKA 3V99A 3SXXA 3CCV3 3DGNA 3KN4A 3MKIA 3NHXA 2P0XA 4HZBB 1Q40B 2W56A 4RNYA 1MNLA 4JF8A 2HMJB 3N54B 3CCL3 1NWWA 1W2B2 5IERA 1DMMA 1W4NA 1YJN3 3B4OA 1JNQA 3LT9A 3HIIA 4LEHA 3SEDA 2UX0A 2XSOB 2WO0A 3JUNA 3EX9A 3J7Yd 2ML5A 4BTWA 2LQVA 1FGMA 1A90A 2CFWA 1HKXA 3N9HA 2WGQA 4J9AA 4R80A 3MWZA 4CCVA 3K0ZA 4KFEA 5CLKA 1FGRA 2CWTA 4L8OA 1SPUA 1GY7A 1VQ53 2Z77A 1IT7A 3FF0A 1YIT3 1IVXA 1VQP3 1ZX2A 1IV7A 1QMAA 3HI7A 3D3LA 2OTL3 2W56B 1JRQA 2PNCA 1YGEA 2GU1A 1ULIB 4MJDA 5D83A 4NREA 3LZAA 2BO9B 2STDA 3EN1B 1VQ63 3NX0A 3FZWA 2XFTA 3F7SA 3CNMA 3K9MC 4FCMA 1C7HA 2YFIB 3PS8A 1JB4A 1UI7A 1N9JA 5IG0A 1IVVA 2W6JH 2E2UA 3NXJA 4EBGA 1UI8A 1O7GB 3F14A 4GL6A 1GYBA 3H51A 1AVKA 2ZDJA 2M7OA 1O7MB 2O9UX 4BTXA 3DMCA 1IQYA 1F8NA 4FMCA 1DVDA 1VQN3 2IUKA 2XGNA 2KXGA 3FG3A 3LTAA 3LOYA 3BB9A 3DGMA 3WA3A 4XBTA 3KE7A 4TX4A 1NJI4 1GY6A 3KSED 5DREA 3GAXA 3KKGA 1J2BA 1OF5A 1OCVA 3JUOA 4STDA 3QRDA 1JKGA 3VGNA 3DGOA 1Z1SA 2GXFA 3ECFA 4I4KA 2P05A 1ISKA 3NV0B 2JQ5A 1UUVB 1LNHA 3X3ZA 5EQLA 5IEPA 1OHSA 2Q07A 4CDLA 3G6E3 3B4PA 1US1A 3BNDA 2XF3A 1IT8A 2CFDA 4LMIA 3PGBA 3UL6A 3CC23 3JUQA 4WFOA 1BUQA 3EQQB 3HIGA 2OWPA 2BNGA 3CPOA 6STDA 3M8CA 4N6OB 1TU5A 1AV4A 1W5ZA 4MMYB 1PU4A 1LOXA 2YX9A 1QJGA 4WYKB 1OF5B 1CYVA 3VSYA 1WMNA 4EXRA 2CH9A 3ALAA 3CCU3 2IA7A 1JJ22 4R4KA 3G8ZA 3SOYA 4BTYA 2XR8B 2HMNB 1VQK3 1IV9A 5JPUA 3JUPA 5BVBA 1S5AA 3DM8A 1W2ZA 2K0MA 1IVUA 2HMOB 1U5OA 4RNZA 3CCQ3 1VQ73 4O3VA 1IQXA 1ROAA 2MC8A 2GBXB 3U97A 1LXEA 1OH0A 2W03A 3TDGA 3FSDA 1S723 4N6UA 5EEOA 4GB5A 4O02B 1QAFA 2CK3H 1OPYA 1QALA 3F7XA 1K9M4 2P09A 5ELUA 2BMRB 4K1UA 4N6V0 3F9SA 1K41A 3CNXA 3MHEA 1N8QA 4L8PA 1VQ83 4K1VA 2XSHB 3FKAA 1JN5A 1K28A 4MMZB 4EYCA 2INXA 1CYUA 4WWUC 3VF1A 1UW1A 1W6YA 4RBNA 1NB3I 3S5CA 2W04A 3RDEA 3EE1A 3CCS3 1TFOA 3EC9A 1CQSA 2BMOB 3CC73 1WNHA 3X3XA 1N5PA 5HGRA 2B1XB 1KC84 3OX9A 4HM1B 2FNQA 4XDVA 4AEQA 4KVHA 2XFSA 1ASKA 1Q42A 3BNEA 3HK4A 5CK6A 5KP4A 1ROVA 1T5YA 4HVNA 3MSOA 4O2HA 2MF7A 3B8LA 3HX8A 3G16A 2Z76A 3X3YA 4IPBA 3IPTA 1JN5B 1W02A 4FMDA 1E3VA 1M1XB 2F99A 1YHQ3 1A2KA 3S27A 3WDGB 5IEOA 5AIGA 1MOLA 5TGNA 3CXC2 3KIIA 3OW22 3UL5A 3PCSA 5CXOA 3WOFB 3X41A 4HM6B 1Q824 3EHCA 3K63A 3OWSA 4RZMA 1OGXA 1KQS2 4R1KA 1D6ZA 3GRDA 3CMA3 1K8A4 2KRTA 1HU9A 1O7HB 4AKYA 4ZM8A 4X2HA 2RSXA 3N8BA 3WMDA 2Y74A 3MYTA 2QEX3 1FA3A 7STDA 3OWYA 5D82A 1ULJB 2F98A 2W9PA 2WOHA 2CC3A 3MPHA 3H3HA 2GEXA 2A15A 1KSIA 2V1LA 1N8R4 2E2VA 2B24B 4FCZA 1GD4A 5STDA 3JUMA 3GZBA 1O7WB 5IF6A 4WP5A 3MG2A 4IIAA 4N6NB 4N3VA 4N6TA 5DRVA 3K7CA 1N5HA 3EBTA 2ML6A 5IG5A 1TP6A 2D1WA 1Q864 3CC43 2CG1A 4HM4B 1G96A 4HZ9B 3AMOA 3FH1A 1AR0A 4HYZA 3FG1A 3I553 4G1MB 3X40A 4XBYA 4JRFA 3F8XA 4LGQA 3GWRA 3Q90A 3JVCA 4R9KA 4N6LA 1NO3A 3G4S3 2P0MA 3CCJ3 3MG3A 1JKGB 3D9RA 1IU7A 2CKFB 5IW9A 1ZO2A 3NUVA 1OGZA 3WODG 3CME3 1DMNA 1Q7Y4 3PXMA 8CHOA 2HMLB 1WMPA 3NQYA 4KFDA 5AEUB 3LYGA 3KFQC 3V98A 1UUWB 1VQ93 4HJLB 2CFKA 1VZZA 3RGAA 1KD14 2GEYA 2XH9A 3LXUX 2K54A 1L5GB 4J8TA 2Z7AA 2WGOA 2Y73A 2CWVA 2OQEA 3CCE3 4O8SA 1WTHA 1OACA 2HMKB 2SBLA 3NBRA 5IENA 5D81A 1V74A 2FGTA 4NHFA 4EV5A 1M1K4 5KP3A 1OHOA 3MG1A 2C10A 2QA43 4AKZA 2I9WA 4HBRA 