2GEXA

Crystal structure of snoal2 a putative hydroxylase from streptomyces nogalater
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
146
structure length
146
Chain Sequence
STTANKERCLEMVAAWNRWDVSGVVAHWAPDVVHYDDEDKPVSAEEVVRRMNSAVEAFPDLRLDVRSIVGEGDRVMLRITCSATHQGVFMGIAPTGRKVRWTYLEELRFSEAGKVVEHWDVFNFSPLFRDLGVVPDGLKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SnoL
publication title Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Oxidoreductase
total genus 41
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gexA00
3MG2A 5AEUB 3FF2A 3FGYA 2B1XB 4HM0B 5FW5A 2GEYA 1JKGB 4XM4A 3SEDA 3STDA 4HZBB 5IEPA 5IG3A 5AIGA 4XBXA 1TUHA 5IERA 3JUOA 4RZMA 1OGZA 1O7MB 3OXAA 4HKVB 2HMOB 3NBRA 3GZXB 3NM2A 1OHOA 3F7SA 2XSOB 3OWYA 4J8TA 1W01A 1GS3A 3MG1A 3KKGA 4K1VA 3GZYB 3HZPA 5DREA 3EN8A 1GY6A 4WP5A 1A2KA 2HMNB 1EG9B 1OGXA 3FF0A 2QGUA 2Z7AA 1CQSA 1E97A 3I0YA 4XB5A 1JKGA 1W02A 4IIAA 3F14A 3OWUA 3F40A 2RGQA 2B24B 4HM1B 1HKXA 1VZZA 4X2OA 3MYTA 3D9RA 5AIHA 2QIYA 1O7WB 4HM7B 4LGQA 3A76A 2CKFB 3FSDA 1EA2A 3MKIA 2A15A 5AEWB 3F8XA 1QMAA 1NU3A 4HJLB 3ER7A 4HM3B 1ULJB 5EVHA 4MJDA 2XSHB 5G2GA 2OWPA 4OUQA 1STDA 3EHCA 5IG5A 1OCVA 3MSOA 4XBYA 1OF5A 3ROBA 3FZWA 2K54A 3DM8A 4N3VA 1IDPA 4HM6B 3B4OA 5AIFA 5JPUA 5CK6A 4U13A 3H51A 4H3UA 4PEJA 1AR0A 3F8HA 6STDA 1ZO2A 5IENA 3F7XA 3NXJA 3OWSA 1NWWA 4XDVA 4OVMA 2GEXA 4K1UA 1GY7A 2IMJA 1OHSA 4HM5B 4HM8B 1OHPA 3ECFA 4L7KA 3IPTA 5KP3A 2GBXB 1GY5A 2YFIB 5BVBA 1OH0A 5KP4A 2GBWB 1O7HB 3UNLA 1ULIB 5CXOA 5IEOA 1Z1SA 4ORLA 2Z77A 4Q53A 3EX9A 3RGRA 1DMMA 3VGNA 3G8ZA 1W00A 3DUKA 2XR8B 4L8OA 5D81A 2YFJB 3K7CA 1C7HA 2HMLB 3MHEA 1K41A 3DXOA 5KP1A 3DMCA 2F86B 3CU3A 1Q42A 7STDA 2BMOB 1JN5B 3FH1A 1W6YA 4X2HA 5BXQA 3F9SA 3GWRA 5CF2A 1NDOB 5DRVA 3CNXA 2STDA 2BMQB 2BMRB 1U5OA 2XRXB 4LEHA 1JB4A 4STDA 3S5CA 4R9LA 1Q40B 3B8LA 2HMMB 3EBYA 2F98A 3SOAA 4R1KA 4L8PA 4FCJA 2PZVA 2F99A 3GRDA 3EQQB 5CF1A 3HK4A 3VSYA 5HGRA 4WWUC 2R4IA 3GZBA 4HVNA 4R9KA 1E3RA 3B4PA 8CHOA 3CNMA 5D83A 4I4KA 2GXFA 5IG4A 3T8UA 3OX9A 1O7NB 1UUWB 1JN5A 3Q90A 3CPOA 3FLJA 4HM4B 2RFRA 2CHCA 3H3HA 3JUQA 3M8CA 4FCMA 1O7GB 3BB9A 1DMQA 4HM2B 2HMJB 3KZTA 4XBTA 2W2CA 1QJGA 3BLZA 1Q40A 3KE7A 4KVHA 3KSPA 4WYKB 3EJVA 2Z76A 3K0ZA 5STDA 1OPYA 1UUVB 2RCDA 5IG0A 3LYGA 3B7CA 3NV0B 3MG3A 3JUMA 1S5AA 4J9AA 5CLKA 4GB5A 1O7PB 3EN1B 3G16A 1OF5B 5IF6A 1JB2A 3JUNA 3G0KA 2I9WA 2UX0A 3SOYA 3RGAA 3WMDA 1ZX2A 3UJMA 1ASKA 3NHXA 4HZ9B 5TGNA 3GZRA 4WYKA 1JB5A 3EC9A 3EBTA 4LMIA 1OUNA 1WQLB 3FKAA 3T8NA 3E99A 5AIIA 1TP6A 3DZLA 2YFLB 4XDWA 3LZAA 3NV0A 2INXA 3HX8A 2JQ5A 1ISKA 3JUPA 2BNGA 2HMKB 1GYBA 3OV4A 1DMNA 5D82A 4CDLA 1SJWA 3EF8A 1BUQA 5JPPA 3NUVA 1E3VA 5AI1A
chains in the Genus database with same CATH superfamily
3HIGA 3MG2A 1MWTA 5AEUB 3FF2A 1I3IA 1TTOA 2B1XB 3FGYA 3AGNA 4HM0B 5FW5A 1YIT3 2GEYA 1JKGB 4XM4A 3SEDA 3STDA 4EV5A 1UI8A 3CC73 4HZBB 5IEPA 3BIRA 1LNIA 2BU4A 1BRGA 2OQEA 3PCSA 5IG3A 5AIGA 2JDIH 1Q7Y4 4XBXA 1G96A 1LQMB 3I553 1TUHA 5IERA 1UW1A 1RJOA 2H0HA 1AY7A 1I2FA 1L5GB 3CCR3 5JBSA 1VQ83 1IQXA 3JUOA 1I8VA 2O9UX 4RZMA 2P05A 1OGZA 3CCE3 2LYXA 4O3VA 2XF3A 1O7MB 3OXAA 3ALAA 5EQLA 4HKVB 2HMOB 3NBRA 3GZXB 3NM2A 4OK0A 3S29A 3X40A 1OHOA 5M19A 2C10A 3F7SA 4K90B 2XSOB 1WMNA 2BO9B 1CYUA 1FGOA 1LQGC 5A0OB 1AVLA 3OWYA 2Y73A 3DGOA 4J8TA 1W01A 4K61A 1GS3A 3V99A 2KF3A 3MG1A 2WO0A 3KKGA 1RRLA 2OQEC 1PU4A 1G02A 2ZL8A 4K1VA 4N6LA 3GZYB 1YHQ3 3DY5A 1W4NA 2L1SA 3HZPA 3PXMA 1RNTA 5DREA 2KRTA 3EN8A 1GY6A 1X1WA 4WP5A 3RDEA 1A2KA 1N8QA 2CG0A 2HMNB 1EG9B 5IW9A 4G1MB 1NNVA 1OGXA 3NM7A 2D42A 3X41A 2BT3A 2WGQA 2H0GA 3FF0A 5M18A 1GMPA 4AKYA 2QGUA 4RBNA 2Z7AA 4CCVA 1T2HA 1CQSA 1VQP3 2D1WA 1IU7A 1E97A 3I0YA 1Q864 4XB5A 1IT8A 1JKGA 1W02A 3TDGA 4R4KA 4IIAA 3F14A 3G6E3 3OWUA 3WA2X 3CCU3 1N9EA 1ROVA 1K734 3CC23 3F40A 1BSAA 2RGQA 2B24B 4JF8A 4WFOA 2Y74A 1I0XA 1VQ53 3LMLA 1IQYA 1HKXA 1I2GA 4HM1B 3AGOA 1RCKA 4BIRA 1VQ43 2F56A 1AQZA 4NREA 2IY2A 1DVDA 3A5EA 1PFPA 1VZZA 4X2OA 1WMPA 3MYTA 3D9RA 4NPBA 5AIHA 1ROAA 1RSNA 2UGIA 2XGNA 1BNIA 2QIYA 1O7WB 1STFI 2KF4A 1V74A 2CC3A 1QVG2 4N6OB 2H0IA 4HM7B 1UUGB 3PYJA 4LGQA 1YVSA 3A76A 2CKFB 3KFQC 1W5ZA 3FSDA 4HAAA 1EA2A 2P09A 2WOHA 3G4S3 4IT7A 1B20A 3MKIA 4RNZA 4MMXB 1BNEA 2A15A 2MF7A 5AEWB 1K28A 3F8XA 1QMAA 2CX0A 1HYFA 1SQWA 2XEPA 1NU3A 1B2XA 4HJLB 4WHAA 4BTXA 3V98A 