1OH0A

Crystal structure of ketosteroid isomerase complexed with equilenin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title High-Resolution Crystal Structures of Delta5-3-Ketosteroid Isomerase with and without a Reaction Intermediate Analogue
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1oh0A00
3B7CA 3GZRA 1TP6A 3EQQB 1OF5B 4K1UA 4LGQA 3GWRA 4X2HA 4J9AA 3T8UA 7STDA 4IIAA 3OWUA 4WYKB 2QGUA 1JB2A 5STDA 8CHOA 1HKXA 1DMMA 3DM8A 3FGYA 4XBYA 2HMKB 3EBTA 3OV4A 5HGRA 3ROBA 1U5OA 4STDA 2IMJA 4HJLB 1ZO2A 1IDPA 2HMMB 3NV0B 4K1VA 3T8NA 1TUHA 2Z77A 3EF8A 3EN8A 2HMOB 5IEOA 5CXOA 3DMCA 3NBRA 3SEDA 5IEPA 3HZPA 3GZYB 1E3RA 1NU3A 2PZVA 5JPPA 2F86B 3FSDA 4HM6B 1UUVB 3OXAA 1GYBA 3G8ZA 2YFJB 3JUPA 2CHCA 4J8TA 3NHXA 1ZX2A 1O7NB 2GEYA 4LMIA 1OUNA 1VZZA 5BVBA 3KSPA 5AEUB 2QIYA 3F7XA 2OWPA 2RFRA 3MG2A 1E97A 3M8CA 5IF6A 1W6YA 1Q40A 2Z7AA 3DUKA 6STDA 3MSOA 1NWWA 3F8HA 4HM4B 3STDA 4HZBB 1EG9B 3JUNA 1STDA 3F40A 4XB5A 4XDWA 3MYTA 3CU3A 2BMQB 3CPOA 1ISKA 2INXA 2R4IA 4CDLA 5IG3A 5D82A 4XDVA 2BMRB 5D81A 1OHPA 3RGRA 1JN5B 1W01A 3HK4A 1A2KA 1ASKA 1JKGB 2BNGA 4Q53A 5AIGA 5EVHA 2STDA 1OF5A 4PEJA 3EJVA 1JB5A 5DREA 3OX9A 5AIIA 3F7SA 3F8XA 4WYKA 4U13A 2I9WA 3EC9A 3K0ZA 1ULJB 3GZXB 4HZ9B 3FF2A 4HM7B 3KZTA 1GY6A 5IG4A 2UX0A 4GB5A 5FW5A 3VSYA 3B8LA 2XRXB 3JUOA 4OVMA 2YFLB 3NV0A 4HM1B 5CF1A 3NXJA 5CF2A 4HM8B 2XSOB 5CK6A 5D83A 5DRVA 3ECFA 1CQSA 2BMOB 1DMNA 3WMDA 4X2OA 3H3HA 3NUVA 2HMNB 1W00A 5CLKA 3Q90A 4R9KA 3DXOA 2GBWB 2GXFA 4WWUC 2GEXA 3IPTA 1OPYA 2CKFB 5IERA 3MG1A 1Z1SA 4L8OA 3GZBA 5IENA 3UNLA 2GBXB 3K7CA 4HM3B 3HX8A 3SOAA 2B24B 3UJMA 1ULIB 4FCJA 3ER7A 4L8PA 2W2CA 1OGZA 4N3VA 1O7WB 4XBXA 1QJGA 2RCDA 4H3UA 5AIHA 2HMJB 3A76A 5KP3A 1OH0A 3MHEA 4HVNA 2F98A 4XBTA 3JUMA 1OGXA 3OWYA 3FLJA 5IG0A 3B4PA 5BXQA 3B4OA 1O7GB 5KP1A 2F99A 1Q42A 2Z76A 3RGAA 