1SIIA 4HM7B 5EVHA 2F86B 2GU3A 1EG9B 2XGLA 4KZ1A 1TIJA 4K90B 1O7PB 4HM8B 5AI1A 3SX1A 5BXQA 4H3UA 1M904 1O7NB 1DYUA 2L4VA 3DY5A 2C11A 2BMQB 3IJEB 1RJOA 4H61A 5ELJA 5KP1A 3U1WA 5FW5A 1RKYA 3GZXB 3NM7A 4OK0A 5A0OB 1FGOA 1YVBI 2JDIH 5CF2A 2QGUA 2IMJA 3CD63 2CFGA 3SVAA 1IQ8A 3E99A 1W00A 3UJMA 3S67A 5AYSC 1R4CA 2OOVA 1EQKA 1W01A 3BNCA 5IG4A 3WOEB 1VQ43 1D6YA 1GS3A 1NU3A 2O3OA 4K61A 2XEPA 2OTJ3 3FLJA 1YIJ3 4ORLA 4XB5A 3NBJA 3Q2PA 1D6UA 3RGRA 3X42A 5AYRB 2WOFA 3FGYA 3DZLA 3KZTA 3DUKA 3EN8A 3PCRA 3T8UA 1SQWA 2OQEC 3ROBA 3EB8A 3CCM3 2E2TA 3L0RA 4HKVB 3SLUA 1VQM3 1YJ93 2RFRA 4OUQA 1RN7A 1OUNA 3T0UA 1YI23 1FUWA 3K5TA 3UNLA 3GZRA 5CF1A 1NB5I 5AIIA 3NBBA 5LC7A 4XM4A 1DVCA 2P38A 5JBSA 3OXAA 1IK3A 3I563 1Q814 5FGOA 4FMBA 1A2VA 2W9QA 1U8CB 2OCTA 1EKMA 1RRHA 2CG0A 3OV4A 4HM2B 4XBXA 1OHPA 2KCDA 3OWUA 1W6GA 4LZIA 1W7CA 3B7CA 3NM2A 3NV0A 3FCSB 3GZYB 1W6CA 4EC6A 2D42A 3EF8A 3LTDA 4IT7A 1WQLB 1IVWA 1N9EA 4XDWA 3T8NA 5IG3A 3A76A 5I97A 1EA2A 1NDOB 1TFKA 3UB1A 2OOVC 1DMQA 2QIYA 3S29A 3STDA 3EJVA 1E97A 1RRLA 4FMAA 3HZPA 1IDPA 1WMOA 4WYKA 1GD3A 1STDA 3F40A 2CIUA 3IMAB 4U13A 1PFPA 1SIHA 1JV2B 2W2CA 2W0QA 4FCJA 4R9LA 3S28A 3SOAA 3WA2X 4Q53A 4L7KA 1STFI 1GY5A 3FF2A 4X2OA 4MMXB 3LTCA 1AVLA 2LYXA 4HM5B 1VQL3 1QVG2 1SJWA 3LT8A 5G2GA 2FXTA 3DXOA 4HM3B 2YFLB 4MEIA 2BT3A 3FG4A 1JB5A 5LC6A 5JPPA 3V92A 3DGLA 3BNBA 1E3RA 2GBWB 3AMOB 5AEWB 3CCR3 3PZWA 4FR9A 2CFLA 3CPW2 4HM0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUH A;  4OVM A;  3ER7 A;  5AIF A;  3CU3 A;  2CHC A;  2YFJ B;  5AIH A;  1JB2 A;  2HMM B;  1Q40 A;  3G0K A;  4PEJ A;  2RGQ A;  3I0Y A;  2RCD A;  2PZV A;  2XRX B;  3KSP A;  3EBY A;  3BLZ A;  2R4I A;  3F8H A;  3MKI A;  3NHX A;  4HZB B;  1Q40 B;  2HMJ B;  1NWW A;  5IER A;  1DMM A;  3B4O A;  4LEH A;  3SED A;  2UX0 A;  2XSO B;  3JUN A;  3EX9 A;  1HKX A;  4J9A A;  3K0Z A;  5CLK A;  4L8O A;  1GY7 A;  2Z77 A;  3FF0 A;  1ZX2 A;  1QMA A;  1ULI B;  4MJD A;  5D83 A;  3LZA A;  2STD A;  3EN1 B;  3FZW A;  3F7S A;  3CNM A;  4FCM A;  1C7H A;  2YFI B;  1JB4 A;  5IG0 A;  3NXJ A;  1O7G B;  3F14 A;  1GYB A;  3H51 A;  1O7M B;  3DMC A;  3BB9 A;  4XBT A;  3KE7 A;  1GY6 A;  5DRE A;  3KKG A;  1OF5 A;  1OCV A;  3JUO A;  4STD A;  1JKG A;  3VGN A;  1Z1S A;  2GXF A;  3ECF A;  4I4K A;  1ISK A;  3NV0 B;  2JQ5 A;  1UUV B;  5IEP A;  1OHS A;  4CDL A;  3B4P A;  4LMI A;  3JUQ A;  1BUQ A;  3EQQ B;  2OWP A;  2BNG A;  3CPO A;  6STD A;  3M8C A;  1QJG A;  4WYK B;  1OF5 B;  3VSY A;  3G8Z A;  3SOY A;  2XR8 B;  2HMN B;  5JPU A;  3JUP A;  5BVB A;  1S5A A;  3DM8 A;  2HMO B;  1U5O A;  2GBX B;  1OH0 A;  3FSD A;  4GB5 A;  1OPY A;  3F7X A;  2BMR B;  4K1U A;  3F9S A;  1K41 A;  3CNX A;  3MHE A;  4L8P A;  4K1V A;  2XSH B;  3FKA A;  1JN5 A;  2INX A;  4WWU C;  1W6Y A;  3S5C A;  3EC9 A;  1CQS A;  2BMO B;  5HGR A;  2B1X B;  3OX9 A;  4HM1 B;  4XDV A;  4KVH A;  1ASK A;  1Q42 A;  5CK6 A;  3HK4 A;  5KP4 A;  4HVN A;  3MSO A;  3B8L A;  3HX8 A;  3G16 A;  2Z76 A;  3IPT A;  1JN5 B;  1W02 A;  1E3V A;  2F99 A;  1A2K A;  5IEO A;  5AIG A;  5TGN A;  5CXO A;  4HM6 B;  3EHC A;  3OWS A;  4RZM