1LRAA 3ER7A 3BNEA 4RNTA 4EBGA 4HM3B 1ULJB 1SIIA 4MJDA 5EVHA 1RKYA 2E2VA 2XSHB 4LZIA 4BTYA 2W0QA 5G2GA 4CPKA 2CX1A 1BRJA 2OWPA 2XFSA 1LOWA 2CFDA 4OUQA 1STDA 1TJDA 2M7OA 1CH0A 3EHCA 3CCJ3 5IG5A 1OCVA 3UL6A 1RLSA 3MSOA 1DVCA 4FMDA 2FNQA 2YX9A 4XBYA 4O02B 1OF5A 5GSPA 4GHOA 3CCQ3 3ROBA 3FZWA 7RNTA 1JBSA 3KSED 3D79A 4EW5A 2K54A 3U1WA 3DM8A 5HOHA 2GU3A 4N3VA 3D5GA 1BRKA 2FXTA 4LSOA 1N9JA 1IDPA 1A2VA 5G1LA 1NB5I 2F5MA 1RCLA 4HM6B 1IVVA 1LNHA 3CCM3 3B4OA 1A90A 5AIFA 3BNBA 5JPUA 1PY3A 5CK6A 4U13A 1LOYA 1GD3A 1BSEA 1MGRA 3H51A 1A2PA 4H3UA 4PEJA 3HI7A 3N8BA 3SLUA 1AR0A 3F8HA 6STDA 1IQ8A 1TRQA 1VQQA 3O8YA 3CMA3 1ZO2A 4BTWA 2F4YA 1BIRA 5IENA 3AHWA 4KFFA 3F7XA 3NXJA 2RBIA 1FGTA 1RN1A 3URPA 3OWSA 1TFOA 1NWWA 3Q1CA 4XDVA 3KN4A 4OVMA 1LOXA 1N5HA 1AV4A 2GEXA 1IVXA 3ZFZA 1EUIC 1G0TA 3ZG0A 4K1UA 1GY7A 4FR9A 2OCTA 3X3YA 1MOLA 2IUJA 2IMJA 1OHSA 4HM5B 4HM8B 3FG1A 4HOHA 5ELJA 4KFEA 3NQYA 1OHPA 1JBRA 3X42A 3ECFA 1MNLA 4DKIA 1R4YA 1IVUA 3LTDA 7GSPA 4L7KA 3IPTA 5KP3A 1X1YA 3S67A 1KSIA 2R41A 4FMAA 2GBXB 2K3DA 4ILFA 1GY5A 3G713 2YFIB 4R80A 5FGOA 5BVBA 1OH0A 3D4AA 4GL6A 2KF5A 2W56B 2Z6BA 5KP4A 1JZDA 3CPW2 1JBTA 1BU4A 1UGIA 2CIUA 3LTAA 1BANA 2GBWB 1O7HB 3UNLA 1IK3A 3DGNA 3FG3A 2OTL3 1CYVA 3WHOA 1ULIB 1T5YA 2C11A 4NHFA 5CXOA 1RGAA 1YGEA 5IEOA 1Z1SA 4I5QA 1BNFA 4ORLA 1VQM3 2Z77A 3LH4A 1I70A 1YI23 5M1AA 1RN4A 2OOVA 4Q53A 1YVBI 3EX9A 3RGRA 2OTJ3 3SYUA 1EEJA 2C4BA 1YJW3 2WOFA 1B2MA 1FW7A 1UCIA 1DMMA 3SX1A 3VGNA 1D6ZA 3G8ZA 1FUTA 3PS8A 1B2ZA 1W00A 1D6UA 1GSPA 3D3LA 3DUKA 2XR8B 3GAXA 4CJNA 1RNBA 4L8OA 4TX4A 4BL3A 5D81A 4EXRA 1FA3A 2PNCA 1NJI4 2YFJB 3JVCA 3K7CA 2ML6A 1YIJ3 1FUWA 1GOVA 2QEX3 1C7HA 2HMLB 4FCZA 2KXGA 3AHSA 3MHEA 1K41A 3DXOA 1A67A 2W6JH 1RGLA 1SIHA 4EYCA 1RN7A 5KP1A 3DMCA 3I563 1Q824 1BNGA 1DETA 2F86B 4HYZA 1RGCA 1FGQA 2P0XA 1Q42A 3CU3A 2ZHXB 3T0UA 7STDA 2BMOB 1VQO3 3HOHA 4N6UA 1I2EA 1BSCA 1MGWA 2J8XB 3L0RA 4BL2A 5I97A 1VQN3 3IMAB 1JN5B 3FH1A 1I3FA 2E2UA 5BU4A 4RNYA 1W6YA 4H61A 4EC6A 2CFGA 1UGHI 4X2HA 3CC43 1M904 5BXQA 3F9SA 3GWRA 3KCHA 4AEQA 1S723 1W7CA 5CF2A 1NDOB 5DRVA 4O2HA 5RNTA 3CNXA 2ZDJA 1JV2B 2STDA 2IUKA 3CXC2 3S27A 2BMQB 1T2IA 1IV7A 2K0MA 1U5OA 2BMRB 1B2UA 2XRXB 2CFWA 5AYRB 4LEHA 1JB4A 4HBRA 5LC6A 4STDA 1BRIA 4MEIA 3S5CA 2KAAA 2CFLA 3ZG5A 5BIRA 4R9LA 1V57A 1W6CA 1Q40B 3B8LA 5G1KA 1GMRA 2SBLA 2HMMB 3EBYA 4N6MA 3DGLA 3LT8A 2F98A 3CME3 3SOAA 2RNTA 1FYSA 1MWUA 1BAOA 4R1KA 3HIIA 4L8PA 4FCJA 2PZVA 2F99A 4FMBA 2SARA 3MWZA 3CCL3 3GRDA 3EQQB 4FMCA 4O8SA 2W9QA 1B21A 3NBBA 1F8NA 2FGTA 5CF1A 1Q9EA 3HK4A 3VSYA 1B3SA 4ZM8A 3OW22 3K5TA 3NX0A 3WR2A 1IV9A 4N6V0 1M1K4 1JZOA 1BGSA 1OACA 5HGRA 3WOFB 1R4CA 4GSPA 2WGOA 2R4IA 4WWUC 3GZBA 3DH2A 4HVNA 4R9KA 1E3RA 3B4PA 6RNTA 8CHOA 3WA3A 1IYYA 3EB8A 3S28A 2CW9A 3CNMA 5D83A 3N9HA 1QAFA 2GXFA 4I4KA 1W2B2 5IG4A 2ML5A 2GU1A 1JRQA 1C54A 1DE3A 3T8UA 1RGFA 3OX9A 1O7NB 1UDII 1RGHA 1TIJA 1UUWB 1JN5A 3Q90A 1RRHA 1JNQA 3CPOA 3PGBA 2V1LA 3FLJA 8RNTA 4HM4B 3CCS3 2RFRA 1YGWA 2CHCA 3H3HA 3LOYA 3JUQA 3WDGB 3DGMA 3EE1A 3M8CA 4FCMA 1O7GB 1MWRA 3BB9A 2F5WA 1DMQA 1DYUA 4JRFA 1NB3I 3SXXA 4KFDA 4HM2B 2HMJB 3KZTA 1NO3A 1RGEA 4XBTA 2P0MA 1HZ1A 3Q2PA 1N5PA 3GSPA 2W2CA 1QJGA 3BLZA 2MC8A 3AMOB 3FG4A 3PCRA 1U8CB 1YNVX 1FGMA 2CWUA 2LQVA 1Q40A 1FZUA 3RNTA 3KE7A 3U97A 3Q3FA 4KVHA 2RSXA 3D5IA 3KSPA 1GOUA 5LC7A 1KC84 1AVKA 2AAEA 4WYKB 1LVNA 3EJVA 2W03A 2XGLA 1QAKA 2Z76A 3K0ZA 4J5KA 5STDA 1OPYA 1UUVB 4KZ1A 1B27A 2RCDA 2CWVA 1RTUA 2IA7A 5IG0A 6GSPA 3LYGA 4QWTA 2CWTA 1RGGA 3UB1A 1Q7HA 3B7CA 1KD14 1GD4A 3NV0B 3MG3A 1BRNL 1ZGXA 1V58A 3JUMA 3WODG 2L4VA 1BRSA 1UCLA 3UL5A 3WOEB 1WNHA 3BU4A 2CK3H 3LT9A 2W9PA 1VQK3 1BNJA 1VQ73 1S5AA 2Q07A 4J9AA 2E2TA 4MMYB 5CLKA 1MWSA 1X1UA 2UUGC 2AADA 3QRDA 4GB5A 1O7PB 1K9M4 3EN1B 3BNCA 1VQL3 1N8R4 3KIIA 1IT7A 1IVWA 1SARA 2ZA4A 1UI7A 1HU9A 3NQZA 5ELUA 3J7Yd 3G16A 2CH9A 4AKZA 3DGYA 1LXEA 1OF5B 1RDSA 4N6NB 1BSBA 3K9MC 4EV2A 5IF6A 1WMOA 1J2BA 1UCKA 1JB2A 3JUNA 1M9GA 3G0KA 2I9WA 4N6TA 2BIRA 2UX0A 2CG1A 3SOYA 1BOXA 3RGAA 3WMDA 1YJ93 2XFTA 2BHMA 3CD63 1I0VA 1B2SA 3NBJA 1Y4KA 2OOVC 2P38A 1TFKA 1US1A 1EQKA 3AMOA 3PZWA 4IPBA 1ZX2A 1W2ZA 2XH9A 9RNTA 1CEWI 1TU5A 3UJMA 3BNDA 3LTBA 3X3XA 1EKMA 3LXUX 1KWIA 1ASKA 3NHXA 4HZ9B 2O3OA 1RGKA 5TGNA 3GZRA 1X1XA 2W56A 3QK9A 1D6YA 4J5GA 2CFKA 1JB5A 4WYKA 1JJ22 3EC9A 1BNRA 3EBTA 3SVAA 2GSPA 3LTCA 1BRHA 1OUNA 1WQLB 1RHLA 2W04A 4LMIA 3FKAA 1ZS7A 3T8NA 1GOYA 1T3BA 3E99A 5AIIA 1KQS2 1TP6A 3DZLA 1TRPA 2HOHA 2IYJA 2QA43 2YFLB 3N54B 4XDWA 4BU4A 2KCDA 3LZAA 3NV0A 3VF1A 3V92A 2INXA 3IJEB 3K63A 3HX8A 1UCJA 2JQ5A 1YJN3 1K8A4 1M1XB 5AYSC 1FGRA 1ISKA 2KF6A 2BNGA 1BNSA 2HMKB 3JUPA 1GYBA 1BSDA 1QVF2 3OV4A 1W6GA 1WTHA 1PYLA 1DMNA 1QALA 5D82A 5EEOA 1SPUA 4CDLA 1LOVA 1RMSA 3X3ZA 3FCSB 1SJWA 1FUSA 1BVIA 4MMZB 1VQ93 3EF8A 4LYLB 3CCV3 1VQ63 1BUQA 5JPPA 3MPHA 3NUVA 4KT3B 1Q814 1E3VA 5AI1A 1BUJA 1GMQA
