2W9PA

Crystal structure of potato multicystatin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords MULTICYSTATIN
publication title Characterization of Solanum Tuberosum Multicystatin and its Structural Comparison with Other Cystatins.
pubmed doi rcsb
source organism Solanum tuberosum
total genus 19
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w9pA00
2CH9A 1DVDA 4IT7A 4N6V0 1YVBI 1CYVA 3Q2PA 1IV9A 2OCTA 1MOLA 1G96A 1A90A 3IMAB 4ZM8A 4LZIA 1A67A 3MWZA 4N6TA 3KSED 3UL5A 1N5HA 3KFQC 3L0RA 1R4CA 1GD4A 1STFI 3PS8A 1N5PA 1TIJA 4EYCA 5A0OB 1PFPA 4N6MA 4N6UA 1FUWA 1M9GA 3PXMA 5ELUA 1RN7A 2KXGA 1FA3A 2BO9B 3UL6A 1CEWI 3S67A 1IV7A 1GD3A 1LXEA 5LC6A 1NB3I 5EQLA 3PYJA 4CCVA 1KWIA 2W9PA 4N6OB 1NB5I 1N9JA 4TX4A 1ROAA 3QRDA 1CYUA 5ELJA 2O9UX 3LH4A 4N6NB 2W9QA 3GAXA 1MNLA 1WNHA 1DVCA 3SVAA 4N6LA 3K9MC 5LC7A 1EQKA 3NX0A
chains in the Genus database with same CATH superfamily
5IENA 3SOAA 1ZO2A 1BRNL 1RGAA 1BSDA 2JQ5A 1CH0A 3B8LA 3LT9A 3OV4A 2D42A 1RN1A 4Q53A 3CCM3 2W6JH 3FSDA 1Q40B 3KKGA 3T8UA 1JN5A 5BU4A 1BIRA 2KCDA 1W00A 3EJVA 1IQYA 4HM7B 1BNRA 2YFIB 1RTUA 5G2GA 2XR8B 3IJEB 2HMJB 3NM2A 1MGWA 3LMLA 1S723 2UUGC 3LT8A 3S5CA 2CX1A 3DGYA 3GZRA 5IG3A 4ZM8A 1FZUA 3D79A 2F4YA 4K61A 4PEJA 4XBXA 6STDA 1A67A 4RBNA 1W02A 3CCQ3 2WGQA 1FUTA 4J9AA 1WTHA 3FG3A 1U8CB 2OOVA 4HAAA 1M904 2RNTA 2E2UA 3A76A 3OW22 2B1XB 2Y74A 1DMQA 3BNDA 3DZLA 3FZWA 1N5PA 1RSNA 2W03A 3AHSA 2XFSA 2Z76A 2RGQA 4GHOA 2QEX3 8RNTA 3RGAA 4OVMA 2KRTA 3KZTA 3CC23 3NXJA 1C7HA 2XFTA 1A2PA 2HMOB 4L8PA 1SJWA 1GYBA 1TJDA 5EEOA 3UB1A 5A0OB 1OGXA 2FXTA 1PFPA 2CWVA 1UCLA 3K7CA 3WHOA 5AIHA 3HI7A 1TFKA 1W6YA 1I2GA 3PXMA 3URPA 3D4AA 3DXOA 5AI1A 2O3OA 3F9SA 3UJMA 2CHCA 1WMOA 4KFDA 1MGRA 2IUKA 3X3XA 2BT3A 1UI8A 1B21A 2B24B 1OHOA 2P09A 2XEPA 1UGHI 4EV5A 3WA2X 1IK3A 4K1UA 1RHLA 1X1YA 2ZL8A 1EKMA 1T2HA 5AEWB 5BIRA 2KAAA 3SEDA 1JKGA 1IV7A 4LEHA 4HVNA 4L7KA 2WOHA 1CQSA 2QIYA 1UUVB 2RBIA 3F7XA 1K28A 3LTDA 5LC6A 3DY5A 4HM0B 2K54A 3CMA3 3EX9A 5EQLA 3PYJA 1RGCA 4L8OA 2MF7A 1BSAA 2HOHA 5G1KA 4WP5A 5JPUA 1KSIA 2F99A 2XH9A 4QWTA 4HZ9B 1IQXA 1GY6A 4WFOA 4BL2A 2GBWB 5IW9A 2CX0A 3WMDA 1UDII 3DGOA 2CFKA 1AQZA 3F8XA 3T8NA 4TX4A 1TRPA 1E3VA 3SLUA 2KF3A 3KIIA 3LZAA 3X3YA 3B4PA 5AIGA 2CKFB 1LQMB 2HMKB 2SARA 2O9UX 4J5GA 3DGNA 1AVKA 1GOYA 2W56A 2W04A 6GSPA 3S27A 2W9QA 3G16A 3OXAA 5CK6A 1IT7A 1MNLA 5AEUB 1GOUA 1DVCA 3SVAA 2P38A 5IEOA 1BSEA 1O7HB 2YFJB 1TUHA 4DKIA 4WYKB 1BNJA 2Z7AA 1NDOB 3K5TA 3NX0A 3CCL3 4KFEA 1SQWA 4I5QA 1GSPA 1I3IA 1Q9EA 3DGMA 4ILFA 3KN4A 1DVDA 1QAKA 3CNMA 4AEQA 5HOHA 2XSOB 1DE3A 1L5GB 6RNTA 1E97A 1OHSA 3V92A 4KZ1A 1WQLB 1YGEA 2Y73A 7GSPA 3I0YA 1GMPA 1JBTA 3CPOA 1FGQA 1B3SA 2R4IA 1B2MA 1IDPA 3CCV3 1DMMA 1Q42A 1RGFA 3B4OA 4HYZA 3HK4A 4STDA 1IT8A 2BU4A 2Q07A 4MMXB 5AIFA 1FGRA 3PCSA 4XDVA 1B2ZA 2XGLA 3MKIA 1T2IA 5AYSC 3EN1B 3FG4A 3IMAB 1IVUA 1SIHA 5KP1A 4HM3B 4KFFA 1OUNA 3KE7A 1STDA 2CC3A 3G713 2CFLA 4R9KA 3D5IA 3HX8A 1SIIA 1N5HA 1YGWA 3L0RA 3OWYA 3JUOA 3X41A 3CC43 1R4CA 2F98A 3CME3 1UUWB 1LOYA 3H51A 3ZG0A 1YHQ3 2QGUA 3PS8A 4R1KA 4FMAA 1YNVX 2ZDJA 1QMAA 3FKAA 4IIAA 1AY7A 3JVCA 2ZHXB 1VQ83 1FGTA 1T5YA 1M1XB 3G8ZA 4RNTA 3CPW2 3BNEA 1M9GA 1JV2B 3DUKA 3PCRA 1IQ8A 2WGOA 3LYGA 2C10A 2OQEC 3FLJA 1RGGA 2CG0A 5M18A 1UW1A 2BMOB 1OF5A 2AAEA 1RRLA 2CFGA 2H0HA 1FA3A 3SXXA 1BUJA 4JRFA 4O02B 3N54B 1GY5A 1EUIC 2LYXA 1D6YA 1BNIA 1I70A 1RGKA 4IPBA 5CLKA 1CEWI 2RSXA 3BU4A 3NQZA 1BSCA 1YIT3 2UGIA 1HYFA 1ULJB 2XGNA 3HIIA 3HOHA 4H3UA 3MG1A 1OPYA 1QVG2 4O2HA 1VQ73 5CF2A 1PU4A 2K0MA 1Q7Y4 3OWUA 1FGOA 1UCJA 2ML6A 2P05A 4HOHA 1T3BA 1ULIB 3AMOA 5JPPA 2JDIH 3GZBA 1FUSA 1E3RA 2ZA4A 4GB5A 4RNZA 1O7GB 3V99A 1QAFA 2C4BA 2H0GA 4NPBA 5I97A 2IYJA 2OOVC 4LMIA 4N6OB 2BIRA 3O8YA 1N9JA 1Q40A 4EBGA 1VQM3 1EA2A 4I4KA 1FW7A 4BL3A 