1OH0A

Crystal structure of ketosteroid isomerase complexed with equilenin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title High-Resolution Crystal Structures of Delta5-3-Ketosteroid Isomerase with and without a Reaction Intermediate Analogue
pubmed doi rcsb
source organism Pseudomonas putida
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1oh0A00
1NU3A 1OHOA 3LZAA 4XDVA 4XB5A 5JPUA 1A2KA 2HMNB 3I0YA 3B8LA 3K0ZA 2W2CA 3A76A 1OF5A 3MG1A 4WWUC 5IENA 1O7PB 4HM1B 5D82A 2BMRB 4IIAA 1C7HA 2GEXA 4N3VA 4L8OA 3NHXA 3VGNA 5CXOA 5IG4A 3OWUA 1Q40B 7STDA 1NWWA 2GBWB 3GRDA 2CKFB 1STDA 4WP5A 2UX0A 1O7NB 4R1KA 4XBTA 4X2OA 5D83A 5BVBA 2HMJB 1E3VA 2PZVA 3JUPA 2B24B 4J8TA 1OCVA 4X2HA 1GS3A 1JB4A 1Z1SA 3SOAA 1Q40A 3G16A 3JUNA 1NDOB 3CPOA 3K7CA 4R9KA 1OUNA 2Z77A 5AEWB 3F7XA 1U5OA 5AIHA 3FH1A 2YFIB 2B1XB 1OHSA 3EJVA 3G8ZA 5FW5A 3F7SA 3OWYA 2GBXB 8CHOA 3F8HA 3F9SA 1OGZA 5IEPA 2GEYA 2HMKB 3SEDA 3FF0A 3CU3A 3KZTA 5AEUB 3NXJA 3ROBA 2RFRA 5CLKA 3OWSA 4LMIA 1VZZA 4LEHA 4L7KA 5DRVA 1JB2A 4HM8B 2F86B 5BXQA 2Z76A 4STDA 4HVNA 4MJDA 2R4IA 1UUVB 5KP3A 3MYTA 3BLZA 3GZXB 2A15A 1ZX2A 2GXFA 1S5AA 4Q53A 5AI1A 5IERA 3CNMA 3SOYA 5KP1A 1HKXA 1SJWA 3RGRA 4I4KA 3MG3A 5JPPA 1O7GB 3G0KA 3RGAA 3MKIA 5AIFA 1GY6A 2QIYA 3ECFA 1OH0A 3MHEA 1Q42A 1DMQA 3NUVA 2HMOB 1JN5B 4OUQA 3STDA 3OXAA 4HZ9B 5DREA 2STDA 1O7WB 5TGNA 3F40A 3S5CA 2YFLB 5AIGA 3T8NA 1OHPA 4RZMA 1W6YA 1EG9B 2INXA 3JUQA 3BB9A 3E99A 3KSPA 4GB5A 1O7HB 3EC9A 4HKVB 1JN5A 4WYKB 3LYGA 3KKGA 4J9AA 1ZO2A 4PEJA 3B7CA 3DXOA 1QJGA 3EBTA 4XM4A 1E97A 5G2GA 2RCDA 3GZYB 2Z7AA 3EBYA 3NM2A 1E3RA 1K41A 1OPYA 4K1UA 3NBRA 3JUOA 4HZBB 4HM7B 4WYKA 1WQLB 2HMMB 3H3HA 2QGUA 1ULJB 3EN1B 3VSYA 3HZPA 3CNXA 5CF1A 5IF6A 5IG3A 3DM8A 1DMNA 3H51A 1QMAA 3FZWA 3F8XA 1ISKA 4H3UA 2XRXB 5EVHA 2CHCA 4HM4B 3FSDA 3JUMA 3NV0B 5D81A 3GZRA 1BUQA 4XDWA 3FKAA 1OGXA 4HM5B 2XSHB 2OWPA 1W01A 4ORLA 2F99A 4HM0B 3FLJA 3HX8A 4HM2B 4FCMA 2F98A 3FGYA 5KP4A 4HJLB 2I9WA 4R9LA 1DMMA 5HGRA 3T8UA 3Q90A 3NV0A 3KE7A 4XBXA 3B4OA 2RGQA 1GY7A 2IMJA 1CQSA 1IDPA 3GZBA 3M8CA 4HM6B 1O7MB 1JKGB 3EF8A 1GYBA 3EQQB 1GY5A 3OX9A 5IEOA 3EX9A 4CDLA 3EN8A 3FF2A 3MG2A 2XSOB 2BNGA 3ER7A 3HK4A 1W02A 1ULIB 3MSOA 5STDA 5IG5A 3EHCA 3F14A 2JQ5A 4FCJA 3WMDA 3DUKA 3UJMA 1JB5A 2BMOB 4OVMA 1AR0A 3GWRA 4LGQA 1TP6A 5AIIA 5CK6A 1JKGA 3DMCA 3OV4A 4HM3B 5IG0A 4U13A 2K54A 4KVHA 4L8PA 4XBYA 6STDA 1ASKA 2HMLB 3B4PA 3UNLA 4K1VA 1TUHA 3D9RA 2YFJB 1EA2A 1UUWB 3DZLA 1OF5B 1W00A 2XR8B 3IPTA 5CF2A 2BMQB
chains in the Genus database with same CATH superfamily
1TU5A 1K9M4 1NU3A 1T2IA 5ELJA 3VF1A 3BU4A 2P0MA 1GMQA 1OHOA 2H0GA 4JRFA 2OTL3 3LZAA 4XDVA 1BNEA 1GOYA 1LQGC 3NM7A 4XB5A 2H0HA 5JPUA 1A2KA 2HMNB 2WGQA 1VQN3 1TFOA 3I0YA 2W9QA 2LQVA 1PU4A 3B8LA 1W5ZA 2RNTA 3WA3A 1BOXA 1DETA 1SQWA 4OK0A 2D1WA 1FUSA 5FGOA 1BSEA 1RDSA 1Q7HA 5BU4A 3DGNA 3KSED 4J5GA 2GU1A 1N8QA 1RSNA 3K0ZA 2W2CA 1YGWA 1JZDA 1YVSA 3CME3 1WMNA 1EEJA 2BIRA 5M18A 3BNEA 3A76A 3WR2A 1OF5A 3Q1CA 2P0XA 1RGFA 1RKYA 3MG1A 4WWUC 2CFDA 5IENA 1O7PB 4HM1B 1VQK3 1FUTA 4TX4A 2IYJA 2QEX3 3D5IA 5D82A 1VQ53 2BMRB 4IIAA 3SLUA 1C7HA 3WOEB 1BRKA 2GEXA 2J8XB 4N3VA 2OOVC 1B2XA 4L8OA 1BSAA 1A2VA 3NHXA 3VGNA 5CXOA 1A2PA 5IG4A 2KRTA 3AGOA 4FMDA 3LMLA 1BNFA 4KZ1A 2CG0A 4RNZA 3OWUA 3V92A 1Q40B 7STDA 1VQ93 1TTOA 1LOVA 1IVXA 1NWWA 4N6V0 2GBWB 3QK9A 3GRDA 2CKFB 1STDA 1UI8A 2WO0A 2UX0A 3DGYA 4MMYB 4WP5A 1O7NB 2CW9A 5AYSC 2IUKA 4K61A 4R1KA 3KN4A 4XBTA 1BANA 1HU9A 3Q3FA 4GHOA 4X2OA 5D83A 1QVG2 2CX0A 1MWTA 3EE1A 2XFTA 2W03A 4AKYA 5BVBA 1I8VA 1ROAA 1OACA 3PXMA 4KFFA 2HMJB 3LXUX 1E3VA 2AAEA 2PZVA 3SX1A 1BRNL 3JUPA 1PFPA 1UCLA 4O8SA 1LVNA 2B24B 4J8TA 3X42A 4BL3A 3JVCA 1STFI 1IYYA 2XEPA 1OCVA 1MGWA 2PNCA 1RN1A 4HAAA 4X2HA 3ZFZA 1RMSA 3G713 1GS3A 1RN4A 1JB4A 1Z1SA 3WDGB 2E2UA 1A90A 3G6E3 3SOAA 1IV9A 1Q40A 3G16A 4LYLB 2CFWA 5G1LA 1B2UA 3JUNA 3RNTA 3LT8A 1NDOB 3CPOA 4JF8A 1D6YA 3D79A 3K7CA 3U97A 4G1MB 3DY5A 4R9KA 1OUNA 3DGMA 3GSPA 2Z77A 1RGCA 4FMCA 1JV2B 4N6UA 1LQMB 4N6MA 5AEWB 2MC8A 1YNVX 3F7XA 4R4KA 1U5OA 3CC23 5AIHA 3FH1A 1IQXA 1FGQA 1BNSA 2YFIB 4AEQA 2B1XB 2OQEC 2CX1A 1JBTA 3SYUA 1VQ43 2CK3H 3FG1A 1OHSA 1FGRA 6RNTA 1K734 1IT8A 1RN7A 2Y74A 3EJVA 3G8ZA 5FW5A 2ZA4A 4K90B 4EBGA 3S27A 1NJI4 3F7SA 3OWYA 1WTHA 1I2FA 2GBXB 2K0MA 2XGNA 3F8HA 3D4AA 