chains in the Genus database with same CATH topology
3HIGA 3MG2A 5AEUB 3FF2A 3FGYA 1YIT3 2B1XB 4HM0B 5FW5A 2GEYA 1JKGB 4XM4A 3SEDA 3STDA 4EV5A 1UI8A 3CC73 4HZBB 5IEPA 2OQEA 3PCSA 5IG3A 5AIGA 2JDIH 1Q7Y4 4XBXA 1G96A 3I553 1TUHA 5IERA 1UW1A 1RJOA 1L5GB 3CCR3 5JBSA 1VQ83 1IQXA 3JUOA 2O9UX 4RZMA 2P05A 1OGZA 3CCE3 2LYXA 4O3VA 2XF3A 1O7MB 3OXAA 3ALAA 5EQLA 4HKVB 2HMOB 3NBRA 3GZXB 3NM2A 4OK0A 3S29A 3X40A 1OHOA 2C10A 3F7SA 4K90B 2XSOB 1WMNA 2BO9B 1CYUA 1FGOA 5A0OB 1AVLA 3OWYA 2Y73A 3DGOA 4J8TA 1W01A 4K61A 1GS3A 3V99A 3MG1A 2WO0A 3KKGA 1RRLA 2OQEC 1PU4A 4K1VA 2ZL8A 1YHQ3 4N6LA 3GZYB 3DY5A 1W4NA 3HZPA 3PXMA 5DREA 2KRTA 3EN8A 1GY6A 4WP5A 3RDEA 1A2KA 1N8QA 2CG0A 2HMNB 1EG9B 5IW9A 4G1MB 1OGXA 3NM7A 2D42A 3X41A 2BT3A 2WGQA 3FF0A 4AKYA 2QGUA 4RBNA 2Z7AA 4CCVA 1CQSA 1VQP3 2D1WA 1IU7A 1E97A 3I0YA 1Q864 4XB5A 1IT8A 1JKGA 1W02A 3TDGA 4R4KA 4IIAA 3F14A 3G6E3 3OWUA 3WA2X 3CCU3 1N9EA 1ROVA 1K734 3CC23 3F40A 2RGQA 2B24B 4JF8A 4WFOA 2Y74A 1VQ53 3LMLA 1IQYA 1HKXA 4HM1B 1VQ43 4NREA 1DVDA 1PFPA 1VZZA 4X2OA 1WMPA 3MYTA 3D9RA 5AIHA 1ROAA 2XGNA 2QIYA 1O7WB 1STFI 1V74A 2CC3A 1QVG2 4N6OB 4HM7B 3PYJA 4LGQA 3A76A 2CKFB 3KFQC 1W5ZA 3FSDA 1EA2A 2P09A 2WOHA 3G4S3 4IT7A 3MKIA 4RNZA 4MMXB 2A15A 2MF7A 5AEWB 1K28A 3F8XA 1QMAA 1SQWA 2XEPA 1NU3A 4WHAA 4HJLB 4BTXA 3V98A 3ER7A 3BNEA 4EBGA 4HM3B 1ULJB 1SIIA 4MJDA 5EVHA 1RKYA 2E2VA 2XSHB 4LZIA 4BTYA 2W0QA 5G2GA 2OWPA 2XFSA 2CFDA 4OUQA 1STDA 2M7OA 3EHCA 3CCJ3 5IG5A 1OCVA 3UL6A 3MSOA 1DVCA 4FMDA 2FNQA 2YX9A 4XBYA 4O02B 1OF5A 3CCQ3 3ROBA 3FZWA 3KSED 2K54A 3U1WA 3DM8A 2GU3A 4N3VA 2FXTA 4LSOA 1N9JA 1IDPA 1A2VA 1NB5I 4HM6B 3CCM3 1IVVA 1LNHA 1A90A 3B4OA 5AIFA 3BNBA 5JPUA 5CK6A 4U13A 1GD3A 3H51A 4H3UA 4PEJA 3HI7A 3N8BA 3SLUA 1AR0A 3F8HA 6STDA 1IQ8A 3O8YA 3CMA3 1ZO2A 4BTWA 5IENA 4KFFA 3F7XA 3NXJA 1FGTA 3OWSA 1TFOA 1NWWA 3Q1CA 4XDVA 3KN4A 4OVMA 1LOXA 1N5HA 1AV4A 2GEXA 1IVXA 4K1UA 1GY7A 4FR9A 2OCTA 3X3YA 1MOLA 2IUJA 2IMJA 1OHSA 4HM5B 4HM8B 3FG1A 5ELJA 4KFEA 3NQYA 1OHPA 3X42A 3ECFA 1MNLA 3LTDA 1IVUA 4L7KA 3IPTA 5KP3A 3S67A 1KSIA 4FMAA 2GBXB 1GY5A 3G713 2YFIB 4R80A 5FGOA 5BVBA 1OH0A 4GL6A 2Z6BA 2W56B 5KP4A 3CPW2 2CIUA 3LTAA 2GBWB 1O7HB 3UNLA 1IK3A 3DGNA 3FG3A 2OTL3 1CYVA 1ULIB 1T5YA 2C11A 4NHFA 5CXOA 1YGEA 5IEOA 1Z1SA 1VQM3 4ORLA 2Z77A 3LH4A 1YI23 2OOVA 4Q53A 1YVBI 3EX9A 3RGRA 2OTJ3 1YJW3 2WOFA 1DMMA 3SX1A 3VGNA 1D6ZA 3G8ZA 3PS8A 1W00A 1D6UA 3D3LA 3DUKA 2XR8B 3GAXA 4L8OA 4TX4A 1FA3A 5D81A 4EXRA 2PNCA 1NJI4 2YFJB 3JVCA 3K7CA 2ML6A 1YIJ3 1FUWA 2QEX3 1C7HA 2HMLB 4FCZA 2KXGA 3MHEA 1K41A 3DXOA 1A67A 2W6JH 1Q824 1SIHA 4EYCA 1RN7A 5KP1A 3DMCA 3I563 2F86B 4HYZA 3CU3A 1FGQA 2P0XA 1Q42A 1VQO3 7STDA 3T0UA 1N8R4 2BMOB 4N6UA 1VQN3 3L0RA 5I97A 3IMAB 1JN5B 3FH1A 2E2UA 4RNYA 1W6YA 4H61A 4EC6A 2CFGA 4X2HA 3CC43 1M904 5BXQA 3F9SA 3GWRA 4AEQA 1S723 1W7CA 5CF2A 1NDOB 5DRVA 4O2HA 3CNXA 2ZDJA 1JV2B 2STDA 2IUKA 3CXC2 3S27A 2BMQB 1IV7A 2K0MA 1U5OA 2BMRB 2XRXB 5AYRB 2CFWA 4LEHA 1JB4A 4HBRA 5LC6A 4STDA 4MEIA 3S5CA 2CFLA 4R9LA 1W6CA 1Q40B 3B8LA 2SBLA 2HMMB 3EBYA 4N6MA 3DGLA 3LT8A 2F98A 3CME3 3SOAA 4R1KA 3HIIA 4L8PA 4FCJA 2PZVA 2F99A 4FMBA 3MWZA 3CCL3 3GRDA 3EQQB 4FMCA 4O8SA 2W9QA 3NBBA 1F8NA 2FGTA 5CF1A 3HK4A 3VSYA 4ZM8A 3OW22 3K5TA 3NX0A 1IV9A 4N6V0 1M1K4 5HGRA 1OACA 3WOFB 1R4CA 2WGOA 2R4IA 4WWUC 3GZBA 4HVNA 4R9KA 1E3RA 3B4PA 8CHOA 3WA3A 3EB8A 3S28A 2CW9A 3CNMA 5D83A 3N9HA 1QAFA 2GXFA 4I4KA 1W2B2 5IG4A 2ML5A 2GU1A 1JRQA 3T8UA 3OX9A 1O7NB 1TIJA 1UUWB 1JN5A 3Q90A 1RRHA 1JNQA 3CPOA 3PGBA 2V1LA 3FLJA 4HM4B 3CCS3 2RFRA 2CHCA 3H3HA 3LOYA 3JUQA 3WDGB 3DGMA 3EE1A 3M8CA 4FCMA 1O7GB 3BB9A 1DMQA 1DYUA 4JRFA 1NB3I 3SXXA 4KFDA 4HM2B 2HMJB 3KZTA 1NO3A 4XBTA 2P0MA 3Q2PA 1N5PA 2W2CA 1QJGA 3BLZA 2MC8A 3AMOB 3FG4A 3PCRA 1U8CB 2CWUA 1FGMA 2LQVA 1Q40A 3U97A 3KE7A 4KVHA 