2HMLB 3EHCA 4HKVB 3EN1B 1O7MB 3MG3A 4HM5B 3SOYA 3CNMA 3FF0A 1W02A 3NM2A 1JN5A 3D9RA 3S5CA 4OUQA 4MJDA 5AI1A 1JKGA 5G2GA 5TGNA 1EA2A 4R9LA 1E3VA 3KE7A 4HM2B 3BB9A 1GY5A 2YFIB 3I0YA 5JPUA 3LYGA 5AIFA 4FCMA 4HM0B 1O7HB 4I4KA 1QMAA 4RZMA 3FZWA 3EBYA 1O7PB 1DMQA 3EX9A 4LEHA 1K41A 4XM4A 3JUQA 4R1KA 3H51A 3CNXA 1GS3A 3F9SA 1AR0A 3G0KA 1C7HA 3BLZA 1UUWB 2XR8B 2K54A 1OHOA 1Q40B 1SJWA 4ORLA 4WP5A 1JB4A 1BUQA 1NDOB 3OWSA 5IG5A 3E99A 3DZLA 1S5AA 3G16A 2A15A 1GY7A 3MKIA 5KP4A 3FKAA 2XSHB 3FH1A 3F14A 1WQLB 4L7KA 3KKGA 2JQ5A 4KVHA 2RGQA 3GRDA 3VGNA 5AEWB 1OCVA 2B1XB 3LZAA 1OHSA
chains in the Genus database with same CATH superfamily
2L4VA 2SBLA 1RN1A 2OQEC 1LRAA 1IT7A 4HAAA 1Q814 1V74A 1RLSA 3K5TA 1I70A 3X3XA 3B7CA 1W2B2 1TRPA 2P38A 1UCJA 4KFDA 4N6V0 2GU1A 4EC6A 2XH9A 1B20A 2RSXA 1RNBA 3GZRA 1W4NA 1VQL3 2C11A 1TP6A 1M9GA 4O8SA 3EQQB 1OF5B 4K1UA 4MMZB 4LGQA 4TX4A 1FUWA 3GWRA 1YJ93 3D4AA 3G4S3 1IQ8A 3CCV3 2W6JH 4X2HA 1ZS7A 4J9AA 3T8UA 1J2BA 3X41A 7STDA 1RKYA 4IIAA 1K28A 3OWUA 2QGUA 1JB2A 4WYKB 2IUJA 3PS8A 1MGWA 4ZM8A 1Q824 5STDA 8CHOA 1IT8A 1HKXA 1DMMA 1AQZA 2C10A 3DM8A 3D5IA 3FGYA 3V98A 4XBYA 2HMKB 3EBTA 1G02A 3OV4A 1VQK3 1A2VA 5ELUA 3DGYA 1RGAA 3NBBA 4O3VA 3CC23 1RGCA 5HGRA 1JBRA 4CPKA 3ROBA 2BO9B 5M1AA 1K9M4 4GHOA 1U5OA 2QEX3 1AVLA 4STDA 1RGKA 1LOXA 2H0GA 2IMJA 4HJLB 1ZO2A 1RRLA 1T2HA 6GSPA 3K63A 1IU7A 1IDPA 3G6E3 2HMMB 2KAAA 3NV0B 1WTHA 5BU4A 5ELJA 3PZWA 1MNLA 3PXMA 1I0XA 3LH4A 2ZL8A 1BNFA 4K1VA 1B3SA 3BU4A 1RGHA 3LT9A 1TUHA 1X1WA 2Z77A 3PGBA 3T8NA 1IVWA 1PFPA 1W5ZA 3EF8A 3EN8A 1RRHA 3SXXA 3CCQ3 1W6CA 2HMOB 3GSPA 5IW9A 1DVDA 1NB5I 5IEOA 1D6ZA 5G1KA 2GU3A 1QVG2 4BTWA 1W2ZA 4N6NB 5G1LA 3FG1A 3DH2A 3Q1CA 1L5GB 5CXOA 3DMCA 1BU4A 2KRTA 3NBRA 4BIRA 1T2IA 2WGQA 3SEDA 5IEPA 2UUGC 1UDII 3VF1A 1HU9A 5M18A 3KIIA 1Q9EA 3HZPA 1VQQA 3U1WA 