2W9PA

Crystal structure of potato multicystatin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTICYSTATIN
publication title Characterization of Solanum Tuberosum Multicystatin and its Structural Comparison with Other Cystatins.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
total genus 19
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w9pA00
2O9UX 4N6OB 1R4CA 3MWZA 3L0RA 5LC7A 1N5HA 4N6LA 3IMAB 3PYJA 1FUWA 1N5PA 1IV9A 4CCVA 4N6TA 1LXEA 1PFPA 3UL6A 5ELUA 1N9JA 3PXMA 4TX4A 1CEWI 4IT7A 1CYVA 2W9QA 1GD3A 1CYUA 5ELJA 3NX0A 1MOLA 3PS8A 1NB5I 3LH4A 1A90A 1A67A 3S67A 2CH9A 5LC6A 3UL5A 1DVCA 5EQLA 1RN7A 4ZM8A 1TIJA 3Q2PA 1DVDA 1M9GA 1STFI 4N6NB 3KFQC 1MNLA 1ROAA 2BO9B 1GD4A 3SVAA 1NB3I 3KSED 1EQKA 4N6V0 5A0OB 1G96A 1FA3A 3QRDA 1IV7A 4EYCA 2KXGA 2W9PA 1WNHA 4LZIA 3GAXA 4N6UA 3K9MC 1YVBI 1KWIA 4N6MA 2OCTA
chains in the Genus database with same CATH superfamily
2O9UX 2R41A 1BNSA 3B4OA 4N6OB 3D9RA 1FYSA 1IVUA 4U13A 2XFTA 4LEHA 1QALA 3KZTA 3FSDA 3DGOA 2F4YA 3CCV3 1A2PA 4MEIA 1FUTA 2CG1A 1VQ63 2F5WA 2IYJA 1C7HA 2C11A 5LC7A 1JN5B 3IMAB 3PYJA 2WOFA 1RHLA 2CIUA 1BNJA 3J7Yd 4CPKA 1HKXA 2P0MA 4N6TA 1GS3A 5D83A 5IW9A 1NWWA 1PFPA 3X42A 4BL2A 2JQ5A 1X1YA 3RGRA 3EC9A 1Q7Y4 3SYUA 3BNEA 3UL6A 5ELUA 1EUIC 4GSPA 1W5ZA 3B4PA 3HX8A 4O8SA 2ZL8A 1RCKA 2CG0A 4J5KA 1FGQA 3UNLA 1BSDA 3N9HA 4IT7A 3ZG5A 4HM1B 3CC23 2XGNA 2BMQB 1NJI4 1RCLA 3EBTA 1B2XA 2GSPA 1B27A 1DYUA 4EV5A 3NX0A 3BNCA 1GOYA 1BRJA 2F86B 1IVXA 1Q40A 1FGMA 3EN1B 3OWSA 1A2KA 1JZDA 3DGMA 2ZDJA 3SOAA 1VQ93 3MG1A 5AYSC 5RNTA 1IQ8A 1A90A 2E2TA 3ALAA 1SPUA 1W4NA 2CC3A 3H3HA 2CK3H 3PCSA 4HAAA 3WA2X 4J5GA 3WMDA 2HOHA 1PY3A 1Z1SA 1HU9A 1CH0A 3N54B 3U1WA 1ASKA 1JKGB 1YJN3 3MG3A 1VQ53 4FMDA 1G02A 4FMCA 2H0IA 4HJLB 1GOUA 3T8UA 3NV0A 1MWUA 1V58A 5HOHA 3OXAA 4RZMA 3X3XA 1B2ZA 3NM2A 1BUJA 1ZX2A 1Q42A 1W00A 3LOYA 1UCIA 2BHMA 1X1WA 1LNHA 1UCJA 3NBRA 2INXA 1OF5A 3PZWA 1D6ZA 1K28A 2E2VA 4BTWA 1GYBA 1X1XA 1DVDA 3FCSB 4AEQA 1AY7A 2XEPA 1RJOA 3FGYA 3I563 3WOFB 2MC8A 1WMNA 2P05A 1B2SA 5CF1A 1BSAA 1UCLA 1I0XA 1N8R4 4WYKB 4LGQA 1RRLA 2IA7A 2AADA 5IERA 2M7OA 5TGNA 1E3RA 2K0MA 1LQMB 1JRQA 1BRHA 2HMLB 3KE7A 3MHEA 1RGCA 2PNCA 1DETA 1FZUA 1WTHA 2RGQA 4EYCA 5IG4A 3EF8A 3F7XA 2RBIA 4FCJA 3ZG0A 2HMMB 3WHOA 3GWRA 1VQK3 2W9PA 2A15A 1WNHA 3S29A 1BNRA 1LOVA 1TUHA 2BMRB 2C4BA 5AIFA 3STDA 3AHWA 2H0GA 1BUQA 2GBWB 2P09A 3EHCA 3HOHA 4HZBB 1IVVA 1UGHI 5EEOA 1RN4A 1YVBI 3CU3A 2GU3A 3HIGA 5DRVA 2YFJB 3BNDA 2UGIA 1RMSA 4N6MA 2OCTA 1DMNA 4XBTA 4CJNA 1SQWA 1K8A4 3G713 4XM4A 1GOVA 1GMRA 2CW9A 5D82A 3OV4A 2OWPA 1OPYA 3DMCA 2CWVA 3LTBA 4HKVB 1BRIA 4AKZA 2GEYA 1MGRA 2L4VA 2P0XA 3L0RA 2Y73A 2IMJA 4J9AA 1OCVA 4KFFA 4CDLA 1N5HA 1Q40B 4N6LA 1VQO3 1FGRA 1QVF2 1FUWA 3D5IA 3F7SA 1FGOA 1LQGC 4LSOA 4LYLB 1BNEA 4CCVA 4EV2A 3F8XA 3U97A 2KF4A 1KQS2 2SARA 3PCRA 1IU7A 5JBSA 4EBGA 2RNTA 1W6YA 3I0YA 5EVHA 1O7MB 3DGNA 4HM2B 3FG4A 5CXOA 2XRXB 1N9JA 1FUSA 1O7NB 4XB5A 3CXC2 1OUNA 2GXFA 2Y74A 3X3YA 3OWUA 1LVNA 1U5OA 1B2UA 1I2GA 3X40A 2KRTA 7STDA 4HOHA 2ZHXB 1C54A 2W9QA 2HMOB 3NV0B 1AV4A 1GD3A 3FF0A 1LNIA 2Z76A 1I70A 4G1MB 1X1UA 3I553 3HIIA 1D6UA 3WDGB 1B20A 3D5GA 3Q3FA 4KVHA 1JJ22 3PS8A 2ML5A 5AIHA 1OF5B 3LMLA 3LTCA 2CWUA 4IIAA 3RGAA 2L1SA 5CK6A 3G6E3 3F9SA 3CME3 4XBYA 1HZ1A 4XBXA 1RGGA 3TDGA 1GMQA 2D42A 3HK4A 3ROBA 2XFSA 1I2FA 3SOYA 3Q90A 4NPBA 2UX0A 2HMKB 1M1XB 3CCJ3 1RSNA 1BSCA 1V57A 2BT3A 1BNFA 3LTDA 5GSPA 4OUQA 2FGTA 3T0UA 1IK3A 2O3OA 3DGYA 1BAOA 1IDPA 2Z7AA 5M1AA 5IG3A 4IPBA 1VQL3 1W7CA 3E99A 2J8XB 6GSPA 3K63A 2QEX3 3RNTA 5EQLA 5STDA 1RN7A 5M19A 1IVWA 1BSEA 1A2VA 2RCDA 4HM0B 4ZM8A 3MYTA 3CC73 3MKIA 1D6YA 3GZXB 3K0ZA 7RNTA 4HYZA 1LOWA 1WMOA 4Q53A 4RNTA 1TFKA 2P38A 3VSYA 4BTYA 8CHOA 3NBBA 3QK9A 5IG5A 2XGLA 1T2HA 1KSIA 3JUQA 3KFQC 3IJEB 