8CHOA 1FZUA 1JRQA 1YJW3 1SARA 3F9SA 1F8NA 1OGZA 3X3ZA 4N6NB 5IEPA 3ALAA 1UUGB 2GEYA 2HMKB 2L1SA 1BNGA 3FF0A 4HOHA 3SEDA 3T0UA 1M1XB 2R41A 3DGOA 1TRPA 2F4YA 4R80A 1IVVA 4LZIA 4EXRA 1BSBA 1US1A 2P38A 3CU3A 3KZTA 5AEUB 4BU4A 1AVLA 3NXJA 1IT7A 1Y4KA 3ROBA 1LXEA 1YVBI 3CCM3 1W2ZA 2RFRA 3FG3A 5CLKA 3CCQ3 3PZWA 3OWSA 4LMIA 2FNQA 1VZZA 2CC3A 4LEHA 1QAFA 4FR9A 4L7KA 5DRVA 1JB2A 4CCVA 3CPW2 3IMAB 1T2HA 4HM8B 1GOUA 1N9EA 4WFOA 3O8YA 1DVCA 2F86B 5BXQA 3NQYA 1M9GA 5IW9A 3AHSA 5ELUA 2Z76A 3QRDA 1I0VA 4STDA 3LOYA 4HVNA 1KSIA 4MJDA 3N9HA 1UGHI 4MEIA 1MWRA 2R4IA 2P05A 1JJ22 1UUVB 5KP3A 1HYFA 4ZM8A 4CPKA 1N5PA 4J5KA 1GMRA 1N5HA 4O3VA 2E2VA 2RBIA 3LTCA 3MYTA 3PCSA 3CCJ3 3BLZA 1RGAA 3J7Yd 1EKMA 2E2TA 3GZXB 3MPHA 2A15A 1ZX2A 2GXFA 3PGBA 1S5AA 1RGKA 1D6UA 1BNRA 4Q53A 5AI1A 1AVKA 4N6LA 1JBSA 5IERA 2XGLA 1C54A 1LNIA 3CNMA 3SOYA 1WMPA 4H61A 3WA2X 5KP1A 1HKXA 1RGEA 1SJWA 2H0IA 3RGRA 1YJ93 2IA7A 1BUJA 4I4KA 2BU4A 1BGSA 3HI7A 3LTDA 3MG3A 5JPPA 1O7GB 2BHMA 3G0KA 3RGAA 1JNQA 2WGOA 2IUJA 3MKIA 5AIFA 3SXXA 1GY6A 1IV7A 2QIYA 1CEWI 3N54B 2YX9A 1B20A 1N9JA 1IVWA 3ECFA 1GMPA 1D6ZA 4N6OB 1OH0A 3WODG 1UCJA 5G1KA 3MHEA 1Q42A 1G02A 1W7CA 1BNJA 1DMQA 2FGTA 2SARA 3IJEB 1UCIA 2GSPA 3S67A 3PCRA 3HIGA 3NUVA 2KF4A 2HMOB 1JN5B 4OUQA 2UGIA 1U8CB 4EW5A 1PY3A 1J2BA 4N6TA 2OTJ3 3K5TA 3STDA 1IU7A 2Z6BA 3OXAA 4HZ9B 5DREA 2STDA 1O7WB 3K63A 5TGNA 4BL2A 3UB1A 3F40A 4GL6A 3MWZA 3S5CA 1UDII 2YFLB 1S723 5AIGA 3S28A 3WHOA 1FGOA 1V74A 4I5QA 3T8NA 4MMXB 1UI7A 1OHPA 1BU4A 4RZMA 2LYXA 1W6YA 1Q814 1X1WA 1EG9B 2W56B 3CCU3 1X1XA 2KXGA 2INXA 3BNBA 3JUQA 3CMA3 2KAAA 3BB9A 1NB3I 1KD14 3EB8A 1ZS7A 1B21A 3E99A 2JDIH 7GSPA 5M1AA 1IQ8A 3KSPA 2QA43 3D3LA 4GB5A 2W9PA 1O7HB 3EC9A 4HKVB 1JN5A 2WOFA 3CCS3 4FMBA 1G0TA 1RRHA 4WYKB 1HZ1A 6GSPA 3HIIA 1KQS2 3LYGA 4O2HA 1MWSA 1FYSA 1PYLA 2Q07A 1B27A 2CFLA 2KF5A 2V1LA 1VQ83 1G96A 3KKGA 1VQ63 1SIIA 4J9AA 1RHLA 1ZO2A 4PEJA 3CCL3 3B7CA 1X1YA 1QALA 2CIUA 3DXOA 1QJGA 4IPBA 3EBTA 5I97A 1QAKA 1FW7A 4XM4A 1B2ZA 1E97A 2MF7A 2W6JH 4HBRA 5G2GA 4RNTA 4EC6A 2RCDA 3GZYB 1Q9EA 3D5GA 2Z7AA 3EBYA 4NHFA 3NM2A 3I563 1E3RA 1K41A 1OPYA 1GOVA 2W56A 2ZHXB 1T3BA 4RBNA 1GD4A 4K1UA 1LRAA 1BSDA 1BVIA 1R4CA 1YIJ3 2CWVA 3LT9A 3TDGA 4BIRA 5JBSA 1IK3A 3FCSB 3NBRA 1L5GB 2RSXA 1VQM3 1BAOA 1KWIA 3JUOA 4HZBB 3CC73 2C4BA 4HM7B 1VQQA 4WYKA 1FGTA 1MNLA 1WQLB 2HMMB 1I0XA 3H3HA 1BRIA 2QGUA 1ULJB 3EN1B 3WOFB 1RCLA 3VSYA 1WMOA 2AADA 1FUWA 2M7OA 1RJOA 2W04A 3V99A 3RDEA 4FCZA 2OOVA 3BNDA 3HZPA 1B3SA 3CNXA 5CF1A 2ZL8A 5IF6A 2F56A 2F5MA 3Q2PA 1MOLA 3K9MC 2BO9B 4IT7A 1TRQA 4KFDA 3GAXA 5IG3A 3DM8A 1RNBA 2KF3A 1YIT3 1DMNA 1WNHA 1EUIC 2KF6A 3L0RA 1JZOA 2C10A 3I553 5GSPA 1ZGXA 3H51A 4MMZB 1BRJA 1QMAA 3FZWA 1N8R4 3F8XA 1ISKA 4H3UA 2CFGA 2CWTA 2XRXB 5EVHA 3AHWA 2CHCA 4FMAA 2W0QA 3FSDA 3JUMA 4HM4B 3NV0B 4ILFA 1W6CA 3N8BA 5D81A 9RNTA 2IY2A 2ZDJA 3GZRA 1BUQA 3X3XA 1BIRA 4XDWA 3FKAA 3CD63 3AMOB 1SIHA 1B2SA 1OGXA 2XSHB 4HM5B 3PYJA 4KFEA 1DYUA 2OWPA 4EV5A 1SPUA 1W01A 4ORLA 3CCR3 2F99A 4HM0B 1NNVA 3FLJA 2WOHA 5AYRB 5HOHA 1I2EA 1BRGA 3HX8A 4HM2B 4FCMA 1AY7A 1JBRA 4CJNA 2F98A 3FGYA 1AQZA 1GD3A 1RNTA 5KP4A 1IQYA 2HOHA 1I3IA 4HJLB 3HOHA 3CXC2 1CYUA 3CCE3 4BTXA 2C11A 1V57A 2I9WA 4R9LA 1Q864 1DMMA 7RNTA 1RLSA 3AGNA 5HGRA 1DVDA 1I3FA 2SBLA 1I2GA 1CH0A 3T8UA 4EV2A 1BRHA 3Q90A 3NV0A 3U1WA 3KE7A 4QWTA 4XBXA 3B4OA 3NBBA 2OQEA 1K8A4 1NB5I 4BTYA 2RGQA 5M19A 1M904 1EQKA 3AMOA 1M1K4 2KCDA 1MGRA 1GY7A 2IMJA 2ML5A 1TJDA 1FGMA 4KT3B 3X41A 1VQ73 1CQSA 1IDPA 1MWUA 3GZBA 3M8CA 1NO3A 3NBJA 4HM6B 1O7MB 2BT3A 2UUGC 5EQLA 4AKZA 1V58A 3UL5A 2F5WA 1JKGB 3EF8A 1GYBA 3EQQB 1GY5A 1UGIA 3LTAA 3A5EA 3OX9A 5IEOA 3EX9A 1W2B2 3KFQC 1LNHA 4CDLA 1DE3A 1RCKA 3EN8A 1LOWA 1IVUA 1T5YA 3DH2A 3FF2A 5EEOA 2XH9A 3MG2A 1YHQ3 2XSOB 3KIIA 2BNGA 3ER7A 3LH4A 1UCKA 3HK4A 1W4NA 1UW1A 2GU3A 1R4YA 1W02A 2XFSA 3UL6A 3OW22 1YJN3 4DKIA 1VQL3 1ULIB 2CG1A 3MSOA 5STDA 1ROVA 2D42A 1AV4A 3EHCA 2ML6A 2O3OA 5IG5A 1YGEA 1A67A 3F14A 1W6GA 2JQ5A 4WHAA 1RTUA 1RGGA 4FCJA 3WMDA 3DUKA 2P09A 3UJMA 1JB5A 1BSCA 1RGLA 1YI23 1KC84 1VQO3 3X40A 2BMOB 4NPBA 4OVMA 1FA3A 1AR0A 3GWRA 4LGQA 1TP6A 4RNYA 5AIIA 1TFKA 2Y73A 5CK6A 1JKGA 1GSPA 3DMCA 1K28A 1X1UA 3OV4A 4HM3B 5IG0A 3CCV3 1BRSA 1Q824 4U13A 2K54A 1I70A 4HYZA 4KVHA 3LTBA 3PS8A 3NX0A 3ZG5A 3G4S3 4BTWA 3CC43 4L8PA 4XBYA 6STDA 3ZG0A 2CFKA 2CH9A 1BNIA 1RGHA 2CWUA 2O9UX 1ASKA 3NQZA 3S29A 2HMLB 3KCHA 3B4PA 3FG4A 3UNLA 3BIRA 4K1VA 3SVAA 1LOYA 4GSPA 5LC7A 2OCTA 3X3YA 1LOXA 4EYCA 1VQP3 1B2MA 1TUHA 3BNCA 1Q7Y4 4NREA 2L4VA 4O02B 3DGLA 3D9RA 1TIJA 2YFJB 1EA2A 3V98A 3URPA 5A0OB 5LC6A 4LSOA 5BIRA 1UUWB 8RNTA 2FXTA 3DZLA 5RNTA 1QVF2 1OF5B 1W00A 1RRLA 2XR8B 1CYVA 2K3DA 2XF3A 3IPTA 5CF2A 2BMQB