A;  1OGX A;  4R1K A;  3GRD A;  1O7H B;  4X2H A;  3WMD A;  3MYT A;  7STD A;  3OWY A;  5D82 A;  1ULJ B;  2F98 A;  3H3H A;  2GEX A;  2A15 A;  2B24 B;  5STD A;  3JUM A;  3GZB A;  1O7W B;  5IF6 A;  4WP5 A;  3MG2 A;  4IIA A;  4N3V A;  5DRV A;  3K7C A;  3EBT A;  5IG5 A;  1TP6 A;  4HM4 B;  4HZ9 B;  3FH1 A;  1AR0 A;  4XBY A;  3F8X A;  4LGQ A;  3GWR A;  3Q90 A;  4R9K A;  3MG3 A;  1JKG B;  3D9R A;  2CKF B;  1ZO2 A;  3NUV A;  1OGZ A;  1DMN A;  8CHO A;  2HML B;  5AEU B;  3LYG A;  1UUW B;  4HJL B;  3RGA A;  1VZZ A;  2GEY A;  2K54 A;  4J8T A;  2Z7A A;  2HMK B;  3NBR A;  5IEN A;  5D81 A;  5KP3 A;  1OHO A;  3MG1 A;  2I9W A;  4HM7 B;  5EVH A;  2F86 B;  1EG9 B;  1O7P B;  4HM8 B;  5AI1 A;  5BXQ A;  4H3U A;  1O7N B;  2BMQ B;  5KP1 A;  5FW5 A;  3GZX B;  5CF2 A;  2QGU A;  2IMJ A;  3E99 A;  1W00 A;  3UJM A;  1W01 A;  5IG4 A;  1GS3 A;  1NU3 A;  3FLJ A;  4ORL A;  4XB5 A;  3RGR A;  3FGY A;  3DZL A;  3KZT A;  3DUK A;  3EN8 A;  3T8U A;  3ROB A;  4HKV B;  2RFR A;  4OUQ A;  1OUN A;  3UNL A;  3GZR A;  5CF1 A;  5AII A;  4XM4 A;  3OXA A;  4HM2 B;  3OV4 A;  4XBX A;  1OHP A;  3OWU A;  3B7C A;  3NM2 A;  3NV0 A;  3GZY B;  3EF8 A;  1WQL B;  4XDW A;  3T8N A;  5IG3 A;  3A76 A;  1EA2 A;  1NDO B;  1DMQ A;  2QIY A;  3STD A;  3EJV A;  1E97 A;  3HZP A;  1IDP A;  4WYK A;  1STD A;  3F40 A;  4U13 A;  2W2C A;  4FCJ A;  4R9L A;  3SOA A;  4Q53 A;  4L7K A;  1GY5 A;  3FF2 A;  4X2O A;  4HM5 B;  1SJW A;  5G2G A;  3DXO A;  4HM3 B;  2YFL B;  1JB5 A;  5JPP A;  1E3R A;  2GBW B;  5AEW B;  4HM0 B; 
#chains in the Genus database with same CATH topology
 1TUH A;  4OVM A;  3ER7 A;  5AIF A;  3CU3 A;  1Y4K A;  8RNT A;  1I3F A;  2KF3 A;  3O8Y A;  2CHC A;  2YFJ B;  5AIH A;  4GSP A;  4LSO A;  1A67 A;  4DKI A;  2ZL8 A;  1JB2 A;  4KFF A;  2CX0 A;  2HMM B;  2IUJ A;  1Q40 A;  1Q7H A;  3G0K A;  1UCJ A;  4QWT A;  1BNI A;  1CEW I;  1QVF 2;  4PEJ A;  5G1K A;  3LML A;  4WHA A;  3LTB A;  2BHM A;  2CWU A;  1FGQ A;  1K73 4;  4N6M A;  2RGQ A;  3PYJ A;  1FGT A;  3Q1C A;  1KWI A;  3I0Y A;  3QK9 A;  3LH4 A;  1RN4 A;  2Z6B A;  3NQZ A;  1VQO 3;  6GSP A;  4EV2 A;  2RCD A;  2PZV A;  1LVN A;  1M9G A;  2XRX B;  3KSP A;  3ZG5 A;  4GHO A;  3EBY A;  3G71 3;  3BLZ A;  1YJW 3;  2CW9 A;  2R4I A;  3F8H A;  1QAK A;  1RGC A;  3V99 A;  3SXX A;  1VQQ A;  3CCV 3;  3DGN A;  3KN4 A;  3MKI A;  3DH2 A;  3NHX A;  2P0X A;  4HZB B;  1Q40 B;  2W56 A;  4RNY A;  1YNV X;  1MNL A;  2KF4 A;  4JF8 A;  2HMJ B;  3N54 B;  3CCL 3;  1NWW A;  1W2B 2;  1BNE A;  5IER A;  1DMM A;  1W4N A;  1YJN 3;  1FUS A;  1JNQ A;  3B4O A;  3LT9 A;  3HII A;  4LEH A;  2F56 A;  3SED A;  2UX0 A;  2XSO B;  2WO0 A;  1BU4 A;  3EX9 A;  3JUN A;  2ML5 A;  3J7Y d;  1SAR A;  2LQV A;  4BTW A;  1I2G A;  1FGM A;  1A90 A;  2CFW A;  1BRH A;  1HKX A;  3N9H A;  2WGQ A;  4J9A A;  1B2Z A;  3MWZ A;  4R80 A;  2KF5 A;  3K0Z A;  4KFE A;  5G1L A;  5CLK A;  1FGR A;  2CWT A;  2KF6 A;  4CCV A;  4L8O A;  1SPU A;  1GY7 A;  1VQ5 3;  2Z77 A;  3SYU A;  1IT7 A;  3FF0 A;  1YIT 3;  1IVX A;  1B2M A;  1VQP 3;  1ZX2 A;  1IV7 A;  1QMA A;  3HI7 A;  1IYY A;  3D3L A;  2OTL 3;  2W56 