2W9PA

Crystal structure of potato multicystatin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTICYSTATIN
publication title Characterization of Solanum Tuberosum Multicystatin and its Structural Comparison with Other Cystatins.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
total genus 19
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w9pA00
3SVAA 1RN7A 3KSED 2O9UX 5ELJA 1N9JA 1NB3I 1KWIA 2KXGA 1N5HA 1GD4A 1A90A 5LC7A 4LZIA 1CYUA 1YVBI 1PFPA 4N6NB 3KFQC 4TX4A 3UL6A 2OCTA 1WNHA 3L0RA 1IV7A 1NB5I 3Q2PA 4N6UA 3PYJA 1FA3A 2W9PA 1MOLA 2CH9A 5EQLA 1GD3A 1A67A 4IT7A 1IV9A 4N6TA 3IMAB 5LC6A 3LH4A 1CEWI 1G96A 4CCVA 1CYVA 3K9MC 1LXEA 3MWZA 5A0OB 1ROAA 4N6LA 3UL5A 1TIJA 1FUWA 3S67A 1M9GA 1STFI 3PXMA 2BO9B 1DVCA 3GAXA 3QRDA 1R4CA 3NX0A 4ZM8A 1N5PA 4EYCA 3PS8A 1EQKA 1MNLA 4N6MA 2W9QA 4N6OB 1DVDA 4N6V0 5ELUA
chains in the Genus database with same CATH superfamily
3SVAA 1Q7Y4 4FR9A 3K63A 1ULIB 2XRXB 1BRJA 2HMOB 3D5IA 1BRHA 1US1A 5KP4A 4XDVA 1RJOA 3FF2A 1PYLA 4J8TA 1SPUA 3KCHA 5D81A 1JKGA 1MGRA 1IQ8A 4AEQA 2B24B 1EUIC 1R4YA 4K61A 3LT9A 3O8YA 4L8OA 1I70A 1RGAA 3DGNA 1UGIA 4HM5B 5IG3A 1I8VA 3H51A 2Y73A 1GD4A 4HYZA 1NNVA 3BNDA 3CMA3 1PY3A 3DGYA 1BUQA 1WTHA 3IPTA 3HX8A 2LQVA 1NU3A 4NHFA 3STDA 4LZIA 1K734 3NUVA 1CYUA 4EV5A 1N8R4 1RGEA 3X3YA 1BRNL 1B2ZA 2RNTA 1TRPA 3CCS3 1TFOA 3WA2X 5IENA 1JB5A 4MJDA 1RGFA 3G713 2BU4A 3UL6A 4GSPA 7RNTA 4KFDA 3BU4A 3FSDA 2ML6A 3FZWA 1LOYA 1RN1A 1NB5I 3Q2PA 2KRTA 1M904 4N6UA 1Q7HA 3BLZA 1W2B2 3J7Yd 1OGZA 2D42A 1HYFA 3CME3 2IY2A 1IDPA 2OOVC 3PYJA 4EBGA 3CCM3 1JRQA 1Q40B 1IVXA 4HM7B 4WHAA 1W5ZA 2OQEC 1MOLA 1ASKA 4EXRA 3NBRA 4XM4A 4NPBA 1Q814 2PNCA 3SLUA 2IYJA 2IUKA 4O2HA 1MGWA 8CHOA 2O3OA 1JBTA 4Q53A 2STDA 3MHEA 2XH9A 1IQYA 2SARA 2W04A 3NQZA 2PZVA 4N6TA 3G4S3 3B4OA 2P0MA 3EBYA 3OWSA 3S27A 1OPYA 3IMAB 5LC6A 1QVF2 1B2XA 1WMNA 2RSXA 3CC73 3HIIA 3SYUA 1RHLA 1BIRA 1OUNA 2CWUA 1LXEA 2Z76A 3FG4A 3MWZA 2LYXA 1FGRA 4PEJA 1LQMB 3DGLA 3VGNA 3EN8A 1B20A 1VQQA 3EHCA 3X41A 1ISKA 3MG1A 3WOEB 5AI1A 1RN4A 2BHMA 3SOAA 3GZBA 2H0IA 1JNQA 5FW5A 1D6ZA 1OCVA 1O7GB 2GEXA 2YFIB 1W7CA 1DE3A 1BNEA 2W6JH 2D1WA 1EEJA 2W2CA 4MEIA 1M1K4 2ZL8A 3OX9A 3RNTA 1W6CA 1R4CA 1RCLA 5M19A 1K9M4 2CKFB 2CK3H 1E3VA 1JN5A 3F8HA 1GSPA 4XBYA 4J5KA 2FGTA 4EYCA 1T3BA 3IJEB 1YJW3 1NO3A 5GSPA 1BSBA 2GXFA 2INXA 4J9AA 3WR2A 7STDA 1YJ93 3BB9A 2XFSA 1SARA 3PCRA 3N8BA 2Q07A 2W03A 3DXOA 3NQYA 4KVHA 2CC3A 3AMOA 2GBXB 1I2FA 1G0TA 1BNRA 2P0XA 3KIIA 3S28A 6RNTA 4LGQA 2CFDA 3RGAA 2GBWB 2C4BA 1ROVA 3WMDA 1JKGB 4GL6A 4R9KA 1EA2A 4N6V0 1TFKA 2OOVA 5AYRB 1BNSA 3F14A 3PGBA 3MKIA 3WA3A 1FW7A 3HOHA 1BUJA 2R41A 4X2HA 1RRHA 1BNJA 2UGIA 3DUKA 5ELJA 4EC6A 3FGYA 3NXJA 4FMAA 2BIRA 2OWPA 1A2PA 2CIUA 1HU9A 3G0KA 3FCSB 1BGSA 5HGRA 4HM4B 3LTAA 1MWSA 3HIGA 4FMBA 1GMQA 3N9HA 1MWRA 1QJGA 4IIAA 2KF6A 4HOHA 2FXTA 1X1XA 1TTOA 4HM1B 1T5YA 3LTBA 3CNMA 3H3HA 3ZFZA 1U5OA 4JRFA 9RNTA 2GU3A 3LMLA 1A90A 2GSPA 3UB1A 1RGGA 4OUQA 2KF5A 1N9EA 4MMYB 1YIT3 3V92A 1FYSA 2CG0A 1DMNA 3JVCA 3QK9A 1AR0A 2KF3A 2L1SA 2ZDJA 2QA43 4WYKB 3G6E3 3FH1A 4K1UA 3OW22 1JBRA 1QMAA 2W0QA 3JUPA 2W56B 4TX4A 2WOFA 1FUSA 1OGXA 4WWUC 5RNTA 1WNHA 3D5GA 1VQO3 4BTWA 1K8A4 3L0RA 1GS3A 1QAKA 3JUMA 1AV4A 3K5TA 4K90B 2CX0A 1RSNA 1GY7A 1D6YA 5EEOA 2CFGA 2YFJB 4RNTA 1YHQ3 1VQ63 5AYSC 1BRGA 3LXUX 2R4IA 1V74A 2C11A 4O8SA 1Z1SA 3G16A 4I4KA 1YJN3 2MF7A 1JJ22 1FA3A 1ZO2A 5FGOA 2W9PA 1GOVA 5BXQA 3ZG0A 1RNTA 2WOHA 4FCJA 1RGHA 2CH9A 3RGRA 2RGQA 2CWVA 1AVKA 4LSOA 5EQLA 1GD3A 2QIYA 1LVNA 1I0VA 4IT7A 1IV9A 4HAAA 5M1AA 5TGNA 1O7PB 1I2EA 1QALA 4BL2A 1X1UA 3HK4A 3GZRA 4I5QA 3WDGB 1W01A 5HOHA 4EV2A 1G96A 1T2IA 3LOYA 1YGWA 3VF1A 2CFKA 2K54A 2SBLA 3PZWA 1YI23 1JZOA 1OHOA 4RZMA 5AIFA 3SOYA 1A2KA 2XR8B 4EW5A 1UI7A 2UX0A 1VQP3 1DMMA 1S723 