chains in the Genus database with same CATH topology
1TU5A 1K9M4 1NU3A 5ELJA 3VF1A 2P0MA 1OHOA 4JRFA 2OTL3 3LZAA 4XDVA 3NM7A 4XB5A 5JPUA 1A2KA 2HMNB 2WGQA 1VQN3 1TFOA 3I0YA 2W9QA 2LQVA 1PU4A 3B8LA 1W5ZA 3WA3A 1SQWA 4OK0A 2D1WA 5FGOA 3DGNA 3KSED 2GU1A 1N8QA 3K0ZA 2W2CA 3CME3 1WMNA 3BNEA 3A76A 1OF5A 3Q1CA 2P0XA 1RKYA 3MG1A 4WWUC 2CFDA 5IENA 1O7PB 4HM1B 1VQK3 4TX4A 2QEX3 1VQ53 5D82A 2BMRB 4IIAA 3SLUA 1C7HA 3WOEB 2GEXA 4N3VA 2OOVC 4L8OA 1A2VA 3NHXA 3VGNA 5CXOA 5IG4A 2KRTA 4FMDA 3LMLA 4KZ1A 2CG0A 4RNZA 3OWUA 3V92A 1Q40B 7STDA 1VQ93 1IVXA 1NWWA 4N6V0 2GBWB 3QK9A 3GRDA 2CKFB 1STDA 1UI8A 2WO0A 2UX0A 4MMYB 4WP5A 1O7NB 2CW9A 5AYSC 2IUKA 4K61A 4R1KA 3KN4A 4XBTA 1HU9A 4X2OA 5D83A 1QVG2 3EE1A 2XFTA 2W03A 4AKYA 5BVBA 1ROAA 1OACA 3PXMA 4KFFA 2HMJB 3LXUX 1E3VA 2PZVA 3SX1A 3JUPA 1PFPA 4O8SA 1LVNA 2B24B 4J8TA 3X42A 3JVCA 1STFI 2XEPA 1OCVA 2PNCA 4X2HA 3G713 1GS3A 1JB4A 1Z1SA 3WDGB 2E2UA 1A90A 3G6E3 3SOAA 1IV9A 1Q40A 3G16A 2CFWA 3JUNA 3LT8A 1NDOB 3CPOA 4JF8A 1D6YA 3K7CA 3U97A 4G1MB 3DY5A 4R9KA 1OUNA 3DGMA 2Z77A 4FMCA 1JV2B 4N6UA 4N6MA 5AEWB 2MC8A 3F7XA 4R4KA 1U5OA 3CC23 5AIHA 3FH1A 1IQXA 1FGQA 2YFIB 4AEQA 2B1XB 2OQEC 1VQ43 2CK3H 3FG1A 1OHSA 1FGRA 1K734 1IT8A 1RN7A 2Y74A 3EJVA 3G8ZA 5FW5A 4K90B 4EBGA 3S27A 1NJI4 3F7SA 3OWYA 1WTHA 2GBXB 2K0MA 2XGNA 8CHOA 3F8HA 1YJW3 1JRQA 3F9SA 1F8NA 1OGZA 3X3ZA 4N6NB 5IEPA 3ALAA 2GEYA 2HMKB 3SEDA 3FF0A 3T0UA 1M1XB 3DGOA 4R80A 1IVVA 4LZIA 4EXRA 1US1A 2P38A 3CU3A 3KZTA 5AEUB 1AVLA 3NXJA 1IT7A 1Y4KA 3ROBA 1LXEA 1YVBI 3CCM3 1W2ZA 2RFRA 3FG3A 5CLKA 3CCQ3 3PZWA 3OWSA 4LMIA 2FNQA 1VZZA 2CC3A 4LEHA 1QAFA 4FR9A 4L7KA 5DRVA 1JB2A 4CCVA 3CPW2 3IMAB 4HM8B 1N9EA 4WFOA 3O8YA 1DVCA 2F86B 5BXQA 3NQYA 1M9GA 5IW9A 5ELUA 2Z76A 3QRDA 4STDA 3LOYA 4HVNA 1KSIA 4MJDA 3N9HA 4MEIA 2R4IA 2P05A 1JJ22 1UUVB 5KP3A 4ZM8A 1N5PA 1N5HA 4O3VA 2E2VA 3PCSA 3LTCA 3MYTA 3CCJ3 3BLZA 3J7Yd 1EKMA 2E2TA 3GZXB 3MPHA 2A15A 1ZX2A 2GXFA 3PGBA 1S5AA 1D6UA 4Q53A 5AI1A 1AVKA 4N6LA 5IERA 2XGLA 3CNMA 3SOYA 3WA2X 1WMPA 4H61A 5KP1A 1HKXA 1SJWA 3RGRA 1YJ93 2IA7A 4I4KA 3HI7A 3LTDA 3MG3A 5JPPA 1O7GB 2BHMA 3G0KA 3RGAA 1JNQA 2WGOA 2IUJA 3MKIA 5AIFA 3SXXA 1GY6A 1IV7A 2QIYA 1CEWI 3N54B 2YX9A 1N9JA 1IVWA 3ECFA 4N6OB 1D6ZA 1OH0A 3WODG 3MHEA 1Q42A 2FGTA 1W7CA 1DMQA 3IJEB 3S67A 3PCRA 3HIGA 3NUVA 2HMOB 1JN5B 4OUQA 1U8CB 1J2BA 4N6TA 2OTJ3 3K5TA 3STDA 1IU7A 2Z6BA 3OXAA 4HZ9B 5DREA 2STDA 1O7WB 3K63A 5TGNA 3UB1A 3F40A 4GL6A 3MWZA 3S5CA 2YFLB 1S723 5AIGA 3S28A 1FGOA 1V74A 3T8NA 4MMXB 1UI7A 1OHPA 4RZMA 2LYXA 1W6YA 1Q814 1EG9B 2W56B 3CCU3 2KXGA 2INXA 3BNBA 3JUQA 3CMA3 3BB9A 1NB3I 1KD14 3EB8A 3E99A 2JDIH 1IQ8A 3KSPA 2QA43 3D3LA 4GB5A 2W9PA 1O7HB 3EC9A 4HKVB 1JN5A 2WOFA 3CCS3 4FMBA 1RRHA 4WYKB 1KQS2 3HIIA 3LYGA 4O2HA 1VQ83 2Q07A 2CFLA 2V1LA 1G96A 3KKGA 1VQ63 1SIIA 4J9AA 1ZO2A 4PEJA 3CCL3 3B7CA 1QALA 2CIUA 3DXOA 1QJGA 4IPBA 3EBTA 5I97A 1QAKA 4XM4A 1E97A 2MF7A 2W6JH 4HBRA 5G2GA 4EC6A 2RCDA 3GZYB 4NHFA 2Z7AA 3EBYA 3NM2A 3I563 1E3RA 1K41A 1OPYA 2W56A 4RBNA 1GD4A 4K1UA 1YIJ3 1R4CA 2CWVA 3LT9A 3TDGA 5JBSA 1IK3A 3FCSB 3NBRA 1L5GB 2RSXA 1VQM3 3JUOA 1KWIA 4HZBB 3CC73 4HM7B 4WYKA 1FGTA 1MNLA 1WQLB 2HMMB 3H3HA 2QGUA 1ULJB 3EN1B 3WOFB 3VSYA 1WMOA 1FUWA 2M7OA 1RJOA 2W04A 3V99A 3RDEA 4FCZA 2OOVA 3BNDA 3HZPA 3CNXA 5CF1A 2ZL8A 5IF6A 3Q2PA 1MOLA 3K9MC 2BO9B 4IT7A 4KFDA 3GAXA 5IG3A 3DM8A 1YIT3 1DMNA 1WNHA 3L0RA 2C10A 3I553 3H51A 4MMZB 1QMAA 1N8R4 3FZWA 3F8XA 1ISKA 4H3UA 2CFGA 2CWTA 2XRXB 5EVHA 2CHCA 4FMAA 2W0QA 3FSDA 3JUMA 4HM4B 3NV0B 1W6CA 3N8BA 5D81A 2ZDJA 3GZRA 1BUQA 3X3XA 4XDWA 3FKAA 3CD63 3AMOB 1SIHA 1OGXA 2XSHB 4HM5B 3PYJA 4KFEA 1DYUA 2OWPA 4EV5A 1SPUA 1W01A 4ORLA 3CCR3 2F99A 4HM0B 3FLJA 2WOHA 5AYRB 3HX8A 4HM2B 4FCMA 2F98A 3FGYA 1GD3A 5KP4A 1IQYA 4HJLB 3CXC2 1CYUA 3CCE3 4BTXA 2C11A 2I9WA 4R9LA 1Q864 1DMMA 1DVDA 5HGRA 2SBLA 3T8UA 4EV2A 3Q90A 3NV0A 3U1WA 3KE7A 4QWTA 4XBXA 3B4OA 3NBBA 2OQEA 1K8A4 