1OH0A

Crystal structure of ketosteroid isomerase complexed with equilenin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title High-Resolution Crystal Structures of Delta5-3-Ketosteroid Isomerase with and without a Reaction Intermediate Analogue
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1oh0A00
1K41A 1GYBA 3F8XA 4Q53A 1O7PB 1OPYA 3MYTA 3FSDA 3KZTA 1GS3A 2B24B 2HMNB 3B8LA 4L8OA 5BVBA 3NUVA 1O7WB 4L8PA 3NBRA 1E3RA 1W02A 1OF5A 4LMIA 3EBYA 4R1KA 3JUNA 5JPPA 3JUQA 2RCDA 1Q40B 3OWYA 4XM4A 1OF5B 3NM2A 1OH0A 3HK4A 4OUQA 1OHSA 2UX0A 2XRXB 3DZLA 2F99A 1HKXA 3JUMA 4HKVB 2QIYA 3EJVA 4HJLB 3EX9A 3A76A 1NWWA 3EBTA 5KP1A 2CKFB 1BUQA 5CF2A 1JB2A 5CLKA 3EHCA 5KP4A 3RGRA 3G0KA 1U5OA 3B4PA 3GRDA 4MJDA 2YFJB 2INXA 1ISKA 5IEPA 3EQQB 4WWUC 1ULJB 1GY6A 3OV4A 5CK6A 3H3HA 1DMNA 1NDOB 3DUKA 3DXOA 1ULIB 4HZ9B 2XR8B 3I0YA 5FW5A 5AIFA 5IF6A 5IEOA 3FLJA 1ASKA 4HM2B 4N3VA 1QJGA 3SOAA 5TGNA 1O7HB 5IG3A 2R4IA 5IG0A 3EN1B 3H51A 1AR0A 2HMOB 3EF8A 4RZMA 3S5CA 1UUVB 4HVNA 2BMQB 3MG3A 5JPUA 1NU3A 3B7CA 1E3VA 5AEWB 2I9WA 4K1VA 4X2OA 3F40A 2CHCA 5STDA 2A15A 4R9KA 2HMKB 3LYGA 1JN5A 1OGZA 5D83A 3WMDA 4GB5A 4XDVA 3MG1A 2Z77A 5CXOA 5KP3A 4J8TA 3GZXB 3K0ZA 2HMMB 3DMCA 4HM4B 4R9LA 3E99A 7STDA 4I4KA 4HM8B 3F7XA 3F14A 3OX9A 1WQLB 4PEJA 2HMJB 4FCMA 4XBTA 3UNLA 5HGRA 2BMOB 1E97A 2Z7AA 3K7CA 4HM0B 4L7KA 4K1UA 3NHXA 4U13A 5EVHA 4ORLA 1TUHA 2GBXB 3OWSA 3FZWA 4HM1B 5IERA 3BLZA 3F9SA 4STDA 3CNMA 2B1XB 4H3UA 1GY5A 3HX8A 8CHOA 4XBYA 4WYKA 3SOYA 1JKGA 1IDPA 2F98A 3GZRA 4HM5B 3VGNA 5DREA 3F8HA 5D82A 2QGUA 2F86B 3FH1A 2RFRA 2RGQA 1TP6A 4J9AA 3MKIA 4CDLA 5IG4A 5AI1A 5AIGA 5AEUB 3CPOA 2GXFA 4WP5A 1EA2A 1W00A 2GEYA 3DM8A 2OWPA 3LZAA 5BXQA 1JB5A 1OUNA 3CU3A 3FGYA 5CF1A 3ECFA 3KE7A 4IIAA 3NXJA 3KKGA 3MSOA 3EN8A 1A2KA 1DMQA 1ZX2A 1OCVA 1S5AA 1JN5B 3FF2A 3T8UA 3ER7A 2PZVA 4FCJA 1UUWB 3UJMA 4HZBB 3FF0A 1OGXA 4HM6B 3B4OA 1Q40A 4HM7B 1GY7A 2W2CA 1STDA 1Q42A 1OHPA 3ROBA 3IPTA 1Z1SA 3FKAA 1CQSA 4HM3B 1DMMA 3D9RA 1W01A 3CNXA 2GBWB 3JUPA 1QMAA 2XSOB 6STDA 2YFIB 2XSHB 3G8ZA 1O7MB 2BNGA 5IENA 3RGAA 2K54A 2Z76A 5AIHA 3HZPA 1C7HA 3MG2A 3M8CA 3BB9A 3GWRA 4XDWA 5D81A 4XB5A 4XBXA 3Q90A 5AIIA 5DRVA 3STDA 4LGQA 3JUOA 3VSYA 3NV0A 2GEXA 4LEHA 4OVMA 4WYKB 1JKGB 3GZYB 2IMJA 2JQ5A 3G16A 3NV0B 1O7GB 1EG9B 1O7NB 3GZBA 1W6YA 2YFLB 2STDA 1JB4A 1VZZA 3KSPA 5G2GA 4X2HA 3F7SA 1ZO2A 3MHEA 3OXAA 4KVHA 3OWUA 5IG5A 1SJWA 2HMLB 1OHOA 3T8NA 3SEDA 3EC9A 2BMRB
chains in the Genus database with same CATH superfamily
8RNTA 3HIGA 1TJDA 2W6JH 1K41A 1X1XA 1GYBA 1K734 3F8XA 4Q53A 1O7PB 2CX0A 1OPYA 2OCTA 2PNCA 1BAOA 3WR2A 1WMPA 3MYTA 1R4YA 3FSDA 3KZTA 4FMDA 2OQEA 2W04A 1GS3A 2B24B 5AYRB 5BU4A 2HMNB 3B8LA 3KIIA 1B2SA 4L8OA 5BVBA 3NUVA 4AEQA 1O7WB 1V57A 4L8PA 4N6MA 2GU1A 2CK3H 3O8YA 3VF1A 3GSPA 1LOYA 3NBRA 5G1KA 4EC6A 1E3RA 1W02A 1VQ63 3UL6A 1M1XB 3U97A 4FMCA 4RNZA 1FGQA 2OOVA 2IUJA 1OF5A 4LMIA 2WOFA 3EBYA 2Q07A 4R1KA 1BUJA 3JUNA 1HZ1A 3AGNA 5JPPA 3JUQA 4HBRA 3BNEA 4JF8A 2CG1A 1RKYA 2RCDA 2FNQA 1Q40B 3OWYA 4XM4A 1GMRA 1OF5B 4HYZA 3WHOA 1QVG2 4ILFA 3NM2A 1W2ZA 1OH0A 2C11A 4MMZB 2CFWA 3U1WA 3HK4A 4OUQA 3KSED 1OHSA 2H0GA 2CW9A 2GSPA 3D5IA 1PFPA 2UX0A 3PZWA 2ZDJA 2XRXB 3DZLA 1VQK3 3CD63 3Q3FA 1I2GA 3CCU3 2F99A 3FG4A 2YX9A 1HKXA 1T2IA 1AY7A 2M7OA 3JUMA 4HKVB 2QIYA 2CIUA 3EJVA 1W4NA 5AYSC 1NNVA 4G1MB 3S29A 3N8BA 1RMSA 1UDII 3G6E3 3CME3 3CCQ3 4HJLB 2BO9B 4WFOA 3EX9A 3IJEB 3A76A 1NWWA 1LOXA 3EBTA 3NBJA 4EW5A 5KP1A 2K0MA 2RNTA 3G4S3 1UW1A 2CKFB 1RNTA 1JBSA 1JBTA 1K8A4 1FUWA 1GSPA 4EV2A 1BUQA 1DVCA 5CF2A 1JB2A 5CLKA 3HOHA 3KN4A 4KFDA 2ZHXB 2WOHA 1M904 3QK9A 3EHCA 5KP4A 3RGRA 1GMQA 1YNVX 1A67A 1N8QA 5M1AA 3G0KA 3PGBA 1SQWA 1MWSA 1U5OA 3B4PA 1QAKA 3GRDA 4GHOA 5HOHA 4MJDA 2YFJB 4IPBA 4CCVA 5I97A 1CYVA 2INXA 3NM7A 1ISKA 3DGMA 1QAFA 2FGTA 6GSPA 5IEPA 2CG0A 1LOVA 3PCRA 2F56A 3EQQB 1YHQ3 3A5EA 4WWUC 1ULJB 1GY6A 3CCL3 4AKZA 5EQLA 5EEOA 3OV4A 1I8VA 2LQVA 5CK6A 6RNTA 3S67A 3H3HA 4KFEA 1DMNA 1NB3I 1NDOB 1G0TA 1ULIB 3DUKA 2XR8B 3DXOA 1TRPA 3I0YA 3X40A 1T5YA 5FW5A 2IUKA 4HZ9B 5AIFA 2R41A 2MC8A 3CXC2 4TX4A 5ELJA 5IF6A 1LVNA 2KF4A 5IEOA 3FLJA 1Q7Y4 1ASKA 2CWUA 4HM2B 2Y73A 2KXGA 3CCS3 1FGMA 2IYJA 3V99A 1WNHA 1AQZA 2WGQA 4N3VA 1IU7A 1BNIA 1LNHA 3AHSA 1IT7A 1I2FA 5IW9A 1GD4A 1QJGA 4N6V0 3SOAA 1YI23 4KZ1A 