1BU4A 2H0IA 3QRDA 1F8NA 4HM2B 1UGIA 1WMNA 2KF4A 3WODG 1CYUA 3DH2A 4K1VA 2HMMB 3BLZA 3D9RA 3LH4A 1RMSA 1VQL3 2Z77A 1RGLA 1YI23 1BRSA 1JBRA 1US1A 3H3HA 5M19A 4HZBB 5HGRA 1YJN3 1HZ1A 1YJW3 1Q7HA 3J7Yd 1ZGXA 2L1SA 2INXA 7RNTA 3VF1A 3GRDA 1WMPA 4R9LA 4MJDA 3N9HA 4EXRA 4J5KA 1R4YA 4H61A 3FF0A 3LXUX 5BVBA 4KVHA 4WWUC 9RNTA 1HKXA 1CYVA 1LOVA 1RGEA 2BNGA 1MWTA 3Q2PA 3MHEA 3GSPA 4N3VA 1IV9A 4GL6A 1K41A 4MMYB 3RDEA 3CCU3 1GOVA 2KF6A 2STDA 4K90B 2V1LA 4HM5B 2OCTA 1LNHA 1K8A4 3AHWA 1MOLA 5D83A 4HJLB 3K63A 3NV0B 1KD14 4HM8B 1JB5A 1RJOA 3NQYA 1A90A 3GZXB 5DRVA 1RDSA 1JB4A 1X1UA 2WOFA 3K0ZA 3UNLA 4LZIA 1JBSA 2SBLA 3CCE3 4MMZB 4O3VA 1I3FA 3MWZA 1AVLA 3CCR3 5IERA 4CJNA 2MC8A 3EB8A 4XB5A 4LSOA 2IUJA 2E2VA 5M1AA 4RZMA 3VSYA 1IVWA 3LTCA 1BRKA 1TFOA 4FCMA 3RNTA 1C54A 3QK9A 3IPTA 4XBYA 1STFI 1UCIA 1JN5B 1NO3A 4EW5A 5JBSA 1JRQA 4J8TA 3CCJ3 3FCSB 4ORLA 1G02A 4BIRA 1BGSA 2K3DA 4BTXA 1I8VA 2RCDA 1J2BA 2F5WA 1FYSA 5IF6A 4EV2A 3CXC2 5IEPA 1GMRA 1I2FA 1W2ZA 2OTL3 1QALA 5KP4A 4R4KA 2HMLB 3ZG5A 1RCLA 2F86B 3E99A 3I563 1BRHA 1FGMA 4BTYA 3KCHA 2GU1A 1W01A 2RFRA 1RN4A 2GXFA 1RN7A 2KXGA 1VQN3 4HM6B 2PNCA 1BNGA 2GEXA 3GWRA 3V98A 3X3ZA 5GSPA 1VQK3 1UCKA 1Q814 2Z6BA 1TU5A 1LNIA 1O7PB 1QJGA 4EC6A 1QVF2 2P0XA 4JF8A 1BSBA 1LRAA 3LTAA 1OCVA 2BO9B 3F14A 3FG1A 4NHFA 4X2HA 1V74A 3U1WA 1UUGB 3UL6A 1VQ63 1EEJA 1ZX2A 1HU9A 3AGNA 2HMNB 3A5EA 2CW9A 4FMBA 3CC73 3CU3A 2KF5A 1OACA 4OK0A 4R80A 4KT3B 1GY7A 3ECFA 3S67A 3NBRA 1TRQA 1RCKA 1B2XA 3MSOA 2YFLB 5STDA 2ML5A 3FGYA 1M1K4 2XRXB 2GSPA 3NUVA 3S29A 1S5AA 3G0KA 1JZOA 3GZYB 2W2CA 3MYTA 4WYKA 5EVHA 1UI7A 4G1MB 3MG3A 1BVIA 1ROVA 3S28A 2I9WA 2LQVA 4X2OA 1KWIA 1LOWA 3BB9A 3OWSA 4U13A 5IG5A 2W9PA 1RKYA 3FF2A 1NB5I 1A2VA 1BANA 4FMDA 5D81A 1Q864 2J8XB 3EBYA 2CWTA 3DGLA 3HIGA 5D82A 3X42A 2GU3A 1KQS2 1MWSA 4GSPA 1RNBA 1VQ53 1BNEA 3N8BA 3LTBA 3SYUA 1JKGB 1NJI4 2FNQA 2M7OA 4FMCA 3NHXA 2BMRB 1BRIA 1SARA 4WHAA 3WOFB 2CG1A 3LOYA 3D5GA 1MWUA 3ALAA 1LVNA 1DETA 3FH1A 4O8SA 3BNCA 5G1LA 1YIJ3 2CH9A 1I0XA 1U5OA 3JUMA 1K9M4 1IVVA 3Q1CA 2BMQB 4IT7A 3DMCA 3PZWA 4N6V0 1V58A 1W7CA 4CDLA 1YVBI 1RLSA 3T0UA 2WO0A 5KP3A 1W6GA 2CWUA 3KSPA 1B2UA 3OX9A 3BNBA 1VQ43 3F7SA 2XF3A 1Q824 3DM8A 2W56B 1VQO3 1G96A 4MEIA 1OH0A 1O7WB 1IVXA 1D6ZA 2GBXB 2YX9A 3EBTA 3MPHA 1IU7A 1RNTA 3Q90A 2D1WA 5IG4A 1OHPA 1RGHA 3JUPA 1BUQA 1NNVA 3EE1A 3NBBA 3F40A 4N6TA 1GMQA 2A15A 3KSED 5RNTA 1SPUA 3RGRA 3D3LA 3UL5A 4AKZA 3KFQC 1EG9B 2UX0A 4BU4A 2BHMA 4RNYA 3I553 1RRHA 3ER7A 1JZDA 1D6UA 1GD4A 1NWWA 1O7MB 1YVSA 1B27A 3HZPA 3TDGA 1OGZA 4HBRA 3EQQB 1MWRA 1TIJA 3Q3FA 4LGQA 1TTOA 1NU3A 3ZFZA 4EYCA 2QA43 5CXOA 1JJ22 4N6MA 3EF8A 1K734 4N6UA 1FUWA 1GS3A 1W6CA 1LQGC 2E2TA 3MG2A 4NREA 3WDGB 3NM7A 2AADA 1VQP3 1B2SA 1G0TA 2FGTA 4XBTA 5ELUA 3G6E3 4CPKA 4LYLB 2IA7A 2PZVA 1DMNA 4HM4B 2P0MA 1X1XA 3CCS3 1W4NA 1V57A 5BXQA 3STDA 2R41A 1IYYA 4FCZA 4FCJA 2CK3H 1BRGA 3SOYA 3WR2A 2CFDA 1ZS7A 1ASKA 1B20A 3WOEB 5AIIA 1O7NB 1BRJA 5FW5A 5IG0A 3EHCA 2F5MA 1LOXA 1GD3A 1N9EA 1PYLA 5FGOA 2F56A 3AGOA 4HM1B 1LXEA 3F8HA 2OWPA 4AKYA 3BIRA 3EC9A 1W2B2 1I0VA 1NB3I 1W5ZA 3X40A 7STDA 3JUNA 1TP6A 1N8R4 4XDWA 1Z1SA 2C11A 3ROBA 4BTWA 4XM4A 5AYRB 4OUQA 4CCVA 1BNFA 1OF5B 2L4VA 1N8QA 1X1WA 1Y4KA 1KC84 1ISKA 1YJ93 5DREA 1JNQA 1ROAA 3PGBA 4HKVB 1BOXA 5CF1A 1JB2A 1VZZA 2IMJA 3WA3A 1AV4A 2OTJ3 3CD63 3B7CA 5ELJA 3NBJA 5TGNA 3JUQA 8CHOA 3CNXA 4N6NB 2CIUA 1A2KA 3U97A 1VQ93 1BNSA 1I2EA 2XSHB 1PY3A 3GAXA 3NV0A 3SX1A 1WNHA 2IY2A 4FR9A 1AR0A 4N6LA 3K9MC 1DYUA 1VQQA 2GEYA 3M8CA 2W0QA 3VGNA 3G4S3 2OQEA 5LC7A 3AMOB 1EQKA 2CFWA 1BAOA 3EN8A
chains in the Genus database with same CATH topology