1T5YA 3CC43 1MNLA 3MSOA 3NQYA 2WGQA 2Z77A 3K7CA 1JZOA 1NB3I 1VQQA 4N6V0 2OTJ3 2K3DA 2W56A 1T3BA 3F40A 1G96A 1W02A 1G0TA 2IY2A 3BU4A 4O3VA 1RNTA 3EB8A 1FGTA 7GSPA 1I3FA 3CCQ3 1UI7A 3LXUX 4R9LA 2CWTA 4STDA 5IENA 3SEDA 1VZZA 2HMNB 3UB1A 3G4S3 4O2HA 3OX9A 1TRPA 3LT9A 1VQ73 4NHFA 4L8OA 3GAXA 1PYLA 2E2UA 1O7WB 3AGOA 4HBRA 1WQLB 1ROVA 1RLSA 4KFDA 4K1UA 4N6UA 5KP4A 1K9M4 1TFOA 5AIIA 2IUKA 3JVCA 1RGFA 5AI1A 3OW22 1JB2A 4HM4B 2H0HA 3SX1A 4L7KA 3GZYB 3KN4A 2RSXA 1JBTA 3S27A 1JNQA 3VGNA 1Q864 1YVSA 1BVIA 2RFRA 1NNVA 2F5MA 2MF7A 3DXOA 3MWZA 4HM6B 5IEOA 3SLUA 3SXXA 1VQ43 5IEPA 1VQM3 1K734 1JB4A 1KC84 1UDII 1JV2B 1JBSA 1UUGB 3H51A 3BB9A 3BNBA 3LT8A 1YJW3 4MMXB 2W04A 2IUJA 3CPW2 1EA2A 1O7HB 3LYGA 1LOYA 5JPPA 4HVNA 3G8ZA 4RBNA 5CLKA 1VQP3 1OHPA 2F98A 2CFGA 3NXJA 3PXMA 1NO3A 4R9KA 3AMOA 2XSOB 4HM3B 1CYVA 2CKFB 3EBYA 4MMYB 4EC6A 1S5AA 3BIRA 4FCMA 2K54A 5AEUB 3GSPA 1L5GB 1MOLA 2OOVA 3S5CA 1NB5I 1BRNL 1JBRA 3NHXA 4OK0A 1Q9EA 3EJVA 3IPTA 4HM5B 4N3VA 5AEWB 1OGXA 1RGKA 3FH1A 4L8PA 1EG9B 1BRKA 1T2IA 1I3IA 1B2MA 5M18A 1DMQA 3HZPA 3JUNA 6RNTA 1NU3A 1CQSA 4R4KA 1JB5A 2AAEA 1W01A 1N8QA 3GZRA 1BNIA 1UUVB 2Z6BA 4RNZA 1O7PB 3MPHA 5AYRB 2KF6A 3S67A 2SBLA 2STDA 1YIJ3 1QMAA 1I0VA 2C10A 2CH9A 5I97A 1RGEA 4EW5A 4FMAA 5LC6A 2W56B 4WHAA 3DUKA 1M904 4K90B 1DVCA 1BOXA 3CCM3 3A5EA 2FNQA 1I8VA 1LRAA 1V74A 2R4IA 3S28A 1BU4A 3Q1CA 2YX9A 2LQVA 3G0KA 3NBJA 2BU4A 3D79A 2D1WA 4RNYA 2B1XB 2QGUA 3JUMA 2QA43 4H3UA 1MWTA 1DE3A 1ROAA 1DMMA 2ZA4A 1ULIB 2BO9B 1GD4A 3RDEA 3SVAA 4JF8A 2WGOA 1WMPA 1UI8A 4BTXA 2PZVA 3DY5A 1QVG2 1SARA 5CF2A 3GRDA 1VQ83 1FA3A 2XR8B 5G1KA 3FG1A 4R1KA 4KZ1A 2W6JH 1GMPA 5BU4A 3MG2A 1W2B2 2ML6A 4J8TA 2KXGA 1AQZA 2CFLA 4O02B 4BL3A 3DGLA 1W6CA 1IQYA 2YFLB 1RNBA 4K1VA 3FLJA 1BANA 2GBXB 2CFDA 3CMA3 4H61A 1E3VA 1OHSA 1OGZA 1YJ93 1ZGXA 1RKYA 1Y4KA 1ISKA 4FR9A 1ZS7A 1BSBA 3M8CA 2W0QA 3DZLA 3KSPA 1STDA 1RGAA 5BIRA 2YFIB 3CCS3 3FZWA 3AMOB 2BMOB 3CPOA 3UJMA 1BRSA 4XDVA 1YHQ3 1IYYA 1QAFA 2W2CA 3V98A 1O7GB 3NUVA 3CCL3 3CCR3 1TRQA 3B7CA 1R4CA 3F8HA 2CHCA 4X2OA 1W2ZA 4JRFA 4BIRA 2KF3A 1UW1A 1ZO2A 3CCE3 1VQN3 1BNGA 2QIYA 3KKGA 4X2HA 3LZAA 1NDOB 4HZ9B 1YGEA 3ECFA 3NM7A 3WOEB 3ZFZA 2XSHB 1N5PA 3WA3A 3BLZA 1IV9A 1E97A 2UUGC 3OWYA 1LXEA 2GEXA 3CNXA 4GHOA 5G2GA 1F8NA 1OHOA 1SIHA 1TU5A 3T8NA 4R80A 1R4YA 1AR0A 4DKIA 3F14A 1SIIA 2OOVC 5IG0A 2CX0A 3EX9A 1BRGA 4TX4A 3FG3A 1OH0A 1S723 1CEWI 1N9EA 3K5TA 1K41A 5KP1A 4MMZB 2OQEC 4EXRA 3V92A 1QJGA 4WWUC 1RRHA 5AIGA 3DM8A 4ORLA 5BVBA 1M1K4 1YGWA 1EEJA 4WFOA 5DREA 1GY6A 2F56A 3EN8A 1Q7HA 1CYUA 9RNTA 5ELJA 3KCHA 2BNGA 4GB5A 1FW7A 1KD14 1Q824 3PGBA 1RGHA 4K61A 5JPUA 1JN5A 1BGSA 3LH4A 3JUOA 1TTOA 1SJWA 4HM7B 4AKYA 2CFWA 5KP3A 1GY5A 2XF3A 3ER7A 1B21A 1A67A 5HGRA 1HYFA 4KT3B 3FKAA 1PU4A 1UUWB 3WODG 2V1LA 2JDIH 2HMJB 1Q814 2KCDA 4MJDA 3WR2A 3UL5A 4FCZA 4I5QA 1LOXA 3AGNA 4HM8B 1U8CB 3LTAA 1TIJA 1MWSA 3VF1A 3DH2A 3KIIA 3Q2PA 2F99A 3G16A 1J2BA 1M9GA 8RNTA 3AHSA 1STFI 3HI7A 2OQEA 3EQQB 2W03A 4N6NB 2WO0A 3D4AA 3FF2A 2Q07A 3O8YA 1AVLA 2XH9A 4WP5A 1EKMA 2OTL3 3X3ZA 1B3SA 5G1LA 1TJDA 2WOHA 3KSED 4LMIA 1AVKA 5FGOA 1JKGA 5IF6A 1EQKA 3V99A 5D81A 4NREA 1YIT3 3URPA 5A0OB 2CFKA 6STDA 1IT8A 2LYXA 3D3LA 3CD63 3QRDA 1IV7A 2I9WA 3GZBA 3CCU3 4BU4A 1UCKA 1IT7A 2KF5A 1TP6A 1W6GA 1IQXA 2B24B 3CNMA 5FW5A 4PEJA 5BXQA 1OACA 1I2EA 1GY7A 1GSPA 3A76A 3EE1A 2KAAA 3NQZA 1US1A 4KFEA 4LZIA 1YI23 4QWTA 2BIRA 3JUPA 2GU1A 1QAKA 4ILFA 3X41A 4WYKA 3K9MC 1UGIA 4XDWA 4I4KA 1ULJB 1MGWA 1BIRA 1RDSA 1RN1A 3B8LA 1RTUA 1RGLA 3N8BA 1KWIA 4GL6A 4FMBA 4OVMA 2FXTA 2CX1A 1MWRA 1YNVX
chains in the Genus database with same CATH topology