B;  5GSP A;  2R41 A;  1JRQ A;  1BNR A;  1V57 A;  2H0G A;  1YGE A;  2PNC A;  1UGH I;  2GU1 A;  1ULI B;  4MJD A;  1FZU A;  1TRP A;  4NRE A;  3LZA A;  5D83 A;  2BO9 B;  2STD A;  3EN1 B;  1VQ6 3;  1BUJ A;  3NX0 A;  3FZW A;  2XFT A;  3F7S A;  3CNM A;  3K9M C;  4FCM A;  4ILF A;  1C7H A;  2YFI B;  3PS8 A;  1JB4 A;  1UI7 A;  1N9J A;  5IG0 A;  1IVV A;  2W6J H;  2E2U A;  3NXJ A;  4EBG A;  1UI8 A;  1O7G B;  2K3D A;  1AQZ A;  4J5K A;  3F14 A;  4GL6 A;  1DE3 A;  1GYB A;  1X1X A;  1LRA A;  1T2I A;  3H51 A;  1AVK A;  2ZDJ A;  2M7O A;  1O7M B;  2O9U X;  4BTX A;  1JBT A;  3DMC A;  1IQY A;  1F8N A;  4FMC A;  1A2P A;  1DVD A;  1VQN 3;  2IUK A;  2XGN A;  2KXG A;  3FG3 A;  3LTA A;  1G0T A;  3LOY A;  3BB9 A;  3DGM A;  3WA3 A;  4XBT A;  3KE7 A;  4TX4 A;  1NJI 4;  1GY6 A;  1BNG A;  3KSE D;  3GAX A;  3KKG A;  5DRE A;  1J2B A;  1OF5 A;  1OCV A;  1RGG A;  3JUO A;  4STD A;  2BU4 A;  3QRD A;  1JKG A;  3VGN A;  3DGO A;  1Z1S A;  2GXF A;  3ECF A;  4I4K A;  1TRQ A;  2P05 A;  1ISK A;  3NV0 B;  2JQ5 A;  1UUV B;  1LNH A;  1BNJ A;  3D5I A;  5EQL A;  3URP A;  3X3Z A;  5IEP A;  1OHS A;  2Q07 A;  4CDL A;  3G6E 3;  3B4P A;  1US1 A;  3BND A;  5RNT A;  2XF3 A;  1RNB A;  1IT8 A;  2CFD A;  4LMI A;  3WHO A;  3PGB A;  3UL6 A;  3CC2 3;  3JUQ A;  4WFO A;  1BUQ A;  1X1W A;  3EQQ B;  3HIG A;  2OWP A;  1R4Y A;  2BNG A;  3CPO A;  3RNT A;  2AAD A;  6STD A;  3M8C A;  4N6O B;  1TU5 A;  1AV4 A;  1W5Z A;  6RNT A;  1RHL A;  4MMY B;  1PU4 A;  1LOX A;  1UCK A;  2YX9 A;  1QJG A;  4WYK B;  2AAE A;  1OF5 B;  1CYV A;  1UCL A;  3VSY A;  1WMN A;  1MWS A;  2CH9 A;  4EXR A;  3ALA A;  3CCU 3;  2IA7 A;  3KCH A;  2F5W A;  1JJ2 2;  4HOH A;  1I8V A;  3G8Z A;  4R4K A;  2XR8 B;  2HMN B;  3SOY A;  4BTY A;  1VQK 3;  1IV9 A;  5JPU A;  3JUP A;  5BVB A;  5BU4 A;  1RDS A;  1S5A A;  1LOY A;  3DM8 A;  1W2Z A;  1BGS A;  2K0M A;  1IVU A;  3D4A A;  3ZG0 A;  1FW7 A;  2HMO B;  1U5O A;  4RNZ A;  3CCQ 3;  1VQ7 3;  4O3V A;  4BU4 A;  1FYS A;  1IQX A;  1ROA A;  2MC8 A;  2GBX B;  3U97 A;  1LXE A;  1OH0 A;  2W03 A;  3TDG A;  1I2E A;  1RGF A;  3FSD A;  1S72 3;  4N6U A;  5EEO A;  4GB5 A;  4O02 B;  1QAF A;  2CK3 H;  1GSP A;  1OPY A;  1QAL A;  3F7X A;  1K9M 4;  2P09 A;  1GMQ A;  5ELU A;  2BMR B;  4K1U A;  4N6V 0;  3AGO A;  3F9S A;  4BIR A;  1K41 A;  3CNX A;  3MHE A;  1N8Q A;  1RMS A;  1BSA A;  3BIR A;  4L8P A;  1VQ8 3;  3DGY A;  3GSP A;  4K1V A;  2XSH B;  3FKA A;  1JN5 A;  1K28 A;  4MMZ B;  4EYC A;  2INX A;  1CYU A;  4WWU C;  3VF1 A;  1UW1 A;  1W6Y A;  4RBN A;  1NB3 I;  3S5C A;  2W04 A;  3RDE A;  1LOV A;  3ZFZ A;  3EE1 A;  3CCS 3;  1TFO A;  1I0V A;  3EC9 A;  1CQS A;  2BMO B;  2ZHX B;  3CC7 3;  1WNH A;  3X3X A;  1N5P A;  5HGR A;  1CH0 A;  2B1X B;  1KC8 4;  1LQG C;  3OX9 A;  2FNQ A;  4HM1 B;  2SAR A;  4XDV A;  4AEQ A;  2CX1 A;  4KVH A;  2XFS A;  1ASK A;  1Q42 A;  3BNE A;  3HK4 A;  1RGH A;  1BRK A;  5CK6 A;  5KP4 A;  1ROV A;  1T5Y A;  4HVN A;  3MSO A;  4O2H A;  2MF7 A;  3B8L A;  3HX8 A;  3G16 A;  2Z76 A;  5M18 A;  3X3Y A;  4IPB A;  3IPT A;  1JN5 B;  1W02 A;  4FMD A;  1E3V A;  1M1X B;  3AHW A;  2F99 