5IENA 3SOAA 1ZO2A 2JQ5A 3LT9A 3B8LA 3OV4A 2D42A 4Q53A 3CCM3 2W6JH 3FSDA 1Q40B 3KKGA 3T8UA 1JN5A 2KCDA 1W00A 3EJVA 1IQYA 4HM7B 2YFIB 5G2GA 2XR8B 3IJEB 2HMJB 3NM2A 3LMLA 1S723 3LT8A 3S5CA 3GZRA 5IG3A 4ZM8A 4K61A 4PEJA 1A67A 4XBXA 6STDA 4RBNA 1W02A 3CCQ3 2WGQA 4J9AA 1WTHA 3FG3A 1U8CB 2OOVA 1M904 2E2UA 3A76A 3OW22 2B1XB 2Y74A 1DMQA 3BNDA 3DZLA 3FZWA 1N5PA 2W03A 4MEIA 4R9KA 2XFSA 2Z76A 2RGQA 2QEX3 3RGAA 4OVMA 2KRTA 3KZTA 3CC23 3NXJA 1C7HA 2XFTA 4L8PA 2HMOB 1SJWA 1GYBA 5EEOA 3UB1A 5A0OB 1OGXA 2FXTA 1PFPA 2CWVA 3K7CA 5AIHA 3HI7A 1TFKA 1W6YA 3PXMA 5AI1A 3DXOA 2O3OA 3F9SA 3UJMA 2CHCA 1WMOA 4KFDA 2IUKA 3X3XA 2BT3A 1UI8A 2B24B 1OHOA 2P09A 2XEPA 4EV5A 1IK3A 4K1UA 2ZL8A 5AEWB 1EKMA 3SEDA 1JKGA 1IV7A 4LEHA 4HVNA 4L7KA 2WOHA 1CQSA 2QIYA 1UUVB 3F7XA 1K28A 3LTDA 5LC6A 3DY5A 4HM0B 2K54A 3CMA3 3EX9A 5EQLA 3PYJA 4L8OA 2MF7A 5JPUA 4WP5A 1KSIA 2XH9A 2F99A 4QWTA 4HZ9B 1IQXA 1GY6A 4WFOA 2GBWB 5IW9A 3WMDA 3DGOA 2CFKA 3F8XA 3T8NA 4TX4A 1E3VA 3SLUA 3KIIA 3LZAA 3X3YA 3B4PA 5AIGA 2CKFB 2HMKB 2O9UX 3DGNA 1AVKA 2W56A 2W04A 3S27A 2W9QA 3G16A 3OXAA 5CK6A 1IT7A 1MNLA 5AEUB 1DVCA 3SVAA 2P38A 5IEOA 1O7HB 2YFJB 1TUHA 4WYKB 2Z7AA 1NDOB 3K5TA 3NX0A 3CCL3 4KFEA 1SQWA 3DGMA 3KN4A 1DVDA 1QAKA 3CNMA 4AEQA 2XSOB 1L5GB 1E97A 1OHSA 3V92A 4KZ1A 1WQLB 1YGEA 2Y73A 3I0YA 3CPOA 1FGQA 2R4IA 1IDPA 3CCV3 1DMMA 1Q42A 3B4OA 4HYZA 3HK4A 4STDA 1IT8A 2Q07A 4MMXB 5AIFA 1NJI4 1FGRA 3PCSA 4XDVA 2XGLA 3MKIA 5AYSC 3EN1B 3FG4A 3IMAB 1IVUA 1SIHA 5KP1A 4HM3B 4KFFA 1OUNA 3KE7A 1STDA 2CC3A 3G713 2CFLA 3HX8A 1SIIA 1N5HA 3L0RA 3OWYA 3JUOA 3X41A 3CC43 1R4CA 2F98A 3CME3 1UUWB 3H51A 1YHQ3 2QGUA 3PS8A 4R1KA 4FMAA 2ZDJA 1QMAA 3FKAA 4IIAA 3JVCA 1VQ83 1FGTA 1T5YA 1M1XB 3G8ZA 3CPW2 3BNEA 1M9GA 1JV2B 3DUKA 3PCRA 1IQ8A 2WGOA 3LYGA 2C10A 2OQEC 3FLJA 2CG0A 1UW1A 2BMOB 1OF5A 1RRLA 2CFGA 1FA3A 3SXXA 4JRFA 4O02B 3N54B 1GY5A 2LYXA 1D6YA 4IPBA 5CLKA 1CEWI 2RSXA 3NQZA 1YIT3 1ULJB 2XGNA 3HIIA 4H3UA 3MG1A 1OPYA 1QVG2 4O2HA 1VQ73 5CF2A 1PU4A 2K0MA 1Q7Y4 3OWUA 1FGOA 2ML6A 2P05A 1ULIB 3AMOA 5JPPA 2JDIH 3GZBA 1E3RA 4GB5A 4RNZA 1O7GB 3V99A 1QAFA 5I97A 2OOVC 4LMIA 4N6OB 1VQM3 4EBGA 3O8YA 1N9JA 1Q40A 1EA2A 4I4KA 3QRDA 1F8NA 4HM2B 1WMNA 3WODG 1CYUA 4K1VA 2HMMB 3BLZA 3D9RA 3LH4A 1VQL3 2Z77A 1YI23 1US1A 3H3HA 4HZBB 5HGRA 1YJN3 1YJW3 3J7Yd 2INXA 3GRDA 1WMPA 4R9LA 4MJDA 3N9HA 4EXRA 4H61A 3FF0A 3LXUX 5BVBA 4KVHA 4WWUC 1HKXA 1CYVA 2BNGA 3Q2PA 3MHEA 4N3VA 1IV9A 4GL6A 1K41A 4MMYB 3RDEA 3CCU3 2STDA 4K90B 2V1LA 4HM5B 2OCTA 1LNHA 1K8A4 1MOLA 5D83A 4HJLB 3K63A 3NV0B 1KD14 4HM8B 1JB5A 1RJOA 3NQYA 1A90A 3GZXB 5DRVA 1JB4A 2WOFA 3K0ZA 3UNLA 4LZIA 2SBLA 3CCE3 4MMZB 4O3VA 3MWZA 3CCR3 1AVLA 5IERA 2MC8A 3EB8A 4XB5A 4LSOA 2IUJA 2E2VA 3VSYA 4RZMA 1IVWA 3LTCA 1TFOA 4FCMA 3QK9A 3IPTA 4XBYA 1STFI 1JN5B 1NO3A 5JBSA 1JRQA 4J8TA 3CCJ3 3FCSB 4ORLA 4BTXA 2RCDA 1J2BA 5IF6A 4EV2A 3CXC2 5IEPA 1W2ZA 2OTL3 1QALA 5KP4A 4R4KA 2HMLB 2F86B 3E99A 3I563 1FGMA 4BTYA 2GU1A 1W01A 2RFRA 2GXFA 1RN7A 2KXGA 1VQN3 4HM6B 2PNCA 2GEXA 3GWRA 3X3ZA 3V98A 1Q814 1VQK3 2Z6BA 1TU5A 1QJGA 1O7PB 4EC6A 1QVF2 2P0XA 4JF8A 3WA2X 3LTAA 1OCVA 2BO9B 3F14A 3FG1A 4NHFA 4X2HA 1V74A 3U1WA 3VF1A 3UL6A 1VQ63 1HU9A 1ZX2A 4FMBA 2HMNB 3CC73 2CW9A 3CU3A 4OK0A 1OACA 4R80A 1GY7A 3ECFA 3S67A 3NBRA 3MSOA 2YFLB 5STDA 2ML5A 3FGYA 1M1K4 2XRXB 3NUVA 3S29A 1S5AA 3G0KA 3GZYB 3MYTA 2W2CA 4WYKA 5EVHA 1UI7A 4G1MB 3MG3A 1ROVA 3S28A 2I9WA 2LQVA 4X2OA 1KWIA 3BB9A 3OWSA 4U13A 5IG5A 2W9PA 1RKYA 3FF2A 1NB5I 1A2VA 4FMDA 5D81A 1Q864 3EBYA 3X42A 2CWTA 3DGLA 3HIGA 5D82A 2GU3A 1KQS2 1VQ53 3N8BA 3LTBA 1JKGB 2FNQA 2M7OA 4FMCA 3NHXA 2BMRB 4WHAA 3WOFB 2CG1A 3LOYA 3ALAA 1LVNA 3FH1A 4O8SA 3BNCA 1YIJ3 2CH9A 3JUMA 1U5OA 1K9M4 1IVVA 3Q1CA 2BMQB 4IT7A 3DMCA 3PZWA 4N6V0 1W7CA 4CDLA 1YVBI 3T0UA 2WO0A 5KP3A 1W6GA 2CWUA 3KSPA 3OX9A 1VQ43 3BNBA 3F7SA 2XF3A 1Q824 3DM8A 2W56B 1VQO3 1G96A 1OH0A 1O7WB 1IVXA 1D6ZA 2GBXB 2YX9A 3EBTA 3MPHA 1IU7A 3Q90A 2D1WA 5IG4A 1OHPA 3JUPA 1BUQA 