2O9UX 3B4OA 4N6OB 3D9RA 1IVUA 4U13A 2XFTA 4LEHA 1QALA 3KZTA 3FSDA 3DGOA 3CCV3 4MEIA 2CG1A 1VQ63 5LC7A 1C7HA 2C11A 1JN5B 3IMAB 3PYJA 2WOFA 2CIUA 3J7Yd 1HKXA 2P0MA 4N6TA 1GS3A 5D83A 5IW9A 1NWWA 1PFPA 3X42A 2JQ5A 3RGRA 3EC9A 1Q7Y4 3BNEA 3UL6A 5ELUA 1W5ZA 3B4PA 3HX8A 4O8SA 2ZL8A 2CG0A 1FGQA 3UNLA 3N9HA 4IT7A 4HM1B 3CC23 2XGNA 2BMQB 1NJI4 3EBTA 4EV5A 1DYUA 3NX0A 3BNCA 2F86B 1IVXA 1Q40A 1FGMA 3EN1B 3OWSA 1A2KA 3DGMA 2ZDJA 3SOAA 1VQ93 3MG1A 5AYSC 1IQ8A 1A90A 2E2TA 3ALAA 1SPUA 1W4NA 2CC3A 3H3HA 2CK3H 3PCSA 3WA2X 3WMDA 1Z1SA 1HU9A 3N54B 3U1WA 1ASKA 1JKGB 1YJN3 3MG3A 1VQ53 4FMDA 4FMCA 4HJLB 3T8UA 3NV0A 3OXAA 4RZMA 3X3XA 3NM2A 1ZX2A 1Q42A 1W00A 3LOYA 2BHMA 1LNHA 3NBRA 2INXA 1OF5A 3PZWA 1D6ZA 1K28A 2E2VA 4BTWA 1GYBA 1DVDA 3FCSB 4AEQA 2XEPA 1RJOA 3FGYA 3I563 3WOFB 2MC8A 1WMNA 2P05A 5CF1A 1N8R4 4WYKB 4LGQA 1RRLA 5IERA 2M7OA 5TGNA 1E3RA 2K0MA 3KE7A 1JRQA 2HMLB 3MHEA 2PNCA 1WTHA 4EYCA 2RGQA 5IG4A 3EF8A 3F7XA 4FCJA 2HMMB 3GWRA 1VQK3 2W9PA 2A15A 1WNHA 3S29A 1TUHA 2BMRB 3STDA 5AIFA 1BUQA 2GBWB 2P09A 3EHCA 4HZBB 1IVVA 5EEOA 1YVBI 3CU3A 2GU3A 3HIGA 5DRVA 2YFJB 3BNDA 4N6MA 2OCTA 1DMNA 4XBTA 1SQWA 1K8A4 3G713 4XM4A 2CW9A 5D82A 3OV4A 2OWPA 1OPYA 3DMCA 2CWVA 3LTBA 4HKVB 4AKZA 2GEYA 2L4VA 2P0XA 3L0RA 2Y73A 2IMJA 4J9AA 1OCVA 4KFFA 4CDLA 1N5HA 1Q40B 4N6LA 1VQO3 1FGRA 1QVF2 1FUWA 3F7SA 1FGOA 4LSOA 4CCVA 4EV2A 3F8XA 3U97A 1KQS2 3PCRA 1IU7A 5JBSA 4EBGA 1W6YA 3I0YA 5EVHA 1O7MB 3DGNA 4HM2B 3FG4A 5CXOA 2XRXB 1N9JA 1O7NB 4XB5A 3CXC2 1OUNA 2GXFA 2Y74A 3X3YA 3OWUA 1LVNA 1U5OA 3X40A 2KRTA 7STDA 2W9QA 2HMOB 3NV0B 1AV4A 1GD3A 3FF0A 2Z76A 4G1MB 3I553 3HIIA 1D6UA 3WDGB 4KVHA 1JJ22 3PS8A 2ML5A 5AIHA 1OF5B 3LMLA 3LTCA 2CWUA 4IIAA 3RGAA 3G6E3 5CK6A 3F9SA 3CME3 4XBYA 4XBXA 3TDGA 2D42A 3HK4A 3ROBA 2XFSA 3SOYA 3Q90A 2UX0A 2HMKB 1M1XB 3CCJ3 2BT3A 3LTDA 4OUQA 2FGTA 3T0UA 1IK3A 2O3OA 1IDPA 2Z7AA 5IG3A 4IPBA 1VQL3 1W7CA 3E99A 2QEX3 3K63A 5EQLA 5STDA 1RN7A 1IVWA 4HM0B 1A2VA 2RCDA 4ZM8A 3MYTA 3CC73 3MKIA 1D6YA 3GZXB 3K0ZA 4HYZA 1WMOA 3VSYA 4Q53A 1TFKA 2P38A 4BTYA 8CHOA 3NBBA 3QK9A 5IG5A 2XGLA 3JUQA 1KSIA 3KFQC 3IJEB 1T5YA 3CC43 1MNLA 3MSOA 3NQYA 2WGQA 2Z77A 3K7CA 1NB3I 4N6V0 2OTJ3 2W56A 3F40A 1G96A 1W02A 4O3VA 3EB8A 1FGTA 3CCQ3 1UI7A 3LXUX 4R9LA 2CWTA 4STDA 5IENA 3SEDA 1VZZA 3UB1A 3G4S3 4O2HA 3OX9A 1VQ73 3LT9A 4NHFA 4L8OA 3GAXA 2E2UA 4HBRA 1O7WB 1K9M4 1WQLB 1ROVA 5KP4A 4KFDA 4K1UA 4N6UA 1TFOA 5AIIA 2IUKA 3JVCA 5AI1A 3OW22 1JB2A 4HM4B 3SX1A 4L7KA 3GZYB 3KN4A 2RSXA 3S27A 1JNQA 3VGNA 1Q864 2RFRA 3DXOA 2MF7A 4HM6B 3SXXA 3MWZA 5IEOA 3SLUA 1VQ43 5IEPA 1VQM3 1K734 1JB4A 1KC84 1JV2B 3H51A 1YJW3 3BB9A 3BNBA 3LT8A 4MMXB 2W04A 2IUJA 3CPW2 1EA2A 1O7HB 3LYGA 5JPPA 4HVNA 3G8ZA 4RBNA 5CLKA 1VQP3 1OHPA 2F98A 2CFGA 3NXJA 3PXMA 1NO3A 4R9KA 3AMOA 2XSOB 4HM3B 1CYVA 2CKFB 3EBYA 4MMYB 4EC6A 1S5AA 4FCMA 2K54A 5AEUB 1L5GB 1MOLA 2OOVA 3S5CA 1NB5I 3NHXA 4OK0A 3EJVA 3IPTA 4HM5B 4N3VA 5AEWB 1OGXA 3FH1A 4L8PA 1EG9B 1DMQA 3HZPA 3JUNA 1NU3A 1CQSA 4R4KA 1JB5A 1W01A 1N8QA 3GZRA 4RNZA 1UUVB 2Z6BA 5AYRB 1O7PB 3MPHA 3S67A 1YIJ3 2SBLA 2STDA 1QMAA 2C10A 2CH9A 5I97A 4FMAA 5LC6A 2W56B 4WHAA 3DUKA 1M904 4K90B 1DVCA 3CCM3 2FNQA 3S28A 1V74A 2R4IA 3Q1CA 2YX9A 2LQVA 3G0KA 3NBJA 2D1WA 4RNYA 2B1XB 2QGUA 3JUMA 2QA43 4H3UA 1ROAA 1DMMA 1ULIB 2BO9B 1GD4A 3RDEA 3SVAA 4JF8A 2WGOA 1WMPA 1UI8A 4BTXA 2PZVA 3DY5A 1QVG2 5CF2A 3GRDA 1VQ83 1FA3A 2XR8B 3FG1A 4R1KA 4KZ1A 2W6JH 3MG2A 1W2B2 2ML6A 4J8TA 2KXGA 2CFLA 4O02B 3DGLA 1W6CA 1IQYA 2YFLB 4K1VA 3FLJA 2GBXB 2CFDA 3CMA3 4H61A 1E3VA 1OHSA 1OGZA 1YJ93 1RKYA 1Y4KA 1ISKA 4FR9A 3M8CA 2FXTA 2W0QA 3DZLA 3KSPA 1STDA 2YFIB 3CCS3 3FZWA 3AMOB 2BMOB 3CPOA 3UJMA 4XDVA 1YHQ3 2W2CA 3V98A 1O7GB 3NUVA 3CCL3 3CCR3 3B7CA 1R4CA 3F8HA 2CHCA 4X2OA 1W2ZA 4JRFA 1UW1A 1ZO2A 3CCE3 1VQN3 3KKGA 4X2HA 3LZAA 1NDOB 4HZ9B 1YGEA 3ECFA 3NM7A 3WOEB 2XSHB 1N5PA 3WA3A 3BLZA 1IV9A 1E97A 3OWYA 1LXEA 2GEXA 3CNXA 5G2GA 1F8NA 1OHOA 1SIHA 1TU5A 3T8NA 4R80A 1AR0A 3F14A 