4CJNA 1UGIA 3GZYB 2CX0A 4N6OB 1E3RA 1NU3A 1UGHI 1GSPA 2PZVA 3Q3FA 5JPPA 2CFLA 3AHSA 4H61A 3WA2X 1VQ83 2CG0A 2CK3H 2ZA4A 2HOHA 4FCZA 2F86B 2XFSA 3FSDA 4HM6B 1UUVB 2W03A 1GYBA 3IMAB 1SIIA 2AADA 2CC3A 3OXAA 3G8ZA 2YFJB 3JUPA 1BAOA 3LOYA 1A67A 2CHCA 4J8TA 4LZIA 3MWZA 1FGOA 3WHOA 1LOVA 2XGLA 3U97A 2AAEA 3FCSB 4AEQA 3CCE3 5LC6A 3NHXA 1ZX2A 1I8VA 1IVVA 3URPA 1BNIA 2XGNA 1X1YA 1EKMA 1SIHA 1O7NB 2GEYA 1M1XB 2E2UA 4KZ1A 4LMIA 1OUNA 1NO3A 1VZZA 2ZDJA 3V99A 5BVBA 3KSPA 5AEUB 1RGFA 4FMDA 3MPHA 2QIYA 1W7CA 3F7XA 4WHAA 1QAFA 1VQ93 2OWPA 3RNTA 2RFRA 1AV4A 3MG2A 3Q2PA 4EXRA 5JBSA 1YHQ3 1E97A 3M8CA 2F5WA 3CC73 5IF6A 1YJN3 1W6YA 1JZOA 1R4CA 2K3DA 1Q7Y4 1Y4KA 5I97A 3WOFB 1A2PA 1Q40A 4RNZA 1N5HA 2Z7AA 3DUKA 3NBJA 4QWTA 2IA7A 6STDA 3MSOA 1V57A 1NWWA 5M19A 3F8HA 1RCLA 3LTBA 2JDIH 4HM4B 1MWUA 2IY2A 1N9JA 3STDA 3T0UA 2CWTA 4HZBB 3FG3A 2D42A 1EG9B 3JUNA 3NX0A 1STDA 3F40A 2CFDA 3I563 4AKZA 4XB5A 4XDWA 3MYTA 2XFTA 3WODG 1BRIA 1OACA 1BOXA 3CU3A 2W04A 5AYRB 5A0OB 1BSDA 1BIRA 2CH9A 3CD63 1BNRA 2BMQB 3CPOA 4N6LA 2INXA 2R4IA 1ISKA 3BNCA 5FGOA 4KFEA 2Q07A 4CDLA 5IG3A 1BSEA 1BRJA 2OCTA 3AHWA 4GSPA 1CH0A 1N8QA 3FG4A 5GSPA 1JV2B 5D82A 1VQ53 2RBIA 4XDVA 1IVUA 2BMRB 3UL5A 2P09A 1ROAA 4R4KA 5D81A 3N9HA 4AKYA 5RNTA 1OHPA 1V58A 4R80A 3RGRA 1S723 1JN5B 1C54A 1A90A 3I553 1IVXA 1W01A 3HK4A 1RGEA 4G1MB 4N6MA 1A2KA 3SVAA 1RSNA 4EV2A 3CCL3 1KC84 1ASKA 1JKGB 2BNGA 4Q53A 5AIGA 1F8NA 5EVHA 1EQKA 4MMYB 1IQYA 1PU4A 2STDA 1YIT3 1IQXA 1R4YA 1BRGA 4MMXB 2CFKA 1OF5A 1QVF2 4PEJA 2OOVA 3EJVA 1RN4A 1JB5A 1TIJA 2BU4A 4N6UA 1BRKA 5DREA 4OK0A 3OX9A 4EYCA 1BRNL 3LTCA 5AIIA 3IJEB 4HYZA 1JRQA 1GMQA 3SYUA 2P05A 4IPBA 1U8CB 3F7SA 3F8XA 4WYKA 1BSBA 3LTAA 4U13A 2LYXA 2R41A 1YI23 2CWUA 2I9WA 2SARA 3EC9A 1VQ73 6RNTA 2CFGA 3K0ZA 3X3ZA 1ULJB 2P0MA 2Y73A 3GZXB 4HZ9B 1FYSA 3FF2A 1CYVA 4HM7B 