2BNGA 1OF5B 2H0GA 2OTL3 1YVSA 1JN5B 3BIRA 1UUGB 1UUVB 3S67A 3NHXA 3CCL3 1EKMA 1I0XA 2F98A 4R1KA 2AAEA 2CG1A 3CC43 1C7HA 3EB8A 2CFLA 3KKGA 1GOUA 3AMOB 4XB5A 2QGUA 3BNEA 3WHOA 5EVHA 5JPPA 1VQL3 1RTUA 1Q42A 3OWUA 4O02B 3SX1A 3B7CA 4LEHA 4O3VA 5BIRA 2P38A 4IPBA 3CPW2 1OHSA 5D82A 3FG1A 3PS8A 2BMQB 2F4YA 1KSIA 2CX1A 3X3ZA 8RNTA 1MWTA 1N8QA 4XDWA 1IVUA 1O7NB 2CWTA 1RMSA 3UNLA 1W02A 3D3LA 2CFWA 3KSPA 4OVMA 5AIIA 5CF2A 1NWWA 5BU4A 2BMOB 1RN7A 3KSED 2YX9A 1MWUA 5KP1A 2F56A 5I97A 1E3RA 2HMNB 2O9UX 3DZLA 2ZA4A 1N9JA 3GZYB 3FF0A 3UJMA 3I563 1Q864 4HJLB 1DYUA 3X3XA 1TRQA 4LMIA 1UCLA 1OH0A 2QEX3 5G1KA 1B2SA 1CQSA 2E2TA 1W2ZA 3V98A 1WQLB 3CCJ3 3NM2A 2F86B 2JQ5A 3EF8A 1M1XB 1FZUA 2IA7A 5M18A 1W6YA 4AKZA 1S5AA 1Y4KA 1FGOA 3DH2A 4FCMA 1TJDA 3S29A 3S5CA 2L4VA 1YVBI 2ZHXB 1ZX2A 1PFPA 3U97A 3BNCA 3KFQC 4K1VA 1Q40A 3JUOA 4FMCA 4BTYA 3OWYA 1BNFA 5IF6A 5DREA 1V57A 3X42A 4BL3A 3CNXA 5ELUA 3ROBA 1BANA 2JDIH 1IV7A 3K7CA 1ULJB 5CLKA 3CCQ3 2XSOB 1B2MA 1WMPA 2XGNA 1RCKA 1OHPA 3KN4A 4LYLB 1W4NA 5DRVA 1VQ93 1B27A 3K0ZA 4FCZA 3NBJA 1RGKA 1E97A 1SQWA 2WO0A 2F99A 2GEYA 4L7KA 1PU4A 3SXXA 1FGTA 3MSOA 2E2UA 3EBTA 3X40A 1DMQA 1GOYA 5AIHA 4HBRA 3URPA 2FNQA 1O7HB 3F40A 1GYBA 1IT7A 3NBBA 2BMRB 1I3FA 1AY7A 2C10A 2CHCA 3RDEA 3F7SA 1I3IA 1F8NA 1JB4A 4BU4A 2KCDA 4HKVB 1FGMA 3CCV3 4CDLA 1EQKA 2Z7AA 1X1YA 1T2HA 1BSEA 1NDOB 3D79A 5G1LA 5A0OB 1GMPA 1DETA 4CJNA 2XGLA 2XF3A 3F7XA 4XBTA 1AQZA 1ROAA 4N6LA 1IU7A 1QAFA 3V99A 4CPKA 1JB2A 1TIJA 3GRDA 6GSPA 3NM7A 1O7MB 5CXOA 1KQS2 1IQXA 2I9WA 1RGLA 1YGEA 1RNBA 1IT8A 3PXMA 1FUTA 3AGNA 4J5GA 3FG3A 4KFFA 1DVCA 3T8NA 3GAXA 3MG2A 5D83A 2ML5A 1VQ43 1J2BA 3EE1A 2XFTA 3A5EA 1SJWA 1TP6A 3A76A 3I0YA 4RNYA 5JBSA 3F9SA 4HZBB 3OXAA 4ILFA 1UI8A 4N6MA 4KFEA 4RNZA 3DMCA 1JBSA 1BVIA 4N6OB 1NJI4 1DVDA 1WMOA 4NREA 3FLJA 1BNGA 4QWTA 1RRLA 3HZPA 3Q1CA 4L8PA 4H3UA 1RGCA 3F8XA 2F5WA 3NV0A 5CF1A 2F5MA 4HM6B 1UCJA 2WGOA 3ECFA 1UUWB 3GWRA 2KF4A 1BNIA 1L5GB 1X1WA 3DGMA 3E99A 1TUHA 3OV4A 2HMJB 2WGQA 3LTDA 2HMLB 5AEUB 3CCE3 1UGHI 3MYTA 1AVLA 5CK6A 3LZAA 1NB3I 2E2VA 4HZ9B 3CD63 1KWIA 2KXGA 2P09A 5G2GA 1LRAA 1B3SA 3EJVA 1N5HA 4WYKA 5AEWB 5JPUA 3WOFB 1HKXA 2W56A 1Q824 1Q9EA 2BT3A 3CXC2 1UW1A 3LYGA 1YNVX 1BOXA 2XSHB 2OTJ3 3Q90A 1STDA 1O7WB 5AIGA 5LC7A 3MG3A 4X2OA 3I553 4WP5A 1B2UA 4AKYA 1GY5A 1LOXA 1OACA 4HM0B 4N6NB 4FMDA 1RLSA 2RCDA 2AADA 3EQQB 2IUJA 2CW9A 2K0MA 3T0UA 1UCIA 2OCTA 4HM3B 3U1WA 3CC23 1ZGXA 3CU3A 2HMMB 3B8LA 1IVWA 3VSYA 4R80A 3EX9A 5IW9A 5IEOA 2HOHA 3DY5A 2P05A 2M7OA 4R9LA 7GSPA 5IG5A 3HI7A 1VQ73 5IG4A 1G02A 1JV2B 4HVNA 5KP3A 2RBIA 2B1XB 1I2GA 1W6GA 1V58A 4GB5A 1BSAA 1VZZA 1UCKA 1UDII 4KZ1A 1LNIA 4JF8A 1KC84 1VQ53 6STDA 3CCR3 1A67A 4HM2B 3PCSA 4N3VA 4DKIA 2J8XB 1BSDA 1K28A 1IYYA 1LOWA 3AGOA 4GHOA 5IERA 3GSPA 1OF5A 2MC8A 5BVBA 5IEPA 3LH4A 1VQN3 1CEWI 4STDA 3KE7A 1U8CB 3JUQA 3SEDA 3ZG5A 3AHWA 1BRIA 1IVVA 1YIJ3 3JUNA 3CCU3 4ORLA 4CCVA 4MMXB 1CYVA 3K9MC 3N54B 5STDA 3T8UA 1JZDA 1C54A 1LQGC 1LOVA 1GMRA 2RFRA 3BNBA 4BTXA 1VQM3 1IK3A 1W00A 1VQ83 2A15A 1SIIA 2HMKB 3DM8A 3KZTA 3UL5A 3LT8A 1BRSA 1TU5A 1FUWA 1EG9B 3LTCA 1M9GA 4HM8B 2YFLB 4G1MB 4MMZB 3TDGA 1ZS7A 2OQEA 1STFI 4H61A 2BO9B 2Y74A 3ER7A 1VQK3 1FGQA 3D9RA 1BAOA 3QRDA 4KT3B 1BRKA 1GY6A 3NX0A 1LNHA 4ZM8A 3ALAA 1N5PA 3D4AA 3EN1B 3Q3FA 1RKYA 3NV0B 3WODG 5IG0A 1K41A 2V1LA 4R4KA 1MNLA 2K3DA 1SIHA 1B21A 4U13A 4XBXA 1KD14 1HZ1A 3G8ZA 1CH0A 3M8CA 1BU4A 4OK0A 4BIRA 4RBNA 2UUGC 2IMJA 2W9QA 3CPOA 1QVG2 2H0HA 1A2VA 1D6UA 3AHSA 3EC9A 2GU1A 2KAAA 2Z77A 3GZXB 1RDSA 2Z6BA 4WFOA 3DGOA 3MPHA 3B4PA 3FKAA 2XEPA 1BSCA
chains in the Genus database with same CATH topology