3EE1A 3NBBA 3F40A 4N6TA 2A15A 3KSED 1SPUA 3RGRA 3D3LA 3UL5A 4AKZA 3KFQC 1EG9B 2UX0A 2BHMA 4RNYA 3I553 1RRHA 3ER7A 1D6UA 1GD4A 1NWWA 1O7MB 3HZPA 3TDGA 1OGZA 4HBRA 3EQQB 1TIJA 4LGQA 1NU3A 4EYCA 2QA43 1JJ22 5CXOA 4N6MA 3EF8A 1K734 4N6UA 1FUWA 1GS3A 1W6CA 2E2TA 3MG2A 4NREA 3WDGB 3NM7A 1VQP3 2FGTA 4XBTA 5ELUA 3G6E3 2IA7A 2PZVA 1DMNA 4HM4B 2P0MA 3CCS3 1W4NA 5BXQA 3STDA 4FCZA 4FCJA 2CK3H 3SOYA 2CFDA 1ASKA 3WOEB 5AIIA 1O7NB 5FW5A 5IG0A 3EHCA 1LOXA 1GD3A 1N9EA 5FGOA 4HM1B 1LXEA 3F8HA 2OWPA 4AKYA 3EC9A 1W2B2 1W5ZA 1NB3I 3X40A 7STDA 3JUNA 1TP6A 1N8R4 4XDWA 1Z1SA 2C11A 3ROBA 4BTWA 4XM4A 5AYRB 4OUQA 4CCVA 1OF5B 2L4VA 1N8QA 1Y4KA 1KC84 1ISKA 1YJ93 5DREA 1JNQA 1ROAA 3PGBA 4HKVB 5CF1A 1JB2A 1VZZA 2IMJA 3WA3A 1AV4A 2OTJ3 3CD63 3B7CA 5ELJA 3NBJA 5TGNA 3JUQA 8CHOA 3CNXA 4N6NB 2CIUA 1A2KA 3U97A 1VQ93 2XSHB 3SX1A 3GAXA 3NV0A 1WNHA 4FR9A 1AR0A 4N6LA 3K9MC 1DYUA 2GEYA 3M8CA 3VGNA 2W0QA 3G4S3 2OQEA 5LC7A 3AMOB 1EQKA 2CFWA 3EN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH9 A;  1DVD A;  4IT7 A;  4N6V 0;  1YVB I;  1CYV A;  3Q2P A;  1IV9 A;  2OCT A;  1MOL A;  1G96 A;  1A90 A;  3IMA B;  4ZM8 A;  4LZI A;  1A67 A;  3MWZ A;  4N6T A;  3KSE D;  3UL5 A;  1N5H A;  3KFQ C;  3L0R A;  1R4C A;  1GD4 A;  1STF I;  3PS8 A;  1N5P A;  1TIJ A;  4EYC A;  5A0O B;  1PFP A;  4N6M A;  4N6U A;  1FUW A;  1M9G A;  3PXM A;  5ELU A;  1RN7 A;  2KXG A;  1FA3 A;  2BO9 B;  3UL6 A;  1CEW I;  3S67 A;  1IV7 A;  1GD3 A;  1LXE A;  5LC6 A;  1NB3 I;  5EQL A;  3PYJ A;  4CCV A;  1KWI A;  2W9P A;  4N6O B;  1NB5 I;  1N9J A;  4TX4 A;  1ROA A;  3QRD A;  1CYU A;  5ELJ A;  2O9U X;  3LH4 A;  4N6N B;  2W9Q A;  3GAX A;  1MNL A;  1WNH A;  1DVC A;  3SVA A;  4N6L A;  3K9M C;  5LC7 A;  1EQK A;  3NX0 A; 
#chains in the Genus database with same CATH topology
 5IEN A;  3SOA A;  1ZO2 A;  1BRN L;  1RGA A;  1BSD A;  2JQ5 A;  1CH0 A;  3B8L A;  3LT9 A;  3OV4 A;  2D42 A;  1RN1 A;  4Q53 A;  3CCM 3;  2W6J H;  3FSD A;  1Q40 B;  3KKG A;  3T8U A;  1JN5 A;  5BU4 A;  1BIR A;  2KCD A;  1W00 A;  3EJV A;  1IQY A;  4HM7 B;  1BNR A;  2YFI B;  1RTU A;  5G2G A;  2XR8 B;  3IJE B;  2HMJ B;  3NM2 A;  1MGW A;  3LML A;  1S72 3;  2UUG C;  3LT8 A;  3S5C A;  2CX1 A;  3DGY A;  3GZR A;  5IG3 A;  4ZM8 A;  1FZU A;  3D79 A;  2F4Y A;  4K61 A;  4PEJ A;  4XBX A;  6STD A;  1A67 A;  4RBN A;  1W02 A;  3CCQ 3;  2WGQ A;  1FUT A;  4J9A A;  1WTH A;  3FG3 A;  1U8C B;  2OOV A;  4HAA A;  1M90 4;  2RNT A;  2E2U A;  3A76 A;  3OW2 2;  2B1X B;  2Y74 A;  1DMQ A;  3BND A;  3DZL A;  3FZW A;  1N5P A;  1RSN A;  2W03 A;  3AHS A;  2XFS A;  2Z76 A;  2RGQ A;  4GHO A;  2QEX 3;  8RNT A;  3RGA A;  4OVM A;  2KRT A;  3KZT A;  3CC2 3;  3NXJ A;  1C7H A;  2XFT A;  1A2P A;  2HMO B;  4L8P A;  1SJW A;  1GYB A;  1TJD A;  5EEO A;  3UB1 A;  5A0O B;  1OGX A;  2FXT A;  1PFP A;  2CWV A;  1UCL A;  3K7C A;  3WHO A;  5AIH A;  3HI7 A;  1TFK A;  1W6Y A;  1I2G A;  3PXM A;  3URP A;  3D4A A;  3DXO A;  5AI1 A;  2O3O A;  3F9S A;  3UJM A;  2CHC A;  1WMO A;  4KFD A;  1MGR A;  2IUK A;  3X3X A;  2BT3 A;  1UI8 A;  1B21 A;  2B24 B;  1OHO A;  2P09 A;  2XEP A;  1UGH I;  4EV5 A;  3WA2 X;  1IK3 A;  4K1U A;  1RHL A;  1X1Y A;  2ZL8 A;  1EKM A;  1T2H A;  5AEW B;  5BIR A;  2KAA A;  3SED A;  1JKG A;  1IV7 A;  4LEH A;  4HVN A;  4L7K A;  2WOH A;  1CQS A;  2QIY A;  1UUV B;  2RBI A;  3F7X A;  1K28 A;  3LTD A;  5LC6 A;  3DY5 A;  4HM0 B;  2K54 A;  3CMA 3;  3EX9 A;  5EQL A;  3PYJ A;  1RGC A;  4L8O A;  2MF7 A;  1BSA A;  2HOH A;  5G1K A;  4WP5 A;  5JPU A;  1KSI A;  2F99 A;  2XH9 A;  4QWT A;  4HZ9 B;  1IQX A;  1GY6 A;  4WFO A;  4BL2 A;  2GBW B;  5IW9 A;  2CX0 A;  3WMD A;  1UDI I;  3DGO A;  2CFK A;  1AQZ A;  3F8X A;  3T8N A;  4TX4 A;  1TRP A;  1E3V A;  3SLU A;  2KF3 A;  3KII A;  3LZA A;  3X3Y A;  3B4P