A;  1YHQ 3;  1A2K A;  2ZA4 A;  3S27 A;  3WDG B;  5IEO A;  1I0X A;  5AIG A;  1MOL A;  1RCK A;  5TGN A;  3CXC 2;  3KII A;  3OW2 2;  3UL5 A;  7RNT A;  7GSP A;  3PCS A;  5CXO A;  3WOF B;  3X41 A;  1I70 A;  5HOH A;  1JBR A;  3BU4 A;  4HM6 B;  1Q82 4;  3EHC A;  3K63 A;  2RBI A;  3OWS A;  4CJN A;  4RZM A;  1OGX A;  1KQS 2;  4R1K A;  1D6Z A;  1X1U A;  1BSB A;  3GRD A;  1K8A 4;  2KRT A;  3CMA 3;  1HU9 A;  1T2H A;  1O7H B;  4AKY A;  4ZM8 A;  4X2H A;  2RSX A;  3N8B A;  1UCI A;  4I5Q A;  3WMD A;  1GOV A;  2Y74 A;  2UGI A;  3MYT A;  2QEX 3;  7STD A;  1FA3 A;  1YGW A;  3OWY A;  5D82 A;  1LQM B;  1HYF A;  1ULJ B;  2F98 A;  2RNT A;  2W9P A;  2WOH A;  2CC3 A;  3MPH A;  3H3H A;  2GEX A;  1UGI A;  2A15 A;  1KSI A;  2BIR A;  2V1L A;  2E2V A;  2B24 B;  1N8R 4;  4FCZ A;  1GD4 A;  1YVS A;  5STD A;  3JUM A;  3GZB A;  1O7W B;  1AY7 A;  4WP5 A;  5IF6 A;  3MG2 A;  4IIA A;  4N6N B;  4N3V A;  4N6T A;  5DRV A;  3K7C A;  1N5H A;  3EBT A;  2ML6 A;  5IG5 A;  1TP6 A;  2D1W A;  1Q86 4;  3CC4 3;  2CG1 A;  4HM4 B;  1G96 A;  3AGN A;  4HZ9 B;  3AMO A;  3FH1 A;  1AR0 A;  4HYZ A;  3FG1 A;  3I55 3;  1BSE A;  1TTO A;  1RGA A;  2KAA A;  4G1M B;  3X40 A;  1G02 A;  4XBY A;  4JRF A;  3F8X A;  4LGQ A;  3GWR A;  3Q90 A;  3JVC A;  4R9K A;  4N6L A;  1NO3 A;  3G4S 3;  2P0M A;  3CCJ 3;  3MG3 A;  1JKG B;  3D9R A;  1IU7 A;  1TJD A;  2CKF B;  5IW9 A;  1ZO2 A;  3NUV A;  1BIR A;  1OGZ A;  3WOD G;  4BL3 A;  3CME 3;  1DMN A;  1Q7Y 4;  3PXM A;  8CHO A;  2HML B;  1WMP A;  1BSC A;  3NQY A;  4KFD A;  1B3S A;  1PYL A;  3A5E A;  5AEU B;  1LOW A;  1PY3 A;  1X1Y A;  3KFQ C;  3LYG A;  3V98 A;  1UUW B;  1VQ9 3;  1JZD A;  1T3B A;  4HJL B;  2CFK A;  1VZZ A;  3RGA A;  1KD1 4;  1BAO A;  2GEY A;  2XH9 A;  3LXU X;  2K54 A;  1L5G B;  4J8T A;  2Z7A A;  2WGO A;  2C4B A;  2Y73 A;  2CWV A;  4CPK A;  2OQE A;  1BNS A;  4O8S A;  3CCE 3;  1WTH A;  1OAC A;  2HMK B;  2SBL A;  3NBR A;  5IEN A;  5D81 A;  1V74 A;  1JZO A;  2FGT A;  4NHF A;  4EV5 A;  1M1K 4;  1B2S A;  5KP3 A;  1OHO A;  3MG1 A;  1MWR A;  2C10 A;  2QA4 3;  1EUI C;  4NPB A;  2H0H A;  4AKZ A;  2I9W A;  4HBR A;  1SII A;  4HM7 B;  5EVH A;  2F86 B;  2GU3 A;  1EG9 B;  2IYJ A;  2XGL A;  4KZ1 A;  1TIJ A;  2H0I A;  4K90 B;  1O7P B;  1HZ1 A;  1GMR A;  4HM8 B;  5AI1 A;  3SX1 A;  4H3U A;  5BXQ A;  1M90 4;  1O7N B;  1MGR A;  1UUG B;  4EW5 A;  1DYU A;  2L4V A;  3DY5 A;  2C11 A;  2BMQ B;  3IJE B;  1RJO A;  4H61 A;  1MWU A;  5ELJ A;  5KP1 A;  3U1W A;  5FW5 A;  1RKY A;  3GZX B;  3NM7 A;  2IY2 A;  4OK0 A;  5A0O B;  1FGO A;  1YVB I;  2J8X B;  1MGW A;  1C54 A;  2JDI H;  5CF2 A;  1DET A;  2QGU A;  2IMJ A;  3CD6 3;  4KT3 B;  2CFG A;  3SVA A;  1IQ8 A;  3E99 A;  1BRI A;  1BOX A;  4HAA A;  1W00 A;  3UJM A;  5BIR A;  3S67 A;  5AYS C;  1I3I A;  1R4C A;  2OOV A;  1EQK A;  1W01 A;  1LNI A;  3BNC A;  3WR2 A;  1B2U A;  3WOE B;  5IG4 A;  1VQ4 3;  1D6Y A;  1GS3 A;  1NU3 A;  2O3O A;  4K61 A;  2XEP A;  2OTJ 3;  3FLJ A;  1YIJ 3;  1BRS A;  4ORL A;  1RN1 A;  2F4Y A;  3Q3F A;  1GOU A;  3NBJ A;  4XB5 A;  5M1A A;  1RTU A;  4BL2 A;  3Q2P A;  1D6U A;  3RGR A;  4J5G