3SVAA 1Q7Y4 4FR9A 3K63A 1ULIB 2XRXB 2HMOB 1US1A 5KP4A 1RJOA 3FF2A 4J8TA 1SPUA 5D81A 1JKGA 1IQ8A 4AEQA 2B24B 4K61A 4L8OA 4XDVA 3LT9A 3O8YA 4BTYA 3DGNA 4HM5B 5IG3A 3H51A 2Y73A 1GD4A 4HYZA 3BNDA 3CMA3 1BUQA 1WTHA 3IPTA 3HX8A 2LQVA 1NU3A 4NHFA 3STDA 4LZIA 1K734 3NUVA 1CYUA 4EV5A 1N8R4 3X3YA 3CCS3 1TFOA 3WA2X 5IENA 1JB5A 4MJDA 3G713 3UL6A 4KFDA 3FSDA 2ML6A 3FZWA 1NB5I 3Q2PA 2KRTA 1M904 4N6UA 1W2B2 3BLZA 3J7Yd 1OGZA 2D42A 3CME3 3PYJA 1IDPA 2OOVC 4EBGA 3CCM3 1JRQA 1Q40B 1IVXA 4HM7B 4WHAA 1W5ZA 2OQEC 1MOLA 1ASKA 4EXRA 3NBRA 4XM4A 1Q814 2PNCA 3SLUA 2IUKA 4O2HA 8CHOA 2O3OA 4Q53A 2STDA 3MHEA 2XH9A 1IQYA 2W04A 3NQZA 2PZVA 4N6TA 3G4S3 3B4OA 2P0MA 3EBYA 3OWSA 3S27A 1OPYA 3IMAB 5LC6A 1QVF2 1WMNA 2RSXA 3CC73 3HIIA 1OUNA 2CWUA 1LXEA 2Z76A 3FG4A 3MWZA 2LYXA 1FGRA 4PEJA 3DGLA 3VGNA 3EN8A 3EHCA 3X41A 1ISKA 3MG1A 3WOEB 5AI1A 2BHMA 3SOAA 3GZBA 1JNQA 5FW5A 1D6ZA 1OCVA 1O7GB 2GEXA 2YFIB 1W7CA 2W6JH 2D1WA 2W2CA 1M1K4 4MEIA 2ZL8A 3OX9A 1W6CA 1R4CA 1K9M4 2CKFB 2CK3H 1E3VA 1JN5A 3F8HA 4XBYA 2FGTA 4EYCA 1EQKA 3IJEB 1YJW3 1NO3A 2INXA 2GXFA 7STDA 4J9AA 1YJ93 3BB9A 2XFSA 3PCRA 3N8BA 2Q07A 2W03A 3DXOA 3NQYA 4KVHA 2CC3A 3AMOA 2GBXB 2P0XA 3KIIA 3S28A 4LGQA 2CFDA 3RGAA 2GBWB 1ROVA 3WMDA 1JKGB 4GL6A 4R9KA 1EA2A 4N6V0 1TFKA 2OOVA 5AYRB 3F14A 3PGBA 3MKIA 3WA3A 4X2HA 1RRHA 3DUKA 5ELJA 4EC6A 3FGYA 3NXJA 4FMAA 2OWPA 2CIUA 1HU9A 3G0KA 3FCSB 5HGRA 4HM4B 3LTAA 3HIGA 4FMBA 3N9HA 1QJGA 4IIAA 2FXTA 4HM1B 1T5YA 3LTBA 3CNMA 3H3HA 1U5OA 4JRFA 2GU3A 3LMLA 1A90A 3UB1A 4OUQA 1N9EA 4MMYB 1YIT3 3V92A 2CG0A 1DMNA 3JVCA 3QK9A 1AR0A 2ZDJA 2QA43 4WYKB 3G6E3 3FH1A 4K1UA 3OW22 1QMAA 2W0QA 3JUPA 2W56B 4TX4A 2WOFA 1OGXA 4WWUC 1VQO3 1WNHA 1K8A4 4BTWA 3L0RA 1GS3A 1QAKA 3JUMA 1AV4A 3K5TA 4K90B 1GY7A 1D6YA 5EEOA 2CFGA 2YFJB 1YHQ3 1VQ63 5AYSC 3LXUX 2R4IA 1V74A 2C11A 4O8SA 1Z1SA 3G16A 4I4KA 1YJN3 2MF7A 1JJ22 1FA3A 1ZO2A 5FGOA 2W9PA 5BXQA 2WOHA 4FCJA 2CH9A 3RGRA 2RGQA 2CWVA 1AVKA 4LSOA 5EQLA 1GD3A 2QIYA 1LVNA 4IT7A 1IV9A 5TGNA 1O7PB 1QALA 3HK4A 3WDGB 3GZRA 1W01A 4EV2A 1G96A 3LOYA 3VF1A 2CFKA 2K54A 2SBLA 3PZWA 1YI23 1OHOA 4RZMA 5AIFA 3SOYA 1A2KA 2XR8B 1UI7A 2UX0A 1VQP3 1DMMA 1S723 2BNGA 1OF5B 2OTL3 1JN5B 1UUVB 3S67A 3NHXA 3CCL3 1EKMA 2F98A 4R1KA 2CG1A 3CC43 1C7HA 3EB8A 2CFLA 3KKGA 3AMOB 4XB5A 2QGUA 3BNEA 5JPPA 5EVHA 1VQL3 1Q42A 3OWUA 4O02B 3SX1A 3B7CA 4LEHA 4O3VA 3CPW2 2P38A 4IPBA 1OHSA 5D82A 3FG1A 3PS8A 2BMQB 1KSIA 3X3ZA 1N8QA 4XDWA 1IVUA 1O7NB 2CWTA 3UNLA 1W02A 3D3LA 2CFWA 3KSPA 4OVMA 5AIIA 5CF2A 1NWWA 2BMOB 1RN7A 3KSED 2YX9A 5KP1A 5I97A 1E3RA 2HMNB 2O9UX 3DZLA 1N9JA 3GZYB 3FF0A 3UJMA 3I563 1Q864 4HJLB 1DYUA 3X3XA 4LMIA 2QEX3 1OH0A 2E2TA 1CQSA 3V98A 1W2ZA 1WQLB 3CCJ3 3NM2A 2F86B 2JQ5A 3EF8A 1M1XB 2IA7A 1W6YA 4AKZA 1S5AA 1Y4KA 1FGOA 4FCMA 3S29A 3S5CA 2L4VA 1YVBI 1ZX2A 1PFPA 3U97A 3BNCA 3KFQC 4K1VA 1Q40A 3JUOA 4FMCA 3OWYA 5IF6A 5DREA 3X42A 3CNXA 5ELUA 3ROBA 2JDIH 1IV7A 3K7CA 1ULJB 5CLKA 3CCQ3 2XSOB 1WMPA 2XGNA 3KN4A 1OHPA 1VQ93 1W4NA 5DRVA 3K0ZA 4FCZA 3NBJA 1E97A 1SQWA 2WO0A 2F99A 2GEYA 4L7KA 1PU4A 3SXXA 1FGTA 3MSOA 2E2UA 3EBTA 3X40A 1DMQA 5AIHA 4HBRA 2FNQA 1O7HB 3F40A 1GYBA 1IT7A 3NBBA 2BMRB 2C10A 2CHCA 3RDEA 3F7SA 1F8NA 1JB4A 2KCDA 4HKVB 1FGMA 3CCV3 4CDLA 2Z7AA 1NDOB 5A0OB 2XGLA 2XF3A 3F7XA 4XBTA 1ROAA 4N6LA 3V99A 1IU7A 1QAFA 1JB2A 1TIJA 3GRDA 3NM7A 1O7MB 5CXOA 1KQS2 1IQXA 2I9WA 1YGEA 1IT8A 3PXMA 3FG3A 4KFFA 1DVCA 3T8NA 3GAXA 3MG2A 5D83A 2ML5A 1VQ43 1J2BA 3EE1A 2XFTA 1SJWA 1TP6A 3A76A 3I0YA 4RNYA 5JBSA 3F9SA 4HZBB 3OXAA 1UI8A 4N6MA 4KFEA 4RNZA 3DMCA 4N6OB 1NJI4 1DVDA 1WMOA 4NREA 3FLJA 4QWTA 1RRLA 3HZPA 3Q1CA 4L8PA 4H3UA 3F8XA 3NV0A 5CF1A 4HM6B 2WGOA 3ECFA 1UUWB 3GWRA 1L5GB 3DGMA 3E99A 1TUHA 3OV4A 2HMJB 2WGQA 3LTDA 2HMLB 5AEUB 3CCE3 3MYTA 1AVLA 5CK6A 3LZAA 1NB3I 2E2VA 4HZ9B 3CD63 1KWIA 2KXGA 2P09A 5G2GA 3EJVA 1N5HA 4WYKA 5AEWB 5JPUA 3WOFB 1HKXA 2W56A 1Q824 2BT3A 3CXC2 1UW1A 3LYGA 2XSHB 2OTJ3 3Q90A 1STDA 1O7WB 5AIGA 5LC7A 3MG3A 4X2OA 