1MWTA 2L1SA 3KZTA 1BNJA 2KCDA 1N8R4 1IYYA 3KSED 4O2HA 1GY6A 5IG4A 1N5PA 1YGWA 5EQLA 1MWRA 1TJDA 2UX0A 1TFOA 2ML6A 4GB5A 3AGNA 5FW5A 3VSYA 1RCKA 1ZGXA 2WGOA 3B8LA 2XRXB 3JUOA 3N8BA 1EEJA 1YGEA 4LYLB 4OVMA 2YFLB 3NV0A 4BL3A 1I3FA 1VQP3 1FUSA 1JZDA 4HM1B 1DETA 3CCR3 5CF1A 4GL6A 3NXJA 9RNTA 3S67A 4BL2A 5CF2A 4HM8B 2XSOB 5CK6A 5D83A 2Z6BA 1STFI 1HZ1A 1VQM3 5DRVA 1GMPA 3ECFA 4BU4A 1CQSA 3BNEA 2BMOB 1BNSA 1I2FA 1DMNA 2P0XA 3A5EA 3WMDA 4X2OA 1PY3A 1NJI4 3H3HA 1BSAA 1LQGC 3CXC2 1BSCA 1UW1A 3NUVA 2W56B 3X40A 2YX9A 1RGGA 2WOFA 1AY7A 1T3BA 2HMNB 1W00A 1N9EA 3LTDA 4RNYA 5CLKA 1RMSA 3Q90A 1FUTA 4R9KA 4BTXA 3DXOA 2GBWB 2GXFA 3LT8A 3KCHA 3WDGB 4WWUC 1GOVA 2GEXA 3IPTA 1OPYA 1JJ22 2CKFB 5IERA 3BNBA 1X1XA 3MG1A 1Z1SA 3QRDA 4N6TA 4L8OA 3N54B 2CW9A 3GZBA 3AMOB 1B2MA 5IENA 1G0TA 4K90B 3CCJ3 1FGMA 3UNLA 3D3LA 1M1K4 1NB3I 3QK9A 4EBGA 4JF8A 2GBXB 1IV9A 3K7CA 3L0RA 1SARA 1MOLA 2J8XB 4HM3B 3D5GA 1UUGB 1ROVA 2CWVA 2KF4A 3HX8A 3SOAA 3BIRA 5LC7A 2H0IA 1YVSA 3AGOA 2B24B 3ZG5A 1TTOA 2XEPA 1KD14 3CC43 2W9PA 3LXUX 3KN4A 3UJMA 4FR9A 3UL6A 1ULIB 2W9QA 4FCJA 1BUJA 3ER7A 3NQYA 1WMPA 4IT7A 4L8PA 1BNGA 1DE3A 3V92A 2OQEA 3TDGA 4O02B 1B2XA 1KWIA 2W2CA 1LQMB 1OGZA 1YNVX 2O9UX 4EW5A 4N3VA 1GOUA 3PCSA 1O7WB 1JBSA 4FMAA 4XBXA 3HOHA 1QJGA 2CX1A 2RCDA 4H3UA 1DVCA 1EUIC 2W0QA 5AIHA 2HMJB 1BGSA 3NQZA 1UCLA 3A76A 3PCRA 1SQWA 3J7Yd 3OW22 5KP3A 3DGLA 1CEWI 1BANA 1OH0A 2XF3A 3MHEA 5EEOA 1TRQA 7GSPA 4KFFA 1MGRA 4HVNA 2F98A 4XBTA 2Y74A 2O3OA 3JUMA 1OGXA 2UGIA 3OWYA 3SLUA 1YIJ3 3FLJA 5IG0A 1VQ63 1UI8A 1FGTA 3B4PA 3B4OA 5BXQA 3DGOA 1D6UA 1KSIA 1FA3A 2E2VA 1O7GB 5KP1A 2F99A 1LNHA 2IYJA 1Q42A 2Z76A 3RGAA 2HMLB 3EHCA 4HKVB 3EN1B 1D6YA 1O7MB 1HYFA 1UCIA 3MG3A 2PNCA 4HM5B 3CNMA 1LNIA 3S28A 3FF0A 3SOYA 1W02A 2ZHXB 5AYSC 2FNQA 2OTL3 3NM2A 3EB8A 1JN5A 1RTUA 3D9RA 4MEIA 1VQN3 2RNTA 