2RSXA 3KSPA 5LC7A 1KC84 1AVKA 4WYKB 1LVNA 3EJVA 2W03A 2XGLA 1QAKA 2Z76A 3K0ZA 5STDA 1OPYA 1UUVB 4KZ1A 2RCDA 2CWVA 2IA7A 5IG0A 3LYGA 4QWTA 2CWTA 3UB1A 3B7CA 1KD14 1GD4A 3NV0B 3MG3A 3JUMA 3WODG 2L4VA 3UL5A 3WOEB 1WNHA 2CK3H 3LT9A 2W9PA 1VQK3 1VQ73 1S5AA 2Q07A 4J9AA 2E2TA 4MMYB 5CLKA 3QRDA 4GB5A 1O7PB 1K9M4 3EN1B 3BNCA 1VQL3 3KIIA 1IVWA 1IT7A 5ELUA 1UI7A 1HU9A 3NQZA 3J7Yd 3G16A 2CH9A 4AKZA 1LXEA 1OF5B 4N6NB 3K9MC 4EV2A 5IF6A 1WMOA 1J2BA 1JB2A 3JUNA 1M9GA 3G0KA 2I9WA 4N6TA 2UX0A 3SOYA 2CG1A 1YJ93 3RGAA 3WMDA 2XFTA 2BHMA 3CD63 3NBJA 1Y4KA 2OOVC 2P38A 1TFKA 1US1A 1EQKA 3AMOA 3PZWA 4IPBA 1ZX2A 1W2ZA 2XH9A 1CEWI 1TU5A 3UJMA 3BNDA 3LTBA 3X3XA 1EKMA 3LXUX 1KWIA 1ASKA 3NHXA 4HZ9B 2O3OA 5TGNA 3GZRA 2W56A 3QK9A 1D6YA 4WYKA 2CFKA 1JB5A 1JJ22 3EC9A 3EBTA 3SVAA 3LTCA 4LMIA 1OUNA 1WQLB 2W04A 3FKAA 3T8NA 3E99A 5AIIA 1KQS2 1TP6A 3DZLA 2QA43 2YFLB 3N54B 4XDWA 2KCDA 3LZAA 3NV0A 3VF1A 3V92A 2INXA 3IJEB 3K63A 3HX8A 2JQ5A 1YJN3 1K8A4 1M1XB 5AYSC 1FGRA 1ISKA 3JUPA 2BNGA 1QVF2 2HMKB 1GYBA 3OV4A 1W6GA 1WTHA 1DMNA 1QALA 5D82A 5EEOA 1SPUA 4CDLA 3X3ZA 3FCSB 1SJWA 1VQ93 4MMZB 3EF8A 3CCV3 1VQ63 1BUQA 5JPPA 3MPHA 3NUVA 1Q814 1E3VA 5AI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MG2 A;  5AEU B;  3FF2 A;  3FGY A;  2B1X B;  4HM0 B;  5FW5 A;  2GEY A;  1JKG B;  4XM4 A;  3SED A;  3STD A;  4HZB B;  5IEP A;  5IG3 A;  5AIG A;  4XBX A;  1TUH A;  5IER A;  3JUO A;  4RZM A;  1OGZ A;  1O7M B;  3OXA A;  4HKV B;  2HMO B;  3NBR A;  3GZX B;  3NM2 A;  1OHO A;  3F7S A;  2XSO B;  3OWY A;  4J8T A;  1W01 A;  1GS3 A;  3MG1 A;  3KKG A;  4K1V A;  3GZY B;  3HZP A;  5DRE A;  3EN8 A;  1GY6 A;  4WP5 A;  1A2K A;  2HMN B;  1EG9 B;  1OGX A;  3FF0 A;  2QGU A;  2Z7A A;  1CQS A;  1E97 A;  3I0Y A;  4XB5 A;  1JKG A;  1W02 A;  4IIA A;  3F14 A;  3OWU A;  3F40 A;  2RGQ A;  2B24 B;  4HM1 B;  1HKX A;  1VZZ A;  4X2O A;  3MYT A;  3D9R A;  5AIH A;  2QIY A;  1O7W B;  4HM7 B;  4LGQ A;  3A76 A;  2CKF B;  3FSD A;  1EA2 A;  3MKI A;  2A15 A;  5AEW B;  3F8X A;  1QMA A;  1NU3 A;  4HJL B;  3ER7 A;  4HM3 B;  1ULJ B;  5EVH A;  4MJD A;  2XSH B;  5G2G A;  2OWP A;  4OUQ A;  1STD A;  3EHC A;  5IG5 A;  1OCV A;  3MSO A;  4XBY A;  1OF5 A;  3ROB A;  3FZW A;  2K54 A;  3DM8 A;  4N3V A;  1IDP A;  4HM6 B;  3B4O A;  5AIF A;  5JPU A;  5CK6 A;  4U13 A;  3H51 A;  4H3U A;  4PEJ A;  1AR0 A;  3F8H A;  6STD A;  1ZO2 A;  5IEN A;  3F7X A;  3NXJ A;  3OWS A;  1NWW A;  4XDV A;  4OVM A;  2GEX A;  4K1U A;  1GY7 A;  2IMJ A;  1OHS A;  4HM5 B;  4HM8 B;  1OHP A;  3ECF A;  4L7K A;  3IPT A;  5KP3 A;  2GBX B;  1GY5 A;  2YFI B;  5BVB A;  1OH0 A;  5KP4 A;  2GBW B;  1O7H B;  3UNL A;  1ULI B;  5CXO A;  5IEO A;  1Z1S A;  4ORL A;  2Z77 A;  4Q53 A;  3EX9 A;  3RGR A;  1DMM A;  3VGN A;  3G8Z A;  1W00 A;  3DUK A;  2XR8 B;  4L8O A;  5D81 A;  2YFJ B;  3K7C A;  1C7H A;  2HML B;  3MHE A;  1K41 A;  3DXO A;  5KP1 A;  3DMC A;  2F86 B;  3CU3 A;  1Q42 A;  7STD A;  2BMO B;  1JN5 B;  3FH1 A;  1W6Y A;  4X2H A;  5BXQ A;  3F9S A;  3GWR A;  5CF2 A;  1NDO B;  5DRV A;  3CNX A;  2STD A;  2BMQ B;  2BMR B;  1U5O A;  2XRX B;  4LEH A;  1JB4 A;  4STD A;  3S5C A;  4R9L A;  1Q40 B;  3B8L A;  2HMM B;  3EBY A;  2F98 A;  3SOA A;  4R1K A;  4L8P A;  4FCJ A;  2PZV A;  2F99 A;  3GRD A;  3EQQ B;  5CF1 A;  3HK4 A;  3VSY A;  5HGR A;  4WWU C;  2R4I A;  3GZB A;  4HVN A;  4R9K A;  1E3R A;  3B4P A;  8CHO A;  3CNM A;  5D83 A;  4I4K A;  2GXF A;  5IG4 A;  3T8U A;  3OX9 A;  1O7N B;  1UUW B;  1JN5 A;  3Q90 A;  3CPO A;  3FLJ A;  4HM4 B;  2RFR A;  2CHC A;  3H3H A;  3JUQ A;  3M8C A;  4FCM A;  1O7G B;  3BB9 A;  1DMQ A;  4HM2 B;  2HMJ B;  3KZT A;  4XBT A;  2W2C A;  1QJG A;  3BLZ A;  1Q40 A;  3KE7 A;  4KVH A;  3KSP A;  4WYK B;  3EJV A;  2Z76 A;  3K0Z A;  5STD A;  1OPY A;  1UUV B;  2RCD A;  5IG0 A;  3LYG A;  3B7C A;  3NV0 B;  3MG3 A;  3JUM A;  1S5A A;  4J9A A;  5CLK A;  4GB5 A;  1O7P B;  3EN1 B;  3G16 A;  1OF5 B;  5IF6 A;  1JB2 A;  3JUN A;  3G0K A;  2I9W A;  2UX0 A;  3SOY A;  3RGA A;  3WMD A;  1ZX2 A;  3UJM A;  1ASK A;  3NHX A;  4HZ9 B;  5TGN A;  3GZR A;  4WYK A;  1JB5 A;  3EC9 A;  3EBT A;  4LMI A;  1OUN A;  1WQL B;  3FKA A;  3T8N A;  3E99 A;  5AII A;  1TP6 A;  3DZL A;  2YFL B;  4XDW A;  3LZA A;  3NV0 A;  2INX A;  3HX8 A;  2JQ5 A;  1ISK A;  3JUP A;  2BNG A;  2HMK B;  1GYB A;  3OV4 A;  1DMN A;  5D82 A;  4CDL A;  1SJW A;  3EF8 A;  1BUQ A;  5JPP A;  3NUV A;  1E3V A;  5AI1 A; 