3I553 4WP5A 4AKYA 1GY5A 1LOXA 1OACA 4HM0B 4N6NB 4FMDA 2RCDA 3EQQB 2IUJA 2CW9A 2K0MA 3T0UA 2OCTA 4HM3B 3U1WA 3CC23 3CU3A 2HMMB 3B8LA 1IVWA 3VSYA 4R80A 3EX9A 5IW9A 5IEOA 3DY5A 2P05A 2M7OA 4R9LA 5IG5A 3HI7A 1VQ73 5IG4A 1JV2B 4HVNA 5KP3A 2B1XB 1W6GA 4GB5A 1VZZA 1A67A 1VQ53 4KZ1A 4JF8A 1KC84 6STDA 3CCR3 4HM2B 3PCSA 4N3VA 1K28A 5IERA 2MC8A 1OF5A 5BVBA 5IEPA 3LH4A 1VQN3 1CEWI 4STDA 3KE7A 1U8CB 3JUQA 3SEDA 1YIJ3 1IVVA 3JUNA 3CCU3 4ORLA 4CCVA 4MMXB 1CYVA 3K9MC 3N54B 5STDA 3T8UA 2RFRA 3BNBA 1VQM3 4BTXA 1IK3A 1W00A 1VQ83 2A15A 1SIIA 2HMKB 3DM8A 3KZTA 3UL5A 3LT8A 1FUWA 1TU5A 1EG9B 3LTCA 1M9GA 4HM8B 2YFLB 4G1MB 4MMZB 3TDGA 2OQEA 1STFI 4H61A 2BO9B 2Y74A 3ER7A 1VQK3 1FGQA 3D9RA 3QRDA 1GY6A 3NX0A 1LNHA 4ZM8A 3ALAA 1N5PA 3EN1B 1RKYA 3NV0B 3WODG 5IG0A 1K41A 2V1LA 4R4KA 1MNLA 4U13A 1SIHA 4XBXA 1KD14 3G8ZA 3M8CA 4OK0A 4RBNA 2IMJA 2W9QA 3CPOA 1QVG2 1A2VA 1D6UA 3EC9A 2GU1A 2Z77A 3GZXB 2Z6BA 4WFOA 3DGOA 3MPHA 3B4PA 3FKAA 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVA A;  1RN7 A;  3KSE D;  2O9U X;  5ELJ A;  1N9J A;  1NB3 I;  1KWI A;  2KXG A;  1N5H A;  1GD4 A;  1A90 A;  5LC7 A;  4LZI A;  1CYU A;  1YVB I;  1PFP A;  4N6N B;  3KFQ C;  4TX4 A;  3UL6 A;  2OCT A;  1WNH A;  3L0R A;  1IV7 A;  1NB5 I;  3Q2P A;  4N6U A;  3PYJ A;  1FA3 A;  2W9P A;  1MOL A;  2CH9 A;  5EQL A;  1GD3 A;  1A67 A;  4IT7 A;  1IV9 A;  4N6T A;  3IMA B;  5LC6 A;  3LH4 A;  1CEW I;  1G96 A;  4CCV A;  1CYV A;  3K9M C;  1LXE A;  3MWZ A;  5A0O B;  1ROA A;  4N6L A;  3UL5 A;  1TIJ A;  1FUW A;  3S67 A;  1M9G A;  1STF I;  3PXM A;  2BO9 B;  1DVC A;  3GAX A;  3QRD A;  1R4C A;  3NX0 A;  4ZM8 A;  1N5P A;  4EYC A;  3PS8 A;  1EQK A;  1MNL A;  4N6M A;  2W9Q A;  4N6O B;  1DVD A;  4N6V 0;  5ELU A; 
#chains in the Genus database with same CATH topology
 3SVA A;  1Q7Y 4;  4FR9 A;  3K63 A;  1ULI B;  2XRX B;  1BRJ A;  2HMO B;  3D5I A;  1BRH A;  1US1 A;  5KP4 A;  4XDV A;  1RJO A;  3FF2 A;  1PYL A;  4J8T A;  1SPU A;  3KCH A;  5D81 A;  1JKG A;  1MGR A;  1IQ8 A;  4AEQ A;  2B24 B;  1EUI C;  1R4Y A;  4K61 A;  3LT9 A;  3O8Y A;  4L8O A;  1I70 A;  1RGA A;  3DGN A;  1UGI A;  4HM5 B;  5IG3 A;  1I8V A;  3H51 A;  2Y73 A;  1GD4 A;  4HYZ A;  1NNV A;  3BND A;  3CMA 3;  1PY3 A;  3DGY A;  1BUQ A;  1WTH A;  3IPT A;  3HX8 A;  2LQV A;  1NU3 A;  4NHF A;  3STD A;  4LZI A;  1K73 4;  3NUV A;  1CYU A;  4EV5 A;  1N8R 4;  1RGE A;  3X3Y A;  1BRN L;  1B2Z A;  2RNT A;  1TRP A;  3CCS 3;  1TFO A;  3WA2 X;  5IEN A;  1JB5 A;  4MJD A;  1RGF A;  3G71 3;  2BU4 A;  3UL6 A;  4GSP A;  7RNT A;  4KFD A;  3BU4 A;  3FSD A;  2ML6 A;  3FZW A;  1LOY A;  1RN1 A;  1NB5 I;  3Q2P A;  2KRT A;  1M90 4;  4N6U A;  1Q7H A;  3BLZ A;  1W2B 2;  3J7Y d;  1OGZ A;  2D42 A;  1HYF A;  3CME 3;  2IY2 A;  1IDP A;  2OOV C;  3PYJ A;  4EBG A;  3CCM 3;  1JRQ A;  1Q40 B;  1IVX A;  4HM7 B;  4WHA A;  1W5Z A;  2OQE C;  1MOL A;  1ASK A;  4EXR A;  3NBR A;  4XM4 A;  4NPB A;  1Q81 4;  2PNC A;  3SLU A;  2IYJ A;  2IUK A;  4O2H A;  1MGW A;  8CHO A;  2O3O A;  1JBT A;  4Q53 A;  2STD A;  3MHE A;  2XH9 A;  1IQY A;  2SAR A;  2W04 A;  3NQZ A;  2PZV A;  4N6T A;  3G4S 3;  3B4O A;  2P0M A;  3EBY A;  3OWS A;  3S27 A;  1OPY A;  3IMA B;  5LC6 A;  1QVF 2;  1B2X A;  1WMN A;  2RSX A;  3CC7 3;  3HII A;  3SYU A;  1RHL A;  1BIR A;  1OUN A;  2CWU A;  1LXE A;  2Z76 A;  3FG4 A;  3MWZ A;  2LYX A;  1FGR A;  4PEJ A;  1LQM B;  3DGL A;  3VGN A;  3EN8 A;  1B20 A;  1VQQ A;  3EHC A;  3X41 A;  1ISK A;  3MG1 A;  3WOE B;  5AI1 A;  1RN4 A;  2BHM A;  3SOA A;  3GZB A;  2H0I A;  1JNQ A;  5FW5 A;  1D6Z A;  1OCV A;  1O7G B;  2GEX A;  2YFI B;  1W7C A;  1DE3 A;  1BNE A;  2W6J H;  2D1W A;  1EEJ A;  2W2C A;  4MEI A;  1M1K 4;  2ZL8 A;  3OX9 A;  3RNT A;  1W6C A;  1R4C A;  1RCL A;  5M19 A;  1K9M 4;  2CKF B;  2CK3 