3X3YA 1FZUA 1GD3A 3S5CA 2K0MA 4OUQA 4MJDA 1RDSA 2WO0A 2ML5A 2OOVC 4RNTA 1RHLA 3EE1A 5AI1A 3HIIA 3SX1A 1JKGA 5G2GA 3WR2A 1GD4A 5TGNA 2BHMA 1B2UA 2E2TA 1BRHA 1EA2A 1I2EA 2KXGA 4R9LA 2KF3A 1E3VA 3KE7A 1X1UA 3S27A 1FW7A 1G96A 2FXTA 4HM2B 2C4BA 1GOYA 1TU5A 3BB9A 1QALA 1WNHA 1W6GA 1GY5A 1I0VA 2YFIB 1K8A4 4HBRA 3I0YA 5JPUA 3LYGA 1B2ZA 4I5QA 5AIFA 2MC8A 3ZG0A 1BVIA 1RNTA 1LXEA 4FMCA 1BRSA 2LQVA 2IUKA 3HIGA 2KF5A 4FCMA 4HM0B 2QA43 1O7HB 4I4KA 3JVCA 3DGMA 1QMAA 4RZMA 1LOYA 2MF7A 3FZWA 3EBYA 1AVKA 1O7PB 1RGLA 2BT3A 4NPBA 3LMLA 3S29A 1I3IA 1VQO3 1DMQA 3EX9A 2GSPA 4LEHA 1IV7A 2H0HA 3CCS3 3CMA3 5BIRA 1K41A 1GMRA 4NHFA 3RDEA 1RJOA 3DY5A 3JUQA 4XM4A 2F56A 3DGNA 3PYJA 4R1KA 3CPW2 1T5YA 2FGTA 3H51A 1WMOA 4WFOA 3KFQC 1B27A 3X42A 1Q864 3CNXA 2CFWA 3ALAA 3CME3 2V1LA 2F5MA 4K61A 5HOHA 1GS3A 1BNEA 3F9SA 2M7OA 4BTYA 1NNVA 3GAXA 1AR0A 3G0KA 1DYUA 1C7HA 3O8YA 1B2SA 4DKIA 3BLZA 1M904 1UUWB 3NM7A 2XR8B 1B21A 4HOHA 2K54A 2WOHA 1K734 1I2GA 1UCKA 1OHOA 4J5GA 1YJW3 8RNTA 4RBNA 1Q40B 1SJWA 4ORLA 2BIRA 3K9MC 2CG1A 1FGRA 4WP5A 3ZFZA 1JB4A 1VQ43 2W56A 4ILFA 1BUQA 4CCVA 1KQS2 1NDOB 3OWSA 5IG5A 2OTJ3 3E99A 3DZLA 1S5AA 1CYUA 3D79A 4JRFA 3CCM3 3G16A 2F4YA 2A15A 1GY7A 3MKIA 5KP4A 1RN7A 4NREA 7RNTA 1YVBI 4EV5A 1SPUA 1JBTA 3AMOA 3FKAA 2XSHB 1UI7A 3FH1A 1LVNA 1TFKA 4J5KA 2D1WA 1WMNA 3HI7A 4FMBA 1IK3A 3F14A 1WQLB 1Q7HA 4L7KA 3KKGA 1PYLA 1US1A 2JQ5A 3CCU3 1MWSA 1QAKA 3WOEB 1JNQA 3BNDA 4KVHA 2RGQA 2CIUA 3GRDA 3VGNA 5AEWB 3UB1A 3WA3A 1FGQA 2KF6A 3G713 1OCVA 2B1XB 1LOWA 3LZAA 1OHSA 4LSOA 4KT3B
chains in the Genus database with same CATH topology