4MEIA 1FYSA 1IYYA 1B2MA 5TGNA 3DH2A 1FGRA 2KAAA 1YJN3 1O7HB 5IG3A 2R4IA 5IG0A 3EN1B 3DGYA 1US1A 2OQEC 1MOLA 1FGOA 2CFDA 2KF5A 3H51A 1AR0A 1PY3A 1W5ZA 2HMOB 3EF8A 3LH4A 4RZMA 3S5CA 3CCJ3 1KC84 3LTCA 1UUVB 1UUGB 3K9MC 4HVNA 4KFFA 3N9HA 1RTUA 2BMQB 2CFKA 4GL6A 1X1UA 3MG3A 1T3BA 4HOHA 4N6TA 5JPUA 1NU3A 1HYFA 2XGLA 3B7CA 3WA3A 1B21A 2OOVC 3AMOA 4R4KA 3S27A 1E3VA 1GD3A 1ZS7A 3WOEB 2I9WA 5AEWB 1BRSA 4K1VA 1LNIA 4X2OA 3F40A 1HU9A 4EBGA 4EYCA 1D6ZA 1B2ZA 2CHCA 3D5GA 5STDA 2P09A 4BL3A 1FA3A 1BRJA 2A15A 4R9KA 1ZGXA 3LT8A 4FR9A 2HMKB 1A2PA 4ZM8A 3LYGA 2FXTA 1DVDA 2D1WA 3AMOB 1JN5A 1OGZA 2UUGC 2W0QA 5LC6A 5D83A 1BRGA 3ZG5A 2H0IA 1BRNL 3DGNA 2BHMA 3WMDA 1RGAA 4GB5A 4XDVA 5GSPA 1BRKA 1Q7HA 2XGNA 2Z77A 1RRLA 1RRHA 3MG1A 5CXOA 1RGKA 5KP3A 2CH9A 2D42A 1X1WA 4J8TA 1IQXA 4MMXB 2KF6A 2SBLA 2ML5A 2KRTA 3DGOA 3BNDA 3GZXB 3Q1CA 1VQ73 1VQ43 1RN4A 3K0ZA 1TRQA 1J2BA 2HMMB 3WDGB 3DMCA 1MGWA 4HM4B 1D6YA 4R9LA 3E99A 2HOHA 1RLSA 4BU4A 3BNBA 1KWIA 2C10A 3UL5A 1GOVA 1UGIA 1W6CA 4BTXA 7STDA 1WTHA 2F4YA 4I4KA 4EV5A 1G02A 4GSPA 4HM8B 3F7XA 4BIRA 3F14A 1RN7A 2CX1A 1IQYA 1BNRA 3OX9A 1WQLB 3IMAB 3WODG 4PEJA 3T0UA 2HMJB 3SLUA 3K63A 2XH9A 4FCMA 1SIHA 2L4VA 2RBIA 4XBTA 3UNLA 3X41A 1VQQA 1YIJ3 5HGRA 2CWVA 2QA43 2BMOB 3CPW2 1FZUA 1E97A 2Z7AA 1RN1A 3K7CA 4HM0B 4N6NB 4L7KA 1BNEA 4K1UA 3NHXA 4R80A 4BTYA 3CCR3 1TFKA 4U13A 1AVLA 1IVVA 5EVHA 1BRHA 1KSIA 2SARA 7GSPA 1YGWA 4ORLA 1TUHA 2GBXB 2BU4A 3OWSA 3FZWA 3X42A 4HM1B 4NHFA 5IERA 3BLZA 3BNCA 3NQZA 1GOYA 1UI8A 3F9SA 2AAEA 4STDA 3MWZA 1M1K4 4EXRA 2C4BA 1U8CB 4I5QA 3CCE3 1I2EA 1JNQA 1UCKA 2O3OA 3CNMA 2B1XB 4H3UA 4K90B 3LOYA 1QVF2 1W2B2 1BNSA 1UCJA 1NO3A 1EUIC 2P0MA 1B2XA 3LTAA 1GY5A 1PU4A 3HX8A 2AADA 2E2UA 3N54B 8CHOA 4XBYA 2F5MA 1C54A 3FG1A 4WYKA 1B27A 4N6OB 1GMPA 3SOYA 1BSCA 1IDPA 1JKGA 2F98A 1YVBI 3GZRA 3KCHA 4DKIA 3D3LA 3KFQC 1RGEA 4HM5B 4RNTA 9RNTA 2QEX3 1FUTA 1Q814 1RSNA 1BNGA 3PCSA 1IK3A 2CFLA 3PS8A 3VGNA 5DREA 5BIRA 1LRAA 1N5HA 2UGIA 3F8HA 4J5GA 3J7Yd 1S723 1JJ22 1VQP3 1LXEA 1TTOA 3Q2PA 5D82A 2QGUA 3CC23 1BVIA 1RGLA 1N5PA 2ZL8A 2F86B 3FH1A 1N8R4 3GAXA 3L0RA 5RNTA 2RFRA 2RGQA 4O8SA 1TP6A 4J9AA 1MWUA 3MKIA 4IT7A 4CDLA 1YJW3 5IG4A 1Y4KA 4WHAA 5AI1A 5AIGA 3WA2X 2V1LA 5LC7A 2XFTA 3CC43 4LSOA 4NREA 5AEUB 1CEWI 3CPOA 2GXFA 4WP5A 1VQL3 5ELUA 1W6GA 1BANA 1D6UA 1EA2A 1K28A 1V58A 1W00A 2GEYA 2ZA4A 3V98A 3MPHA 3DM8A 1EEJA 3ALAA 2OWPA 3X3XA 1IT8A 3LZAA 5BXQA 1JB5A 1BSBA 1OUNA 3CU3A 3FGYA 3LTDA 5CF1A 1N9JA 3AGOA 1KQS2 3ECFA 3KE7A 4IIAA 2BT3A 1UCIA 5FGOA 1N9EA 3NXJA 3SYUA 3D79A 3KKGA 4K61A 2W9PA 1YGEA 3MSOA 2E2TA 1QALA 1A2KA 3EN8A 1DMQA 1UGHI 1ZX2A 1SARA 4BL2A 1VQ83 1UI7A 1OCVA 2Z6BA 1S5AA 1JN5B 3CC73 3FF2A 1JV2B 3SVAA 1KD14 3T8UA 3PXMA 1A2VA 1BU4A 3EB8A 1I70A 3ER7A 1Q824 4H61A 1WMNA 1BNFA 2PZVA 1VQ93 3DY5A 1AVKA 4FCJA 1RDSA 4O02B 1MGRA 4O2HA 1UUWB 3UJMA 4HZBB 3AHWA 4O3VA 3FF0A 1OGXA 3CMA3 4HM6B 1DYUA 3B4OA 1Q40A 3NQYA 3JVCA 1LQGC 1BIRA 2LYXA 2MF7A 2J8XB 1BRIA 4HM7B 4OK0A 1I0VA 1GY7A 2W2CA 2XFSA 4LYLB 1B2UA 1IVXA 2W03A 1STDA 3K5TA 1Q42A 3LTBA 4FMBA 4KT3B 4N6UA 1EQKA 1OHPA 2CFGA 3ROBA 1VQ53 3IPTA 1Z1SA 2JDIH 3FKAA 1LOWA 1OACA 1CQSA 4HM3B 3NBBA 1VQN3 1DMMA 2GU3A 3D9RA 1FUSA 2KF3A 1VQM3 1W01A 3CNXA 2GBWB 1IVWA 3JUPA 3ZFZA 5M18A 2O9UX 1CYUA 1SPUA 1QMAA 1W7CA 2BIRA 2XSOB 1TIJA 6STDA 1IQ8A 1LQMB 2YFIB 1RGHA 2XSHB 4FCZA 1RCKA 3PYJA 4CPKA 4FMAA 2OTJ3 3OW22 4RBNA 1NB5I 3SX1A 1JZOA 3G8ZA 2XEPA 1O7MB 2K3DA 3S28A 1ROAA 1JRQA 1R4CA 2BNGA 5IENA 3RNTA 4AKYA 2XF3A 3D4AA 3RGAA 1NJI4 3HI7A 2K54A 3CCV3 1RNBA 2CC3A 3HIIA 1STFI 3X3ZA 2Z76A 3FCSB 2P0XA 1IVUA 5G1LA 3WOFB 1I3IA 1VQO3 5AIHA 3EE1A 1BNJA 2W9QA 3HZPA 2CWTA 5A0OB 1DE3A 3LT9A 1ROVA 1TU5A 1C7HA 2KCDA 3MG2A 1SIIA 3M8CA 1GOUA 1MWTA 3BB9A 4RNYA 3GWRA 1V74A 1MNLA 3BIRA 2ML6A 2L1SA 4HAAA 2IA7A 4XB5A 4XDWA 4XBXA 3Q90A 5D81A 3UB1A 1B20A 4J5KA 1JZDA 3BU4A 5AIIA 7RNTA 1Q9EA 4QWTA 3RDEA 5DRVA 3LMLA 3STDA 3FG3A 1RGFA 4MMYB 4N6LA 1YJ93 4LGQA 1T2HA 1X1YA 1CH0A 3I563 4LZIA 3TDGA 2OTL3 1RHLA 3JUOA 2W56A 3VSYA 3NV0A 1F8NA 1BSEA 1B3SA 2GEXA 5M19A 1AV4A 1K9M4 4LEHA 4OVMA 4WYKB 2E2VA 3SXXA 2WGOA 1I0XA 4CJNA 4JRFA 1JKGB 1FGTA 2P05A 2IY2A 1PYLA 2IMJA 3GZYB 2F5WA 1EKMA 2JQ5A 4BTWA 3QRDA 2W56B 1UCLA 1G96A 3X3YA 3G16A 3NV0B 3URPA 2RSXA 1I3FA 1O7GB 1BGSA 2H0HA 2P38A 1DETA 1EG9B 1O7NB 3GZBA 1MWRA 1W6YA 3NX0A 1RGGA 2YFLB 2STDA 1JB4A 1VZZA 2WO0A 3KSPA 1RJOA 5G2GA 3V92A 1BSDA 1A90A 3ZG0A 4X2HA 3LXUX 1IV9A 1YVSA 3F7SA 1WMOA 1L5GB 1RCLA 1ZO2A 3MHEA 1TFOA 5JBSA 3CCM3 1Q864 1JBRA 3G713 3OXAA 4KVHA 4NPBA 1FW7A 3OWUA 5IG5A 1SJWA 2HMLB 2Y74A 1OHOA 1IV7A 3DGLA 3T8NA 3SEDA 1RGCA 1BSAA 1YIT3 3EC9A 3I553 1BOXA 2BMRB 1M9GA