1NB5I 4BTYA 2RGQA 1M904 1EQKA 3AMOA 1M1K4 2KCDA 1GY7A 2IMJA 2ML5A 3X41A 1FGMA 1VQ73 1CQSA 1IDPA 3GZBA 3M8CA 1NO3A 3NBJA 4HM6B 1O7MB 2BT3A 5EQLA 4AKZA 3UL5A 1JKGB 3EF8A 1GYBA 3EQQB 1GY5A 3LTAA 3OX9A 5IEOA 3EX9A 1W2B2 3KFQC 1LNHA 4CDLA 3EN8A 1IVUA 1T5YA 3FF2A 5EEOA 2XH9A 3MG2A 1YHQ3 2XSOB 3KIIA 2BNGA 3ER7A 3LH4A 3HK4A 1W4NA 1UW1A 2GU3A 1W02A 2XFSA 3UL6A 3OW22 1YJN3 1VQL3 1ULIB 2CG1A 3MSOA 5STDA 1ROVA 2D42A 1AV4A 3EHCA 2ML6A 2O3OA 5IG5A 1YGEA 1A67A 3F14A 1W6GA 2JQ5A 4WHAA 4FCJA 3WMDA 3DUKA 2P09A 3UJMA 1JB5A 1YI23 1KC84 1VQO3 3X40A 2BMOB 4OVMA 1FA3A 1AR0A 3GWRA 4LGQA 1TP6A 4RNYA 5AIIA 1TFKA 2Y73A 5CK6A 1JKGA 3DMCA 1K28A 3OV4A 4HM3B 5IG0A 3CCV3 1Q824 4U13A 2K54A 4HYZA 4KVHA 3LTBA 3PS8A 3NX0A 3G4S3 4BTWA 3CC43 4L8PA 4XBYA 6STDA 2CFKA 2CH9A 2CWUA 2O9UX 3NQZA 3S29A 1ASKA 2HMLB 3B4PA 3FG4A 3UNLA 4K1VA 3SVAA 5LC7A 3X3YA 1VQP3 2OCTA 1LOXA 4EYCA 1TUHA 3BNCA 1Q7Y4 4NREA 2L4VA 4O02B 3DGLA 3D9RA 1TIJA 2YFJB 1EA2A 3V98A 5A0OB 5LC6A 4LSOA 1UUWB 2FXTA 3DZLA 1QVF2 1OF5B 1W00A 1RRLA 2XR8B 1CYVA 2XF3A 3IPTA 5CF2A 2BMQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU3 A;  1OHO A;  3LZA A;  4XDV A;  4XB5 A;  5JPU A;  1A2K A;  2HMN B;  3I0Y A;  3B8L A;  3K0Z A;  2W2C A;  3A76 A;  1OF5 A;  3MG1 A;  4WWU C;  5IEN A;  1O7P B;  4HM1 B;  5D82 A;  2BMR B;  4IIA A;  1C7H A;  2GEX A;  4N3V A;  4L8O A;  3NHX A;  3VGN A;  5CXO A;  5IG4 A;  3OWU A;  1Q40 B;  7STD A;  1NWW A;  2GBW B;  3GRD A;  2CKF B;  1STD A;  4WP5 A;  2UX0 A;  1O7N B;  4R1K A;  4XBT A;  4X2O A;  5D83 A;  5BVB A;  2HMJ B;  1E3V A;  2PZV A;  3JUP A;  2B24 B;  4J8T A;  1OCV A;  4X2H A;  1GS3 A;  1JB4 A;  1Z1S A;  3SOA A;  1Q40 A;  3G16 A;  3JUN A;  1NDO B;  3CPO A;  3K7C A;  4R9K A;  1OUN A;  2Z77 A;  5AEW B;  3F7X A;  1U5O A;  5AIH A;  3FH1 A;  2YFI B;  2B1X B;  1OHS A;  3EJV A;  3G8Z A;  5FW5 A;  3F7S A;  3OWY A;  2GBX B;  8CHO A;  3F8H A;  3F9S A;  1OGZ A;  5IEP A;  2GEY A;  2HMK B;  3SED A;  3FF0 A;  3CU3 A;  3KZT A;  5AEU B;  3NXJ A;  3ROB A;  2RFR A;  5CLK A;  3OWS A;  4LMI A;  1VZZ A;  4LEH A;  4L7K A;  5DRV A;  1JB2 A;  4HM8 B;  2F86 B;  5BXQ A;  2Z76 A;  4STD A;  4HVN A;  4MJD A;  2R4I A;  1UUV B;  5KP3 A;  3MYT A;  3BLZ A;  3GZX B;  2A15 A;  1ZX2 A;  2GXF A;  1S5A A;  4Q53 A;  5AI1 A;  5IER A;  3CNM A;  3SOY A;  5KP1 A;  1HKX A;  1SJW A;  3RGR A;  4I4K A;  3MG3 A;  5JPP A;  1O7G B;  3G0K A;  3RGA A;  3MKI A;  5AIF A;  1GY6 A;  2QIY A;  3ECF A;  1OH0 A;  3MHE A;  1Q42 A;  1DMQ A;  3NUV A;  2HMO B;  1JN5 B;  4OUQ A;  3STD A;  3OXA A;  4HZ9 B;  5DRE A;  2STD A;  1O7W B;  5TGN A;  3F40 A;  3S5C A;  2YFL B;  5AIG A;  3T8N A;  1OHP A;  4RZM A;  1W6Y A;  1EG9 B;  2INX A;  3JUQ A;  3BB9 A;  3E99 A;  3KSP A;  4GB5 A;  1O7H B;  3EC9 A;  4HKV B;  1JN5 A;  4WYK B;  3LYG A;  3KKG A;  4J9A A;  1ZO2 A;  4PEJ A;  3B7C A;  3DXO A;  1QJG A;  3EBT A;  4XM4 A;  1E97 A;  5G2G A;  2RCD A;  3GZY B;  2Z7A A;  3EBY A;  3NM2 A;  1E3R A;  1K41 A;  1OPY A;  4K1U A;  3NBR A;  3JUO A;  4HZB B;  4HM7 B;  4WYK A;  1WQL B;  2HMM B;  3H3H A;  2QGU A;  1ULJ B;  3EN1 B;  3VSY A;  3HZP A;  3CNX A;  5CF1 A;  5IF6 A;  5IG3 A;  3DM8 A;  1DMN A;  3H51 A;  1QMA A;  3FZW A;  3F8X A;  1ISK A;  4H3U A;  2XRX B;  5EVH A;  2CHC A;  4HM4 B;  3FSD A;  3JUM A;  3NV0 B;  5D81 A;  3GZR A;  1BUQ A;  4XDW A;  3FKA A;  1OGX A;  4HM5 B;  2XSH B;  2OWP A;  1W01 A;  4ORL A;  2F99 A;  4HM0 B;  3FLJ A;  3HX8 A;  4HM2 B;  4FCM A;  2F98 A;  3FGY A;  5KP4 A;  4HJL B;  2I9W A;  4R9L A;  1DMM A;  5HGR A;  3T8U A;  3Q90 A;  3NV0 A;  3KE7 A;  4XBX A;  3B4O A;  2RGQ A;  1GY7 A;  2IMJ A;  1CQS A;  1IDP A;  3GZB A;  3M8C A;  4HM6 B;  1O7M B;  1JKG B;  3EF8 A;  1GYB A;  3EQQ B;  1GY5 A;  3OX9 A;  5IEO A;  3EX9 A;  4CDL A;  3EN8 A;  3FF2 A;  3MG2 A;  2XSO B;  2BNG A;  3ER7 A;  3HK4 A;  1W02 A;  1ULI B;  3MSO A;  5STD A;  5IG5 A;  3EHC A;  3F14 A;  2JQ5 A;  4FCJ A;  3WMD A;  3DUK A;  3UJM A;  1JB5 A;  2BMO B;  4OVM A;  1AR0 A;  3GWR A;  4LGQ A;  1TP6 A;  5AII A;  5CK6 A;  1JKG A;  3DMC A;  3OV4 A;  4HM3 B;  5IG0 A;  4U13 A;  2K54 A;  4KVH A;  4L8P A;  4XBY A;  6STD A;  1ASK A;  2HML B;  3B4P A;  3UNL A;  4K1V A;  1TUH A;  3D9R A;  2YFJ B;  1EA2 A;  1UUW B;  3DZL A;  1OF5 B;  1W00 A;  2XR8 B;  3IPT A;  5CF2 A;  2BMQ B; 