A;  2UUG C;  5AYR B;  1BAN A;  1B21 A;  2WOF A;  3FGY A;  3DZL A;  3X42 A;  3KZT A;  3DUK A;  3EN8 A;  3PCR A;  3T8U A;  1SQW A;  1ZS7 A;  2OQE C;  3ROB A;  3EB8 A;  3CCM 3;  2E2T A;  3L0R A;  4HKV B;  3SLU A;  1VQM 3;  1Q9E A;  1YJ9 3;  1BNF A;  2RFR A;  4OUQ A;  1UDI I;  1V58 A;  1RN7 A;  3AHS A;  1OUN A;  3T0U A;  1YI2 3;  1FUW A;  1BRJ A;  3K5T A;  3UNL A;  3GZR A;  5CF1 A;  1NB5 I;  5AII A;  3NBB A;  5LC7 A;  4XM4 A;  1DVC A;  2P38 A;  1RGK A;  5JBS A;  3OXA A;  1IK3 A;  3I56 3;  1Q81 4;  5FGO A;  4FMB A;  1A2V A;  2W9Q A;  2GSP A;  4LYL B;  1U8C B;  2OCT A;  1EKM A;  1RRH A;  2CG0 A;  3OV4 A;  4HM2 B;  4XBX A;  1OHP A;  2KCD A;  1ZGX A;  3OWU A;  1BRN L;  1RSN A;  1BVI A;  1W6G A;  4LZI A;  1W7C A;  3B7C A;  3NM2 A;  3NV0 A;  3FCS B;  3GZY B;  1W6C A;  4EC6 A;  2D42 A;  3EF8 A;  3LTD A;  4IT7 A;  1WQL B;  1IVW A;  1GOY A;  1N9E A;  4XDW A;  3T8N A;  5IG3 A;  3A76 A;  3HOH A;  5I97 A;  1EA2 A;  1NDO B;  1TFK A;  3UB1 A;  2L1S A;  2F5M A;  1RGE A;  2OOV C;  1JBS A;  1DMQ A;  2QIY A;  3S29 A;  3STD A;  3EJV A;  1E97 A;  1RRL A;  4FMA A;  3HZP A;  1IDP A;  1WMO A;  4WYK A;  1GD3 A;  1STD A;  3F40 A;  2CIU A;  3IMA B;  4U13 A;  1BSD A;  1PFP A;  1SIH A;  1JV2 B;  2W2C A;  2W0Q A;  4FCJ A;  4R9L A;  3S28 A;  3SOA A;  3WA2 X;  4Q53 A;  9RNT A;  1FUT A;  4L7K A;  1STF I;  1GY5 A;  3FF2 A;  3D5G A;  3D79 A;  4X2O A;  4MMX B;  1B2X A;  3LTC A;  1MWT A;  1AVL A;  1EEJ A;  1NNV A;  2LYX A;  4HM5 B;  1VQL 3;  1QVG 2;  1SJW A;  3LT8 A;  1RLS A;  5G2G A;  2FXT A;  3DXO A;  4HM3 B;  2YFL B;  1RCL A;  4MEI A;  2BT3 A;  3FG4 A;  1BRG A;  1B20 A;  1JB5 A;  5LC6 A;  1RGL A;  5JPP A;  3V92 A;  3DGL A;  3BNB A;  1E3R A;  4RNT A;  2GBW B;  3AMO B;  1GMP A;  1RNT A;  1B27 A;  2HOH A;  3PZW A;  5AEW B;  3CCR 3;  4FR9 A;  2CFL A;  3CPW 2;  5M19 A;  4HM0 B;  1I2F A; 
#chains in the Genus database with same CATH homology
 1TUH A;  4OVM A;  3ER7 A;  5AIF A;  3CU3 A;  1Y4K A;  3O8Y A;  2CHC A;  2YFJ B;  5AIH A;  4LSO A;  1A67 A;  2ZL8 A;  1JB2 A;  4KFF A;  2HMM B;  2IUJ A;  1Q40 A;  3G0K A;  4QWT A;  1CEW I;  1QVF 2;  4PEJ A;  3LML A;  4WHA A;  3LTB A;  2BHM A;  2CWU A;  1FGQ A;  1K73 4;  4N6M A;  2RGQ A;  3PYJ A;  1FGT A;  3Q1C A;  1KWI A;  3I0Y A;  3QK9 A;  3LH4 A;  3NQZ A;  2Z6B A;  1VQO 3;  4EV2 A;  2RCD A;  2PZV A;  1LVN A;  1M9G A;  2XRX B;  3KSP A;  3EBY A;  3G71 3;  3BLZ A;  1YJW 3;  2CW9 A;  2R4I A;  3F8H A;  1QAK A;  3V99 A;  3SXX A;  3CCV 3;  3DGN A;  3KN4 A;  3MKI A;  3NHX A;  2P0X A;  4HZB B;  1Q40 B;  2W56 A;  4RNY A;  1MNL A;  4JF8 A;  2HMJ B;  3N54 B;  3CCL 3;  1NWW A;  1W2B 2;  5IER A;  1DMM A;  1W4N A;  1YJN 3;  3B4O A;  1JNQ A;  3LT9 A;  3HII A;  4LEH A;  3SED A;  2UX0 A;  2XSO B;  2WO0 A;  3JUN A;  3EX9 A;  3J7Y d;  2ML5 A;  4BTW A;  2LQV A;  1FGM A;  1A90 A;  2CFW A;  1HKX A;  3N9H A;  2WGQ A;  4J9A A;  4R80 A;  3MWZ A;  4CCV A;  3K0Z A;  4KFE A;  5CLK A;  1FGR A;  2CWT A;  4L8O A;  1SPU A;  1GY7 A;  1VQ5 3;  2Z77 A;  1IT7 A;  3FF0 A;  1YIT 3;  1IVX A;  1VQP 3;  1ZX2 A;  1IV7 A;  1QMA A;  3HI7 A;  3D3L