chains in the Genus database with same CATH topology
3HIGA 2W6JH 1K41A 1GYBA 1K734 3F8XA 4Q53A 1O7PB 1OPYA 2OCTA 2PNCA 1WMPA 3MYTA 3FSDA 3KZTA 4FMDA 2OQEA 2W04A 1GS3A 2B24B 5AYRB 2HMNB 3B8LA 3KIIA 4L8OA 5BVBA 3NUVA 4AEQA 1O7WB 4L8PA 4N6MA 2GU1A 2CK3H 3O8YA 3VF1A 3NBRA 4EC6A 1E3RA 1W02A 1VQ63 3UL6A 1M1XB 3U97A 4FMCA 4RNZA 1FGQA 2OOVA 2IUJA 1OF5A 4LMIA 2WOFA 3EBYA 2Q07A 4R1KA 3JUNA 5JPPA 3JUQA 4HBRA 3BNEA 4JF8A 2CG1A 1RKYA 2RCDA 2FNQA 1Q40B 3OWYA 4XM4A 1OF5B 4HYZA 1QVG2 3NM2A 1W2ZA 1OH0A 2C11A 4MMZB 2CFWA 3U1WA 3HK4A 4OUQA 3KSED 1OHSA 2CW9A 1PFPA 2UX0A 3PZWA 2ZDJA 2XRXB 3DZLA 1VQK3 3CD63 3CCU3 2F99A 3FG4A 2YX9A 1HKXA 2M7OA 3JUMA 4HKVB 2QIYA 2CIUA 3EJVA 1W4NA 5AYSC 4G1MB 3S29A 3N8BA 3G6E3 3CME3 3CCQ3 4HJLB 2BO9B 4WFOA 3EX9A 3IJEB 3A76A 1NWWA 1LOXA 3EBTA 3NBJA 5KP1A 3G4S3 2K0MA 1UW1A 2CKFB 1FUWA 1K8A4 1BUQA 4EV2A 1DVCA 5CF2A 1JB2A 5CLKA 3KN4A 4KFDA 2WOHA 1M904 3QK9A 3EHCA 5KP4A 3RGRA 1A67A 1N8QA 3G0KA 3PGBA 1SQWA 1U5OA 3B4PA 3GRDA 1QAKA 4MJDA 2YFJB 4IPBA 4CCVA 5I97A 1CYVA 2INXA 3NM7A 1ISKA 3DGMA 1QAFA 2FGTA 5IEPA 2CG0A 3PCRA 3EQQB 1YHQ3 4WWUC 1ULJB 1GY6A 3CCL3 4AKZA 5EQLA 5EEOA 3OV4A 2LQVA 5CK6A 3S67A 3H3HA 4KFEA 1DMNA 1NB3I 1NDOB 3DUKA 1ULIB 3DXOA 2XR8B 3I0YA 4HZ9B 3X40A 1T5YA 5FW5A 2IUKA 5AIFA 2MC8A 3CXC2 4TX4A 5ELJA 5IF6A 1LVNA 5IEOA 3FLJA 1Q7Y4 1ASKA 2CWUA 4HM2B 2Y73A 2KXGA 3CCS3 1FGMA 3V99A 1WNHA 2WGQA 4N3VA 1IU7A 1LNHA 1IT7A 5IW9A 1GD4A 1QJGA 4N6V0 3SOAA 1YI23 4KZ1A 4MEIA 5TGNA 1FGRA 1YJN3 1O7HB 5IG3A 2R4IA 5IG0A 3EN1B 1US1A 2OQEC 1MOLA 1FGOA 2CFDA 3H51A 1AR0A 1W5ZA 2HMOB 3EF8A 3LH4A 4RZMA 3S5CA 3CCJ3 1KC84 3LTCA 1UUVB 3K9MC 4HVNA 4KFFA 3N9HA 2BMQB 2CFKA 4GL6A 3MG3A 5JPUA 4N6TA 1NU3A 3B7CA 2XGLA 3WA3A 2OOVC 3AMOA 3S27A 4R4KA 1E3VA 1GD3A 5AEWB 3WOEB 2I9WA 4K1VA 4X2OA 3F40A 1HU9A 4EBGA 4EYCA 1D6ZA 2CHCA 5STDA 2P09A 1FA3A 2A15A 4R9KA 3LT8A 4FR9A 2HMKB 4ZM8A 3LYGA 2FXTA 1DVDA 2D1WA 3AMOB 1JN5A 1OGZA 2W0QA 5LC6A 5D83A 3DGNA 2BHMA 3WMDA 4GB5A 4XDVA 3MG1A 2Z77A 2XGNA 1RRLA 1RRHA 5CXOA 5KP3A 2CH9A 2D42A 4J8TA 1IQXA 4MMXB 2SBLA 2ML5A 2KRTA 3DGOA 3BNDA 3GZXB 3Q1CA 1VQ73 1VQ43 3K0ZA 1J2BA 2HMMB 3WDGB 3DMCA 4HM4B 1D6YA 4R9LA 3E99A 3BNBA 1KWIA 2C10A 3UL5A 1W6CA 4BTXA 7STDA 1WTHA 4I4KA 4EV5A 4HM8B 3F7XA 3F14A 1RN7A 1IQYA 3OX9A 1WQLB 3IMAB 3WODG 4PEJA 3T0UA 2HMJB 3SLUA 3K63A 2XH9A 4FCMA 1SIHA 2L4VA 4XBTA 3UNLA 3X41A 1YIJ3 5HGRA 2CWVA 2QA43 2BMOB 3CPW2 1E97A 2Z7AA 3K7CA 4HM0B 4N6NB 4L7KA 4R80A 4K1UA 3NHXA 4BTYA 3CCR3 1TFKA 4U13A 1AVLA 1IVVA 5EVHA 1KSIA 4ORLA 1TUHA 2GBXB 3OWSA 3FZWA 3X42A 4HM1B 4NHFA 5IERA 3BLZA 3BNCA 3NQZA 1UI8A 3F9SA 4STDA 3MWZA 1M1K4 4EXRA 1U8CB 3CCE3 1JNQA 2O3OA 3CNMA 2B1XB 4H3UA 4K90B 3LOYA 1QVF2 1W2B2 1NO3A 2P0MA 3LTAA 1GY5A 1PU4A 3HX8A 2E2UA 3N54B 8CHOA 4XBYA 3FG1A 4WYKA 4N6OB 3SOYA 1JKGA 1IDPA 2F98A 3GZRA 1YVBI 3D3LA 3KFQC 4HM5B 2QEX3 1Q814 3PCSA 1IK3A 2CFLA 3PS8A 3VGNA 5DREA 1N5HA 3F8HA 1S723 3J7Yd 1JJ22 1VQP3 1LXEA 3Q2PA 5D82A 3CC23 2QGUA 1N5PA 2ZL8A 2F86B 3FH1A 1N8R4 3GAXA 3L0RA 2RFRA 2RGQA 4O8SA 1TP6A 4J9AA 3MKIA 4IT7A 4CDLA 1YJW3 5IG4A 1Y4KA 4WHAA 5AI1A 5AIGA 3WA2X 2V1LA 5LC7A 2XFTA 3CC43 4LSOA 4NREA 5AEUB 1CEWI 3CPOA 2GXFA 4WP5A 1VQL3 5ELUA 1W6GA 1D6UA 1EA2A 1W00A 1K28A 2GEYA 3V98A 3MPHA 3DM8A 3ALAA 2OWPA 3X3XA 1IT8A 3LZAA 5BXQA 1JB5A 1OUNA 3CU3A 3FGYA 3LTDA 5CF1A 1N9JA 1KQS2 3ECFA 3KE7A 4IIAA 2BT3A 5FGOA 1N9EA 3NXJA 3KKGA 4K61A 2W9PA 1YGEA 3MSOA 2E2TA 1QALA 1A2KA 3EN8A 1DMQA 1ZX2A 1VQ83 1UI7A 1OCVA 2Z6BA 1S5AA 1JN5B 3CC73 3FF2A 1JV2B 3SVAA 1KD14 3T8UA 3PXMA 1A2VA 3EB8A 3ER7A 1Q824 4H61A 1WMNA 2PZVA 1VQ93 3DY5A 1AVKA 4FCJA 4O02B 4O2HA 1UUWB 3UJMA 4HZBB 4O3VA 3FF0A 1OGXA 3CMA3 4HM6B 1DYUA 3B4OA 1Q40A 3NQYA 3JVCA 2LYXA 2MF7A 4HM7B 4OK0A 1GY7A 2W2CA 2XFSA 1IVXA 2W03A 1STDA 3K5TA 1Q42A 3LTBA 4FMBA 4N6UA 1EQKA 1OHPA 2CFGA 3ROBA 1VQ53 3IPTA 1Z1SA 2JDIH 3FKAA 1OACA 1CQSA 4HM3B 3NBBA 1VQN3 1DMMA 2GU3A 3D9RA 1VQM3 1W01A 3CNXA 2GBWB 1IVWA 3JUPA 