#chains in the Genus database with same CATH topology
 1TU5 A;  1K9M 4;  1NU3 A;  1T2I A;  5ELJ A;  3VF1 A;  3BU4 A;  2P0M A;  1GMQ A;  1OHO A;  2H0G A;  4JRF A;  2OTL 3;  3LZA A;  4XDV A;  1BNE A;  1GOY A;  1LQG C;  3NM7 A;  4XB5 A;  2H0H A;  5JPU A;  1A2K A;  2HMN B;  2WGQ A;  1VQN 3;  1TFO A;  3I0Y A;  2W9Q A;  2LQV A;  1PU4 A;  3B8L A;  1W5Z A;  2RNT A;  3WA3 A;  1BOX A;  1DET A;  1SQW A;  4OK0 A;  2D1W A;  1FUS A;  5FGO A;  1BSE A;  1RDS A;  1Q7H A;  5BU4 A;  3DGN A;  3KSE D;  4J5G A;  2GU1 A;  1N8Q A;  1RSN A;  3K0Z A;  2W2C A;  1YGW A;  1JZD A;  1YVS A;  3CME 3;  1WMN A;  1EEJ A;  2BIR A;  5M18 A;  3BNE A;  3A76 A;  3WR2 A;  1OF5 A;  3Q1C A;  2P0X A;  1RGF A;  1RKY A;  3MG1 A;  4WWU C;  2CFD A;  5IEN A;  1O7P B;  4HM1 B;  1VQK 3;  1FUT A;  4TX4 A;  2IYJ A;  2QEX 3;  3D5I A;  5D82 A;  1VQ5 3;  2BMR B;  4IIA A;  3SLU A;  1C7H A;  3WOE B;  1BRK A;  2GEX A;  2J8X B;  4N3V A;  2OOV C;  1B2X A;  4L8O A;  1BSA A;  1A2V A;  3NHX A;  3VGN A;  5CXO A;  1A2P A;  5IG4 A;  2KRT A;  3AGO A;  4FMD A;  3LML A;  1BNF A;  4KZ1 A;  2CG0 A;  4RNZ A;  3OWU A;  3V92 A;  1Q40 B;  7STD A;  1VQ9 3;  1TTO A;  1LOV A;  1IVX A;  1NWW A;  4N6V 0;  2GBW B;  3QK9 A;  3GRD A;  2CKF B;  1STD A;  1UI8 A;  2WO0 A;  2UX0 A;  3DGY A;  4MMY B;  4WP5 A;  1O7N B;  2CW9 A;  5AYS C;  2IUK A;  4K61 A;  4R1K A;  3KN4 A;  4XBT A;  1BAN A;  1HU9 A;  3Q3F A;  4GHO A;  4X2O A;  5D83 A;  1QVG 2;  2CX0 A;  1MWT A;  3EE1 A;  2XFT A;  2W03 A;  4AKY A;  5BVB A;  1I8V A;  1ROA A;  1OAC A;  3PXM A;  4KFF A;  2HMJ B;  3LXU X;  1E3V A;  2AAE A;  2PZV A;  3SX1 A;  1BRN L;  3JUP A;  1PFP A;  1UCL A;  4O8S A;  1LVN A;  2B24 B;  4J8T A;  3X42 A;  4BL3 A;  3JVC A;  1STF I;  1IYY A;  2XEP A;  1OCV A;  1MGW A;  2PNC A;  1RN1 A;  4HAA A;  4X2H A;  3ZFZ A;  1RMS A;  3G71 3;  1GS3 A;  1RN4 A;  1JB4 A;  1Z1S A;  3WDG B;  2E2U A;  1A90 A;  3G6E 3;  3SOA A;  1IV9 A;  1Q40 A;  3G16 A;  4LYL B;  2CFW A;  5G1L A;  1B2U A;  3JUN A;  3RNT A;  3LT8 A;  1NDO B;  3CPO A;  4JF8 A;  1D6Y A;  3D79 A;  3K7C A;  3U97 A;  4G1M B;  3DY5 A;  4R9K A;  1OUN A;  3DGM A;  3GSP A;  2Z77 A;  1RGC A;  4FMC A;  1JV2 B;  4N6U A;  1LQM B;  4N6M A;  5AEW B;  2MC8 A;  1YNV X;  3F7X A;  4R4K A;  1U5O A;  3CC2 3;  5AIH A;  3FH1 A;  1IQX A;  1FGQ A;  1BNS A;  2YFI B;  4AEQ A;  2B1X B;  2OQE C;  2CX1 A;  1JBT A;  3SYU A;  1VQ4 3;  2CK3 H;  3FG1 A;  1OHS A;  1FGR A;  6RNT A;  1K73 4;  1IT8 A;  1RN7 A;  2Y74 A;  3EJV A;  3G8Z A;  5FW5 A;  2ZA4 A;  4K90 B;  4EBG A;  3S27 A;  1NJI 4;  3F7S A;  3OWY A;  1WTH A;  1I2F A;  2GBX B;  2K0M A;  2XGN A;  3F8H A;  3D4A A;  8CHO A;  1FZU A;  1JRQ A;  1YJW 3;  1SAR A;  3F9S A;  1F8N A;  1OGZ A;  3X3Z A;  4N6N B;  5IEP A;  3ALA A;  1UUG B;  2GEY A;  2HMK B;  2L1S A;  1BNG A;  3FF0 A;  4HOH A;  3SED A;  3T0U A;  1M1X B;  2R41 A;  3DGO A;  1TRP A;  2F4Y A;  4R80 A;  1IVV A;  4LZI A;  4EXR A;  1BSB A;  1US1 A;  2P38 A;  3CU3 A;  3KZT A;  5AEU B;  4BU4 A;  1AVL A;  3NXJ A;  1IT7 A;  1Y4K A;  3ROB A;  1LXE A;  1YVB I;  3CCM 3;  1W2Z A;  2RFR A;  3FG3 A;  5CLK A;  3CCQ 3;  3PZW A;  3OWS A;  4LMI A;  2FNQ A;  1VZZ A;  2CC3 A;  4LEH A;  1QAF A;  4FR9 A;  4L7K A;  5DRV A;  1JB2 A;  4CCV A;  3CPW 2;  3IMA B;  1T2H A;  4HM8 B;  1GOU A;  1N9E A;  4WFO A;  3O8Y A;  1DVC A;  2F86 B;  5BXQ A;  3NQY A;  1M9G A;  5IW9 A;  3AHS A;  5ELU A;  2Z76 A;  3QRD A;  1I0V A;  4STD A;  3LOY A;  4HVN A;  1KSI A;  4MJD A;  3N9H A;  1UGH I;  4MEI A;  1MWR A;  2R4I A;  2P05 A;  1JJ2 2;  1UUV B;  5KP3 A;  1HYF A;  4ZM8 A;  4CPK A;  1N5P A;  4J5K A;  1GMR A;  1N5H A;  4O3V A;  2E2V A;  2RBI A;  3LTC A;  3MYT A;  3PCS A;  3CCJ 3;  3BLZ A;  1RGA A;  3J7Y d;  1EKM A;  2E2T A;  3GZX B;  3MPH A;  2A15 A;  1ZX2 A;  2GXF A;  3PGB A;  1S5A A;  1RGK A;  1D6U A;  1BNR A;  4Q53 A;  5AI1 A;  1AVK A;  4N6L A;  1JBS A;  5IER A;  2XGL A;  1C54 A;  1LNI A;  3CNM A;  3SOY A;  1WMP A;  4H61 A;  3WA2 X;  5KP1 A;  1HKX A;  1RGE A;  1SJW A;  2H0I A;  3RGR A;  1YJ9 3;  2IA7 A;  1BUJ A;  4I4K A;  2BU4 A;  1BGS A;  3HI7 A;  3LTD A;  3MG3 A;  5JPP A;  1O7G B;  2BHM A;  3G0K A;  3RGA A;  1JNQ A;  2WGO A;  2IUJ A;  3MKI A;  5AIF A;  3SXX A;  1GY6 A;  1IV7 A;  2QIY A;  1CEW I;  3N54 B;  2YX9 A;  1B20 A;  