1SIIA 2OOVC 5IG0A 3EX9A 4TX4A 3FG3A 1OH0A 1S723 1CEWI 1N9EA 3K5TA 1K41A 5KP1A 4MMZB 2OQEC 4EXRA 3V92A 1QJGA 4WWUC 1RRHA 5AIGA 3DM8A 4ORLA 5BVBA 1M1K4 4WFOA 5DREA 1GY6A 3EN8A 1CYUA 5ELJA 2BNGA 4GB5A 1KD14 1Q824 3PGBA 4K61A 5JPUA 1JN5A 3LH4A 3JUOA 1SJWA 4HM7B 4AKYA 2CFWA 5KP3A 2XF3A 1GY5A 3ER7A 1A67A 5HGRA 3FKAA 1PU4A 1UUWB 3WODG 2V1LA 2JDIH 2HMJB 1Q814 2KCDA 3UL5A 4FCZA 1LOXA 4HM8B 1U8CB 3LTAA 1TIJA 3VF1A 3KIIA 3Q2PA 2F99A 3G16A 1J2BA 1M9GA 1STFI 3HI7A 2OQEA 3EQQB 2W03A 4N6NB 2WO0A 3FF2A 2Q07A 3O8YA 1AVLA 2XH9A 4WP5A 1EKMA 2OTL3 3X3ZA 2WOHA 3KSED 4LMIA 1EQKA 1AVKA 5FGOA 1JKGA 5IF6A 3V99A 5D81A 4NREA 1YIT3 5A0OB 2CFKA 6STDA 1IT8A 2LYXA 3D3LA 3CD63 3QRDA 1IV7A 2I9WA 3GZBA 3CCU3 1IT7A 1TP6A 1W6GA 1IQXA 2B24B 3CNMA 5FW5A 4PEJA 5BXQA 1OACA 3A76A 1GY7A 3EE1A 3NQZA 1US1A 4KFEA 4LZIA 1YI23 4QWTA 3JUPA 2GU1A 1QAKA 3X41A 4WYKA 3K9MC 4XDWA 4I4KA 1ULJB 4MJDA 3B8LA 4OVMA 3N8BA 4GL6A 1KWIA 4FMBA 2IA7A 2QIYA 2HMNB 1QAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9U X;  4N6O B;  1R4C A;  3MWZ A;  3L0R A;  5LC7 A;  1N5H A;  4N6L A;  3IMA B;  3PYJ A;  1FUW A;  1N5P A;  1IV9 A;  4CCV A;  4N6T A;  1LXE A;  1PFP A;  3UL6 A;  5ELU A;  1N9J A;  3PXM A;  4TX4 A;  1CEW I;  4IT7 A;  1CYV A;  2W9Q A;  1GD3 A;  1CYU A;  5ELJ A;  3NX0 A;  1MOL A;  3PS8 A;  1NB5 I;  3LH4 A;  1A90 A;  1A67 A;  3S67 A;  2CH9 A;  5LC6 A;  3UL5 A;  1DVC A;  5EQL A;  1RN7 A;  4ZM8 A;  1TIJ A;  3Q2P A;  1DVD A;  1M9G A;  1STF I;  4N6N B;  3KFQ C;  1MNL A;  1ROA A;  2BO9 B;  1GD4 A;  3SVA A;  1NB3 I;  3KSE D;  1EQK A;  4N6V 0;  5A0O B;  1G96 A;  1FA3 A;  3QRD A;  1IV7 A;  4EYC A;  2KXG A;  2W9P A;  1WNH A;  4LZI A;  3GAX A;  4N6U A;  3K9M C;  1YVB I;  1KWI A;  4N6M A;  2OCT A; 
#chains in the Genus database with same CATH topology
 2O9U X;  2R41 A;  1BNS A;  3B4O A;  4N6O B;  3D9R A;  1FYS A;  1IVU A;  4U13 A;  2XFT A;  4LEH A;  1QAL A;  3KZT A;  3FSD A;  3DGO A;  2F4Y A;  3CCV 3;  1A2P A;  4MEI A;  1FUT A;  2CG1 A;  1VQ6 3;  2F5W A;  2IYJ A;  1C7H A;  2C11 A;  5LC7 A;  1JN5 B;  3IMA B;  3PYJ A;  2WOF A;  1RHL A;  2CIU A;  1BNJ A;  3J7Y d;  4CPK A;  1HKX A;  2P0M A;  4N6T A;  1GS3 A;  5D83 A;  5IW9 A;  1NWW A;  1PFP A;  3X42 A;  4BL2 A;  2JQ5 A;  1X1Y A;  3RGR A;  3EC9 A;  1Q7Y 4;  3SYU A;  3BNE A;  3UL6 A;  5ELU A;  1EUI C;  4GSP A;  1W5Z A;  3B4P A;  3HX8 A;  4O8S A;  2ZL8 A;  1RCK A;  2CG0 A;  4J5K A;  1FGQ A;  3UNL A;  1BSD A;  3N9H A;  4IT7 A;  3ZG5 A;  4HM1 B;  3CC2 3;  2XGN A;  2BMQ B;  1NJI 4;  1RCL A;  3EBT A;  1B2X A;  2GSP A;  1B27 A;  1DYU A;  4EV5 A;  3NX0 A;  3BNC A;  1GOY A;  1BRJ A;  2F86 B;  1IVX A;  1Q40 A;  1FGM A;  3EN1 B;  3OWS A;  1A2K A;  1JZD A;  3DGM A;  2ZDJ A;  3SOA A;  1VQ9 3;  3MG1 A;  5AYS C;  5RNT A;  1IQ8 A;  1A90 A;  2E2T A;  3ALA A;  1SPU A;  1W4N A;  2CC3 A;  3H3H A;  2CK3 H;  3PCS A;  4HAA A;  3WA2 X;  4J5G A;  3WMD A;  2HOH A;  1PY3 A;  1Z1S A;  1HU9 A;  1CH0 A;  3N54 B;  3U1W A;  1ASK A;  1JKG B;  1YJN 3;  3MG3 A;  1VQ5 3;  4FMD A;  1G02 A;  4FMC A;  2H0I A;  4HJL B;  1GOU A;  3T8U A;  3NV0 A;  1MWU A;  1V58 A;  5HOH A;  3OXA A;  4RZM A;  3X3X A;  1B2Z A;  3NM2 A;  1BUJ A;  1ZX2 A;  1Q42 A;  1W00 A;  3LOY A;  1UCI A;  2BHM A;  1X1W A;  1LNH A;  1UCJ A;  3NBR A;  2INX A;  1OF5 A;  3PZW A;  1D6Z A;  1K28 A;  2E2V A;  4BTW A;  1GYB A;  1X1X A;  1DVD A;  3FCS B;  4AEQ A;  1AY7 A;  2XEP A;  1RJO A;  3FGY A;  3I56 3;  3WOF B;  2MC8 A;  1WMN A;  2P05 A;  1B2S A;  5CF1 A;  1BSA A;  1UCL A;  1I0X A;  1N8R 4;  4WYK B;  4LGQ A;  1RRL A;  2IA7 A;  2AAD A;  5IER A;  2M7O A;  5TGN A;  1E3R A;  2K0M A;  1LQM B;  1JRQ A;  1BRH A;  2HML B;  3KE7 A;  3MHE A;  1RGC A;  2PNC A;  1DET A;  1FZU A;  1WTH A;  2RGQ A;  4EYC A;  5IG4 A;  3EF8 A;  3F7X