2O9UX 1CYUA 1SPUA 1QMAA 1W7CA 2XSOB 1TIJA 6STDA 1IQ8A 2YFIB 2XSHB 4FCZA 3PYJA 4FMAA 2OTJ3 3OW22 4RBNA 1NB5I 3SX1A 3G8ZA 2XEPA 1O7MB 3S28A 1ROAA 1JRQA 1R4CA 2BNGA 5IENA 4AKYA 2XF3A 3RGAA 1NJI4 3HI7A 2K54A 3CCV3 2CC3A 3HIIA 1STFI 3X3ZA 2Z76A 3FCSB 2P0XA 1IVUA 3WOFB 1VQO3 5AIHA 3EE1A 2W9QA 3HZPA 5A0OB 2CWTA 3LT9A 1ROVA 1TU5A 1C7HA 2KCDA 3MG2A 1SIIA 3M8CA 3BB9A 4RNYA 3GWRA 1V74A 1MNLA 4BTWA 2ML6A 4XDWA 5D81A 2IA7A 4XB5A 3UB1A 4XBXA 3Q90A 5AIIA 4QWTA 3RDEA 5DRVA 3LMLA 3STDA 3FG3A 4MMYB 4N6LA 1YJ93 4LGQA 3I563 4LZIA 3TDGA 2OTL3 3JUOA 2W56A 3VSYA 3NV0A 1F8NA 2GEXA 1AV4A 1K9M4 4LEHA 4OVMA 4WYKB 2E2VA 3SXXA 2WGOA 4JRFA 1JKGB 1FGTA 2P05A 3GZYB 2IMJA 1EKMA 2JQ5A 3QRDA 2W56B 3X3YA 1G96A 3G16A 3NV0B 2RSXA 1O7GB 2P38A 1EG9B 1O7NB 3GZBA 3NX0A 1W6YA 2YFLB 2STDA 1JB4A 1VZZA 2WO0A 3KSPA 1RJOA 5G2GA 3V92A 1A90A 4X2HA 3LXUX 1IV9A 1L5GB 3F7SA 1WMOA 1ZO2A 3MHEA 1TFOA 5JBSA 3CCM3 1Q864 3G713 3OXAA 4KVHA 3OWUA 5IG5A 1SJWA 2HMLB 2Y74A 1OHOA 1IV7A 3DGLA 3T8NA 3SEDA 1YIT3 3EC9A 3I553 2BMRB 1M9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K41 A;  1GYB A;  3F8X A;  4Q53 A;  1O7P B;  1OPY A;  3MYT A;  3FSD A;  3KZT A;  1GS3 A;  2B24 B;  2HMN B;  3B8L A;  4L8O A;  5BVB A;  3NUV A;  1O7W B;  4L8P A;  3NBR A;  1E3R A;  1W02 A;  1OF5 A;  4LMI A;  3EBY A;  4R1K A;  3JUN A;  5JPP A;  3JUQ A;  2RCD A;  1Q40 B;  3OWY A;  4XM4 A;  1OF5 B;  3NM2 A;  1OH0 A;  3HK4 A;  4OUQ A;  1OHS A;  2UX0 A;  2XRX B;  3DZL A;  2F99 A;  1HKX A;  3JUM A;  4HKV B;  2QIY A;  3EJV A;  4HJL B;  3EX9 A;  3A76 A;  1NWW A;  3EBT A;  5KP1 A;  2CKF B;  1BUQ A;  5CF2 A;  1JB2 A;  5CLK A;  3EHC A;  5KP4 A;  3RGR A;  3G0K A;  1U5O A;  3B4P A;  3GRD A;  4MJD A;  2YFJ B;  2INX A;  1ISK A;  5IEP A;  3EQQ B;  4WWU C;  1ULJ B;  1GY6 A;  3OV4 A;  5CK6 A;  3H3H A;  1DMN A;  1NDO B;  3DUK A;  3DXO A;  1ULI B;  4HZ9 B;  2XR8 B;  3I0Y A;  5FW5 A;  5AIF A;  5IF6 A;  5IEO A;  3FLJ A;  1ASK A;  4HM2 B;  4N3V A;  1QJG A;  3SOA A;  5TGN A;  1O7H B;  5IG3 A;  2R4I A;  5IG0 A;  3EN1 B;  3H51 A;  1AR0 A;  2HMO B;  3EF8 A;  4RZM A;  3S5C A;  1UUV B;  4HVN A;  2BMQ B;  3MG3 A;  5JPU A;  1NU3 A;  3B7C A;  1E3V A;  5AEW B;  2I9W A;  4K1V A;  4X2O A;  3F40 A;  2CHC A;  5STD A;  2A15 A;  4R9K A;  2HMK B;  3LYG A;  1JN5 A;  1OGZ A;  5D83 A;  3WMD A;  4GB5 A;  4XDV A;  3MG1 A;  2Z77 A;  5CXO A;  5KP3 A;  4J8T A;  3GZX B;  3K0Z A;  2HMM B;  3DMC A;  4HM4 B;  4R9L A;  3E99 A;  7STD A;  4I4K A;  4HM8 B;  3F7X A;  3F14 A;  3OX9 A;  1WQL B;  4PEJ A;  2HMJ B;  4FCM A;  4XBT A;  3UNL A;  5HGR A;  2BMO B;  1E97 A;  2Z7A A;  3K7C A;  4HM0 B;  4L7K A;  4K1U A;  3NHX A;  4U13 A;  5EVH A;  4ORL A;  1TUH A;  2GBX B;  3OWS A;  3FZW A;  4HM1 B;  5IER A;  3BLZ A;  3F9S A;  4STD A;  3CNM A;  2B1X B;  4H3U A;  1GY5 A;  3HX8 A;  8CHO A;  4XBY A;  4WYK A;  3SOY A;  1JKG A;  1IDP A;  2F98 A;  3GZR A;  4HM5 B;  3VGN A;  5DRE A;  3F8H A;  5D82 A;  2QGU A;  2F86 B;  3FH1 A;  2RFR A;  2RGQ A;  1TP6 A;  4J9A A;  3MKI A;  4CDL A;  5IG4 A;  5AI1 A;  5AIG A;  5AEU B;  3CPO A;  2GXF A;  4WP5 A;  1EA2 A;  1W00 A;  2GEY A;  3DM8 A;  2OWP A;  3LZA A;  5BXQ A;  1JB5 A;  1OUN A;  3CU3 A;  3FGY A;  5CF1 A;  3ECF A;  3KE7 A;  4IIA A;  3NXJ A;  3KKG A;  3MSO A;  3EN8 A;  1A2K A;  1DMQ A;  1ZX2 A;  1OCV A;  1S5A A;  1JN5 B;  3FF2 A;  3T8U A;  3ER7 A;  2PZV A;  4FCJ A;  1UUW B;  3UJM A;  4HZB B;  3FF0 A;  1OGX A;  4HM6 B;  3B4O A;  1Q40 A;  4HM7 B;  1GY7 A;  2W2C A;  1STD A;  1Q42 A;  1OHP A;  3ROB A;  3IPT A;  1Z1S A;  3FKA A;  1CQS A;  4HM3 B;  1DMM A;  3D9R A;  1W01 A;  3CNX A;  2GBW B;  3JUP A;  1QMA A;  2XSO B;  6STD A;  2YFI B;  2XSH B;  3G8Z A;  1O7M B;  2BNG A;  5IEN A;  3RGA A;  2K54 A;  2Z76 A;  5AIH A;  3HZP A;  1C7H A;  3MG2 A;  3M8C A;  3BB9 A;  3GWR A;  4XDW A;  5D81 A;  4XB5 A;  4XBX A;  3Q90 A;  5AII A;  5DRV A;  3STD A;  4LGQ A;  3JUO A;  3VSY A;  3NV0 A;  2GEX A;  4LEH A;  4OVM A;  4WYK B;  1JKG B;  3GZY B;  2IMJ A;  2JQ5 A;  3G16 A;  3NV0 B;  1O7G B;  1EG9 B;  1O7N B;  3GZB A;  1W6Y A;  2YFL B;  2STD A;  1JB4 A;  1VZZ A;  3KSP A;  5G2G A;  4X2H A;  3F7S A;  1ZO2 A;  3MHE A;  3OXA A;  4KVH A;  3OWU A;  5IG5 A;  1SJW A;  2HML B;  1OHO A;  3T8N A;  3SED A;  3EC9 A;  2BMR B; 