1N9J A;  1IVW A;  3ECF A;  1GMP A;  1D6Z A;  4N6O B;  1OH0 A;  3WOD G;  1UCJ A;  5G1K A;  3MHE A;  1Q42 A;  1G02 A;  1W7C A;  1BNJ A;  1DMQ A;  2FGT A;  2SAR A;  3IJE B;  1UCI A;  2GSP A;  3S67 A;  3PCR A;  3HIG A;  3NUV A;  2KF4 A;  2HMO B;  1JN5 B;  4OUQ A;  2UGI A;  1U8C B;  4EW5 A;  1PY3 A;  1J2B A;  4N6T A;  2OTJ 3;  3K5T A;  3STD A;  1IU7 A;  2Z6B A;  3OXA A;  4HZ9 B;  5DRE A;  2STD A;  1O7W B;  3K63 A;  5TGN A;  4BL2 A;  3UB1 A;  3F40 A;  4GL6 A;  3MWZ A;  3S5C A;  1UDI I;  2YFL B;  1S72 3;  5AIG A;  3S28 A;  3WHO A;  1FGO A;  1V74 A;  4I5Q A;  3T8N A;  4MMX B;  1UI7 A;  1OHP A;  1BU4 A;  4RZM A;  2LYX A;  1W6Y A;  1Q81 4;  1X1W A;  1EG9 B;  2W56 B;  3CCU 3;  1X1X A;  2KXG A;  2INX A;  3BNB A;  3JUQ A;  3CMA 3;  2KAA A;  3BB9 A;  1NB3 I;  1KD1 4;  3EB8 A;  1ZS7 A;  1B21 A;  3E99 A;  2JDI H;  7GSP A;  5M1A A;  1IQ8 A;  3KSP A;  2QA4 3;  3D3L A;  4GB5 A;  2W9P A;  1O7H B;  3EC9 A;  4HKV B;  1JN5 A;  2WOF A;  3CCS 3;  4FMB A;  1G0T A;  1RRH A;  4WYK B;  1HZ1 A;  6GSP A;  3HII A;  1KQS 2;  3LYG A;  4O2H A;  1MWS A;  1FYS A;  1PYL A;  2Q07 A;  1B27 A;  2CFL A;  2KF5 A;  2V1L A;  1VQ8 3;  1G96 A;  3KKG A;  1VQ6 3;  1SII A;  4J9A A;  1RHL A;  1ZO2 A;  4PEJ A;  3CCL 3;  3B7C A;  1X1Y A;  1QAL A;  2CIU A;  3DXO A;  1QJG A;  4IPB A;  3EBT A;  5I97 A;  1QAK A;  1FW7 A;  4XM4 A;  1B2Z A;  1E97 A;  2MF7 A;  2W6J H;  4HBR A;  5G2G A;  4RNT A;  4EC6 A;  2RCD A;  3GZY B;  1Q9E A;  3D5G A;  2Z7A A;  3EBY A;  4NHF A;  3NM2 A;  3I56 3;  1E3R A;  1K41 A;  1OPY A;  1GOV A;  2W56 A;  2ZHX B;  1T3B A;  4RBN A;  1GD4 A;  4K1U A;  1LRA A;  1BSD A;  1BVI A;  1R4C A;  1YIJ 3;  2CWV A;  3LT9 A;  3TDG A;  4BIR A;  5JBS A;  1IK3 A;  3FCS B;  3NBR A;  1L5G B;  2RSX A;  1VQM 3;  1BAO A;  1KWI A;  3JUO A;  4HZB B;  3CC7 3;  2C4B A;  4HM7 B;  1VQQ A;  4WYK A;  1FGT A;  1MNL A;  1WQL B;  2HMM B;  1I0X A;  3H3H A;  1BRI A;  2QGU A;  1ULJ B;  3EN1 B;  3WOF B;  1RCL A;  3VSY A;  1WMO A;  2AAD A;  1FUW A;  2M7O A;  1RJO A;  2W04 A;  3V99 A;  3RDE A;  4FCZ A;  2OOV A;  3BND A;  3HZP A;  1B3S A;  3CNX A;  5CF1 A;  2ZL8 A;  5IF6 A;  2F56 A;  2F5M A;  3Q2P A;  1MOL A;  3K9M C;  2BO9 B;  4IT7 A;  1TRQ A;  4KFD A;  3GAX A;  5IG3 A;  3DM8 A;  1RNB A;  2KF3 A;  1YIT 3;  1DMN A;  1WNH A;  1EUI C;  2KF6 A;  3L0R A;  1JZO A;  2C10 A;  3I55 3;  5GSP A;  1ZGX A;  3H51 A;  4MMZ B;  1BRJ A;  1QMA A;  3FZW A;  1N8R 4;  3F8X A;  1ISK A;  4H3U A;  2CFG A;  2CWT A;  2XRX B;  5EVH A;  3AHW A;  2CHC A;  4FMA A;  2W0Q A;  3FSD A;  3JUM A;  4HM4 B;  3NV0 B;  4ILF A;  1W6C A;  3N8B A;  5D81 A;  9RNT A;  2IY2 A;  2ZDJ A;  3GZR A;  1BUQ A;  3X3X A;  1BIR A;  4XDW A;  3FKA A;  3CD6 3;  3AMO B;  1SIH A;  1B2S A;  1OGX A;  2XSH B;  4HM5 B;  3PYJ A;  4KFE A;  1DYU A;  2OWP A;  4EV5 A;  1SPU A;  1W01 A;  4ORL A;  3CCR 3;  2F99 A;  4HM0 B;  1NNV A;  3FLJ A;  2WOH A;  5AYR B;  5HOH A;  1I2E A;  1BRG A;  3HX8 A;  4HM2 B;  4FCM A;  1AY7 A;  1JBR A;  4CJN A;  2F98 A;  3FGY A;  1AQZ A;  1GD3 A;  1RNT A;  5KP4 A;  1IQY A;  2HOH A;  1I3I A;  4HJL B;  3HOH A;  3CXC 2;  1CYU A;  3CCE 3;  4BTX A;  2C11 A;  1V57 A;  2I9W A;  4R9L A;  1Q86 4;  1DMM A;  7RNT A;  1RLS A;  3AGN A;  5HGR A;  1DVD A;  1I3F A;  2SBL A;  1I2G A;  1CH0 A;  3T8U A;  4EV2 A;  1BRH A;  3Q90 A;  3NV0 A;  3U1W A;  3KE7 A;  4QWT A;  4XBX A;  3B4O A;  3NBB A;  2OQE A;  1K8A 4;  1NB5 I;  4BTY A;  2RGQ A;  5M19 A;  1M90 4;  1EQK A;  3AMO A;  1M1K 4;  2KCD A;  1MGR A;  1GY7 A;  2IMJ A;  2ML5 A;  1TJD A;  1FGM A;  4KT3 B;  3X41 A;  1VQ7 3;  1CQS A;  1IDP A;  1MWU A;  3GZB A;  3M8C A;  1NO3 A;  3NBJ A;  4HM6 B;  1O7M B;  2BT3 A;  2UUG C;  5EQL A;  4AKZ A;  1V58 A;  3UL5 A;  2F5W A;  1JKG B;  3EF8 A;  1GYB A;  3EQQ B;  1GY5 A;  1UGI A;  3LTA A;  3A5E A;  3OX9 A;  5IEO A;  3EX9 A;  1W2B 2;  3KFQ C;  1LNH A;  4CDL A;  1DE3 A;  1RCK A;  3EN8 A;  1LOW A;  1IVU A;  1T5Y A;  3DH2 A;  3FF2 A;  5EEO A;  2XH9 A;  3MG2 A;  1YHQ 3;  2XSO B;  3KII A;  2BNG A;  3ER7 A;  3LH4 A;  1UCK A;  3HK4 A;  1W4N A;  1UW1 A;  2GU3 A;  1R4Y A;  1W02 A;  2XFS A;  3UL6 A;  3OW2 2;  1YJN 3;  4DKI A;  1VQL 3;  1ULI B;  2CG1 A;  3MSO A;  5STD A;  1ROV A;  2D42 A;  1AV4 A;  3EHC A;  2ML6 A;  2O3O A;  5IG5 A;  1YGE A;  1A67 A;  3F14 