A;  2RBI A;  4FCJ A;  3ZG0 A;  2HMM B;  3WHO A;  3GWR A;  1VQK 3;  2W9P A;  2A15 A;  1WNH A;  3S29 A;  1BNR A;  1LOV A;  1TUH A;  2BMR B;  2C4B A;  5AIF A;  3STD A;  3AHW A;  2H0G A;  1BUQ A;  2GBW B;  2P09 A;  3EHC A;  3HOH A;  4HZB B;  1IVV A;  1UGH I;  5EEO A;  1RN4 A;  1YVB I;  3CU3 A;  2GU3 A;  3HIG A;  5DRV A;  2YFJ B;  3BND A;  2UGI A;  1RMS A;  4N6M A;  2OCT A;  1DMN A;  4XBT A;  4CJN A;  1SQW A;  1K8A 4;  3G71 3;  4XM4 A;  1GOV A;  1GMR A;  2CW9 A;  5D82 A;  3OV4 A;  2OWP A;  1OPY A;  3DMC A;  2CWV A;  3LTB A;  4HKV B;  1BRI A;  4AKZ A;  2GEY A;  1MGR A;  2L4V A;  2P0X A;  3L0R A;  2Y73 A;  2IMJ A;  4J9A A;  1OCV A;  4KFF A;  4CDL A;  1N5H A;  1Q40 B;  4N6L A;  1VQO 3;  1FGR A;  1QVF 2;  1FUW A;  3D5I A;  3F7S A;  1FGO A;  1LQG C;  4LSO A;  4LYL B;  1BNE A;  4CCV A;  4EV2 A;  3F8X A;  3U97 A;  2KF4 A;  1KQS 2;  2SAR A;  3PCR A;  1IU7 A;  5JBS A;  4EBG A;  2RNT A;  1W6Y A;  3I0Y A;  5EVH A;  1O7M B;  3DGN A;  4HM2 B;  3FG4 A;  5CXO A;  2XRX B;  1N9J A;  1FUS A;  1O7N B;  4XB5 A;  3CXC 2;  1OUN A;  2GXF A;  2Y74 A;  3X3Y A;  3OWU A;  1LVN A;  1U5O A;  1B2U A;  1I2G A;  3X40 A;  2KRT A;  7STD A;  4HOH A;  2ZHX B;  1C54 A;  2W9Q A;  2HMO B;  3NV0 B;  1AV4 A;  1GD3 A;  3FF0 A;  1LNI A;  2Z76 A;  1I70 A;  4G1M B;  1X1U A;  3I55 3;  3HII A;  1D6U A;  3WDG B;  1B20 A;  3D5G A;  3Q3F A;  4KVH A;  1JJ2 2;  3PS8 A;  2ML5 A;  5AIH A;  1OF5 B;  3LML A;  3LTC A;  2CWU A;  4IIA A;  3RGA A;  2L1S A;  5CK6 A;  3G6E 3;  3F9S A;  3CME 3;  4XBY A;  1HZ1 A;  4XBX A;  1RGG A;  3TDG A;  1GMQ A;  2D42 A;  3HK4 A;  3ROB A;  2XFS A;  1I2F A;  3SOY A;  3Q90 A;  4NPB A;  2UX0 A;  2HMK B;  1M1X B;  3CCJ 3;  1RSN A;  1BSC A;  1V57 A;  2BT3 A;  1BNF A;  3LTD A;  5GSP A;  4OUQ A;  2FGT A;  3T0U A;  1IK3 A;  2O3O A;  3DGY A;  1BAO A;  1IDP A;  2Z7A A;  5M1A A;  5IG3 A;  4IPB A;  1VQL 3;  1W7C A;  3E99 A;  2J8X B;  6GSP A;  3K63 A;  2QEX 3;  3RNT A;  5EQL A;  5STD A;  1RN7 A;  5M19 A;  1IVW A;  1BSE A;  1A2V A;  2RCD A;  4HM0 B;  4ZM8 A;  3MYT A;  3CC7 3;  3MKI A;  1D6Y A;  3GZX B;  3K0Z A;  7RNT A;  4HYZ A;  1LOW A;  1WMO A;  4Q53 A;  4RNT A;  1TFK A;  2P38 A;  3VSY A;  4BTY A;  8CHO A;  3NBB A;  3QK9 A;  5IG5 A;  2XGL A;  1T2H A;  1KSI A;  3JUQ A;  3KFQ C;  3IJE B;  1T5Y A;  3CC4 3;  1MNL A;  3MSO A;  3NQY A;  2WGQ A;  2Z77 A;  3K7C A;  1JZO A;  1NB3 I;  1VQQ A;  4N6V 0;  2OTJ 3;  2K3D A;  2W56 A;  1T3B A;  3F40 A;  1G96 A;  1W02 A;  1G0T A;  2IY2 A;  3BU4 A;  4O3V A;  1RNT A;  3EB8 A;  1FGT A;  7GSP A;  1I3F A;  3CCQ 3;  1UI7 A;  3LXU X;  4R9L A;  2CWT A;  4STD A;  5IEN A;  3SED A;  1VZZ A;  2HMN B;  3UB1 A;  3G4S 3;  4O2H A;  3OX9 A;  1TRP A;  3LT9 A;  1VQ7 3;  4NHF A;  4L8O A;  3GAX A;  1PYL A;  2E2U A;  1O7W B;  3AGO A;  4HBR A;  1WQL B;  1ROV A;  1RLS A;  4KFD A;  4K1U A;  4N6U A;  5KP4 A;  1K9M 4;  1TFO A;  5AII A;  2IUK A;  3JVC A;  1RGF A;  5AI1 A;  3OW2 2;  1JB2 A;  4HM4 B;  2H0H A;  3SX1 A;  4L7K A;  3GZY B;  3KN4 A;  2RSX A;  1JBT A;  3S27 A;  1JNQ A;  3VGN A;  1Q86 4;  1YVS A;  1BVI A;  2RFR A;  1NNV A;  2F5M A;  2MF7 A;  3DXO A;  3MWZ A;  4HM6 B;  5IEO A;  3SLU A;  3SXX A;  1VQ4 3;  5IEP A;  1VQM 3;  1K73 4;  1JB4 A;  1KC8 4;  1UDI I;  1JV2 B;  1JBS A;  1UUG B;  3H51 A;  3BB9 A;  3BNB A;  3LT8 A;  1YJW 3;  4MMX B;  2W04 A;  2IUJ A;  3CPW 2;  1EA2 A;  1O7H B;  3LYG A;  1LOY A;  5JPP A;  4HVN A;  3G8Z A;  4RBN A;  5CLK A;  1VQP 3;  1OHP A;  2F98 A;  2CFG A;  3NXJ A;  3PXM A;  1NO3 A;  4R9K A;  3AMO A;  2XSO B;  4HM3 B;  1CYV A;  2CKF B;  3EBY A;  4MMY B;  4EC6 A;  1S5A A;  3BIR A;  4FCM A;  2K54 A;  5AEU B;  3GSP A;  1L5G B;  1MOL A;  2OOV A;  3S5C A;  1NB5 I;  1BRN L;  1JBR A;  3NHX A;  4OK0 A;  1Q9E A;  3EJV A;  3IPT A;  4HM5 