A;  5AIG A;  2CKF B;  1LQM B;  2HMK B;  2SAR A;  2O9U X;  4J5G A;  3DGN A;  1AVK A;  1GOY A;  2W56 A;  2W04 A;  6GSP A;  3S27 A;  2W9Q A;  3G16 A;  3OXA A;  5CK6 A;  1IT7 A;  1MNL A;  5AEU B;  1GOU A;  1DVC A;  3SVA A;  2P38 A;  5IEO A;  1BSE A;  1O7H B;  2YFJ B;  1TUH A;  4DKI A;  4WYK B;  1BNJ A;  2Z7A A;  1NDO B;  3K5T A;  3NX0 A;  3CCL 3;  4KFE A;  1SQW A;  4I5Q A;  1GSP A;  1I3I A;  1Q9E A;  3DGM A;  4ILF A;  3KN4 A;  1DVD A;  1QAK A;  3CNM A;  4AEQ A;  5HOH A;  2XSO B;  1DE3 A;  1L5G B;  6RNT A;  1E97 A;  1OHS A;  3V92 A;  4KZ1 A;  1WQL B;  1YGE A;  2Y73 A;  7GSP A;  3I0Y A;  1GMP A;  1JBT A;  3CPO A;  1FGQ A;  1B3S A;  2R4I A;  1B2M A;  1IDP A;  3CCV 3;  1DMM A;  1Q42 A;  1RGF A;  3B4O A;  4HYZ A;  3HK4 A;  4STD A;  1IT8 A;  2BU4 A;  2Q07 A;  4MMX B;  5AIF A;  1FGR A;  3PCS A;  4XDV A;  1B2Z A;  2XGL A;  3MKI A;  1T2I A;  5AYS C;  3EN1 B;  3FG4 A;  3IMA B;  1IVU A;  1SIH A;  5KP1 A;  4HM3 B;  4KFF A;  1OUN A;  3KE7 A;  1STD A;  2CC3 A;  3G71 3;  2CFL A;  4R9K A;  3D5I A;  3HX8 A;  1SII A;  1N5H A;  1YGW A;  3L0R A;  3OWY A;  3JUO A;  3X41 A;  3CC4 3;  1R4C A;  2F98 A;  3CME 3;  1UUW B;  1LOY A;  3H51 A;  3ZG0 A;  1YHQ 3;  2QGU A;  3PS8 A;  4R1K A;  4FMA A;  1YNV X;  2ZDJ A;  1QMA A;  3FKA A;  4IIA A;  1AY7 A;  3JVC A;  2ZHX B;  1VQ8 3;  1FGT A;  1T5Y A;  1M1X B;  3G8Z A;  4RNT A;  3CPW 2;  3BNE A;  1M9G A;  1JV2 B;  3DUK A;  3PCR A;  1IQ8 A;  2WGO A;  3LYG A;  2C10 A;  2OQE C;  3FLJ A;  1RGG A;  2CG0 A;  5M18 A;  1UW1 A;  2BMO B;  1OF5 A;  2AAE A;  1RRL A;  2CFG A;  2H0H A;  1FA3 A;  3SXX A;  1BUJ A;  4JRF A;  4O02 B;  3N54 B;  1GY5 A;  1EUI C;  2LYX A;  1D6Y A;  1BNI A;  1I70 A;  1RGK A;  4IPB A;  5CLK A;  1CEW I;  2RSX A;  3BU4 A;  3NQZ A;  1BSC A;  1YIT 3;  2UGI A;  1HYF A;  1ULJ B;  2XGN A;  3HII A;  3HOH A;  4H3U A;  3MG1 A;  1OPY A;  1QVG 2;  4O2H A;  1VQ7 3;  5CF2 A;  1PU4 A;  2K0M A;  1Q7Y 4;  3OWU A;  1FGO A;  1UCJ A;  2ML6 A;  2P05 A;  4HOH A;  1T3B A;  1ULI B;  3AMO A;  5JPP A;  2JDI H;  3GZB A;  1FUS A;  1E3R A;  2ZA4 A;  4GB5 A;  4RNZ A;  1O7G B;  3V99 A;  1QAF A;  2C4B A;  2H0G A;  4NPB A;  5I97 A;  2IYJ A;  2OOV C;  4LMI A;  4N6O B;  2BIR A;  3O8Y A;  1N9J A;  1Q40 A;  4EBG A;  1VQM 3;  1EA2 A;  4I4K A;  1FW7 A;  4BL3 A;  1BU4 A;  2H0I A;  3QRD A;  1F8N A;  4HM2 B;  1UGI A;  1WMN A;  2KF4 A;  3WOD G;  1CYU A;  3DH2 A;  4K1V A;  2HMM B;  3BLZ A;  3D9R A;  3LH4 A;  1RMS A;  1VQL 3;  2Z77 A;  1RGL A;  1YI2 3;  1BRS A;  1JBR A;  1US1 A;  3H3H A;  5M19 A;  4HZB B;  5HGR A;  1YJN 3;  1HZ1 A;  1YJW 3;  1Q7H A;  3J7Y d;  1ZGX A;  2L1S A;  2INX A;  7RNT A;  3VF1 A;  3GRD A;  1WMP A;  4R9L A;  4MJD A;  3N9H A;  4EXR A;  4J5K A;  1R4Y A;  4H61 A;  3FF0 A;  3LXU X;  5BVB A;  4KVH A;  4WWU C;  9RNT A;  1HKX A;  1CYV A;  1LOV A;  1RGE A;  2BNG A;  1MWT A;  3Q2P A;  3MHE A;  3GSP A;  4N3V A;  1IV9 A;  4GL6 A;  1K41 A;  4MMY B;  3RDE A;  3CCU 3;  1GOV A;  2KF6 A;  2STD A;  4K90 B;  2V1L A;  4HM5 B;  2OCT A;  1LNH A;  1K8A 4;  3AHW A;  1MOL A;  5D83 A;  4HJL B;  3K63 A;  3NV0 B;  1KD1 4;  4HM8 B;  1JB5 A;  1RJO A;  3NQY A;  1A90 A;  3GZX B;  5DRV A;  1RDS A;  1JB4 A;  1X1U A;  2WOF A;  3K0Z A;  3UNL A;  4LZI A;  1JBS A;  2SBL A;  3CCE 3;  4MMZ B;  4O3V A;  1I3F A;  3MWZ A;  1AVL A;  3CCR 3;  5IER A;  4CJN A;  2MC8 A;  3EB8 A;  4XB5 A;  4LSO A;  2IUJ A;  2E2V A;  5M1A A;  4RZM A;  3VSY A;  1IVW A;  3LTC A;  1BRK A;  1TFO A;  4FCM A;  3RNT A;  1C54 A;  3QK9 A;  3IPT A;  4XBY A;  1STF I;  1UCI A;  1JN5 B;  1NO3 A;  4EW5 A;  5JBS A;  1JRQ A;  4J8T A;  3CCJ 3;  3FCS B;  4ORL A;  1G02 A;  4BIR A;  1BGS A;  2K3D A;  4BTX A;  1I8V A;  2RCD A;  1J2B A;  2F5W A;  1FYS A;  5IF6 A;  4EV2 A;  3CXC 2;  5IEP A;  1GMR A;  1I2F