2L4VA 2SBLA 2OQEC 1IT7A 1Q814 1V74A 3K5TA 3X3XA 3B7CA 1W2B2 2P38A 4KFDA 4N6V0 2GU1A 4EC6A 2XH9A 2RSXA 3GZRA 1W4NA 1VQL3 2C11A 1TP6A 1M9GA 4O8SA 3EQQB 1OF5B 4K1UA 4MMZB 4LGQA 4TX4A 1FUWA 3GWRA 1YJ93 3G4S3 1IQ8A 3CCV3 2W6JH 4X2HA 4J9AA 3T8UA 1J2BA 3X41A 7STDA 1RKYA 4IIAA 1K28A 3OWUA 2QGUA 1JB2A 4WYKB 2IUJA 3PS8A 4ZM8A 1Q824 5STDA 8CHOA 1IT8A 1HKXA 1DMMA 2C10A 3DM8A 3FGYA 3V98A 4XBYA 2HMKB 3EBTA 3OV4A 1VQK3 1A2VA 5ELUA 3NBBA 3CC23 4O3VA 5HGRA 3ROBA 2BO9B 1K9M4 1U5OA 2QEX3 1AVLA 4STDA 1LOXA 2IMJA 4HJLB 1ZO2A 1RRLA 3K63A 1IU7A 1IDPA 3G6E3 2HMMB 3NV0B 1WTHA 5ELJA 3PZWA 1MNLA 3PXMA 3LH4A 2ZL8A 4K1VA 3PGBA 3LT9A 1TUHA 2Z77A 3T8NA 1IVWA 1PFPA 1W5ZA 3EF8A 3EN8A 1RRHA 3SXXA 3CCQ3 1W6CA 2HMOB 5IW9A 1DVDA 1NB5I 5IEOA 1D6ZA 2GU3A 1QVG2 4BTWA 1W2ZA 4N6NB 3FG1A 3Q1CA 1L5GB 5CXOA 3DMCA 2KRTA 3NBRA 2WGQA 3SEDA 5IEPA 3VF1A 1HU9A 3KIIA 3HZPA 3U1WA 3GZYB 4N6OB 1E3RA 1NU3A 2PZVA 5JPPA 2CFLA 4H61A 3WA2X 1VQ83 2CG0A 2CK3H 4FCZA 2F86B 2XFSA 3FSDA 4HM6B 1UUVB 2W03A 1GYBA 3IMAB 1SIIA 3OXAA 2CC3A 3G8ZA 2YFJB 3JUPA 3LOYA 1A67A 2CHCA 4J8TA 4LZIA 3MWZA 1FGOA 2XGLA 3U97A 3FCSB 4AEQA 3CCE3 5LC6A 3NHXA 1ZX2A 1IVVA 2XGNA 1EKMA 1SIHA 1O7NB 2GEYA 1M1XB 2E2UA 4KZ1A 4LMIA 1OUNA 1NO3A 1VZZA 2ZDJA 3V99A 5BVBA 3KSPA 5AEUB 4FMDA 3MPHA 2QIYA 1W7CA 3F7XA 4WHAA 1QAFA 1VQ93 2OWPA 4EXRA 2RFRA 1AV4A 3MG2A 3Q2PA 1YHQ3 5JBSA 1E97A 3M8CA 3CC73 5IF6A 1YJN3 1W6YA 1R4CA 1Q7Y4 1Y4KA 5I97A 3WOFB 1Q40A 4RNZA 1N5HA 2Z7AA 3DUKA 3NBJA 4QWTA 2IA7A 6STDA 3MSOA 1NWWA 3F8HA 3LTBA 2JDIH 4HM4B 1N9JA 3STDA 3T0UA 2CWTA 4HZBB 3FG3A 2D42A 1EG9B 3JUNA 3NX0A 1STDA 3F40A 2CFDA 3I563 4AKZA 4XB5A 4XDWA 3MYTA 2XFTA 3WODG 1OACA 3CU3A 5A0OB 2W04A 5AYRB 2CH9A 3CD63 2BMQB 3CPOA 4N6LA 2INXA 2R4IA 1ISKA 3BNCA 5FGOA 4KFEA 2Q07A 4CDLA 5IG3A 2OCTA 1N8QA 3FG4A 1JV2B 5D82A 1VQ53 4XDVA 1IVUA 2BMRB 3UL5A 2P09A 1ROAA 4R4KA 5D81A 3N9HA 4AKYA 1OHPA 4R80A 1S723 3RGRA 1JN5B 1A90A 3I553 1IVXA 1W01A 3HK4A 4G1MB 4N6MA 1KC84 1A2KA 3SVAA 4EV2A 3CCL3 1ASKA 1JKGB 2BNGA 4Q53A 5AIGA 1F8NA 5EVHA 1EQKA 4MMYB 1IQYA 1PU4A 2STDA 1YIT3 1IQXA 