H;  1E3V A;  1JN5 A;  3F8H A;  1GSP A;  4XBY A;  4J5K A;  2FGT A;  4EYC A;  1T3B A;  3IJE B;  1YJW 3;  1NO3 A;  5GSP A;  1BSB A;  2GXF A;  2INX A;  4J9A A;  3WR2 A;  7STD A;  1YJ9 3;  3BB9 A;  2XFS A;  1SAR A;  3PCR A;  3N8B A;  2Q07 A;  2W03 A;  3DXO A;  3NQY A;  4KVH A;  2CC3 A;  3AMO A;  2GBX B;  1I2F A;  1G0T A;  1BNR A;  2P0X A;  3KII A;  3S28 A;  6RNT A;  4LGQ A;  2CFD A;  3RGA A;  2GBW B;  2C4B A;  1ROV A;  3WMD A;  1JKG B;  4GL6 A;  4R9K A;  1EA2 A;  4N6V 0;  1TFK A;  2OOV A;  5AYR B;  1BNS A;  3F14 A;  3PGB A;  3MKI A;  3WA3 A;  1FW7 A;  3HOH A;  1BUJ A;  2R41 A;  4X2H A;  1RRH A;  1BNJ A;  2UGI A;  3DUK A;  5ELJ A;  4EC6 A;  3FGY A;  3NXJ A;  4FMA A;  2BIR A;  2OWP A;  1A2P A;  2CIU A;  1HU9 A;  3G0K A;  3FCS B;  1BGS A;  5HGR A;  4HM4 B;  3LTA A;  1MWS A;  3HIG A;  4FMB A;  1GMQ A;  3N9H A;  1MWR A;  1QJG A;  4IIA A;  2KF6 A;  4HOH A;  2FXT A;  1X1X A;  1TTO A;  4HM1 B;  1T5Y A;  3LTB A;  3CNM A;  3H3H A;  3ZFZ A;  1U5O A;  4JRF A;  9RNT A;  2GU3 A;  3LML A;  1A90 A;  2GSP A;  3UB1 A;  1RGG A;  4OUQ A;  2KF5 A;  1N9E A;  4MMY B;  1YIT 3;  3V92 A;  1FYS A;  2CG0 A;  1DMN A;  3JVC A;  3QK9 A;  1AR0 A;  2KF3 A;  2L1S A;  2ZDJ A;  2QA4 3;  4WYK B;  3G6E 3;  3FH1 A;  4K1U A;  3OW2 2;  1JBR A;  1QMA A;  2W0Q A;  3JUP A;  2W56 B;  4TX4 A;  2WOF A;  1FUS A;  1OGX A;  4WWU C;  5RNT A;  1WNH A;  3D5G A;  1VQO 3;  4BTW A;  1K8A 4;  3L0R A;  1GS3 A;  1QAK A;  3JUM A;  1AV4 A;  3K5T A;  4K90 B;  2CX0 A;  1RSN A;  1GY7 A;  1D6Y A;  5EEO A;  2CFG A;  2YFJ B;  4RNT A;  1YHQ 3;  1VQ6 3;  5AYS C;  1BRG A;  3LXU X;  2R4I A;  1V74 A;  2C11 A;  4O8S A;  1Z1S A;  3G16 A;  4I4K A;  1YJN 3;  2MF7 A;  1JJ2 2;  1FA3 A;  1ZO2 A;  5FGO A;  2W9P A;  1GOV A;  5BXQ A;  3ZG0 A;  1RNT A;  2WOH A;  4FCJ A;  1RGH A;  2CH9 A;  3RGR A;  2RGQ A;  2CWV A;  1AVK A;  4LSO A;  5EQL A;  1GD3 A;  2QIY A;  1LVN A;  1I0V A;  4IT7 A;  1IV9 A;  4HAA A;  5M1A A;  5TGN A;  1O7P B;  1I2E A;  1QAL A;  4BL2 A;  1X1U A;  3HK4 A;  3GZR A;  4I5Q A;  3WDG B;  1W01 A;  5HOH A;  4EV2 A;  1G96 A;  1T2I A;  3LOY A;  1YGW A;  3VF1 A;  2CFK A;  2K54 A;  2SBL A;  3PZW A;  1YI2 3;  1JZO A;  1OHO A;  4RZM A;  5AIF A;  3SOY A;  1A2K A;  2XR8 B;  4EW5 A;  1UI7 A;  2UX0 A;  1VQP 3;  1DMM A;  1S72 3;  2BNG A;  1OF5 B;  2H0G A;  2OTL 3;  1YVS A;  1JN5 B;  3BIR A;  1UUG B;  1UUV B;  3S67 A;  3NHX A;  3CCL 3;  1EKM A;  1I0X A;  2F98 A;  4R1K A;  2AAE A;  2CG1 A;  3CC4 3;  1C7H A;  3EB8 A;  2CFL A;  3KKG A;  1GOU A;  3AMO B;  4XB5 A;  2QGU A;  3BNE A;  3WHO A;  5EVH A;  5JPP A;  1VQL 3;  1RTU A;  1Q42 A;  3OWU A;  4O02 B;  3SX1 A;  3B7C A;  4LEH A;  4O3V A;  5BIR A;  2P38 A;  4IPB A;  3CPW 2;  1OHS A;  5D82 A;  3FG1 A;  3PS8 A;  2BMQ B;  2F4Y A;  1KSI A;  2CX1 A;  3X3Z A;  8RNT A;  1MWT A;  1N8Q A;  4XDW A;  1IVU A;  1O7N B;  2CWT A;  1RMS A;  3UNL A;  1W02 A;  3D3L A;  2CFW A;  3KSP A;  4OVM A;  5AII A;  5CF2 A;  1NWW A;  5BU4 A;  2BMO B;  1RN7 A;  3KSE D;  2YX9 A;  1MWU A;  5KP1 A;  2F56 A;  5I97 A;  1E3R A;  2HMN B;  2O9U X;  3DZL A;  2ZA4 A;  1N9J A;  3GZY B;  3FF0 A;  3UJM A;  3I56 3;  1Q86 4;  4HJL B;  1DYU A;  3X3X A;  1TRQ A;  4LMI A;  1UCL A;  1OH0 A;  2QEX 3;  5G1K A;  1B2S A;  1CQS A;  2E2T A;  1W2Z A;  3V98 A;  1WQL B;  3CCJ 3;  3NM2 A;  2F86 B;  2JQ5 A;  3EF8 A;  1M1X B;  1FZU A;  2IA7 A;  5M18 A;  1W6Y A;  4AKZ A;  1S5A A;  1Y4K A;  1FGO A;  3DH2 A;  4FCM A;  1TJD A;  3S29 A;  3S5C A;  2L4V A;  1YVB I;  2ZHX B;  1ZX2 A;  1PFP A;  3U97 A;  3BNC A;  3KFQ C;  4K1V A;  1Q40 A;  3JUO A;  4FMC A;  4BTY A;  3OWY A;  1BNF A;  5IF6 A;  5DRE A;  1V57 A;  3X42 A;  4BL3 A;  3CNX A;  5ELU A;  3ROB A;  1BAN A;  2JDI H;  1IV7 A;  3K7C A;  1ULJ B;  5CLK A;  3CCQ 3;  2XSO B;  1B2M