A;  1W2Z A;  2OTL 3;  1QAL A;  5KP4 A;  4R4K A;  2HML B;  3ZG5 A;  1RCL A;  2F86 B;  3E99 A;  3I56 3;  1BRH A;  1FGM A;  4BTY A;  3KCH A;  2GU1 A;  1W01 A;  2RFR A;  1RN4 A;  2GXF A;  1RN7 A;  2KXG A;  1VQN 3;  4HM6 B;  2PNC A;  1BNG A;  2GEX A;  3GWR A;  3V98 A;  3X3Z A;  5GSP A;  1VQK 3;  1UCK A;  1Q81 4;  2Z6B A;  1TU5 A;  1LNI A;  1O7P B;  1QJG A;  4EC6 A;  1QVF 2;  2P0X A;  4JF8 A;  1BSB A;  1LRA A;  3LTA A;  1OCV A;  2BO9 B;  3F14 A;  3FG1 A;  4NHF A;  4X2H A;  1V74 A;  3U1W A;  1UUG B;  3UL6 A;  1VQ6 3;  1EEJ A;  1ZX2 A;  1HU9 A;  3AGN A;  2HMN B;  3A5E A;  2CW9 A;  4FMB A;  3CC7 3;  3CU3 A;  2KF5 A;  1OAC A;  4OK0 A;  4R80 A;  4KT3 B;  1GY7 A;  3ECF A;  3S67 A;  3NBR A;  1TRQ A;  1RCK A;  1B2X A;  3MSO A;  2YFL B;  5STD A;  2ML5 A;  3FGY A;  1M1K 4;  2XRX B;  2GSP A;  3NUV A;  3S29 A;  1S5A A;  3G0K A;  1JZO A;  3GZY B;  2W2C A;  3MYT A;  4WYK A;  5EVH A;  1UI7 A;  4G1M B;  3MG3 A;  1BVI A;  1ROV A;  3S28 A;  2I9W A;  2LQV A;  4X2O A;  1KWI A;  1LOW A;  3BB9 A;  3OWS A;  4U13 A;  5IG5 A;  2W9P A;  1RKY A;  3FF2 A;  1NB5 I;  1A2V A;  1BAN A;  4FMD A;  5D81 A;  1Q86 4;  2J8X B;  3EBY A;  2CWT A;  3DGL A;  3HIG A;  5D82 A;  3X42 A;  2GU3 A;  1KQS 2;  1MWS A;  4GSP A;  1RNB A;  1VQ5 3;  1BNE A;  3N8B A;  3LTB A;  3SYU A;  1JKG B;  1NJI 4;  2FNQ A;  2M7O A;  4FMC A;  3NHX A;  2BMR B;  1BRI A;  1SAR A;  4WHA A;  3WOF B;  2CG1 A;  3LOY A;  3D5G A;  1MWU A;  3ALA A;  1LVN A;  1DET A;  3FH1 A;  4O8S A;  3BNC A;  5G1L A;  1YIJ 3;  2CH9 A;  1I0X A;  1U5O A;  3JUM A;  1K9M 4;  1IVV A;  3Q1C A;  2BMQ B;  4IT7 A;  3DMC A;  3PZW A;  4N6V 0;  1V58 A;  1W7C A;  4CDL A;  1YVB I;  1RLS A;  3T0U A;  2WO0 A;  5KP3 A;  1W6G A;  2CWU A;  3KSP A;  1B2U A;  3OX9 A;  3BNB A;  1VQ4 3;  3F7S A;  2XF3 A;  1Q82 4;  3DM8 A;  2W56 B;  1VQO 3;  1G96 A;  4MEI A;  1OH0 A;  1O7W B;  1IVX A;  1D6Z A;  2GBX B;  2YX9 A;  3EBT A;  3MPH A;  1IU7 A;  1RNT A;  3Q90 A;  2D1W A;  5IG4 A;  1OHP A;  1RGH A;  3JUP A;  1BUQ A;  1NNV A;  3EE1 A;  3NBB A;  3F40 A;  4N6T A;  1GMQ A;  2A15 A;  3KSE D;  5RNT A;  1SPU A;  3RGR A;  3D3L A;  3UL5 A;  4AKZ A;  3KFQ C;  1EG9 B;  2UX0 A;  4BU4 A;  2BHM A;  4RNY A;  3I55 3;  1RRH A;  3ER7 A;  1JZD A;  1D6U A;  1GD4 A;  1NWW A;  1O7M B;  1YVS A;  1B27 A;  3HZP A;  3TDG A;  1OGZ A;  4HBR A;  3EQQ B;  1MWR A;  1TIJ A;  3Q3F A;  4LGQ A;  1TTO A;  1NU3 A;  3ZFZ A;  4EYC A;  2QA4 3;  5CXO A;  1JJ2 2;  4N6M A;  3EF8 A;  1K73 4;  4N6U A;  1FUW A;  1GS3 A;  1W6C A;  1LQG C;  2E2T A;  3MG2 A;  4NRE A;  3WDG B;  3NM7 A;  2AAD A;  1VQP 3;  1B2S A;  1G0T A;  2FGT A;  4XBT A;  5ELU A;  3G6E 3;  4CPK A;  4LYL B;  2IA7 A;  2PZV A;  1DMN A;  4HM4 B;  2P0M A;  1X1X A;  3CCS 3;  1W4N A;  1V57 A;  5BXQ A;  3STD A;  2R41 A;  1IYY A;  4FCZ A;  4FCJ A;  2CK3 H;  1BRG A;  3SOY A;  3WR2 A;  2CFD A;  1ZS7 A;  1ASK A;  1B20 A;  3WOE B;  5AII A;  1O7N B;  1BRJ A;  5FW5 A;  5IG0 A;  3EHC A;  2F5M A;  1LOX A;  1GD3 A;  1N9E A;  1PYL A;  5FGO A;  2F56 A;  3AGO A;  4HM1 B;  1LXE A;  3F8H A;  2OWP A;  4AKY A;  3BIR A;  3EC9 A;  1W2B 2;  1I0V A;  1NB3 I;  1W5Z A;  3X40 A;  7STD A;  3JUN A;  1TP6 A;  1N8R 4;  4XDW A;  1Z1S A;  2C11 A;  3ROB A;  4BTW A;  4XM4 A;  5AYR B;  4OUQ A;  4CCV A;  1BNF A;  1OF5 B;  2L4V A;  1N8Q A;  1X1W A;  1Y4K A;  1KC8 4;  1ISK A;  1YJ9 3;  5DRE A;  1JNQ A;  1ROA A;  3PGB A;  4HKV B;  1BOX A;  5CF1 A;  1JB2 A;  1VZZ A;  2IMJ A;  3WA3 A;  1AV4 A;  2OTJ 3;  3CD6 3;  3B7C A;  5ELJ A;  3NBJ A;  5TGN A;  3JUQ A;  8CHO A;  3CNX A;  4N6N B;  2CIU A;  1A2K A;  3U97 A;  1VQ9 3;  1BNS A;  1I2E A;  2XSH B;  1PY3 A;  3GAX A;  3NV0 A;  3SX1 A;  1WNH A;  2IY2 A;  4FR9 A;  1AR0 A;  4N6L A;  3K9M C;  1DYU A;  1VQQ A;  2GEY A;  3M8C A;  2W0Q A;  3VGN A;  3G4S 3;  2OQE A;  5LC7 A;  3AMO B;  1EQK A;  2CFW A;  1BAO A;  3EN8 A; 