B;  4N3V A;  5AEW B;  1OGX A;  1RGK A;  3FH1 A;  4L8P A;  1EG9 B;  1BRK A;  1T2I A;  1I3I A;  1B2M A;  5M18 A;  1DMQ A;  3HZP A;  3JUN A;  6RNT A;  1NU3 A;  1CQS A;  4R4K A;  1JB5 A;  2AAE A;  1W01 A;  1N8Q A;  3GZR A;  1BNI A;  1UUV B;  2Z6B A;  4RNZ A;  1O7P B;  3MPH A;  5AYR B;  2KF6 A;  3S67 A;  2SBL A;  2STD A;  1YIJ 3;  1QMA A;  1I0V A;  2C10 A;  2CH9 A;  5I97 A;  1RGE A;  4EW5 A;  4FMA A;  5LC6 A;  2W56 B;  4WHA A;  3DUK A;  1M90 4;  4K90 B;  1DVC A;  1BOX A;  3CCM 3;  3A5E A;  2FNQ A;  1I8V A;  1LRA A;  1V74 A;  2R4I A;  3S28 A;  1BU4 A;  3Q1C A;  2YX9 A;  2LQV A;  3G0K A;  3NBJ A;  2BU4 A;  3D79 A;  2D1W A;  4RNY A;  2B1X B;  2QGU A;  3JUM A;  2QA4 3;  4H3U A;  1MWT A;  1DE3 A;  1ROA A;  1DMM A;  2ZA4 A;  1ULI B;  2BO9 B;  1GD4 A;  3RDE A;  3SVA A;  4JF8 A;  2WGO A;  1WMP A;  1UI8 A;  4BTX A;  2PZV A;  3DY5 A;  1QVG 2;  1SAR A;  5CF2 A;  3GRD A;  1VQ8 3;  1FA3 A;  2XR8 B;  5G1K A;  3FG1 A;  4R1K A;  4KZ1 A;  2W6J H;  1GMP A;  5BU4 A;  3MG2 A;  1W2B 2;  2ML6 A;  4J8T A;  2KXG A;  1AQZ A;  2CFL A;  4O02 B;  4BL3 A;  3DGL A;  1W6C A;  1IQY A;  2YFL B;  1RNB A;  4K1V A;  3FLJ A;  1BAN A;  2GBX B;  2CFD A;  3CMA 3;  4H61 A;  1E3V A;  1OHS A;  1OGZ A;  1YJ9 3;  1ZGX A;  1RKY A;  1Y4K A;  1ISK A;  4FR9 A;  1ZS7 A;  1BSB A;  3M8C A;  2W0Q A;  3DZL A;  3KSP A;  1STD A;  1RGA A;  5BIR A;  2YFI B;  3CCS 3;  3FZW A;  3AMO B;  2BMO B;  3CPO A;  3UJM A;  1BRS A;  4XDV A;  1YHQ 3;  1IYY A;  1QAF A;  2W2C A;  3V98 A;  1O7G B;  3NUV A;  3CCL 3;  3CCR 3;  1TRQ A;  3B7C A;  1R4C A;  3F8H A;  2CHC A;  4X2O A;  1W2Z A;  4JRF A;  4BIR A;  2KF3 A;  1UW1 A;  1ZO2 A;  3CCE 3;  1VQN 3;  1BNG A;  2QIY A;  3KKG A;  4X2H A;  3LZA A;  1NDO B;  4HZ9 B;  1YGE A;  3ECF A;  3NM7 A;  3WOE B;  3ZFZ A;  2XSH B;  1N5P A;  3WA3 A;  3BLZ A;  1IV9 A;  1E97 A;  2UUG C;  3OWY A;  1LXE A;  2GEX A;  3CNX A;  4GHO A;  5G2G A;  1F8N A;  1OHO A;  1SIH A;  1TU5 A;  3T8N A;  4R80 A;  1R4Y A;  1AR0 A;  4DKI A;  3F14 A;  1SII A;  2OOV C;  5IG0 A;  2CX0 A;  3EX9 A;  1BRG A;  4TX4 A;  3FG3 A;  1OH0 A;  1S72 3;  1CEW I;  1N9E A;  3K5T A;  1K41 A;  5KP1 A;  4MMZ B;  2OQE C;  4EXR A;  3V92 A;  1QJG A;  4WWU C;  1RRH A;  5AIG A;  3DM8 A;  4ORL A;  5BVB A;  1M1K 4;  1YGW A;  1EEJ A;  4WFO A;  5DRE A;  1GY6 A;  2F56 A;  3EN8 A;  1Q7H A;  1CYU A;  9RNT A;  5ELJ A;  3KCH A;  2BNG A;  4GB5 A;  1FW7 A;  1KD1 4;  1Q82 4;  3PGB A;  1RGH A;  4K61 A;  5JPU A;  1JN5 A;  1BGS A;  3LH4 A;  3JUO A;  1TTO A;  1SJW A;  4HM7 B;  4AKY A;  2CFW A;  5KP3 A;  1GY5 A;  2XF3 A;  3ER7 A;  1B21 A;  1A67 A;  5HGR A;  1HYF A;  4KT3 B;  3FKA A;  1PU4 A;  1UUW B;  3WOD G;  2V1L A;  2JDI H;  2HMJ B;  1Q81 4;  2KCD A;  4MJD A;  3WR2 A;  3UL5 A;  4FCZ A;  4I5Q A;  1LOX A;  3AGN A;  4HM8 B;  1U8C B;  3LTA A;  1TIJ A;  1MWS A;  3VF1 A;  3DH2 A;  3KII A;  3Q2P A;  2F99 A;  3G16 A;  1J2B A;  1M9G A;  8RNT A;  3AHS A;  1STF I;  3HI7 A;  2OQE A;  3EQQ B;  2W03 A;  4N6N B;  2WO0 A;  3D4A A;  3FF2 A;  2Q07 A;  3O8Y A;  1AVL A;  2XH9 A;  4WP5 A;  1EKM A;  2OTL 3;  3X3Z A;  1B3S A;  5G1L A;  1TJD A;  2WOH A;  3KSE D;  4LMI A;  1AVK A;  5FGO A;  1JKG A;  5IF6 A;  1EQK A;  3V99 A;  5D81 A;  4NRE A;  1YIT 3;  3URP A;  5A0O B;  2CFK A;  6STD A;  1IT8 A;  2LYX A;  3D3L A;  3CD6 3;  3QRD A;  1IV7 A;  2I9W A;  3GZB A;  3CCU 3;  4BU4 A;  1UCK A;  1IT7 A;  2KF5 A;  1TP6 A;  1W6G A;  1IQX A;  2B24 B;  3CNM A;  5FW5 A;  4PEJ A;  5BXQ A;  1OAC A;  1I2E A;  1GY7 A;  1GSP A;  3A76 A;  3EE1 A;  2KAA A;  3NQZ A;  1US1 A;  4KFE A;  4LZI A;  1YI2 3;  4QWT A;  2BIR A;  3JUP A;  2GU1 A;  1QAK A;  4ILF A;  3X41 A;  4WYK A;  3K9M C;  1UGI A;  4XDW A;  4I4K A;  1ULJ B;  1MGW A;  1BIR A;  1RDS A;  1RN1 A;  3B8L A;  1RTU A;  1RGL A;  3N8B A;  1KWI A;  4GL6 A;  4FMB A;  4OVM A;  2FXT A;  2CX1 A;  1MWR A;  1YNV X; 