A;  1W6G A;  2JQ5 A;  4WHA A;  1RTU A;  1RGG A;  4FCJ A;  3WMD A;  3DUK A;  2P09 A;  3UJM A;  1JB5 A;  1BSC A;  1RGL A;  1YI2 3;  1KC8 4;  1VQO 3;  3X40 A;  2BMO B;  4NPB A;  4OVM A;  1FA3 A;  1AR0 A;  3GWR A;  4LGQ A;  1TP6 A;  4RNY A;  5AII A;  1TFK A;  2Y73 A;  5CK6 A;  1JKG A;  1GSP A;  3DMC A;  1K28 A;  1X1U A;  3OV4 A;  4HM3 B;  5IG0 A;  3CCV 3;  1BRS A;  1Q82 4;  4U13 A;  2K54 A;  1I70 A;  4HYZ A;  4KVH A;  3LTB A;  3PS8 A;  3NX0 A;  3ZG5 A;  3G4S 3;  4BTW A;  3CC4 3;  4L8P A;  4XBY A;  6STD A;  3ZG0 A;  2CFK A;  2CH9 A;  1BNI A;  1RGH A;  2CWU A;  2O9U X;  1ASK A;  3NQZ A;  3S29 A;  2HML B;  3KCH A;  3B4P A;  3FG4 A;  3UNL A;  3BIR A;  4K1V A;  3SVA A;  1LOY A;  4GSP A;  5LC7 A;  2OCT A;  3X3Y A;  1LOX A;  4EYC A;  1VQP 3;  1B2M A;  1TUH A;  3BNC A;  1Q7Y 4;  4NRE A;  2L4V A;  4O02 B;  3DGL A;  3D9R A;  1TIJ A;  2YFJ B;  1EA2 A;  3V98 A;  3URP A;  5A0O B;  5LC6 A;  4LSO A;  5BIR A;  1UUW B;  8RNT A;  2FXT A;  3DZL A;  5RNT A;  1QVF 2;  1OF5 B;  1W00 A;  1RRL A;  2XR8 B;  1CYV A;  2K3D A;  2XF3 A;  3IPT A;  5CF2 A;  2BMQ B; 
#chains in the Genus database with same CATH homology
 1TU5 A;  1K9M 4;  1NU3 A;  5ELJ A;  3VF1 A;  2P0M A;  1OHO A;  4JRF A;  2OTL 3;  3LZA A;  4XDV A;  3NM7 A;  4XB5 A;  5JPU A;  1A2K A;  2HMN B;  2WGQ A;  1VQN 3;  1TFO A;  3I0Y A;  2W9Q A;  2LQV A;  1PU4 A;  3B8L A;  1W5Z A;  3WA3 A;  1SQW A;  4OK0 A;  2D1W A;  5FGO A;  3DGN A;  3KSE D;  2GU1 A;  1N8Q A;  3K0Z A;  2W2C A;  3CME 3;  1WMN A;  3BNE A;  3A76 A;  1OF5 A;  3Q1C A;  2P0X A;  1RKY A;  3MG1 A;  4WWU C;  2CFD A;  5IEN A;  1O7P B;  4HM1 B;  1VQK 3;  4TX4 A;  2QEX 3;  1VQ5 3;  5D82 A;  2BMR B;  4IIA A;  3SLU A;  1C7H A;  3WOE B;  2GEX A;  4N3V A;  2OOV C;  4L8O A;  1A2V A;  3NHX A;  3VGN A;  5CXO A;  5IG4 A;  2KRT A;  4FMD A;  3LML A;  4KZ1 A;  2CG0 A;  4RNZ A;  3OWU A;  3V92 A;  1Q40 B;  7STD A;  1VQ9 3;  1IVX A;  1NWW A;  4N6V 0;  2GBW B;  3QK9 A;  3GRD A;  2CKF B;  1STD A;  1UI8 A;  2WO0 A;  2UX0 A;  4MMY B;  4WP5 A;  1O7N B;  2CW9 A;  5AYS C;  2IUK A;  4K61 A;  4R1K A;  3KN4 A;  4XBT A;  1HU9 A;  4X2O A;  5D83 A;  1QVG 2;  3EE1 A;  2XFT A;  2W03 A;  4AKY A;  5BVB A;  1ROA A;  1OAC A;  3PXM A;  4KFF A;  2HMJ B;  3LXU X;  1E3V A;  2PZV A;  3SX1 A;  3JUP A;  1PFP A;  4O8S A;  1LVN A;  2B24 B;  4J8T A;  3X42 A;  3JVC A;  1STF I;  2XEP A;  1OCV A;  2PNC A;  4X2H A;  3G71 3;  1GS3 A;  1JB4 A;  1Z1S A;  3WDG B;  2E2U A;  1A90 A;  3G6E 3;  3SOA A;  1IV9 A;  1Q40 A;  3G16 A;  2CFW A;  3JUN A;  3LT8 A;  1NDO B;  3CPO A;  4JF8 A;  1D6Y A;  3K7C A;  3U97 A;  4G1M B;  3DY5 A;  4R9K A;  1OUN A;  3DGM A;  2Z77 A;  4FMC A;  1JV2 B;  4N6U A;  4N6M A;  5AEW B;  2MC8 A;  3F7X A;  4R4K A;  1U5O A;  3CC2 3;  5AIH A;  3FH1 A;  1IQX A;  1FGQ A;  2YFI B;  4AEQ A;  2B1X B;  2OQE C;  1VQ4 3;  2CK3 H;  3FG1 A;  1OHS A;  1FGR A;  1K73 4;  1IT8 A;  1RN7 A;  2Y74 A;  3EJV A;  3G8Z A;  5FW5 A;  4K90 B;  4EBG A;  3S27 A;  1NJI 4;  3F7S A;  3OWY A;  1WTH A;  2GBX B;  2K0M A;  2XGN A;  8CHO A;  3F8H A;  1YJW 3;  1JRQ A;  3F9S A;  1F8N A;  1OGZ A;  3X3Z A;  4N6N B;  5IEP A;  3ALA A;  2GEY A;  2HMK B;  3SED A;  3FF0 A;  3T0U A;  1M1X B;  3DGO A;  4R80 A;  1IVV A;  4LZI A;  4EXR A;  1US1 A;  2P38 A;  3CU3 A;  3KZT A;  5AEU B;  1AVL A;  3NXJ A;  1IT7 A;  1Y4K A;  3ROB A;  1LXE A;  1YVB I;  3CCM 3;  1W2Z A;  2RFR A;  3FG3 A;  5CLK A;  3CCQ 3;  3PZW A;  3OWS A;  4LMI A;  2FNQ A;  1VZZ A;  2CC3 A;  4LEH A;  1QAF A;  4FR9 A;  4L7K A;  5DRV A;  1JB2 A;  4CCV A;  3CPW 2;  3IMA B;  4HM8 B;  1N9E A;  4WFO A;  3O8Y A;  1DVC A;  2F86 B;  5BXQ A;  3NQY A;  1M9G A;  5IW9 A;  5ELU A;  2Z76 A;  3QRD A;  4STD A;  3LOY A;  4HVN A;  1KSI A;  4MJD A;  3N9H A;  4MEI A;  2R4I A;  2P05 A;  1JJ2 2;  1UUV B;  5KP3 A;  4ZM8 A;  1N5P A;  1N5H A;  4O3V A;  2E2V A;  3PCS A;  3LTC A;  3MYT A;  3CCJ 3;  3BLZ A;  3J7Y d;  1EKM A;  2E2T A;  3GZX B;  3MPH A;  2A15 A;  1ZX2 A;  2GXF A;  3PGB A;  1S5A A;  1D6U A;  4Q53 A;  5AI1 A;  1AVK A;  4N6L A;  5IER A;  2XGL A;  3CNM A;  3SOY A;  3WA2 X;  1WMP A;  4H61 A;  5KP1 A;  1HKX A;  1SJW A;  3RGR A;  1YJ9 3;  2IA7 A;  4I4K A;  3HI7 A;  3LTD A;  3MG3 A;  5JPP A;  1O7G B;  2BHM A;  3G0K A;  3RGA A;  1JNQ A;  2WGO A;  2IUJ A;  