A;  1WMP A;  2XGN A;  1RCK A;  1OHP A;  3KN4 A;  4LYL B;  1W4N A;  5DRV A;  1VQ9 3;  1B27 A;  3K0Z A;  4FCZ A;  3NBJ A;  1RGK A;  1E97 A;  1SQW A;  2WO0 A;  2F99 A;  2GEY A;  4L7K A;  1PU4 A;  3SXX A;  1FGT A;  3MSO A;  2E2U A;  3EBT A;  3X40 A;  1DMQ A;  1GOY A;  5AIH A;  4HBR A;  3URP A;  2FNQ A;  1O7H B;  3F40 A;  1GYB A;  1IT7 A;  3NBB A;  2BMR B;  1I3F A;  1AY7 A;  2C10 A;  2CHC A;  3RDE A;  3F7S A;  1I3I A;  1F8N A;  1JB4 A;  4BU4 A;  2KCD A;  4HKV B;  1FGM A;  3CCV 3;  4CDL A;  1EQK A;  2Z7A A;  1X1Y A;  1T2H A;  1BSE A;  1NDO B;  3D79 A;  5G1L A;  5A0O B;  1GMP A;  1DET A;  4CJN A;  2XGL A;  2XF3 A;  3F7X A;  4XBT A;  1AQZ A;  1ROA A;  4N6L A;  1IU7 A;  1QAF A;  3V99 A;  4CPK A;  1JB2 A;  1TIJ A;  3GRD A;  6GSP A;  3NM7 A;  1O7M B;  5CXO A;  1KQS 2;  1IQX A;  2I9W A;  1RGL A;  1YGE A;  1RNB A;  1IT8 A;  3PXM A;  1FUT A;  3AGN A;  4J5G A;  3FG3 A;  4KFF A;  1DVC A;  3T8N A;  3GAX A;  3MG2 A;  5D83 A;  2ML5 A;  1VQ4 3;  1J2B A;  3EE1 A;  2XFT A;  3A5E A;  1SJW A;  1TP6 A;  3A76 A;  3I0Y A;  4RNY A;  5JBS A;  3F9S A;  4HZB B;  3OXA A;  4ILF A;  1UI8 A;  4N6M A;  4KFE A;  4RNZ A;  3DMC A;  1JBS A;  1BVI A;  4N6O B;  1NJI 4;  1DVD A;  1WMO A;  4NRE A;  3FLJ A;  1BNG A;  4QWT A;  1RRL A;  3HZP A;  3Q1C A;  4L8P A;  4H3U A;  1RGC A;  3F8X A;  2F5W A;  3NV0 A;  5CF1 A;  2F5M A;  4HM6 B;  1UCJ A;  2WGO A;  3ECF A;  1UUW B;  3GWR A;  2KF4 A;  1BNI A;  1L5G B;  1X1W A;  3DGM A;  3E99 A;  1TUH A;  3OV4 A;  2HMJ B;  2WGQ A;  3LTD A;  2HML B;  5AEU B;  3CCE 3;  1UGH I;  3MYT A;  1AVL A;  5CK6 A;  3LZA A;  1NB3 I;  2E2V A;  4HZ9 B;  3CD6 3;  1KWI A;  2KXG A;  2P09 A;  5G2G A;  1LRA A;  1B3S A;  3EJV A;  1N5H A;  4WYK A;  5AEW B;  5JPU A;  3WOF B;  1HKX A;  2W56 A;  1Q82 4;  1Q9E A;  2BT3 A;  3CXC 2;  1UW1 A;  3LYG A;  1YNV X;  1BOX A;  2XSH B;  2OTJ 3;  3Q90 A;  1STD A;  1O7W B;  5AIG A;  5LC7 A;  3MG3 A;  4X2O A;  3I55 3;  4WP5 A;  1B2U A;  4AKY A;  1GY5 A;  1LOX A;  1OAC A;  4HM0 B;  4N6N B;  4FMD A;  1RLS A;  2RCD A;  2AAD A;  3EQQ B;  2IUJ A;  2CW9 A;  2K0M A;  3T0U A;  1UCI A;  2OCT A;  4HM3 B;  3U1W A;  3CC2 3;  1ZGX A;  3CU3 A;  2HMM B;  3B8L A;  1IVW A;  3VSY A;  4R80 A;  3EX9 A;  5IW9 A;  5IEO A;  2HOH A;  3DY5 A;  2P05 A;  2M7O A;  4R9L A;  7GSP A;  5IG5 A;  3HI7 A;  1VQ7 3;  5IG4 A;  1G02 A;  1JV2 B;  4HVN A;  5KP3 A;  2RBI A;  2B1X B;  1I2G A;  1W6G A;  1V58 A;  4GB5 A;  1BSA A;  1VZZ A;  1UCK A;  1UDI I;  4KZ1 A;  1LNI A;  4JF8 A;  1KC8 4;  1VQ5 3;  6STD A;  3CCR 3;  1A67 A;  4HM2 B;  3PCS A;  4N3V A;  4DKI A;  2J8X B;  1BSD A;  1K28 A;  1IYY A;  1LOW A;  3AGO A;  4GHO A;  5IER A;  3GSP A;  1OF5 A;  2MC8 A;  5BVB A;  5IEP A;  3LH4 A;  1VQN 3;  1CEW I;  4STD A;  3KE7 A;  1U8C B;  3JUQ A;  3SED A;  3ZG5 A;  3AHW A;  1BRI A;  1IVV A;  1YIJ 3;  3JUN A;  3CCU 3;  4ORL A;  4CCV A;  4MMX B;  1CYV A;  3K9M C;  3N54 B;  5STD A;  3T8U A;  1JZD A;  1C54 A;  1LQG C;  1LOV A;  1GMR A;  2RFR A;  3BNB A;  4BTX A;  1VQM 3;  1IK3 A;  1W00 A;  1VQ8 3;  2A15 A;  1SII A;  2HMK B;  3DM8 A;  3KZT A;  3UL5 A;  3LT8 A;  1BRS A;  1TU5 A;  1FUW A;  1EG9 B;  3LTC A;  1M9G A;  4HM8 B;  2YFL B;  4G1M B;  4MMZ B;  3TDG A;  1ZS7 A;  2OQE A;  1STF I;  4H61 A;  2BO9 B;  2Y74 A;  3ER7 A;  1VQK 3;  1FGQ A;  3D9R A;  1BAO A;  3QRD A;  4KT3 B;  1BRK A;  1GY6 A;  3NX0 A;  1LNH A;  4ZM8 A;  3ALA A;  1N5P A;  3D4A A;  3EN1 B;  3Q3F A;  1RKY A;  3NV0 B;  3WOD G;  5IG0 A;  1K41 A;  2V1L A;  4R4K A;  1MNL A;  2K3D A;  1SIH A;  1B21 A;  4U13 A;  4XBX A;  1KD1 4;  1HZ1 A;  3G8Z A;  1CH0 A;  3M8C A;  1BU4 A;  4OK0 A;  4BIR A;  4RBN A;  2UUG C;  2IMJ A;  2W9Q A;  3CPO A;  1QVG 2;  2H0H A;  1A2V A;  1D6U A;  3AHS A;  3EC9 A;  2GU1 A;  2KAA A;  2Z77 A;  3GZX B;  1RDS A;  2Z6B A;  4WFO A;  3DGO A;  3MPH A;  3B4P A;  3FKA A;  2XEP A;  1BSC A; 