#chains in the Genus database with same CATH topology
 8RNT A;  3HIG A;  1TJD A;  2W6J H;  1K41 A;  1X1X A;  1GYB A;  1K73 4;  3F8X A;  4Q53 A;  1O7P B;  2CX0 A;  1OPY A;  2OCT A;  2PNC A;  1BAO A;  3WR2 A;  1WMP A;  3MYT A;  1R4Y A;  3FSD A;  3KZT A;  4FMD A;  2OQE A;  2W04 A;  1GS3 A;  2B24 B;  5AYR B;  5BU4 A;  2HMN B;  3B8L A;  3KII A;  1B2S A;  4L8O A;  5BVB A;  3NUV A;  4AEQ A;  1O7W B;  1V57 A;  4L8P A;  4N6M A;  2GU1 A;  2CK3 H;  3O8Y A;  3VF1 A;  3GSP A;  1LOY A;  3NBR A;  5G1K A;  4EC6 A;  1E3R A;  1W02 A;  1VQ6 3;  3UL6 A;  1M1X B;  3U97 A;  4FMC A;  4RNZ A;  1FGQ A;  2OOV A;  2IUJ A;  1OF5 A;  4LMI A;  2WOF A;  3EBY A;  2Q07 A;  4R1K A;  1BUJ A;  3JUN A;  1HZ1 A;  3AGN A;  5JPP A;  3JUQ A;  4HBR A;  3BNE A;  4JF8 A;  2CG1 A;  1RKY A;  2RCD A;  2FNQ A;  1Q40 B;  3OWY A;  4XM4 A;  1GMR A;  1OF5 B;  4HYZ A;  3WHO A;  1QVG 2;  4ILF A;  3NM2 A;  1W2Z A;  1OH0 A;  2C11 A;  4MMZ B;  2CFW A;  3U1W A;  3HK4 A;  4OUQ A;  3KSE D;  1OHS A;  2H0G A;  2CW9 A;  2GSP A;  3D5I A;  1PFP A;  2UX0 A;  3PZW A;  2ZDJ A;  2XRX B;  3DZL A;  1VQK 3;  3CD6 3;  3Q3F A;  1I2G A;  3CCU 3;  2F99 A;  3FG4 A;  2YX9 A;  1HKX A;  1T2I A;  1AY7 A;  2M7O A;  3JUM A;  4HKV B;  2QIY A;  2CIU A;  3EJV A;  1W4N A;  5AYS C;  1NNV A;  4G1M B;  3S29 A;  3N8B A;  1RMS A;  1UDI I;  3G6E 3;  3CME 3;  3CCQ 3;  4HJL B;  2BO9 B;  4WFO A;  3EX9 A;  3IJE B;  3A76 A;  1NWW A;  1LOX A;  3EBT A;  3NBJ A;  4EW5 A;  5KP1 A;  2K0M A;  2RNT A;  3G4S 3;  1UW1 A;  2CKF B;  1RNT A;  1JBS A;  1JBT A;  1K8A 4;  1FUW A;  1GSP A;  4EV2 A;  1BUQ A;  1DVC A;  5CF2 A;  1JB2 A;  5CLK A;  3HOH A;  3KN4 A;  4KFD A;  2ZHX B;  2WOH A;  1M90 4;  3QK9 A;  3EHC A;  5KP4 A;  3RGR A;  1GMQ A;  1YNV X;  1A67 A;  1N8Q A;  5M1A A;  3G0K A;  3PGB A;  1SQW A;  1MWS A;  1U5O A;  3B4P A;  1QAK A;  3GRD A;  4GHO A;  5HOH A;  4MJD A;  2YFJ B;  4IPB A;  4CCV A;  5I97 A;  1CYV A;  2INX A;  3NM7 A;  1ISK A;  3DGM A;  1QAF A;  2FGT A;  6GSP A;  5IEP A;  2CG0 A;  1LOV A;  3PCR A;  2F56 A;  3EQQ B;  1YHQ 3;  3A5E A;  4WWU C;  1ULJ B;  1GY6 A;  3CCL 3;  4AKZ A;  5EQL A;  5EEO A;  3OV4 A;  1I8V A;  2LQV A;  5CK6 A;  6RNT A;  3S67 A;  3H3H A;  4KFE A;  1DMN A;  1NB3 I;  1NDO B;  1G0T A;  1ULI B;  3DUK A;  2XR8 B;  3DXO A;  1TRP A;  3I0Y A;  3X40 A;  1T5Y A;  5FW5 A;  2IUK A;  4HZ9 B;  5AIF A;  2R41 A;  2MC8 A;  3CXC 2;  4TX4 A;  5ELJ A;  5IF6 A;  1LVN A;  2KF4 A;  5IEO A;  3FLJ A;  1Q7Y 4;  1ASK A;  2CWU A;  4HM2 B;  2Y73 A;  2KXG A;  3CCS 3;  1FGM A;  2IYJ A;  3V99 A;  1WNH A;  1AQZ A;  2WGQ A;  4N3V A;  1IU7 A;  1BNI A;  1LNH A;  3AHS A;  1IT7 A;  1I2F A;  5IW9 A;  1GD4 A;  1QJG A;  4N6V 0;  3SOA A;  1YI2 3;  4KZ1 A;  4MEI A;  1FYS A;  1IYY A;  1B2M A;  5TGN A;  3DH2 A;  1FGR A;  2KAA A;  1YJN 3;  1O7H B;  5IG3 A;  2R4I A;  5IG0 A;  3EN1 B;  3DGY A;  1US1 A;  2OQE C;  1MOL A;  1FGO A;  2CFD A;  2KF5 A;  3H51 A;  1AR0 A;  1PY3 A;  1W5Z A;  2HMO B;  3EF8 A;  3LH4 A;  4RZM A;  3S5C A;  3CCJ 3;  1KC8 4;  3LTC A;  1UUV B;  1UUG B;  3K9M C;  4HVN A;  4KFF A;  3N9H A;  1RTU A;  2BMQ B;  2CFK A;  4GL6 A;  1X1U A;  3MG3 A;  1T3B A;  4HOH A;  4N6T A;  5JPU A;  1NU3 A;  1HYF A;  2XGL A;  3B7C A;  3WA3 A;  1B21 A;  2OOV C;  3AMO A;  4R4K A;  3S27 A;  1E3V A;  1GD3 A;  1ZS7 A;  3WOE B;  2I9W A;  5AEW B;  1BRS A;  4K1V A;  1LNI A;  4X2O A;  3F40 A;  1HU9 A;  4EBG A;  4EYC A;  1D6Z A;  1B2Z A;  2CHC A;  3D5G A;  5STD A;  2P09 A;  4BL3 A;  1FA3 A;  1BRJ A;  2A15 A;  4R9K A;  1ZGX A;  3LT8 A;  4FR9 A;  2HMK B;  1A2P A;  4ZM8 A;  3LYG A;  2FXT A;  1DVD A;  2D1W A;  3AMO B;  1JN5 A;  1OGZ A;  2UUG C;  2W0Q A;  5LC6 A;  5D83 A;  1BRG A;  3ZG5 A;  2H0I A;  1BRN L;  3DGN A;  2BHM A;  3WMD A;  1RGA A;  4GB5 A;  4XDV A;  5GSP A;  1BRK A;  1Q7H A;  2XGN A;  2Z77 A;  1RRL A;  1RRH A;  3MG1 A;  5CXO A;  1RGK A;  5KP3 A;  2CH9 A;  2D42 A;  1X1W A;  4J8T A;  1IQX A;  4MMX B;  2KF6 A;  2SBL A;  2ML5 A;  2KRT A;  3DGO A;  3BND A;  3GZX B;  3Q1C A;  1VQ7 3;  1VQ4 3;  1RN4 A;  3K0Z A;  1TRQ A;  1J2B A;  2HMM B;  3WDG B;  3DMC A;  1MGW A;  4HM4 B;  1D6Y A;  4R9L A;  3E99 A;  2HOH A;  1RLS A;  4BU4 A;  3BNB A;  1KWI A;  2C10 A;  3UL5 A;  1GOV A;  1UGI A;  1W6C A;  4BTX A;  7STD A;  1WTH A;  2F4Y A;  4I4K A;  4EV5 A;  