#chains in the Genus database with same CATH topology
 3HIG A;  3MG2 A;  1MWT A;  5AEU B;  3FF2 A;  1I3I A;  1TTO A;  2B1X B;  3FGY A;  3AGN A;  4HM0 B;  5FW5 A;  1YIT 3;  2GEY A;  1JKG B;  4XM4 A;  3SED A;  3STD A;  4EV5 A;  1UI8 A;  3CC7 3;  4HZB B;  5IEP A;  3BIR A;  1LNI A;  2BU4 A;  1BRG A;  2OQE A;  3PCS A;  5IG3 A;  5AIG A;  2JDI H;  1Q7Y 4;  4XBX A;  1G96 A;  1LQM B;  3I55 3;  1TUH A;  5IER A;  1UW1 A;  1RJO A;  2H0H A;  1AY7 A;  1I2F A;  1L5G B;  3CCR 3;  5JBS A;  1VQ8 3;  1IQX A;  3JUO A;  1I8V A;  2O9U X;  4RZM A;  2P05 A;  1OGZ A;  3CCE 3;  2LYX A;  4O3V A;  2XF3 A;  1O7M B;  3OXA A;  3ALA A;  5EQL A;  4HKV B;  2HMO B;  3NBR A;  3GZX B;  3NM2 A;  4OK0 A;  3S29 A;  3X40 A;  1OHO A;  5M19 A;  2C10 A;  3F7S A;  4K90 B;  2XSO B;  1WMN A;  2BO9 B;  1CYU A;  1FGO A;  1LQG C;  5A0O B;  1AVL A;  3OWY A;  2Y73 A;  3DGO A;  4J8T A;  1W01 A;  4K61 A;  1GS3 A;  3V99 A;  2KF3 A;  3MG1 A;  2WO0 A;  3KKG A;  1RRL A;  2OQE C;  1PU4 A;  1G02 A;  2ZL8 A;  4K1V A;  4N6L A;  3GZY B;  1YHQ 3;  3DY5 A;  1W4N A;  2L1S A;  3HZP A;  3PXM A;  1RNT A;  5DRE A;  2KRT A;  3EN8 A;  1GY6 A;  1X1W A;  4WP5 A;  3RDE A;  1A2K A;  1N8Q A;  2CG0 A;  2HMN B;  1EG9 B;  5IW9 A;  4G1M B;  1NNV A;  1OGX A;  3NM7 A;  2D42 A;  3X41 A;  2BT3 A;  2WGQ A;  2H0G A;  3FF0 A;  5M18 A;  1GMP A;  4AKY A;  2QGU A;  4RBN A;  2Z7A A;  4CCV A;  1T2H A;  1CQS A;  1VQP 3;  2D1W A;  1IU7 A;  1E97 A;  3I0Y A;  1Q86 4;  4XB5 A;  1IT8 A;  1JKG A;  1W02 A;  3TDG A;  4R4K A;  4IIA A;  3F14 A;  3G6E 3;  3OWU A;  3WA2 X;  3CCU 3;  1N9E A;  1ROV A;  1K73 4;  3CC2 3;  3F40 A;  1BSA A;  2RGQ A;  2B24 B;  4JF8 A;  4WFO A;  2Y74 A;  1I0X A;  1VQ5 3;  3LML A;  1IQY A;  1HKX A;  1I2G A;  4HM1 B;  3AGO A;  1RCK A;  4BIR A;  1VQ4 3;  2F56 A;  1AQZ A;  4NRE A;  2IY2 A;  1DVD A;  3A5E A;  1PFP A;  1VZZ A;  4X2O A;  1WMP A;  3MYT A;  3D9R A;  4NPB A;  5AIH A;  1ROA A;  1RSN A;  2UGI A;  2XGN A;  1BNI A;  2QIY A;  1O7W B;  1STF I;  2KF4 A;  1V74 A;  2CC3 A;  1QVG 2;  4N6O B;  2H0I A;  4HM7 B;  1UUG B;  3PYJ A;  4LGQ A;  1YVS A;  3A76 A;  2CKF B;  3KFQ C;  1W5Z A;  3FSD A;  4HAA A;  1EA2 A;  2P09 A;  2WOH A;  3G4S 3;  4IT7 A;  1B20 A;  3MKI A;  4RNZ A;  4MMX B;  1BNE A;  2A15 A;  2MF7 A;  5AEW B;  1K28 A;  3F8X A;  1QMA A;  2CX0 A;  1HYF A;  1SQW A;  2XEP A;  1NU3 A;  1B2X A;  4HJL B;  4WHA A;  4BTX A;  3V98 A;  1LRA A;  3ER7 A;  3BNE A;  4RNT A;  4EBG A;  4HM3 B;  1ULJ B;  1SII A;  4MJD A;  5EVH A;  1RKY A;  2E2V A;  2XSH B;  4LZI A;  4BTY A;  2W0Q A;  5G2G A;  4CPK A;  2CX1 A;  1BRJ A;  2OWP A;  2XFS A;  1LOW A;  2CFD A;  4OUQ A;  1STD A;  1TJD A;  2M7O A;  1CH0 A;  3EHC A;  3CCJ 3;  5IG5 A;  1OCV A;  3UL6 A;  1RLS A;  3MSO A;  1DVC A;  4FMD A;  2FNQ A;  2YX9 A;  4XBY A;  4O02 B;  1OF5 A;  5GSP A;  4GHO A;  3CCQ 3;  3ROB A;  3FZW A;  7RNT A;  1JBS A;  3KSE D;  3D79 A;  4EW5 A;  2K54 A;  3U1W A;  3DM8 A;  5HOH A;  2GU3 A;  4N3V A;  3D5G A;  1BRK A;  2FXT A;  4LSO A;  1N9J A;  1IDP A;  1A2V A;  5G1L A;  1NB5 I;  2F5M A;  1RCL A;  4HM6 B;  1IVV A;  1LNH A;  3CCM 3;  3B4O A;  1A90 A;  5AIF A;  3BNB A;  5JPU A;  1PY3 A;  5CK6 A;  4U13 A;  1LOY A;  1GD3 A;  1BSE A;  1MGR A;  3H51 A;  1A2P A;  4H3U A;  4PEJ A;  3HI7 A;  3N8B A;  3SLU A;  1AR0 A;  3F8H A;  6STD A;  1IQ8 A;  1TRQ A;  1VQQ A;  3O8Y A;  3CMA 3;  1ZO2 A;  4BTW A;  2F4Y A;  1BIR A;  5IEN A;  3AHW A;  4KFF A;  3F7X A;  3NXJ A;  2RBI A;  1FGT A;  1RN1 A;  3URP A;  3OWS A;  1TFO A;  1NWW A;  3Q1C A;  4XDV A;  3KN4 A;  4OVM A;  1LOX A;  1N5H A;  1AV4 A;  2GEX A;  1IVX A;  3ZFZ A;  1EUI C;  1G0T A;  3ZG0 A;  4K1U A;  1GY7 A;  4FR9 A;  2OCT A;  3X3Y A;  1MOL A;  2IUJ A;  2IMJ A;  1OHS A;  4HM5 B;  4HM8 B;  3FG1 A;  4HOH A;  5ELJ A;  4KFE A;  3NQY A;  1OHP A;  1JBR A;  3X42 A;  3ECF A;  1MNL A;  4DKI A;  1R4Y A;  1IVU A;  3LTD A;  7GSP A;  4L7K A;  3IPT A;  5KP3 A;  1X1Y A;  3S67 A;  1KSI A;  2R41 A;  4FMA A;  2GBX B;  2K3D A;  4ILF A;  1GY5 A;  3G71 3;  2YFI B;  4R80 A;  5FGO A;  5BVB A;  1OH0 A;  3D4A A;  4GL6 A;  2KF5 A;  2W56 B;  2Z6B A;  5KP4 A;  1JZD A;  3CPW 2;  1JBT A;  1BU4 A;  1UGI A;  2CIU A;  3LTA A;  1BAN A;  2GBW B;  1O7H B;  