#chains in the Genus database with same CATH homology
 3SVA A;  1Q7Y 4;  4FR9 A;  3K63 A;  1ULI B;  2XRX B;  2HMO B;  1US1 A;  5KP4 A;  1RJO A;  3FF2 A;  4J8T A;  1SPU A;  5D81 A;  1JKG A;  1IQ8 A;  4AEQ A;  2B24 B;  4K61 A;  4L8O A;  4XDV A;  3LT9 A;  3O8Y A;  4BTY A;  3DGN A;  4HM5 B;  5IG3 A;  3H51 A;  2Y73 A;  1GD4 A;  4HYZ A;  3BND A;  3CMA 3;  1BUQ A;  1WTH A;  3IPT A;  3HX8 A;  2LQV A;  1NU3 A;  4NHF A;  3STD A;  4LZI A;  1K73 4;  3NUV A;  1CYU A;  4EV5 A;  1N8R 4;  3X3Y A;  3CCS 3;  1TFO A;  3WA2 X;  5IEN A;  1JB5 A;  4MJD A;  3G71 3;  3UL6 A;  4KFD A;  3FSD A;  2ML6 A;  3FZW A;  1NB5 I;  3Q2P A;  2KRT A;  1M90 4;  4N6U A;  1W2B 2;  3BLZ A;  3J7Y d;  1OGZ A;  2D42 A;  3CME 3;  3PYJ A;  1IDP A;  2OOV C;  4EBG A;  3CCM 3;  1JRQ A;  1Q40 B;  1IVX A;  4HM7 B;  4WHA A;  1W5Z A;  2OQE C;  1MOL A;  1ASK A;  4EXR A;  3NBR A;  4XM4 A;  1Q81 4;  2PNC A;  3SLU A;  2IUK A;  4O2H A;  8CHO A;  2O3O A;  4Q53 A;  2STD A;  3MHE A;  2XH9 A;  1IQY A;  2W04 A;  3NQZ A;  2PZV A;  4N6T A;  3G4S 3;  3B4O A;  2P0M A;  3EBY A;  3OWS A;  3S27 A;  1OPY A;  3IMA B;  5LC6 A;  1QVF 2;  1WMN A;  2RSX A;  3CC7 3;  3HII A;  1OUN A;  2CWU A;  1LXE A;  2Z76 A;  3FG4 A;  3MWZ A;  2LYX A;  1FGR A;  4PEJ A;  3DGL A;  3VGN A;  3EN8 A;  3EHC A;  3X41 A;  1ISK A;  3MG1 A;  3WOE B;  5AI1 A;  2BHM A;  3SOA A;  3GZB A;  1JNQ A;  5FW5 A;  1D6Z A;  1OCV A;  1O7G B;  2GEX A;  2YFI B;  1W7C A;  2W6J H;  2D1W A;  2W2C A;  1M1K 4;  4MEI A;  2ZL8 A;  3OX9 A;  1W6C A;  1R4C A;  1K9M 4;  2CKF B;  2CK3 H;  1E3V A;  1JN5 A;  3F8H A;  4XBY A;  2FGT A;  4EYC A;  1EQK A;  3IJE B;  1YJW 3;  1NO3 A;  2INX A;  2GXF A;  7STD A;  4J9A A;  1YJ9 3;  3BB9 A;  2XFS A;  3PCR A;  3N8B A;  2Q07 A;  2W03 A;  3DXO A;  3NQY A;  4KVH A;  2CC3 A;  3AMO A;  2GBX B;  2P0X A;  3KII A;  3S28 A;  4LGQ A;  2CFD A;  3RGA A;  2GBW B;  1ROV A;  3WMD A;  1JKG B;  4GL6 A;  4R9K A;  1EA2 A;  4N6V 0;  1TFK A;  2OOV A;  5AYR B;  3F14 A;  3PGB A;  3MKI A;  3WA3 A;  4X2H A;  1RRH A;  3DUK A;  5ELJ A;  4EC6 A;  3FGY A;  3NXJ A;  4FMA A;  2OWP A;  2CIU A;  1HU9 A;  3G0K A;  3FCS B;  5HGR A;  4HM4 B;  3LTA A;  3HIG A;  4FMB A;  3N9H A;  1QJG A;  4IIA A;  2FXT A;  4HM1 B;  1T5Y A;  3LTB A;  3CNM A;  3H3H A;  1U5O A;  4JRF A;  2GU3 A;  3LML A;  1A90 A;  3UB1 A;  4OUQ A;  1N9E A;  4MMY B;  1YIT 3;  3V92 A;  2CG0 A;  1DMN A;  3JVC A;  3QK9 A;  1AR0 A;  2ZDJ A;  2QA4 3;  4WYK B;  3G6E 3;  3FH1 A;  4K1U A;  3OW2 2;  1QMA A;  2W0Q A;  3JUP A;  2W56 B;  4TX4 A;  2WOF A;  1OGX A;  4WWU C;  1VQO 3;  1WNH A;  1K8A 4;  4BTW A;  3L0R A;  1GS3 A;  1QAK A;  3JUM A;  1AV4 A;  3K5T A;  4K90 B;  1GY7 A;  1D6Y A;  5EEO A;  2CFG A;  2YFJ B;  1YHQ 3;  1VQ6 3;  5AYS C;  3LXU X;  2R4I A;  1V74 A;  2C11 A;  4O8S A;  1Z1S A;  3G16 A;  4I4K A;  1YJN 3;  2MF7 A;  1JJ2 2;  1FA3 A;  1ZO2 A;  5FGO A;  2W9P A;  5BXQ A;  2WOH A;  4FCJ A;  2CH9 A;  3RGR A;  2RGQ A;  2CWV A;  1AVK A;  4LSO A;  5EQL A;  1GD3 A;  2QIY A;  1LVN A;  4IT7 A;  1IV9 A;  5TGN A;  1O7P B;  1QAL A;  3HK4 A;  3WDG B;  3GZR A;  1W01 A;  4EV2 A;  1G96 A;  3LOY A;  3VF1 A;  2CFK A;  2K54 A;  2SBL A;  3PZW A;  1YI2 3;  1OHO A;  4RZM A;  5AIF A;  3SOY A;  1A2K A;  2XR8 B;  1UI7 A;  2UX0 A;  1VQP 3;  1DMM A;  1S72 3;  2BNG A;  1OF5 B;  2OTL 3;  1JN5 B;  1UUV B;  3S67 A;  3NHX A;  3CCL 3;  1EKM A;  2F98 A;  4R1K A;  2CG1 A;  3CC4 3;  1C7H A;  3EB8 A;  2CFL A;  3KKG A;  3AMO B;  4XB5 A;  2QGU A;  3BNE A;  5JPP A;  5EVH A;  1VQL 3;  1Q42 A;  3OWU A;  4O02 B;  3SX1 A;  3B7C A;  4LEH A;  4O3V A;  3CPW 2;  2P38 A;  4IPB A;  1OHS A;  5D82 A;  3FG1 A;  3PS8 A;  2BMQ B;  1KSI A;  3X3Z A;  