A;  2OTL 3;  2W56 B;  1JRQ A;  2PNC A;  1YGE A;  2GU1 A;  1ULI B;  4MJD A;  5D83 A;  4NRE A;  3LZA A;  2BO9 B;  2STD A;  3EN1 B;  1VQ6 3;  3NX0 A;  3FZW A;  2XFT A;  3F7S A;  3CNM A;  3K9M C;  4FCM A;  1C7H A;  2YFI B;  3PS8 A;  1JB4 A;  1UI7 A;  1N9J A;  5IG0 A;  1IVV A;  2W6J H;  2E2U A;  3NXJ A;  4EBG A;  1UI8 A;  1O7G B;  3F14 A;  4GL6 A;  1GYB A;  3H51 A;  1AVK A;  2ZDJ A;  2M7O A;  1O7M B;  2O9U X;  4BTX A;  3DMC A;  1IQY A;  1F8N A;  4FMC A;  1DVD A;  1VQN 3;  2IUK A;  2XGN A;  2KXG A;  3FG3 A;  3LTA A;  3LOY A;  3BB9 A;  3DGM A;  3WA3 A;  4XBT A;  3KE7 A;  4TX4 A;  1NJI 4;  1GY6 A;  3KSE D;  5DRE A;  3GAX A;  3KKG A;  1J2B A;  1OF5 A;  1OCV A;  3JUO A;  4STD A;  3QRD A;  1JKG A;  3VGN A;  3DGO A;  1Z1S A;  2GXF A;  3ECF A;  4I4K A;  2P05 A;  1ISK A;  3NV0 B;  2JQ5 A;  1UUV B;  1LNH A;  3X3Z A;  5EQL A;  5IEP A;  1OHS A;  2Q07 A;  4CDL A;  3G6E 3;  3B4P A;  1US1 A;  3BND A;  2XF3 A;  1IT8 A;  2CFD A;  4LMI A;  3PGB A;  3UL6 A;  3CC2 3;  3JUQ A;  4WFO A;  1BUQ A;  3EQQ B;  3HIG A;  2OWP A;  2BNG A;  3CPO A;  6STD A;  3M8C A;  4N6O B;  1TU5 A;  1AV4 A;  1W5Z A;  4MMY B;  1PU4 A;  1LOX A;  2YX9 A;  1QJG A;  4WYK B;  1OF5 B;  1CYV A;  3VSY A;  1WMN A;  4EXR A;  2CH9 A;  3ALA A;  3CCU 3;  2IA7 A;  1JJ2 2;  4R4K A;  3G8Z A;  3SOY A;  4BTY A;  2XR8 B;  2HMN B;  1VQK 3;  1IV9 A;  5JPU A;  3JUP A;  5BVB A;  1S5A A;  3DM8 A;  1W2Z A;  2K0M A;  1IVU A;  2HMO B;  1U5O A;  4RNZ A;  3CCQ 3;  1VQ7 3;  4O3V A;  1IQX A;  1ROA A;  2MC8 A;  2GBX B;  3U97 A;  1LXE A;  1OH0 A;  2W03 A;  3TDG A;  3FSD A;  1S72 3;  4N6U A;  5EEO A;  4GB5 A;  4O02 B;  1QAF A;  2CK3 H;  1OPY A;  1QAL A;  3F7X A;  1K9M 4;  2P09 A;  5ELU A;  2BMR B;  4K1U A;  4N6V 0;  3F9S A;  1K41 A;  3CNX A;  3MHE A;  1N8Q A;  4L8P A;  1VQ8 3;  4K1V A;  2XSH B;  3FKA A;  1JN5 A;  1K28 A;  4MMZ B;  4EYC A;  2INX A;  1CYU A;  4WWU C;  3VF1 A;  1UW1 A;  1W6Y A;  4RBN A;  1NB3 I;  3S5C A;  2W04 A;  3RDE A;  3EE1 A;  3CCS 3;  1TFO A;  3EC9 A;  1CQS A;  2BMO B;  3CC7 3;  1WNH A;  3X3X A;  1N5P A;  5HGR A;  2B1X B;  1KC8 4;  3OX9 A;  4HM1 B;  2FNQ A;  4XDV A;  4AEQ A;  4KVH A;  2XFS A;  1ASK A;  1Q42 A;  3BNE A;  3HK4 A;  5CK6 A;  5KP4 A;  1ROV A;  1T5Y A;  4HVN A;  3MSO A;  4O2H A;  2MF7 A;  3B8L A;  3HX8 A;  3G16 A;  2Z76 A;  3X3Y A;  4IPB A;  3IPT A;  1JN5 B;  1W02 A;  4FMD A;  1E3V A;  1M1X B;  2F99 A;  1YHQ 3;  1A2K A;  3S27 A;  3WDG B;  5IEO A;  5AIG A;  1MOL A;  5TGN A;  3CXC 2;  3KII A;  3OW2 2;  3UL5 A;  3PCS A;  5CXO A;  3WOF B;  3X41 A;  4HM6 B;  1Q82 4;  3EHC A;  3K63 A;  3OWS A;  4RZM A;  1OGX A;  1KQS 2;  4R1K A;  1D6Z A;  3GRD A;  3CMA 3;  1K8A 4;  2KRT A;  1HU9 A;  1O7H B;  4AKY A;  4ZM8 A;  4X2H A;  2RSX A;  3N8B A;  3WMD A;  2Y74 A;  3MYT A;  2QEX 3;  1FA3 A;  7STD A;  3OWY A;  5D82 A;  1ULJ B;  2F98 A;  2W9P A;  2WOH A;  2CC3 A;  3MPH A;  3H3H A;  2GEX A;  2A15 A;  1KSI A;  2V1L A;  1N8R 4;  2E2V A;  2B24 B;  4FCZ A;  1GD4 A;  5STD A;  3JUM A;  3GZB A;  1O7W B;  5IF6 A;  4WP5 A;  3MG2 A;  4IIA A;  4N6N B;  4N3V A;  4N6T A;  5DRV A;  3K7C