1G02 A;  4GSP A;  4HM8 B;  3F7X A;  4BIR A;  3F14 A;  1RN7 A;  2CX1 A;  1IQY A;  1BNR A;  3OX9 A;  1WQL B;  3IMA B;  3WOD G;  4PEJ A;  3T0U A;  2HMJ B;  3SLU A;  3K63 A;  2XH9 A;  4FCM A;  1SIH A;  2L4V A;  2RBI A;  4XBT A;  3UNL A;  3X41 A;  1VQQ A;  1YIJ 3;  5HGR A;  2CWV A;  2QA4 3;  2BMO B;  3CPW 2;  1FZU A;  1E97 A;  2Z7A A;  1RN1 A;  3K7C A;  4HM0 B;  4N6N B;  4L7K A;  1BNE A;  4K1U A;  3NHX A;  4R80 A;  4BTY A;  3CCR 3;  1TFK A;  4U13 A;  1AVL A;  1IVV A;  5EVH A;  1BRH A;  1KSI A;  2SAR A;  7GSP A;  1YGW A;  4ORL A;  1TUH A;  2GBX B;  2BU4 A;  3OWS A;  3FZW A;  3X42 A;  4HM1 B;  4NHF A;  5IER A;  3BLZ A;  3BNC A;  3NQZ A;  1GOY A;  1UI8 A;  3F9S A;  2AAE A;  4STD A;  3MWZ A;  1M1K 4;  4EXR A;  2C4B A;  1U8C B;  4I5Q A;  3CCE 3;  1I2E A;  1JNQ A;  1UCK A;  2O3O A;  3CNM A;  2B1X B;  4H3U A;  4K90 B;  3LOY A;  1QVF 2;  1W2B 2;  1BNS A;  1UCJ A;  1NO3 A;  1EUI C;  2P0M A;  1B2X A;  3LTA A;  1GY5 A;  1PU4 A;  3HX8 A;  2AAD A;  2E2U A;  3N54 B;  8CHO A;  4XBY A;  2F5M A;  1C54 A;  3FG1 A;  4WYK A;  1B27 A;  4N6O B;  1GMP A;  3SOY A;  1BSC A;  1IDP A;  1JKG A;  2F98 A;  1YVB I;  3GZR A;  3KCH A;  4DKI A;  3D3L A;  3KFQ C;  1RGE A;  4HM5 B;  4RNT A;  9RNT A;  2QEX 3;  1FUT A;  1Q81 4;  1RSN A;  1BNG A;  3PCS A;  1IK3 A;  2CFL A;  3PS8 A;  3VGN A;  5DRE A;  5BIR A;  1LRA A;  1N5H A;  2UGI A;  3F8H A;  4J5G A;  3J7Y d;  1S72 3;  1JJ2 2;  1VQP 3;  1LXE A;  1TTO A;  3Q2P A;  5D82 A;  2QGU A;  3CC2 3;  1BVI A;  1RGL A;  1N5P A;  2ZL8 A;  2F86 B;  3FH1 A;  1N8R 4;  3GAX A;  3L0R A;  5RNT A;  2RFR A;  2RGQ A;  4O8S A;  1TP6 A;  4J9A A;  1MWU A;  3MKI A;  4IT7 A;  4CDL A;  1YJW 3;  5IG4 A;  1Y4K A;  4WHA A;  5AI1 A;  5AIG A;  3WA2 X;  2V1L A;  5LC7 A;  2XFT A;  3CC4 3;  4LSO A;  4NRE A;  5AEU B;  1CEW I;  3CPO A;  2GXF A;  4WP5 A;  1VQL 3;  5ELU A;  1W6G A;  1BAN A;  1D6U A;  1EA2 A;  1K28 A;  1V58 A;  1W00 A;  2GEY A;  2ZA4 A;  3V98 A;  3MPH A;  3DM8 A;  1EEJ A;  3ALA A;  2OWP A;  3X3X A;  1IT8 A;  3LZA A;  5BXQ A;  1JB5 A;  1BSB A;  1OUN A;  3CU3 A;  3FGY A;  3LTD A;  5CF1 A;  1N9J A;  3AGO A;  1KQS 2;  3ECF A;  3KE7 A;  4IIA A;  2BT3 A;  1UCI A;  5FGO A;  1N9E A;  3NXJ A;  3SYU A;  3D79 A;  3KKG A;  4K61 A;  2W9P A;  1YGE A;  3MSO A;  2E2T A;  1QAL A;  1A2K A;  3EN8 A;  1DMQ A;  1UGH I;  1ZX2 A;  1SAR A;  4BL2 A;  1VQ8 3;  1UI7 A;  1OCV A;  2Z6B A;  1S5A A;  1JN5 B;  3CC7 3;  3FF2 A;  1JV2 B;  3SVA A;  1KD1 4;  3T8U A;  3PXM A;  1A2V A;  1BU4 A;  3EB8 A;  1I70 A;  3ER7 A;  1Q82 4;  4H61 A;  1WMN A;  1BNF A;  2PZV A;  1VQ9 3;  3DY5 A;  1AVK A;  4FCJ A;  1RDS A;  4O02 B;  1MGR A;  4O2H A;  1UUW B;  3UJM A;  4HZB B;  3AHW A;  4O3V A;  3FF0 A;  1OGX A;  3CMA 3;  4HM6 B;  1DYU A;  3B4O A;  1Q40 A;  3NQY A;  3JVC A;  1LQG C;  1BIR A;  2LYX A;  2MF7 A;  2J8X B;  1BRI A;  4HM7 B;  4OK0 A;  1I0V A;  1GY7 A;  2W2C A;  2XFS A;  4LYL B;  1B2U A;  1IVX A;  2W03 A;  1STD A;  3K5T A;  1Q42 A;  3LTB A;  4FMB A;  4KT3 B;  4N6U A;  1EQK A;  1OHP A;  2CFG A;  3ROB A;  1VQ5 3;  3IPT A;  1Z1S A;  2JDI H;  3FKA A;  1LOW A;  1OAC A;  1CQS A;  4HM3 B;  3NBB A;  1VQN 3;  1DMM A;  2GU3 A;  3D9R A;  1FUS A;  2KF3 A;  1VQM 3;  1W01 A;  3CNX A;  2GBW B;  1IVW A;  3JUP A;  3ZFZ A;  5M18 A;  2O9U X;  1CYU A;  1SPU A;  1QMA A;  1W7C A;  2BIR A;  2XSO B;  1TIJ A;  6STD A;  1IQ8 A;  1LQM B;  2YFI B;  1RGH A;  2XSH B;  4FCZ A;  1RCK A;  3PYJ A;  4CPK A;  4FMA A;  2OTJ 3;  3OW2 2;  4RBN A;  1NB5 I;  3SX1 A;  1JZO A;  3G8Z A;  2XEP A;  1O7M B;  2K3D A;  3S28 A;  1ROA A;  1JRQ A;  1R4C A;  2BNG A;  5IEN A;  3RNT A;  4AKY A;  2XF3 A;  3D4A A;  3RGA A;  1NJI 4;  3HI7 A;  2K54 A;  3CCV 3;  1RNB A;  2CC3 A;  3HII A;  1STF I;  3X3Z A;  2Z76 A;  3FCS B;  2P0X A;  1IVU A;  5G1L A;  3WOF B;  1I3I A;  1VQO 3;  5AIH A;  3EE1 A;  1BNJ A;  2W9Q A;  3HZP A;  2CWT A;  5A0O B;  1DE3 A;  3LT9 A;  1ROV A;  1TU5 A;  1C7H A;  2KCD A;  3MG2 A;  1SII A;  3M8C A;  1GOU A;  1MWT A;  3BB9 A;  4RNY A;  3GWR A;  1V74 A;  1MNL A;  3BIR A;  2ML6 A;  2L1S A;  4HAA A;  2IA7 A;  4XB5 A;  4XDW A;  4XBX A;  3Q90 A;  5D81 A;  3UB1 A;  1B20 A;  4J5K A;  1JZD A;  3BU4 A;  5AII A;  7RNT A;  1Q9E A;  4QWT A;  3RDE A;  5DRV A;  3LML A;  3STD A;  3FG3 A;  1RGF A;  