#chains in the Genus database with same CATH homology
 5IEN A;  3SOA A;  1ZO2 A;  2JQ5 A;  3LT9 A;  3B8L A;  3OV4 A;  2D42 A;  4Q53 A;  3CCM 3;  2W6J H;  3FSD A;  1Q40 B;  3KKG A;  3T8U A;  1JN5 A;  2KCD A;  1W00 A;  3EJV A;  1IQY A;  4HM7 B;  2YFI B;  5G2G A;  2XR8 B;  3IJE B;  2HMJ B;  3NM2 A;  3LML A;  1S72 3;  3LT8 A;  3S5C A;  3GZR A;  5IG3 A;  4ZM8 A;  4K61 A;  4PEJ A;  1A67 A;  4XBX A;  6STD A;  4RBN A;  1W02 A;  3CCQ 3;  2WGQ A;  4J9A A;  1WTH A;  3FG3 A;  1U8C B;  2OOV A;  1M90 4;  2E2U A;  3A76 A;  3OW2 2;  2B1X B;  2Y74 A;  1DMQ A;  3BND A;  3DZL A;  3FZW A;  1N5P A;  2W03 A;  4MEI A;  4R9K A;  2XFS A;  2Z76 A;  2RGQ A;  2QEX 3;  3RGA A;  4OVM A;  2KRT A;  3KZT A;  3CC2 3;  3NXJ A;  1C7H A;  2XFT A;  4L8P A;  2HMO B;  1SJW A;  1GYB A;  5EEO A;  3UB1 A;  5A0O B;  1OGX A;  2FXT A;  1PFP A;  2CWV A;  3K7C A;  5AIH A;  3HI7 A;  1TFK A;  1W6Y A;  3PXM A;  5AI1 A;  3DXO A;  2O3O A;  3F9S A;  3UJM A;  2CHC A;  1WMO A;  4KFD A;  2IUK A;  3X3X A;  2BT3 A;  1UI8 A;  2B24 B;  1OHO A;  2P09 A;  2XEP A;  4EV5 A;  1IK3 A;  4K1U A;  2ZL8 A;  5AEW B;  1EKM A;  3SED A;  1JKG A;  1IV7 A;  4LEH A;  4HVN A;  4L7K A;  2WOH A;  1CQS A;  2QIY A;  1UUV B;  3F7X A;  1K28 A;  3LTD A;  5LC6 A;  3DY5 A;  4HM0 B;  2K54 A;  3CMA 3;  3EX9 A;  5EQL A;  3PYJ A;  4L8O A;  2MF7 A;  5JPU A;  4WP5 A;  1KSI A;  2XH9 A;  2F99 A;  4QWT A;  4HZ9 B;  1IQX A;  1GY6 A;  4WFO A;  2GBW B;  5IW9 A;  3WMD A;  3DGO A;  2CFK A;  3F8X A;  3T8N A;  4TX4 A;  1E3V A;  3SLU A;  3KII A;  3LZA A;  3X3Y A;  3B4P A;  5AIG A;  2CKF B;  2HMK B;  2O9U X;  3DGN A;  1AVK A;  2W56 A;  2W04 A;  3S27 A;  2W9Q A;  3G16 A;  3OXA A;  5CK6 A;  1IT7 A;  1MNL A;  5AEU B;  1DVC A;  3SVA A;  2P38 A;  5IEO A;  1O7H B;  2YFJ B;  1TUH A;  4WYK B;  2Z7A A;  1NDO B;  3K5T A;  3NX0 A;  3CCL 3;  4KFE A;  1SQW A;  3DGM A;  3KN4 A;  1DVD A;  1QAK A;  3CNM A;  4AEQ A;  2XSO B;  1L5G B;  1E97 A;  1OHS A;  3V92 A;  4KZ1 A;  1WQL B;  1YGE A;  2Y73 A;  3I0Y A;  3CPO A;  1FGQ A;  2R4I A;  1IDP A;  3CCV 3;  1DMM A;  1Q42 A;  3B4O A;  4HYZ A;  3HK4 A;  4STD A;  1IT8 A;  2Q07 A;  4MMX B;  5AIF A;  1NJI 4;  1FGR A;  3PCS A;  4XDV A;  2XGL A;  3MKI A;  5AYS C;  3EN1 B;  3FG4 A;  3IMA B;  1IVU A;  1SIH A;  5KP1 A;  4HM3 B;  4KFF A;  1OUN A;  3KE7 A;  1STD A;  2CC3 A;  3G71 3;  2CFL A;  3HX8 A;  1SII A;  1N5H A;  3L0R A;  3OWY A;  3JUO A;  3X41 A;  3CC4 3;  1R4C A;  2F98 A;  3CME 3;  1UUW B;  3H51 A;  1YHQ 3;  2QGU A;  3PS8 A;  4R1K A;  4FMA A;  2ZDJ A;  1QMA A;  3FKA A;  4IIA A;  3JVC A;  1VQ8 3;  1FGT A;  1T5Y A;  1M1X B;  3G8Z A;  3CPW 2;  3BNE A;  1M9G A;  1JV2 B;  3DUK A;  3PCR A;  1IQ8 A;  2WGO A;  3LYG A;  2C10 A;  2OQE C;  3FLJ A;  2CG0 A;  1UW1 A;  2BMO B;  1OF5 A;  1RRL A;  2CFG A;  1FA3 A;  3SXX A;  4JRF A;  4O02 B;  3N54 B;  1GY5 A;  2LYX A;  1D6Y A;  4IPB A;  5CLK A;  1CEW I;  2RSX A;  3NQZ A;  1YIT 3;  1ULJ B;  2XGN A;  3HII A;  4H3U A;  3MG1 A;  1OPY A;  1QVG 2;  4O2H A;  1VQ7 3;  5CF2 A;  1PU4 A;  2K0M A;  1Q7Y 4;  3OWU A;  1FGO A;  2ML6 A;  2P05 A;  1ULI B;  3AMO A;  5JPP A;  2JDI H;  3GZB A;  1E3R A;  4GB5 A;  4RNZ A;  1O7G B;  3V99 A;  1QAF A;  5I97 A;  2OOV C;  4LMI A;  4N6O B;  1VQM 3;  4EBG A;  3O8Y A;  1N9J A;  1Q40 A;  1EA2 A;  4I4K A;  3QRD A;  1F8N A;  4HM2 B;  1WMN A;  3WOD G;  1CYU A;  4K1V A;  2HMM B;  3BLZ A;  3D9R A;  3LH4 A;  1VQL 3;  2Z77 A;  1YI2 3;  1US1 A;  3H3H A;  4HZB B;  5HGR A;  1YJN 3;  1YJW 3;  3J7Y d;  2INX A;  3GRD A;  1WMP A;  4R9L A;  4MJD A;  3N9H A;  4EXR A;  4H61 A;  3FF0 A;  3LXU X;  5BVB A;  4KVH A;  4WWU C;  1HKX A;  1CYV A;  2BNG A;  3Q2P A;  3MHE A;  4N3V A;  1IV9 