A;  1N5H A;  3EBT A;  2ML6 A;  5IG5 A;  1TP6 A;  2D1W A;  1Q86 4;  3CC4 3;  2CG1 A;  4HM4 B;  1G96 A;  4HZ9 B;  3AMO A;  3FH1 A;  1AR0 A;  4HYZ A;  3FG1 A;  3I55 3;  4G1M B;  3X40 A;  4XBY A;  4JRF A;  3F8X A;  4LGQ A;  3GWR A;  3Q90 A;  3JVC A;  4R9K A;  4N6L A;  1NO3 A;  3G4S 3;  2P0M A;  3CCJ 3;  3MG3 A;  1JKG B;  3D9R A;  1IU7 A;  2CKF B;  5IW9 A;  1ZO2 A;  3NUV A;  1OGZ A;  3WOD G;  3CME 3;  1DMN A;  1Q7Y 4;  3PXM A;  8CHO A;  2HML B;  1WMP A;  3NQY A;  4KFD A;  5AEU B;  3LYG A;  3KFQ C;  3V98 A;  1UUW B;  1VQ9 3;  4HJL B;  2CFK A;  1VZZ A;  3RGA A;  1KD1 4;  2GEY A;  2XH9 A;  3LXU X;  2K54 A;  1L5G B;  4J8T A;  2Z7A A;  2WGO A;  2Y73 A;  2CWV A;  2OQE A;  3CCE 3;  4O8S A;  1WTH A;  1OAC A;  2HMK B;  2SBL A;  3NBR A;  5IEN A;  5D81 A;  1V74 A;  2FGT A;  4NHF A;  4EV5 A;  1M1K 4;  5KP3 A;  1OHO A;  3MG1 A;  2C10 A;  2QA4 3;  4AKZ A;  2I9W A;  4HBR A;  1SII A;  4HM7 B;  5EVH A;  2F86 B;  2GU3 A;  1EG9 B;  2XGL A;  4KZ1 A;  1TIJ A;  4K90 B;  1O7P B;  4HM8 B;  5AI1 A;  3SX1 A;  5BXQ A;  4H3U A;  1M90 4;  1O7N B;  1DYU A;  2L4V A;  3DY5 A;  2C11 A;  2BMQ B;  3IJE B;  1RJO A;  4H61 A;  5ELJ A;  5KP1 A;  3U1W A;  5FW5 A;  1RKY A;  3GZX B;  3NM7 A;  4OK0 A;  5A0O B;  1FGO A;  1YVB I;  2JDI H;  5CF2 A;  2QGU A;  2IMJ A;  3CD6 3;  2CFG A;  3SVA A;  1IQ8 A;  3E99 A;  1W00 A;  3UJM A;  3S67 A;  5AYS C;  1R4C A;  2OOV A;  1EQK A;  1W01 A;  3BNC A;  5IG4 A;  3WOE B;  1VQ4 3;  1D6Y A;  1GS3 A;  1NU3 A;  2O3O A;  4K61 A;  2XEP A;  2OTJ 3;  3FLJ A;  1YIJ 3;  4ORL A;  4XB5 A;  3NBJ A;  3Q2P A;  1D6U A;  3RGR A;  3X42 A;  5AYR B;  2WOF A;  3FGY A;  3DZL A;  3KZT A;  3DUK A;  3EN8 A;  3PCR A;  3T8U A;  1SQW A;  2OQE C;  3ROB A;  3EB8 A;  3CCM 3;  2E2T A;  3L0R A;  4HKV B;  3SLU A;  1VQM 3;  1YJ9 3;  2RFR A;  4OUQ A;  1RN7 A;  1OUN A;  3T0U A;  1YI2 3;  1FUW A;  3K5T A;  3UNL A;  3GZR A;  5CF1 A;  1NB5 I;  5AII A;  3NBB A;  5LC7 A;  4XM4 A;  1DVC A;  2P38 A;  5JBS A;  3OXA A;  1IK3 A;  3I56 3;  1Q81 4;  5FGO A;  4FMB A;  1A2V A;  2W9Q A;  1U8C B;  2OCT A;  1EKM A;  1RRH A;  2CG0 A;  3OV4 A;  4HM2 B;  4XBX A;  1OHP A;  2KCD A;  3OWU A;  1W6G A;  4LZI A;  1W7C A;  3B7C A;  3NM2 A;  3NV0 A;  3FCS B;  3GZY B;  1W6C A;  4EC6 A;  2D42 A;  3EF8 A;  3LTD A;  4IT7 A;  1WQL B;  1IVW A;  1N9E A;  4XDW A;  3T8N A;  5IG3 A;  3A76 A;  5I97 A;  1EA2 A;  1NDO B;  1TFK A;  3UB1 A;  2OOV C;  1DMQ A;  2QIY A;  3S29 A;  3STD A;  3EJV A;  1E97 A;  1RRL A;  4FMA A;  3HZP A;  1IDP A;  1WMO A;  4WYK A;  1GD3 A;  1STD A;  3F40 A;  2CIU A;  3IMA B;  4U13 A;  1PFP A;  1SIH A;  1JV2 B;  2W2C A;  2W0Q A;  4FCJ A;  4R9L A;  3S28 A;  3SOA A;  3WA2 X;  4Q53 A;  4L7K A;  1STF I;  1GY5 A;  3FF2 A;  4X2O A;  4MMX B;  3LTC A;  1AVL A;  2LYX A;  4HM5 B;  1VQL 3;  1QVG 2;  1SJW A;  3LT8 A;  5G2G A;  2FXT A;  3DXO A;  4HM3 B;  2YFL B;  4MEI A;  2BT3 A;  3FG4 A;  1JB5 A;  5LC6 A;  5JPP A;  3V92 A;  3DGL A;  3BNB A;  1E3R A;  2GBW B;  3AMO B;  5AEW B;  3CCR 3;  3PZW A;  4FR9 A;  2CFL A;  3CPW 2;  4HM0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...