3UNL A;  1IK3 A;  3DGN A;  3FG3 A;  2OTL 3;  1CYV A;  3WHO A;  1ULI B;  1T5Y A;  2C11 A;  4NHF A;  5CXO A;  1RGA A;  1YGE A;  5IEO A;  1Z1S A;  4I5Q A;  1BNF A;  4ORL A;  1VQM 3;  2Z77 A;  3LH4 A;  1I70 A;  1YI2 3;  5M1A A;  1RN4 A;  2OOV A;  4Q53 A;  1YVB I;  3EX9 A;  3RGR A;  2OTJ 3;  3SYU A;  1EEJ A;  2C4B A;  1YJW 3;  2WOF A;  1B2M A;  1FW7 A;  1UCI A;  1DMM A;  3SX1 A;  3VGN A;  1D6Z A;  3G8Z A;  1FUT A;  3PS8 A;  1B2Z A;  1W00 A;  1D6U A;  1GSP A;  3D3L A;  3DUK A;  2XR8 B;  3GAX A;  4CJN A;  1RNB A;  4L8O A;  4TX4 A;  4BL3 A;  5D81 A;  4EXR A;  1FA3 A;  2PNC A;  1NJI 4;  2YFJ B;  3JVC A;  3K7C A;  2ML6 A;  1YIJ 3;  1FUW A;  1GOV A;  2QEX 3;  1C7H A;  2HML B;  4FCZ A;  2KXG A;  3AHS A;  3MHE A;  1K41 A;  3DXO A;  1A67 A;  2W6J H;  1RGL A;  1SIH A;  4EYC A;  1RN7 A;  5KP1 A;  3DMC A;  3I56 3;  1Q82 4;  1BNG A;  1DET A;  2F86 B;  4HYZ A;  1RGC A;  1FGQ A;  2P0X A;  1Q42 A;  3CU3 A;  2ZHX B;  3T0U A;  7STD A;  2BMO B;  1VQO 3;  3HOH A;  4N6U A;  1I2E A;  1BSC A;  1MGW A;  2J8X B;  3L0R A;  4BL2 A;  5I97 A;  1VQN 3;  3IMA B;  1JN5 B;  3FH1 A;  1I3F A;  2E2U A;  5BU4 A;  4RNY A;  1W6Y A;  4H61 A;  4EC6 A;  2CFG A;  1UGH I;  4X2H A;  3CC4 3;  1M90 4;  5BXQ A;  3F9S A;  3GWR A;  3KCH A;  4AEQ A;  1S72 3;  1W7C A;  5CF2 A;  1NDO B;  5DRV A;  4O2H A;  5RNT A;  3CNX A;  2ZDJ A;  1JV2 B;  2STD A;  2IUK A;  3CXC 2;  3S27 A;  2BMQ B;  1T2I A;  1IV7 A;  2K0M A;  1U5O A;  2BMR B;  1B2U A;  2XRX B;  2CFW A;  5AYR B;  4LEH A;  1JB4 A;  4HBR A;  5LC6 A;  4STD A;  1BRI A;  4MEI A;  3S5C A;  2KAA A;  2CFL A;  3ZG5 A;  5BIR A;  4R9L A;  1V57 A;  1W6C A;  1Q40 B;  3B8L A;  5G1K A;  1GMR A;  2SBL A;  2HMM B;  3EBY A;  4N6M A;  3DGL A;  3LT8 A;  2F98 A;  3CME 3;  3SOA A;  2RNT A;  1FYS A;  1MWU A;  1BAO A;  4R1K A;  3HII A;  4L8P A;  4FCJ A;  2PZV A;  2F99 A;  4FMB A;  2SAR A;  3MWZ A;  3CCL 3;  3GRD A;  3EQQ B;  4FMC A;  4O8S A;  2W9Q A;  1B21 A;  3NBB A;  1F8N A;  2FGT A;  5CF1 A;  1Q9E A;  3HK4 A;  3VSY A;  1B3S A;  4ZM8 A;  3OW2 2;  3K5T A;  3NX0 A;  3WR2 A;  1IV9 A;  4N6V 0;  1M1K 4;  1JZO A;  1BGS A;  1OAC A;  5HGR A;  3WOF B;  1R4C A;  4GSP A;  2WGO A;  2R4I A;  4WWU C;  3GZB A;  3DH2 A;  4HVN A;  4R9K A;  1E3R A;  3B4P A;  6RNT A;  8CHO A;  3WA3 A;  1IYY A;  3EB8 A;  3S28 A;  2CW9 A;  3CNM A;  5D83 A;  3N9H A;  1QAF A;  2GXF A;  4I4K A;  1W2B 2;  5IG4 A;  2ML5 A;  2GU1 A;  1JRQ A;  1C54 A;  1DE3 A;  3T8U A;  1RGF A;  3OX9 A;  1O7N B;  1UDI I;  1RGH A;  1TIJ A;  1UUW B;  1JN5 A;  3Q90 A;  1RRH A;  1JNQ A;  3CPO A;  3PGB A;  2V1L A;  3FLJ A;  8RNT A;  4HM4 B;  3CCS 3;  2RFR A;  1YGW A;  2CHC A;  3H3H A;  3LOY A;  3JUQ A;  3WDG B;  3DGM A;  3EE1 A;  3M8C A;  4FCM A;  1O7G B;  1MWR A;  3BB9 A;  2F5W A;  1DMQ A;  1DYU A;  4JRF A;  1NB3 I;  3SXX A;  4KFD A;  4HM2 B;  2HMJ B;  3KZT A;  1NO3 A;  1RGE A;  4XBT A;  2P0M A;  1HZ1 A;  3Q2P A;  1N5P A;  3GSP A;  2W2C A;  1QJG A;  3BLZ A;  2MC8 A;  3AMO B;  3FG4 A;  3PCR A;  1U8C B;  1YNV X;  1FGM A;  2CWU A;  2LQV A;  1Q40 A;  1FZU A;  3RNT A;  3KE7 A;  3U97 A;  3Q3F A;  4KVH A;  2RSX A;  3D5I A;  3KSP A;  1GOU A;  5LC7 A;  1KC8 4;  1AVK A;  2AAE A;  4WYK B;  1LVN A;  3EJV A;  2W03 A;  2XGL A;  1QAK A;  2Z76 A;  3K0Z A;  4J5K A;  5STD A;  1OPY A;  1UUV B;  4KZ1 A;  1B27 A;  2RCD A;  2CWV A;  1RTU A;  2IA7 A;  5IG0 A;  6GSP A;  3LYG A;  4QWT A;  2CWT A;  1RGG A;  3UB1 A;  1Q7H A;  3B7C A;  1KD1 4;  1GD4 A;  3NV0 B;  3MG3 A;  1BRN L;  1ZGX A;  1V58 A;  3JUM A;  3WOD G;  2L4V A;  1BRS A;  1UCL A;  3UL5 A;  3WOE B;  1WNH A;  3BU4 A;  2CK3 H;  3LT9 A;  2W9P A;  1VQK 3;  1BNJ A;  1VQ7 3;  1S5A A;  2Q07 A;  4J9A A;  2E2T A;  4MMY B;  5CLK A;  1MWS A;  1X1U A;  2UUG C;  2AAD A;  3QRD A;  4GB5 A;  1O7P B;  1K9M 4;  3EN1 B;  3BNC A;  1VQL 3;  1N8R 4;  3KII A;  1IT7 A;  1IVW A;  1SAR A;  2ZA4 A;  1UI7 A;  1HU9 A;  3NQZ A;  5ELU A;  3J7Y d;  3G16 A;  2CH9 A;  4AKZ A;  3DGY A;  1LXE A;  1OF5 B;  1RDS A;  4N6N B;  1BSB A;  3K9M C;  4EV2 A;  5IF6 A;  1WMO A;  1J2B A;  1UCK A;  1JB2 A;  3JUN A;  1M9G A;  3G0K A;  2I9W A;  4N6T A;  2BIR A;  2UX0 A;  2CG1 A;  3SOY A;  1BOX A;  3RGA A;  3WMD A;  1YJ9 3;  2XFT A;  2BHM A;  3CD6 3;  1I0V A;  1B2S A;  3NBJ A;  1Y4K A;  2OOV C;  2P38 A;  1TFK A;  1US1 