4MMY B;  4N6L A;  1YJ9 3;  4LGQ A;  1T2H A;  1X1Y A;  1CH0 A;  3I56 3;  4LZI A;  3TDG A;  2OTL 3;  1RHL A;  3JUO A;  2W56 A;  3VSY A;  3NV0 A;  1F8N A;  1BSE A;  1B3S A;  2GEX A;  5M19 A;  1AV4 A;  1K9M 4;  4LEH A;  4OVM A;  4WYK B;  2E2V A;  3SXX A;  2WGO A;  1I0X A;  4CJN A;  4JRF A;  1JKG B;  1FGT A;  2P05 A;  2IY2 A;  1PYL A;  2IMJ A;  3GZY B;  2F5W A;  1EKM A;  2JQ5 A;  4BTW A;  3QRD A;  2W56 B;  1UCL A;  1G96 A;  3X3Y A;  3G16 A;  3NV0 B;  3URP A;  2RSX A;  1I3F A;  1O7G B;  1BGS A;  2H0H A;  2P38 A;  1DET A;  1EG9 B;  1O7N B;  3GZB A;  1MWR A;  1W6Y A;  3NX0 A;  1RGG A;  2YFL B;  2STD A;  1JB4 A;  1VZZ A;  2WO0 A;  3KSP A;  1RJO A;  5G2G A;  3V92 A;  1BSD A;  1A90 A;  3ZG0 A;  4X2H A;  3LXU X;  1IV9 A;  1YVS A;  3F7S A;  1WMO A;  1L5G B;  1RCL A;  1ZO2 A;  3MHE A;  1TFO A;  5JBS A;  3CCM 3;  1Q86 4;  1JBR A;  3G71 3;  3OXA A;  4KVH A;  4NPB A;  1FW7 A;  3OWU A;  5IG5 A;  1SJW A;  2HML B;  2Y74 A;  1OHO A;  1IV7 A;  3DGL A;  3T8N A;  3SED A;  1RGC A;  1BSA A;  1YIT 3;  3EC9 A;  3I55 3;  1BOX A;  2BMR B;  1M9G A; 
#chains in the Genus database with same CATH homology
 3HIG A;  2W6J H;  1K41 A;  1GYB A;  1K73 4;  3F8X A;  4Q53 A;  1O7P B;  1OPY A;  2OCT A;  2PNC A;  1WMP A;  3MYT A;  3FSD A;  3KZT A;  4FMD A;  2OQE A;  2W04 A;  1GS3 A;  2B24 B;  5AYR B;  2HMN B;  3B8L A;  3KII A;  4L8O A;  5BVB A;  3NUV A;  4AEQ A;  1O7W B;  4L8P A;  4N6M A;  2GU1 A;  2CK3 H;  3O8Y A;  3VF1 A;  3NBR A;  4EC6 A;  1E3R A;  1W02 A;  1VQ6 3;  3UL6 A;  1M1X B;  3U97 A;  4FMC A;  4RNZ A;  1FGQ A;  2OOV A;  2IUJ A;  1OF5 A;  4LMI A;  2WOF A;  3EBY A;  2Q07 A;  4R1K A;  3JUN A;  5JPP A;  3JUQ A;  4HBR A;  3BNE A;  4JF8 A;  2CG1 A;  1RKY A;  2RCD A;  2FNQ A;  1Q40 B;  3OWY A;  4XM4 A;  1OF5 B;  4HYZ A;  1QVG 2;  3NM2 A;  1W2Z A;  1OH0 A;  2C11 A;  4MMZ B;  2CFW A;  3U1W A;  3HK4 A;  4OUQ A;  3KSE D;  1OHS A;  2CW9 A;  1PFP A;  2UX0 A;  3PZW A;  2ZDJ A;  2XRX B;  3DZL A;  1VQK 3;  3CD6 3;  3CCU 3;  2F99 A;  3FG4 A;  2YX9 A;  1HKX A;  2M7O A;  3JUM A;  4HKV B;  2QIY A;  2CIU A;  3EJV A;  1W4N A;  5AYS C;  4G1M B;  3S29 A;  3N8B A;  3G6E 3;  3CME 3;  3CCQ 3;  4HJL B;  2BO9 B;  4WFO A;  3EX9 A;  3IJE B;  3A76 A;  1NWW A;  1LOX A;  3EBT A;  3NBJ A;  5KP1 A;  3G4S 3;  2K0M A;  1UW1 A;  2CKF B;  1FUW A;  1K8A 4;  1BUQ A;  4EV2 A;  1DVC A;  5CF2 A;  1JB2 A;  5CLK A;  3KN4 A;  4KFD A;  2WOH A;  1M90 4;  3QK9 A;  3EHC A;  5KP4 A;  3RGR A;  1A67 A;  1N8Q A;  3G0K A;  3PGB A;  1SQW A;  1U5O A;  3B4P A;  3GRD A;  1QAK A;  4MJD A;  2YFJ B;  4IPB A;  4CCV A;  5I97 A;  1CYV A;  2INX A;  3NM7 A;  1ISK A;  3DGM A;  1QAF A;  2FGT A;  5IEP A;  2CG0 A;  3PCR A;  3EQQ B;  1YHQ 3;  4WWU C;  1ULJ B;  1GY6 A;  3CCL 3;  4AKZ A;  5EQL A;  5EEO A;  3OV4 A;  2LQV A;  5CK6 A;  3S67 A;  3H3H A;  4KFE A;  1DMN A;  1NB3 I;  1NDO B;  3DUK A;  1ULI B;  3DXO A;  2XR8 B;  3I0Y A;  4HZ9 B;  3X40 A;  1T5Y A;  5FW5 A;  2IUK A;  5AIF A;  2MC8 A;  3CXC 2;  4TX4 A;  5ELJ A;  5IF6 A;  1LVN A;  5IEO A;  3FLJ A;  1Q7Y 4;  1ASK A;  2CWU A;  4HM2 B;  2Y73 A;  2KXG A;  3CCS 3;  1FGM A;  3V99 A;  1WNH A;  2WGQ A;  4N3V A;  1IU7 A;  1LNH A;  1IT7 A;  5IW9 A;  1GD4 A;  1QJG A;  4N6V 0;  3SOA A;  1YI2 3;  4KZ1 A;  4MEI A;  5TGN A;  1FGR A;  1YJN 3;  1O7H B;  5IG3 A;  2R4I A;  5IG0 A;  3EN1 B;  1US1 A;  2OQE C;  1MOL A;  1FGO A;  2CFD A;  3H51 A;  1AR0 A;  1W5Z A;  2HMO B;  3EF8 A;  3LH4 A;  4RZM A;  3S5C A;  3CCJ 3;  1KC8 4;  3LTC A;  1UUV B;  3K9M C;  4HVN A;  4KFF A;  3N9H A;  2BMQ B;  2CFK A;  4GL6 A;  3MG3 A;  5JPU A;  4N6T A;  1NU3 A;  3B7C A;  2XGL A;  3WA3 A;  2OOV C;  3AMO A;  3S27 A;  4R4K A;  1E3V A;  1GD3 A;  5AEW B;  3WOE B;  2I9W A;  4K1V A;  4X2O A;  3F40 A;  1HU9 A;  4EBG A;  4EYC A;  1D6Z A;  2CHC A;  5STD A;  2P09 A;  1FA3 A;  2A15 A;  4R9K A;  3LT8 A;  4FR9 A;  2HMK B;  4ZM8 A;  3LYG A;  2FXT A;  1DVD A;  2D1W A;  3AMO B;  1JN5 A;  1OGZ A;  2W0Q A;  5LC6 A;  5D83 A;  3DGN A;  2BHM A;  3WMD A;  4GB5 A;  4XDV A;  3MG1 A;  2Z77 A;  2XGN A;  1RRL A;  1RRH A;  5CXO A;  5KP3 A;  2CH9 A;  2D42 A;  4J8T A;  1IQX A;  4MMX B;  2SBL A;  2ML5 A;  2KRT A;  3DGO A;  3BND A;  3GZX B;  3Q1C A;  1VQ7 3;  1VQ4 3;  3K0Z A;  1J2B A;  2HMM B;  3WDG B;  3DMC