3MKI A;  5AIF A;  3SXX A;  1GY6 A;  1IV7 A;  2QIY A;  1CEW I;  3N54 B;  2YX9 A;  1N9J A;  1IVW A;  3ECF A;  4N6O B;  1D6Z A;  1OH0 A;  3WOD G;  3MHE A;  1Q42 A;  2FGT A;  1W7C A;  1DMQ A;  3IJE B;  3S67 A;  3PCR A;  3HIG A;  3NUV A;  2HMO B;  1JN5 B;  4OUQ A;  1U8C B;  1J2B A;  4N6T A;  2OTJ 3;  3K5T A;  3STD A;  1IU7 A;  2Z6B A;  3OXA A;  4HZ9 B;  5DRE A;  2STD A;  1O7W B;  3K63 A;  5TGN A;  3UB1 A;  3F40 A;  4GL6 A;  3MWZ A;  3S5C A;  2YFL B;  1S72 3;  5AIG A;  3S28 A;  1FGO A;  1V74 A;  3T8N A;  4MMX B;  1UI7 A;  1OHP A;  4RZM A;  2LYX A;  1W6Y A;  1Q81 4;  1EG9 B;  2W56 B;  3CCU 3;  2KXG A;  2INX A;  3BNB A;  3JUQ A;  3CMA 3;  3BB9 A;  1NB3 I;  1KD1 4;  3EB8 A;  3E99 A;  2JDI H;  1IQ8 A;  3KSP A;  2QA4 3;  3D3L A;  4GB5 A;  2W9P A;  1O7H B;  3EC9 A;  4HKV B;  1JN5 A;  2WOF A;  3CCS 3;  4FMB A;  1RRH A;  4WYK B;  1KQS 2;  3HII A;  3LYG A;  4O2H A;  1VQ8 3;  2Q07 A;  2CFL A;  2V1L A;  1G96 A;  3KKG A;  1VQ6 3;  1SII A;  4J9A A;  1ZO2 A;  4PEJ A;  3CCL 3;  3B7C A;  1QAL A;  2CIU A;  3DXO A;  1QJG A;  4IPB A;  3EBT A;  5I97 A;  1QAK A;  4XM4 A;  1E97 A;  2MF7 A;  2W6J H;  4HBR A;  5G2G A;  4EC6 A;  2RCD A;  3GZY B;  4NHF A;  2Z7A A;  3EBY A;  3NM2 A;  3I56 3;  1E3R A;  1K41 A;  1OPY A;  2W56 A;  4RBN A;  1GD4 A;  4K1U A;  1YIJ 3;  1R4C A;  2CWV A;  3LT9 A;  3TDG A;  5JBS A;  1IK3 A;  3FCS B;  3NBR A;  1L5G B;  2RSX A;  1VQM 3;  3JUO A;  1KWI A;  4HZB B;  3CC7 3;  4HM7 B;  4WYK A;  1FGT A;  1MNL A;  1WQL B;  2HMM B;  3H3H A;  2QGU A;  1ULJ B;  3EN1 B;  3WOF B;  3VSY A;  1WMO A;  1FUW A;  2M7O A;  1RJO A;  2W04 A;  3V99 A;  3RDE A;  4FCZ A;  2OOV A;  3BND A;  3HZP A;  3CNX A;  5CF1 A;  2ZL8 A;  5IF6 A;  3Q2P A;  1MOL A;  3K9M C;  2BO9 B;  4IT7 A;  4KFD A;  3GAX A;  5IG3 A;  3DM8 A;  1YIT 3;  1DMN A;  1WNH A;  3L0R A;  2C10 A;  3I55 3;  3H51 A;  4MMZ B;  1QMA A;  1N8R 4;  3FZW A;  3F8X A;  1ISK A;  4H3U A;  2CFG A;  2CWT A;  2XRX B;  5EVH A;  2CHC A;  4FMA A;  2W0Q A;  3FSD A;  3JUM A;  4HM4 B;  3NV0 B;  1W6C A;  3N8B A;  5D81 A;  2ZDJ A;  3GZR A;  1BUQ A;  3X3X A;  4XDW A;  3FKA A;  3CD6 3;  3AMO B;  1SIH A;  1OGX A;  2XSH B;  4HM5 B;  3PYJ A;  4KFE A;  1DYU A;  2OWP A;  4EV5 A;  1SPU A;  1W01 A;  4ORL A;  3CCR 3;  2F99 A;  4HM0 B;  3FLJ A;  2WOH A;  5AYR B;  3HX8 A;  4HM2 B;  4FCM A;  2F98 A;  3FGY A;  1GD3 A;  5KP4 A;  1IQY A;  4HJL B;  3CXC 2;  1CYU A;  3CCE 3;  4BTX A;  2C11 A;  2I9W A;  4R9L A;  1Q86 4;  1DMM A;  1DVD A;  5HGR A;  2SBL A;  3T8U A;  4EV2 A;  3Q90 A;  3NV0 A;  3U1W A;  3KE7 A;  4QWT A;  4XBX A;  3B4O A;  3NBB A;  2OQE A;  1K8A 4;  1NB5 I;  4BTY A;  2RGQ A;  1M90 4;  1EQK A;  3AMO A;  1M1K 4;  2KCD A;  1GY7 A;  2IMJ A;  2ML5 A;  3X41 A;  1FGM A;  1VQ7 3;  1CQS A;  1IDP A;  3GZB A;  3M8C A;  1NO3 A;  3NBJ A;  4HM6 B;  1O7M B;  2BT3 A;  5EQL A;  4AKZ A;  3UL5 A;  1JKG B;  3EF8 A;  1GYB A;  3EQQ B;  1GY5 A;  3LTA A;  3OX9 A;  5IEO A;  3EX9 A;  1W2B 2;  3KFQ C;  1LNH A;  4CDL A;  3EN8 A;  1IVU A;  1T5Y A;  3FF2 A;  5EEO A;  2XH9 A;  3MG2 A;  1YHQ 3;  2XSO B;  3KII A;  2BNG A;  3ER7 A;  3LH4 A;  3HK4 A;  1W4N A;  1UW1 A;  2GU3 A;  1W02 A;  2XFS A;  3UL6 A;  3OW2 2;  1YJN 3;  1VQL 3;  1ULI B;  2CG1 A;  3MSO A;  5STD A;  1ROV A;  2D42 A;  1AV4 A;  3EHC A;  2ML6 A;  2O3O A;  5IG5 A;  1YGE A;  1A67 A;  3F14 A;  1W6G A;  2JQ5 A;  4WHA A;  4FCJ A;  3WMD A;  3DUK A;  2P09 A;  3UJM A;  1JB5 A;  1YI2 3;  1KC8 4;  1VQO 3;  3X40 A;  2BMO B;  4OVM A;  1FA3 A;  1AR0 A;  3GWR A;  4LGQ A;  1TP6 A;  4RNY A;  5AII A;  1TFK A;  2Y73 A;  5CK6 A;  1JKG A;  3DMC A;  1K28 A;  3OV4 A;  4HM3 B;  5IG0 A;  3CCV 3;  1Q82 4;  4U13 A;  2K54 A;  4HYZ A;  4KVH A;  3LTB A;  3PS8 A;  3NX0 A;  3G4S 3;  4BTW A;  3CC4 3;  4L8P A;  4XBY A;  6STD A;  2CFK A;  2CH9 A;  2CWU A;  2O9U X;  3NQZ A;  3S29 A;  1ASK A;  2HML B;  3B4P A;  3FG4 A;  3UNL A;  4K1V A;  3SVA A;  5LC7 A;  3X3Y A;  1VQP 3;  2OCT A;  1LOX A;  4EYC A;  1TUH A;  3BNC A;  1Q7Y 4;  4NRE A;  2L4V A;  4O02 B;  3DGL A;  3D9R A;  1TIJ A;  2YFJ B;  1EA2 A;  3V98 A;  5A0O B;  5LC6 A;  4LSO A;  1UUW B;  2FXT A;  3DZL A;  1QVF 2;  1OF5 B;  1W00 A;  1RRL A;  2XR8 B;  1CYV A;  2XF3 A;  3IPT A;  5CF2 A;  2BMQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...