A;  4GL6 A;  1K41 A;  4MMY B;  3RDE A;  3CCU 3;  2STD A;  4K90 B;  2V1L A;  4HM5 B;  2OCT A;  1LNH A;  1K8A 4;  1MOL A;  5D83 A;  4HJL B;  3K63 A;  3NV0 B;  1KD1 4;  4HM8 B;  1JB5 A;  1RJO A;  3NQY A;  1A90 A;  3GZX B;  5DRV A;  1JB4 A;  2WOF A;  3K0Z A;  3UNL A;  4LZI A;  2SBL A;  3CCE 3;  4MMZ B;  4O3V A;  3MWZ A;  3CCR 3;  1AVL A;  5IER A;  2MC8 A;  3EB8 A;  4XB5 A;  4LSO A;  2IUJ A;  2E2V A;  3VSY A;  4RZM A;  1IVW A;  3LTC A;  1TFO A;  4FCM A;  3QK9 A;  3IPT A;  4XBY A;  1STF I;  1JN5 B;  1NO3 A;  5JBS A;  1JRQ A;  4J8T A;  3CCJ 3;  3FCS B;  4ORL A;  4BTX A;  2RCD A;  1J2B A;  5IF6 A;  4EV2 A;  3CXC 2;  5IEP A;  1W2Z A;  2OTL 3;  1QAL A;  5KP4 A;  4R4K A;  2HML B;  2F86 B;  3E99 A;  3I56 3;  1FGM A;  4BTY A;  2GU1 A;  1W01 A;  2RFR A;  2GXF A;  1RN7 A;  2KXG A;  1VQN 3;  4HM6 B;  2PNC A;  2GEX A;  3GWR A;  3X3Z A;  3V98 A;  1Q81 4;  1VQK 3;  2Z6B A;  1TU5 A;  1QJG A;  1O7P B;  4EC6 A;  1QVF 2;  2P0X A;  4JF8 A;  3WA2 X;  3LTA A;  1OCV A;  2BO9 B;  3F14 A;  3FG1 A;  4NHF A;  4X2H A;  1V74 A;  3U1W A;  3VF1 A;  3UL6 A;  1VQ6 3;  1HU9 A;  1ZX2 A;  4FMB A;  2HMN B;  3CC7 3;  2CW9 A;  3CU3 A;  4OK0 A;  1OAC A;  4R80 A;  1GY7 A;  3ECF A;  3S67 A;  3NBR A;  3MSO A;  2YFL B;  5STD A;  2ML5 A;  3FGY A;  1M1K 4;  2XRX B;  3NUV A;  3S29 A;  1S5A A;  3G0K A;  3GZY B;  3MYT A;  2W2C A;  4WYK A;  5EVH A;  1UI7 A;  4G1M B;  3MG3 A;  1ROV A;  3S28 A;  2I9W A;  2LQV A;  4X2O A;  1KWI A;  3BB9 A;  3OWS A;  4U13 A;  5IG5 A;  2W9P A;  1RKY A;  3FF2 A;  1NB5 I;  1A2V A;  4FMD A;  5D81 A;  1Q86 4;  3EBY A;  3X42 A;  2CWT A;  3DGL A;  3HIG A;  5D82 A;  2GU3 A;  1KQS 2;  1VQ5 3;  3N8B A;  3LTB A;  1JKG B;  2FNQ A;  2M7O A;  4FMC A;  3NHX A;  2BMR B;  4WHA A;  3WOF B;  2CG1 A;  3LOY A;  3ALA A;  1LVN A;  3FH1 A;  4O8S A;  3BNC A;  1YIJ 3;  2CH9 A;  3JUM A;  1U5O A;  1K9M 4;  1IVV A;  3Q1C A;  2BMQ B;  4IT7 A;  3DMC A;  3PZW A;  4N6V 0;  1W7C A;  4CDL A;  1YVB I;  3T0U A;  2WO0 A;  5KP3 A;  1W6G A;  2CWU A;  3KSP A;  3OX9 A;  1VQ4 3;  3BNB A;  3F7S A;  2XF3 A;  1Q82 4;  3DM8 A;  2W56 B;  1VQO 3;  1G96 A;  1OH0 A;  1O7W B;  1IVX A;  1D6Z A;  2GBX B;  2YX9 A;  3EBT A;  3MPH A;  1IU7 A;  3Q90 A;  2D1W A;  5IG4 A;  1OHP A;  3JUP A;  1BUQ A;  3EE1 A;  3NBB A;  3F40 A;  4N6T A;  2A15 A;  3KSE D;  1SPU A;  3RGR A;  3D3L A;  3UL5 A;  4AKZ A;  3KFQ C;  1EG9 B;  2UX0 A;  2BHM A;  4RNY A;  3I55 3;  1RRH A;  3ER7 A;  1D6U A;  1GD4 A;  1NWW A;  1O7M B;  3HZP A;  3TDG A;  1OGZ A;  4HBR A;  3EQQ B;  1TIJ A;  4LGQ A;  1NU3 A;  4EYC A;  2QA4 3;  1JJ2 2;  5CXO A;  4N6M A;  3EF8 A;  1K73 4;  4N6U A;  1FUW A;  1GS3 A;  1W6C A;  2E2T A;  3MG2 A;  4NRE A;  3WDG B;  3NM7 A;  1VQP 3;  2FGT A;  4XBT A;  5ELU A;  3G6E 3;  2IA7 A;  2PZV A;  1DMN A;  4HM4 B;  2P0M A;  3CCS 3;  1W4N A;  5BXQ A;  3STD A;  4FCZ A;  4FCJ A;  2CK3 H;  3SOY A;  2CFD A;  1ASK A;  3WOE B;  5AII A;  1O7N B;  5FW5 A;  5IG0 A;  3EHC A;  1LOX A;  1GD3 A;  1N9E A;  5FGO A;  4HM1 B;  1LXE A;  3F8H A;  2OWP A;  4AKY A;  3EC9 A;  1W2B 2;  1W5Z A;  1NB3 I;  3X40 A;  7STD A;  3JUN A;  1TP6 A;  1N8R 4;  4XDW A;  1Z1S A;  2C11 A;  3ROB A;  4BTW A;  4XM4 A;  5AYR B;  4OUQ A;  4CCV A;  1OF5 B;  2L4V A;  1N8Q A;  1Y4K A;  1KC8 4;  1ISK A;  1YJ9 3;  5DRE A;  1JNQ A;  1ROA A;  3PGB A;  4HKV B;  5CF1 A;  1JB2 A;  1VZZ A;  2IMJ A;  3WA3 A;  1AV4 A;  2OTJ 3;  3CD6 3;  3B7C A;  5ELJ A;  3NBJ A;  5TGN A;  3JUQ A;  8CHO A;  3CNX A;  4N6N B;  2CIU A;  1A2K A;  3U97 A;  1VQ9 3;  2XSH B;  3SX1 A;  3GAX A;  3NV0 A;  1WNH A;  4FR9 A;  1AR0 A;  4N6L A;  3K9M C;  1DYU A;  2GEY A;  3M8C A;  3VGN A;  2W0Q A;  3G4S 3;  2OQE A;  5LC7 A;  3AMO B;  1EQK A;  2CFW A;  3EN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...