A;  1EQK A;  3AMO A;  3PZW A;  4IPB A;  1ZX2 A;  1W2Z A;  2XH9 A;  9RNT A;  1CEW I;  1TU5 A;  3UJM A;  3BND A;  3LTB A;  3X3X A;  1EKM A;  3LXU X;  1KWI A;  1ASK A;  3NHX A;  4HZ9 B;  2O3O A;  1RGK A;  5TGN A;  3GZR A;  1X1X A;  2W56 A;  3QK9 A;  1D6Y A;  4J5G A;  2CFK A;  1JB5 A;  4WYK A;  1JJ2 2;  3EC9 A;  1BNR A;  3EBT A;  3SVA A;  2GSP A;  3LTC A;  1BRH A;  1OUN A;  1WQL B;  1RHL A;  2W04 A;  4LMI A;  3FKA A;  1ZS7 A;  3T8N A;  1GOY A;  1T3B A;  3E99 A;  5AII A;  1KQS 2;  1TP6 A;  3DZL A;  1TRP A;  2HOH A;  2IYJ A;  2QA4 3;  2YFL B;  3N54 B;  4XDW A;  4BU4 A;  2KCD A;  3LZA A;  3NV0 A;  3VF1 A;  3V92 A;  2INX A;  3IJE B;  3K63 A;  3HX8 A;  1UCJ A;  2JQ5 A;  1YJN 3;  1K8A 4;  1M1X B;  5AYS C;  1FGR A;  1ISK A;  2KF6 A;  2BNG A;  1BNS A;  2HMK B;  3JUP A;  1GYB A;  1BSD A;  1QVF 2;  3OV4 A;  1W6G A;  1WTH A;  1PYL A;  1DMN A;  1QAL A;  5D82 A;  5EEO A;  1SPU A;  4CDL A;  1LOV A;  1RMS A;  3X3Z A;  3FCS B;  1SJW A;  1FUS A;  1BVI A;  4MMZ B;  1VQ9 3;  3EF8 A;  4LYL B;  3CCV 3;  1VQ6 3;  1BUQ A;  5JPP A;  3MPH A;  3NUV A;  4KT3 B;  1Q81 4;  1E3V A;  5AI1 A;  1BUJ A;  1GMQ A; 
#chains in the Genus database with same CATH homology
 3HIG A;  3MG2 A;  5AEU B;  3FF2 A;  3FGY A;  1YIT 3;  2B1X B;  4HM0 B;  5FW5 A;  2GEY A;  1JKG B;  4XM4 A;  3SED A;  3STD A;  4EV5 A;  1UI8 A;  3CC7 3;  4HZB B;  5IEP A;  2OQE A;  3PCS A;  5IG3 A;  5AIG A;  2JDI H;  1Q7Y 4;  4XBX A;  1G96 A;  3I55 3;  1TUH A;  5IER A;  1UW1 A;  1RJO A;  1L5G B;  3CCR 3;  5JBS A;  1VQ8 3;  1IQX A;  3JUO A;  2O9U X;  4RZM A;  2P05 A;  1OGZ A;  3CCE 3;  2LYX A;  4O3V A;  2XF3 A;  1O7M B;  3OXA A;  3ALA A;  5EQL A;  4HKV B;  2HMO B;  3NBR A;  3GZX B;  3NM2 A;  4OK0 A;  3S29 A;  3X40 A;  1OHO A;  2C10 A;  3F7S A;  4K90 B;  2XSO B;  1WMN A;  2BO9 B;  1CYU A;  1FGO A;  5A0O B;  1AVL A;  3OWY A;  2Y73 A;  3DGO A;  4J8T A;  1W01 A;  4K61 A;  1GS3 A;  3V99 A;  3MG1 A;  2WO0 A;  3KKG A;  1RRL A;  2OQE C;  1PU4 A;  4K1V A;  2ZL8 A;  1YHQ 3;  4N6L A;  3GZY B;  3DY5 A;  1W4N A;  3HZP A;  3PXM A;  5DRE A;  2KRT A;  3EN8 A;  1GY6 A;  4WP5 A;  3RDE A;  1A2K A;  1N8Q A;  2CG0 A;  2HMN B;  1EG9 B;  5IW9 A;  4G1M B;  1OGX A;  3NM7 A;  2D42 A;  3X41 A;  2BT3 A;  2WGQ A;  3FF0 A;  4AKY A;  2QGU A;  4RBN A;  2Z7A A;  4CCV A;  1CQS A;  1VQP 3;  2D1W A;  1IU7 A;  1E97 A;  3I0Y A;  1Q86 4;  4XB5 A;  1IT8 A;  1JKG A;  1W02 A;  3TDG A;  4R4K A;  4IIA A;  3F14 A;  3G6E 3;  3OWU A;  3WA2 X;  3CCU 3;  1N9E A;  1ROV A;  1K73 4;  3CC2 3;  3F40 A;  2RGQ A;  2B24 B;  4JF8 A;  4WFO A;  2Y74 A;  1VQ5 3;  3LML A;  1IQY A;  1HKX A;  4HM1 B;  1VQ4 3;  4NRE A;  1DVD A;  1PFP A;  1VZZ A;  4X2O A;  1WMP A;  3MYT A;  3D9R A;  5AIH A;  1ROA A;  2XGN A;  2QIY A;  1O7W B;  1STF I;  1V74 A;  2CC3 A;  1QVG 2;  4N6O B;  4HM7 B;  3PYJ A;  4LGQ A;  3A76 A;  2CKF B;  3KFQ C;  1W5Z A;  3FSD A;  1EA2 A;  2P09 A;  2WOH A;  3G4S 3;  4IT7 A;  3MKI A;  4RNZ A;  4MMX B;  2A15 A;  2MF7 A;  5AEW B;  1K28 A;  3F8X A;  1QMA A;  1SQW A;  2XEP A;  1NU3 A;  4WHA A;  4HJL B;  4BTX A;  3V98 A;  3ER7 A;  3BNE A;  4EBG A;  4HM3 B;  1ULJ B;  1SII A;  4MJD A;  5EVH A;  1RKY A;  2E2V A;  2XSH B;  4LZI A;  4BTY A;  2W0Q A;  5G2G A;  2OWP A;  2XFS A;  2CFD A;  4OUQ A;  1STD A;  2M7O A;  3EHC A;  3CCJ 3;  5IG5 A;  1OCV A;  3UL6 A;  3MSO A;  1DVC A;  4FMD A;  2FNQ A;  2YX9 A;  4XBY A;  4O02 B;  1OF5 A;  3CCQ 3;  3ROB A;  3FZW A;  3KSE D;  2K54 A;  3U1W A;  3DM8 A;  2GU3 A;  4N3V A;  2FXT A;  4LSO A;  1N9J A;  1IDP A;  1A2V A;  1NB5 I;  4HM6 B;  3CCM 3;  1IVV A;  1LNH A;  1A90 A;  3B4O A;  5AIF A;  3BNB A;  5JPU A;  5CK6 A;  4U13 A;  1GD3 A;  3H51 A;  4H3U A;  4PEJ A;  3HI7 A;  3N8B A;  3SLU A;  1AR0 A;  3F8H A;  6STD A;  1IQ8 A;  3O8Y A;  3CMA 3;  1ZO2 A;  4BTW A;  5IEN A;  4KFF A;  3F7X A;  3NXJ A;  1FGT A;  3OWS A;  1TFO A;  1NWW A;  3Q1C A;  4XDV A;  3KN4 A;  4OVM A;  1LOX A;  1N5H A;  1AV4 A;  2GEX A;  1IVX A;  4K1U A;  1GY7 A;  4FR9 A;  2OCT A;  3X3Y A;  1MOL A;  2IUJ A;  2IMJ A;  1OHS A;  4HM5 B;  4HM8 B;  3FG1 A;  5ELJ A;  4KFE A;  3NQY A;  1OHP A;  3X42 A;  3ECF A;  1MNL A;  3LTD A;  1IVU A;  4L7K A;  3IPT A;  5KP3 A;  3S67 A;  1KSI A;  4FMA A;  2GBX B;  1GY5 A;  3G71 3;  2YFI B;  4R80 A;  5FGO A;  5BVB A;  1OH0 A;  4GL6 