#chains in the Genus database with same CATH homology
 2O9U X;  3B4O A;  4N6O B;  3D9R A;  1IVU A;  4U13 A;  2XFT A;  4LEH A;  1QAL A;  3KZT A;  3FSD A;  3DGO A;  3CCV 3;  4MEI A;  2CG1 A;  1VQ6 3;  5LC7 A;  1C7H A;  2C11 A;  1JN5 B;  3IMA B;  3PYJ A;  2WOF A;  2CIU A;  3J7Y d;  1HKX A;  2P0M A;  4N6T A;  1GS3 A;  5D83 A;  5IW9 A;  1NWW A;  1PFP A;  3X42 A;  2JQ5 A;  3RGR A;  3EC9 A;  1Q7Y 4;  3BNE A;  3UL6 A;  5ELU A;  1W5Z A;  3B4P A;  3HX8 A;  4O8S A;  2ZL8 A;  2CG0 A;  1FGQ A;  3UNL A;  3N9H A;  4IT7 A;  4HM1 B;  3CC2 3;  2XGN A;  2BMQ B;  1NJI 4;  3EBT A;  4EV5 A;  1DYU A;  3NX0 A;  3BNC A;  2F86 B;  1IVX A;  1Q40 A;  1FGM A;  3EN1 B;  3OWS A;  1A2K A;  3DGM A;  2ZDJ A;  3SOA A;  1VQ9 3;  3MG1 A;  5AYS C;  1IQ8 A;  1A90 A;  2E2T A;  3ALA A;  1SPU A;  1W4N A;  2CC3 A;  3H3H A;  2CK3 H;  3PCS A;  3WA2 X;  3WMD A;  1Z1S A;  1HU9 A;  3N54 B;  3U1W A;  1ASK A;  1JKG B;  1YJN 3;  3MG3 A;  1VQ5 3;  4FMD A;  4FMC A;  4HJL B;  3T8U A;  3NV0 A;  3OXA A;  4RZM A;  3X3X A;  3NM2 A;  1ZX2 A;  1Q42 A;  1W00 A;  3LOY A;  2BHM A;  1LNH A;  3NBR A;  2INX A;  1OF5 A;  3PZW A;  1D6Z A;  1K28 A;  2E2V A;  4BTW A;  1GYB A;  1DVD A;  3FCS B;  4AEQ A;  2XEP A;  1RJO A;  3FGY A;  3I56 3;  3WOF B;  2MC8 A;  1WMN A;  2P05 A;  5CF1 A;  1N8R 4;  4WYK B;  4LGQ A;  1RRL A;  5IER A;  2M7O A;  5TGN A;  1E3R A;  2K0M A;  3KE7 A;  1JRQ A;  2HML B;  3MHE A;  2PNC A;  1WTH A;  4EYC A;  2RGQ A;  5IG4 A;  3EF8 A;  3F7X A;  4FCJ A;  2HMM B;  3GWR A;  1VQK 3;  2W9P A;  2A15 A;  1WNH A;  3S29 A;  1TUH A;  2BMR B;  3STD A;  5AIF A;  1BUQ A;  2GBW B;  2P09 A;  3EHC A;  4HZB B;  1IVV A;  5EEO A;  1YVB I;  3CU3 A;  2GU3 A;  3HIG A;  5DRV A;  2YFJ B;  3BND A;  4N6M A;  2OCT A;  1DMN A;  4XBT A;  1SQW A;  1K8A 4;  3G71 3;  4XM4 A;  2CW9 A;  5D82 A;  3OV4 A;  2OWP A;  1OPY A;  3DMC A;  2CWV A;  3LTB A;  4HKV B;  4AKZ A;  2GEY A;  2L4V A;  2P0X A;  3L0R A;  2Y73 A;  2IMJ A;  4J9A A;  1OCV A;  4KFF A;  4CDL A;  1N5H A;  1Q40 B;  4N6L A;  1VQO 3;  1FGR A;  1QVF 2;  1FUW A;  3F7S A;  1FGO A;  4LSO A;  4CCV A;  4EV2 A;  3F8X A;  3U97 A;  1KQS 2;  3PCR A;  1IU7 A;  5JBS A;  4EBG A;  1W6Y A;  3I0Y A;  5EVH A;  1O7M B;  3DGN A;  4HM2 B;  3FG4 A;  5CXO A;  2XRX B;  1N9J A;  1O7N B;  4XB5 A;  3CXC 2;  1OUN A;  2GXF A;  2Y74 A;  3X3Y A;  3OWU A;  1LVN A;  1U5O A;  3X40 A;  2KRT A;  7STD A;  2W9Q A;  2HMO B;  3NV0 B;  1AV4 A;  1GD3 A;  3FF0 A;  2Z76 A;  4G1M B;  3I55 3;  3HII A;  1D6U A;  3WDG B;  4KVH A;  1JJ2 2;  3PS8 A;  2ML5 A;  5AIH A;  1OF5 B;  3LML A;  3LTC A;  2CWU A;  4IIA A;  3RGA A;  3G6E 3;  5CK6 A;  3F9S A;  3CME 3;  4XBY A;  4XBX A;  3TDG A;  2D42 A;  3HK4 A;  3ROB A;  2XFS A;  3SOY A;  3Q90 A;  2UX0 A;  2HMK B;  1M1X B;  3CCJ 3;  2BT3 A;  3LTD A;  4OUQ A;  2FGT A;  3T0U A;  1IK3 A;  2O3O A;  1IDP A;  2Z7A A;  5IG3 A;  4IPB A;  1VQL 3;  1W7C A;  3E99 A;  2QEX 3;  3K63 A;  5EQL A;  5STD A;  1RN7 A;  1IVW A;  4HM0 B;  1A2V A;  2RCD A;  4ZM8 A;  3MYT A;  3CC7 3;  3MKI A;  1D6Y A;  3GZX B;  3K0Z A;  4HYZ A;  1WMO A;  3VSY A;  4Q53 A;  1TFK A;  2P38 A;  4BTY A;  8CHO A;  3NBB A;  3QK9 A;  5IG5 A;  2XGL A;  3JUQ A;  1KSI A;  3KFQ C;  3IJE B;  1T5Y A;  3CC4 3;  1MNL A;  3MSO A;  3NQY A;  2WGQ A;  2Z77 A;  3K7C A;  1NB3 I;  4N6V 0;  2OTJ 3;  2W56 A;  3F40 A;  1G96 A;  1W02 A;  4O3V A;  3EB8 A;  1FGT A;  3CCQ 3;  1UI7 A;  3LXU X;  4R9L A;  2CWT A;  4STD A;  5IEN A;  3SED A;  1VZZ A;  3UB1 A;  3G4S 3;  4O2H A;  3OX9 A;  1VQ7 3;  3LT9 A;  4NHF A;  4L8O A;  3GAX A;  2E2U A;  4HBR A;  1O7W B;  1K9M 4;  1WQL B;  1ROV A;  5KP4 A;  4KFD A;  4K1U A;  4N6U A;  1TFO A;  5AII A;  2IUK A;  3JVC