1N8Q A;  4XDW A;  1IVU A;  1O7N B;  2CWT A;  3UNL A;  1W02 A;  3D3L A;  2CFW A;  3KSP A;  4OVM A;  5AII A;  5CF2 A;  1NWW A;  2BMO B;  1RN7 A;  3KSE D;  2YX9 A;  5KP1 A;  5I97 A;  1E3R A;  2HMN B;  2O9U X;  3DZL A;  1N9J A;  3GZY B;  3FF0 A;  3UJM A;  3I56 3;  1Q86 4;  4HJL B;  1DYU A;  3X3X A;  4LMI A;  2QEX 3;  1OH0 A;  2E2T A;  1CQS A;  3V98 A;  1W2Z A;  1WQL B;  3CCJ 3;  3NM2 A;  2F86 B;  2JQ5 A;  3EF8 A;  1M1X B;  2IA7 A;  1W6Y A;  4AKZ A;  1S5A A;  1Y4K A;  1FGO A;  4FCM A;  3S29 A;  3S5C A;  2L4V A;  1YVB I;  1ZX2 A;  1PFP A;  3U97 A;  3BNC A;  3KFQ C;  4K1V A;  1Q40 A;  3JUO A;  4FMC A;  3OWY A;  5IF6 A;  5DRE A;  3X42 A;  3CNX A;  5ELU A;  3ROB A;  2JDI H;  1IV7 A;  3K7C A;  1ULJ B;  5CLK A;  3CCQ 3;  2XSO B;  1WMP A;  2XGN A;  3KN4 A;  1OHP A;  1VQ9 3;  1W4N A;  5DRV A;  3K0Z A;  4FCZ A;  3NBJ A;  1E97 A;  1SQW A;  2WO0 A;  2F99 A;  2GEY A;  4L7K A;  1PU4 A;  3SXX A;  1FGT A;  3MSO A;  2E2U A;  3EBT A;  3X40 A;  1DMQ A;  5AIH A;  4HBR A;  2FNQ A;  1O7H B;  3F40 A;  1GYB A;  1IT7 A;  3NBB A;  2BMR B;  2C10 A;  2CHC A;  3RDE A;  3F7S A;  1F8N A;  1JB4 A;  2KCD A;  4HKV B;  1FGM A;  3CCV 3;  4CDL A;  2Z7A A;  1NDO B;  5A0O B;  2XGL A;  2XF3 A;  3F7X A;  4XBT A;  1ROA A;  4N6L A;  3V99 A;  1IU7 A;  1QAF A;  1JB2 A;  1TIJ A;  3GRD A;  3NM7 A;  1O7M B;  5CXO A;  1KQS 2;  1IQX A;  2I9W A;  1YGE A;  1IT8 A;  3PXM A;  3FG3 A;  4KFF A;  1DVC A;  3T8N A;  3GAX A;  3MG2 A;  5D83 A;  2ML5 A;  1VQ4 3;  1J2B A;  3EE1 A;  2XFT A;  1SJW A;  1TP6 A;  3A76 A;  3I0Y A;  4RNY A;  5JBS A;  3F9S A;  4HZB B;  3OXA A;  1UI8 A;  4N6M A;  4KFE A;  4RNZ A;  3DMC A;  4N6O B;  1NJI 4;  1DVD A;  1WMO A;  4NRE A;  3FLJ A;  4QWT A;  1RRL A;  3HZP A;  3Q1C A;  4L8P A;  4H3U A;  3F8X A;  3NV0 A;  5CF1 A;  4HM6 B;  2WGO A;  3ECF A;  1UUW B;  3GWR A;  1L5G B;  3DGM A;  3E99 A;  1TUH A;  3OV4 A;  2HMJ B;  2WGQ A;  3LTD A;  2HML B;  5AEU B;  3CCE 3;  3MYT A;  1AVL A;  5CK6 A;  3LZA A;  1NB3 I;  2E2V A;  4HZ9 B;  3CD6 3;  1KWI A;  2KXG A;  2P09 A;  5G2G A;  3EJV A;  1N5H A;  4WYK A;  5AEW B;  5JPU A;  3WOF B;  1HKX A;  2W56 A;  1Q82 4;  2BT3 A;  3CXC 2;  1UW1 A;  3LYG A;  2XSH B;  2OTJ 3;  3Q90 A;  1STD A;  1O7W B;  5AIG A;  5LC7 A;  3MG3 A;  4X2O A;  3I55 3;  4WP5 A;  4AKY A;  1GY5 A;  1LOX A;  1OAC A;  4HM0 B;  4N6N B;  4FMD A;  2RCD A;  3EQQ B;  2IUJ A;  2CW9 A;  2K0M A;  3T0U A;  2OCT A;  4HM3 B;  3U1W A;  3CC2 3;  3CU3 A;  2HMM B;  3B8L A;  1IVW A;  3VSY A;  4R80 A;  3EX9 A;  5IW9 A;  5IEO A;  3DY5 A;  2P05 A;  2M7O A;  4R9L A;  5IG5 A;  3HI7 A;  1VQ7 3;  5IG4 A;  1JV2 B;  4HVN A;  5KP3 A;  2B1X B;  1W6G A;  4GB5 A;  1VZZ A;  1A67 A;  1VQ5 3;  4KZ1 A;  4JF8 A;  1KC8 4;  6STD A;  3CCR 3;  4HM2 B;  3PCS A;  4N3V A;  1K28 A;  5IER A;  2MC8 A;  1OF5 A;  5BVB A;  5IEP A;  3LH4 A;  1VQN 3;  1CEW I;  4STD A;  3KE7 A;  1U8C B;  3JUQ A;  3SED A;  1YIJ 3;  1IVV A;  3JUN A;  3CCU 3;  4ORL A;  4CCV A;  4MMX B;  1CYV A;  3K9M C;  3N54 B;  5STD A;  3T8U A;  2RFR A;  3BNB A;  1VQM 3;  4BTX A;  1IK3 A;  1W00 A;  1VQ8 3;  2A15 A;  1SII A;  2HMK B;  3DM8 A;  3KZT A;  3UL5 A;  3LT8 A;  1FUW A;  1TU5 A;  1EG9 B;  3LTC A;  1M9G A;  4HM8 B;  2YFL B;  4G1M B;  4MMZ B;  3TDG A;  2OQE A;  1STF I;  4H61 A;  2BO9 B;  2Y74 A;  3ER7 A;  1VQK 3;  1FGQ A;  3D9R A;  3QRD A;  1GY6 A;  3NX0 A;  1LNH A;  4ZM8 A;  3ALA A;  1N5P A;  3EN1 B;  1RKY A;  3NV0 B;  3WOD G;  5IG0 A;  1K41 A;  2V1L A;  4R4K A;  1MNL A;  4U13 A;  1SIH A;  4XBX A;  1KD1 4;  3G8Z A;  3M8C A;  4OK0 A;  4RBN A;  2IMJ A;  2W9Q A;  3CPO A;  1QVG 2;  1A2V A;  1D6U A;  3EC9 A;  2GU1 A;  2Z77 A;  3GZX B;  2Z6B A;  4WFO A;  3DGO A;  3MPH A;  3B4P A;  3FKA A;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...