A;  2Z6B A;  2W56 B;  5KP4 A;  3CPW 2;  2CIU A;  3LTA A;  2GBW B;  1O7H B;  3UNL A;  1IK3 A;  3DGN A;  3FG3 A;  2OTL 3;  1CYV A;  1ULI B;  1T5Y A;  2C11 A;  4NHF A;  5CXO A;  1YGE A;  5IEO A;  1Z1S A;  1VQM 3;  4ORL A;  2Z77 A;  3LH4 A;  1YI2 3;  2OOV A;  4Q53 A;  1YVB I;  3EX9 A;  3RGR A;  2OTJ 3;  1YJW 3;  2WOF A;  1DMM A;  3SX1 A;  3VGN A;  1D6Z A;  3G8Z A;  3PS8 A;  1W00 A;  1D6U A;  3D3L A;  3DUK A;  2XR8 B;  3GAX A;  4L8O A;  4TX4 A;  1FA3 A;  5D81 A;  4EXR A;  2PNC A;  1NJI 4;  2YFJ B;  3JVC A;  3K7C A;  2ML6 A;  1YIJ 3;  1FUW A;  2QEX 3;  1C7H A;  2HML B;  4FCZ A;  2KXG A;  3MHE A;  1K41 A;  3DXO A;  1A67 A;  2W6J H;  1Q82 4;  1SIH A;  4EYC A;  1RN7 A;  5KP1 A;  3DMC A;  3I56 3;  2F86 B;  4HYZ A;  3CU3 A;  1FGQ A;  2P0X A;  1Q42 A;  1VQO 3;  7STD A;  3T0U A;  1N8R 4;  2BMO B;  4N6U A;  1VQN 3;  3L0R A;  5I97 A;  3IMA B;  1JN5 B;  3FH1 A;  2E2U A;  4RNY A;  1W6Y A;  4H61 A;  4EC6 A;  2CFG A;  4X2H A;  3CC4 3;  1M90 4;  5BXQ A;  3F9S A;  3GWR A;  4AEQ A;  1S72 3;  1W7C A;  5CF2 A;  1NDO B;  5DRV A;  4O2H A;  3CNX A;  2ZDJ A;  1JV2 B;  2STD A;  2IUK A;  3CXC 2;  3S27 A;  2BMQ B;  1IV7 A;  2K0M A;  1U5O A;  2BMR B;  2XRX B;  5AYR B;  2CFW A;  4LEH A;  1JB4 A;  4HBR A;  5LC6 A;  4STD A;  4MEI A;  3S5C A;  2CFL A;  4R9L A;  1W6C A;  1Q40 B;  3B8L A;  2SBL A;  2HMM B;  3EBY A;  4N6M A;  3DGL A;  3LT8 A;  2F98 A;  3CME 3;  3SOA A;  4R1K A;  3HII A;  4L8P A;  4FCJ A;  2PZV A;  2F99 A;  4FMB A;  3MWZ A;  3CCL 3;  3GRD A;  3EQQ B;  4FMC A;  4O8S A;  2W9Q A;  3NBB A;  1F8N A;  2FGT A;  5CF1 A;  3HK4 A;  3VSY A;  4ZM8 A;  3OW2 2;  3K5T A;  3NX0 A;  1IV9 A;  4N6V 0;  1M1K 4;  5HGR A;  1OAC A;  3WOF B;  1R4C A;  2WGO A;  2R4I A;  4WWU C;  3GZB A;  4HVN A;  4R9K A;  1E3R A;  3B4P A;  8CHO A;  3WA3 A;  3EB8 A;  3S28 A;  2CW9 A;  3CNM A;  5D83 A;  3N9H A;  1QAF A;  2GXF A;  4I4K A;  1W2B 2;  5IG4 A;  2ML5 A;  2GU1 A;  1JRQ A;  3T8U A;  3OX9 A;  1O7N B;  1TIJ A;  1UUW B;  1JN5 A;  3Q90 A;  1RRH A;  1JNQ A;  3CPO A;  3PGB A;  2V1L A;  3FLJ A;  4HM4 B;  3CCS 3;  2RFR A;  2CHC A;  3H3H A;  3LOY A;  3JUQ A;  3WDG B;  3DGM A;  3EE1 A;  3M8C A;  4FCM A;  1O7G B;  3BB9 A;  1DMQ A;  1DYU A;  4JRF A;  1NB3 I;  3SXX A;  4KFD A;  4HM2 B;  2HMJ B;  3KZT A;  1NO3 A;  4XBT A;  2P0M A;  3Q2P A;  1N5P A;  2W2C A;  1QJG A;  3BLZ A;  2MC8 A;  3AMO B;  3FG4 A;  3PCR A;  1U8C B;  2CWU A;  1FGM A;  2LQV A;  1Q40 A;  3U97 A;  3KE7 A;  4KVH A;  2RSX A;  3KSP A;  5LC7 A;  1KC8 4;  1AVK A;  4WYK B;  1LVN A;  3EJV A;  2W03 A;  2XGL A;  1QAK A;  2Z76 A;  3K0Z A;  5STD A;  1OPY A;  1UUV B;  4KZ1 A;  2RCD A;  2CWV A;  2IA7 A;  5IG0 A;  3LYG A;  4QWT A;  2CWT A;  3UB1 A;  3B7C A;  1KD1 4;  1GD4 A;  3NV0 B;  3MG3 A;  3JUM A;  3WOD G;  2L4V A;  3UL5 A;  3WOE B;  1WNH A;  2CK3 H;  3LT9 A;  2W9P A;  1VQK 3;  1VQ7 3;  1S5A A;  2Q07 A;  4J9A A;  2E2T A;  4MMY B;  5CLK A;  3QRD A;  4GB5 A;  1O7P B;  1K9M 4;  3EN1 B;  3BNC A;  1VQL 3;  3KII A;  1IVW A;  1IT7 A;  5ELU A;  1UI7 A;  1HU9 A;  3NQZ A;  3J7Y d;  3G16 A;  2CH9 A;  4AKZ A;  1LXE A;  1OF5 B;  4N6N B;  3K9M C;  4EV2 A;  5IF6 A;  1WMO A;  1J2B A;  1JB2 A;  3JUN A;  1M9G A;  3G0K A;  2I9W A;  4N6T A;  2UX0 A;  3SOY A;  2CG1 A;  1YJ9 3;  3RGA A;  3WMD A;  2XFT A;  2BHM A;  3CD6 3;  3NBJ A;  1Y4K A;  2OOV C;  2P38 A;  1TFK A;  1US1 A;  1EQK A;  3AMO A;  3PZW A;  4IPB A;  1ZX2 A;  1W2Z A;  2XH9 A;  1CEW I;  1TU5 A;  3UJM A;  3BND A;  3LTB A;  3X3X A;  1EKM A;  3LXU X;  1KWI A;  1ASK A;  3NHX A;  4HZ9 B;  2O3O A;  5TGN A;  3GZR A;  2W56 A;  3QK9 A;  1D6Y A;  4WYK A;  2CFK A;  1JB5 A;  1JJ2 2;  3EC9 A;  3EBT A;  3SVA A;  3LTC A;  4LMI A;  1OUN A;  1WQL B;  2W04 A;  3FKA A;  3T8N A;  3E99 A;  5AII A;  1KQS 2;  1TP6 A;  3DZL A;  2QA4 3;  2YFL B;  3N54 B;  4XDW A;  2KCD A;  3LZA A;  3NV0 A;  3VF1 A;  3V92 A;  2INX A;  3IJE B;  3K63 A;  3HX8 A;  2JQ5 A;  1YJN 3;  1K8A 4;  1M1X B;  5AYS C;  1FGR A;  1ISK A;  3JUP A;  2BNG A;  1QVF 2;  2HMK B;  1GYB A;  3OV4 A;  1W6G A;  1WTH A;  1DMN A;  1QAL A;  5D82 A;  5EEO A;  1SPU A;  4CDL A;  3X3Z A;  3FCS B;  1SJW A;  1VQ9 3;  4MMZ B;  3EF8 A;  3CCV 3;  1VQ6 3;  1BUQ A;  5JPP A;  3MPH A;  3NUV A;  1Q81 4;  1E3V A;  5AI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...