A;  5AI1 A;  3OW2 2;  1JB2 A;  4HM4 B;  3SX1 A;  4L7K A;  3GZY B;  3KN4 A;  2RSX A;  3S27 A;  1JNQ A;  3VGN A;  1Q86 4;  2RFR A;  3DXO A;  2MF7 A;  4HM6 B;  3SXX A;  3MWZ A;  5IEO A;  3SLU A;  1VQ4 3;  5IEP A;  1VQM 3;  1K73 4;  1JB4 A;  1KC8 4;  1JV2 B;  3H51 A;  1YJW 3;  3BB9 A;  3BNB A;  3LT8 A;  4MMX B;  2W04 A;  2IUJ A;  3CPW 2;  1EA2 A;  1O7H B;  3LYG A;  5JPP A;  4HVN A;  3G8Z A;  4RBN A;  5CLK A;  1VQP 3;  1OHP A;  2F98 A;  2CFG A;  3NXJ A;  3PXM A;  1NO3 A;  4R9K A;  3AMO A;  2XSO B;  4HM3 B;  1CYV A;  2CKF B;  3EBY A;  4MMY B;  4EC6 A;  1S5A A;  4FCM A;  2K54 A;  5AEU B;  1L5G B;  1MOL A;  2OOV A;  3S5C A;  1NB5 I;  3NHX A;  4OK0 A;  3EJV A;  3IPT A;  4HM5 B;  4N3V A;  5AEW B;  1OGX A;  3FH1 A;  4L8P A;  1EG9 B;  1DMQ A;  3HZP A;  3JUN A;  1NU3 A;  1CQS A;  4R4K A;  1JB5 A;  1W01 A;  1N8Q A;  3GZR A;  4RNZ A;  1UUV B;  2Z6B A;  5AYR B;  1O7P B;  3MPH A;  3S67 A;  1YIJ 3;  2SBL A;  2STD A;  1QMA A;  2C10 A;  2CH9 A;  5I97 A;  4FMA A;  5LC6 A;  2W56 B;  4WHA A;  3DUK A;  1M90 4;  4K90 B;  1DVC A;  3CCM 3;  2FNQ A;  3S28 A;  1V74 A;  2R4I A;  3Q1C A;  2YX9 A;  2LQV A;  3G0K A;  3NBJ A;  2D1W A;  4RNY A;  2B1X B;  2QGU A;  3JUM A;  2QA4 3;  4H3U A;  1ROA A;  1DMM A;  1ULI B;  2BO9 B;  1GD4 A;  3RDE A;  3SVA A;  4JF8 A;  2WGO A;  1WMP A;  1UI8 A;  4BTX A;  2PZV A;  3DY5 A;  1QVG 2;  5CF2 A;  3GRD A;  1VQ8 3;  1FA3 A;  2XR8 B;  3FG1 A;  4R1K A;  4KZ1 A;  2W6J H;  3MG2 A;  1W2B 2;  2ML6 A;  4J8T A;  2KXG A;  2CFL A;  4O02 B;  3DGL A;  1W6C A;  1IQY A;  2YFL B;  4K1V A;  3FLJ A;  2GBX B;  2CFD A;  3CMA 3;  4H61 A;  1E3V A;  1OHS A;  1OGZ A;  1YJ9 3;  1RKY A;  1Y4K A;  1ISK A;  4FR9 A;  3M8C A;  2FXT A;  2W0Q A;  3DZL A;  3KSP A;  1STD A;  2YFI B;  3CCS 3;  3FZW A;  3AMO B;  2BMO B;  3CPO A;  3UJM A;  4XDV A;  1YHQ 3;  2W2C A;  3V98 A;  1O7G B;  3NUV A;  3CCL 3;  3CCR 3;  3B7C A;  1R4C A;  3F8H A;  2CHC A;  4X2O A;  1W2Z A;  4JRF A;  1UW1 A;  1ZO2 A;  3CCE 3;  1VQN 3;  3KKG A;  4X2H A;  3LZA A;  1NDO B;  4HZ9 B;  1YGE A;  3ECF A;  3NM7 A;  3WOE B;  2XSH B;  1N5P A;  3WA3 A;  3BLZ A;  1IV9 A;  1E97 A;  3OWY A;  1LXE A;  2GEX A;  3CNX A;  5G2G A;  1F8N A;  1OHO A;  1SIH A;  1TU5 A;  3T8N A;  4R80 A;  1AR0 A;  3F14 A;  1SII A;  2OOV C;  5IG0 A;  3EX9 A;  4TX4 A;  3FG3 A;  1OH0 A;  1S72 3;  1CEW I;  1N9E A;  3K5T A;  1K41 A;  5KP1 A;  4MMZ B;  2OQE C;  4EXR A;  3V92 A;  1QJG A;  4WWU C;  1RRH A;  5AIG A;  3DM8 A;  4ORL A;  5BVB A;  1M1K 4;  4WFO A;  5DRE A;  1GY6 A;  3EN8 A;  1CYU A;  5ELJ A;  2BNG A;  4GB5 A;  1KD1 4;  1Q82 4;  3PGB A;  4K61 A;  5JPU A;  1JN5 A;  3LH4 A;  3JUO A;  1SJW A;  4HM7 B;  4AKY A;  2CFW A;  5KP3 A;  2XF3 A;  1GY5 A;  3ER7 A;  1A67 A;  5HGR A;  3FKA A;  1PU4 A;  1UUW B;  3WOD G;  2V1L A;  2JDI H;  2HMJ B;  1Q81 4;  2KCD A;  3UL5 A;  4FCZ A;  1LOX A;  4HM8 B;  1U8C B;  3LTA A;  1TIJ A;  3VF1 A;  3KII A;  3Q2P A;  2F99 A;  3G16 A;  1J2B A;  1M9G A;  1STF I;  3HI7 A;  2OQE A;  3EQQ B;  2W03 A;  4N6N B;  2WO0 A;  3FF2 A;  2Q07 A;  3O8Y A;  1AVL A;  2XH9 A;  4WP5 A;  1EKM A;  2OTL 3;  3X3Z A;  2WOH A;  3KSE D;  4LMI A;  1EQK A;  1AVK A;  5FGO A;  1JKG A;  5IF6 A;  3V99 A;  5D81 A;  4NRE A;  1YIT 3;  5A0O B;  2CFK A;  6STD A;  1IT8 A;  2LYX A;  3D3L A;  3CD6 3;  3QRD A;  1IV7 A;  2I9W A;  3GZB A;  3CCU 3;  1IT7 A;  1TP6 A;  1W6G A;  1IQX A;  2B24 B;  3CNM A;  5FW5 A;  4PEJ A;  5BXQ A;  1OAC A;  3A76 A;  1GY7 A;  3EE1 A;  3NQZ A;  1US1 A;  4KFE A;  4LZI A;  1YI2 3;  4QWT A;  3JUP A;  2GU1 A;  1QAK A;  3X41 A;  4WYK A;  3K9M C;  4XDW A;  4I4K A;  1ULJ B;  4MJD A;  3B8L A;  4OVM A;  3N8B A;  4GL6 A;  1KWI A;  4FMB A;  2IA7 A;  2QIY A;  2HMN B;  1QAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...