A;  4HM4 B;  1D6Y A;  4R9L A;  3E99 A;  3BNB A;  1KWI A;  2C10 A;  3UL5 A;  1W6C A;  4BTX A;  7STD A;  1WTH A;  4I4K A;  4EV5 A;  4HM8 B;  3F7X A;  3F14 A;  1RN7 A;  1IQY A;  3OX9 A;  1WQL B;  3IMA B;  3WOD G;  4PEJ A;  3T0U A;  2HMJ B;  3SLU A;  3K63 A;  2XH9 A;  4FCM A;  1SIH A;  2L4V A;  4XBT A;  3UNL A;  3X41 A;  1YIJ 3;  5HGR A;  2CWV A;  2QA4 3;  2BMO B;  3CPW 2;  1E97 A;  2Z7A A;  3K7C A;  4HM0 B;  4N6N B;  4L7K A;  4R80 A;  4K1U A;  3NHX A;  4BTY A;  3CCR 3;  1TFK A;  4U13 A;  1AVL A;  1IVV A;  5EVH A;  1KSI A;  4ORL A;  1TUH A;  2GBX B;  3OWS A;  3FZW A;  3X42 A;  4HM1 B;  4NHF A;  5IER A;  3BLZ A;  3BNC A;  3NQZ A;  1UI8 A;  3F9S A;  4STD A;  3MWZ A;  1M1K 4;  4EXR A;  1U8C B;  3CCE 3;  1JNQ A;  2O3O A;  3CNM A;  2B1X B;  4H3U A;  4K90 B;  3LOY A;  1QVF 2;  1W2B 2;  1NO3 A;  2P0M A;  3LTA A;  1GY5 A;  1PU4 A;  3HX8 A;  2E2U A;  3N54 B;  8CHO A;  4XBY A;  3FG1 A;  4WYK A;  4N6O B;  3SOY A;  1JKG A;  1IDP A;  2F98 A;  3GZR A;  1YVB I;  3D3L A;  3KFQ C;  4HM5 B;  2QEX 3;  1Q81 4;  3PCS A;  1IK3 A;  2CFL A;  3PS8 A;  3VGN A;  5DRE A;  1N5H A;  3F8H A;  1S72 3;  3J7Y d;  1JJ2 2;  1VQP 3;  1LXE A;  3Q2P A;  5D82 A;  3CC2 3;  2QGU A;  1N5P A;  2ZL8 A;  2F86 B;  3FH1 A;  1N8R 4;  3GAX A;  3L0R A;  2RFR A;  2RGQ A;  4O8S A;  1TP6 A;  4J9A A;  3MKI A;  4IT7 A;  4CDL A;  1YJW 3;  5IG4 A;  1Y4K A;  4WHA A;  5AI1 A;  5AIG A;  3WA2 X;  2V1L A;  5LC7 A;  2XFT A;  3CC4 3;  4LSO A;  4NRE A;  5AEU B;  1CEW I;  3CPO A;  2GXF A;  4WP5 A;  1VQL 3;  5ELU A;  1W6G A;  1D6U A;  1EA2 A;  1W00 A;  1K28 A;  2GEY A;  3V98 A;  3MPH A;  3DM8 A;  3ALA A;  2OWP A;  3X3X A;  1IT8 A;  3LZA A;  5BXQ A;  1JB5 A;  1OUN A;  3CU3 A;  3FGY A;  3LTD A;  5CF1 A;  1N9J A;  1KQS 2;  3ECF A;  3KE7 A;  4IIA A;  2BT3 A;  5FGO A;  1N9E A;  3NXJ A;  3KKG A;  4K61 A;  2W9P A;  1YGE A;  3MSO A;  2E2T A;  1QAL A;  1A2K A;  3EN8 A;  1DMQ A;  1ZX2 A;  1VQ8 3;  1UI7 A;  1OCV A;  2Z6B A;  1S5A A;  1JN5 B;  3CC7 3;  3FF2 A;  1JV2 B;  3SVA A;  1KD1 4;  3T8U A;  3PXM A;  1A2V A;  3EB8 A;  3ER7 A;  1Q82 4;  4H61 A;  1WMN A;  2PZV A;  1VQ9 3;  3DY5 A;  1AVK A;  4FCJ A;  4O02 B;  4O2H A;  1UUW B;  3UJM A;  4HZB B;  4O3V A;  3FF0 A;  1OGX A;  3CMA 3;  4HM6 B;  1DYU A;  3B4O A;  1Q40 A;  3NQY A;  3JVC A;  2LYX A;  2MF7 A;  4HM7 B;  4OK0 A;  1GY7 A;  2W2C A;  2XFS A;  1IVX A;  2W03 A;  1STD A;  3K5T A;  1Q42 A;  3LTB A;  4FMB A;  4N6U A;  1EQK A;  1OHP A;  2CFG A;  3ROB A;  1VQ5 3;  3IPT A;  1Z1S A;  2JDI H;  3FKA A;  1OAC A;  1CQS A;  4HM3 B;  3NBB A;  1VQN 3;  1DMM A;  2GU3 A;  3D9R A;  1VQM 3;  1W01 A;  3CNX A;  2GBW B;  1IVW A;  3JUP A;  2O9U X;  1CYU A;  1SPU A;  1QMA A;  1W7C A;  2XSO B;  1TIJ A;  6STD A;  1IQ8 A;  2YFI B;  2XSH B;  4FCZ A;  3PYJ A;  4FMA A;  2OTJ 3;  3OW2 2;  4RBN A;  1NB5 I;  3SX1 A;  3G8Z A;  2XEP A;  1O7M B;  3S28 A;  1ROA A;  1JRQ A;  1R4C A;  2BNG A;  5IEN A;  4AKY A;  2XF3 A;  3RGA A;  1NJI 4;  3HI7 A;  2K54 A;  3CCV 3;  2CC3 A;  3HII A;  1STF I;  3X3Z A;  2Z76 A;  3FCS B;  2P0X A;  1IVU A;  3WOF B;  1VQO 3;  5AIH A;  3EE1 A;  2W9Q A;  3HZP A;  5A0O B;  2CWT A;  3LT9 A;  1ROV A;  1TU5 A;  1C7H A;  2KCD A;  3MG2 A;  1SII A;  3M8C A;  3BB9 A;  4RNY A;  3GWR A;  1V74 A;  1MNL A;  4BTW A;  2ML6 A;  4XDW A;  5D81 A;  2IA7 A;  4XB5 A;  3UB1 A;  4XBX A;  3Q90 A;  5AII A;  4QWT A;  3RDE A;  5DRV A;  3LML A;  3STD A;  3FG3 A;  4MMY B;  4N6L A;  1YJ9 3;  4LGQ A;  3I56 3;  4LZI A;  3TDG A;  2OTL 3;  3JUO A;  2W56 A;  3VSY A;  3NV0 A;  1F8N A;  2GEX A;  1AV4 A;  1K9M 4;  4LEH A;  4OVM A;  4WYK B;  2E2V A;  3SXX A;  2WGO A;  4JRF A;  1JKG B;  1FGT A;  2P05 A;  3GZY B;  2IMJ A;  1EKM A;  2JQ5 A;  3QRD A;  2W56 B;  3X3Y A;  1G96 A;  3G16 A;  3NV0 B;  2RSX A;  1O7G B;  2P38 A;  1EG9 B;  1O7N B;  3GZB A;  3NX0 A;  1W6Y A;  2YFL B;  2STD A;  1JB4 A;  1VZZ A;  2WO0 A;  3KSP A;  1RJO A;  5G2G A;  3V92 A;  1A90 A;  4X2H A;  3LXU X;  1IV9 A;  1L5G B;  3F7S A;  1WMO A;  1ZO2 A;  3MHE A;  1TFO A;  5JBS A;  3CCM 3;  1Q86 4;  3G71 3;  3OXA A;  4KVH A;  3OWU A;  5IG5 A;  1SJW A;  2HML B;  2Y74 A;  1OHO A;  1IV7 A;  3DGL A;  3T8N A;  3SED A;  1YIT 3;  3EC9 A;  3I55 3;  2BMR B;  1M9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...