4MMXB 2CFKA 1OF5A 1QVF2 4PEJA 2OOVA 3EJVA 1JB5A 1TIJA 4N6UA 5DREA 4OK0A 3OX9A 4EYCA 3LTCA 5AIIA 3IJEB 4HYZA 1JRQA 2P05A 4IPBA 1U8CB 3F7SA 3F8XA 4WYKA 3LTAA 4U13A 2LYXA 1YI23 2CWUA 2I9WA 3EC9A 1VQ73 2CFGA 3K0ZA 3X3ZA 1ULJB 2P0MA 2Y73A 3GZXB 4HZ9B 3FF2A 1CYVA 4HM7B 3KZTA 2KCDA 1N8R4 3KSED 4O2HA 1GY6A 5IG4A 1N5PA 5EQLA 2UX0A 1TFOA 2ML6A 4GB5A 5FW5A 3VSYA 2WGOA 3B8LA 2XRXB 3JUOA 3N8BA 4OVMA 1YGEA 2YFLB 3NV0A 1VQP3 4HM1B 3CCR3 5CF1A 4GL6A 3NXJA 3S67A 5CF2A 4HM8B 2XSOB 5CK6A 5D83A 2Z6BA 1STFI 1VQM3 5DRVA 3ECFA 1CQSA 3BNEA 2BMOB 1DMNA 2P0XA 3WMDA 4X2OA 1NJI4 3H3HA 3CXC2 1UW1A 3NUVA 2W56B 3X40A 2YX9A 2WOFA 2HMNB 1W00A 1N9EA 3LTDA 4RNYA 5CLKA 4BTXA 3Q90A 4R9KA 3DXOA 2GBWB 2GXFA 3LT8A 3WDGB 4WWUC 2GEXA 3IPTA 1OPYA 1JJ22 2CKFB 5IERA 3BNBA 3MG1A 3QRDA 1Z1SA 4N6TA 4L8OA 3N54B 2CW9A 3GZBA 3AMOB 5IENA 4K90B 3CCJ3 1FGMA 3UNLA 3D3LA 1M1K4 1NB3I 3QK9A 4EBGA 4JF8A 2GBXB 1IV9A 3K7CA 3L0RA 1MOLA 4HM3B 2CWVA 1ROVA 3HX8A 3SOAA 5LC7A 2B24B 2XEPA 1KD14 3CC43 2W9PA 3LXUX 3KN4A 3UJMA 4FR9A 3UL6A 1ULIB 2W9QA 4FCJA 3ER7A 3NQYA 1WMPA 4IT7A 4L8PA 3V92A 2OQEA 3TDGA 4O02B 1KWIA 2W2CA 1OGZA 2O9UX 4N3VA 3PCSA 1O7WB 4FMAA 4XBXA 1QJGA 2RCDA 4H3UA 1DVCA 2W0QA 5AIHA 2HMJB 3NQZA 3A76A 3PCRA 1SQWA 3J7Yd 3OW22 5KP3A 3DGLA 1CEWI 1OH0A 2XF3A 3MHEA 5EEOA 4KFFA 4HVNA 2F98A 4XBTA 2Y74A 2O3OA 3JUMA 1OGXA 3OWYA 3SLUA 1YIJ3 3FLJA 5IG0A 1VQ63 3B4PA 1UI8A 1FGTA 3B4OA 5BXQA 3DGOA 1D6UA 1KSIA 1FA3A 2E2VA 1O7GB 5KP1A 2F99A 1LNHA 1Q42A 2Z76A 3RGAA 2HMLB 3EHCA 4HKVB 3EN1B 1D6YA 1O7MB 3MG3A 3S28A 2PNCA 4HM5B 3CNMA 3SOYA 3FF0A 1W02A 5AYSC 2FNQA 2OTL3 3NM2A 3EB8A 1JN5A 3D9RA 4MEIA 1VQN3 3X3YA 1GD3A 3S5CA 2K0MA 4OUQA 4MJDA 2WO0A 2ML5A 2OOVC 3EE1A 5AI1A 3HIIA 3SX1A 1JKGA 5G2GA 1GD4A 5TGNA 2BHMA 2E2TA 1EA2A 4R9LA 2KXGA 1E3VA 3KE7A 3S27A 1G96A 2FXTA 4HM2B 1TU5A 3BB9A 1QALA 1WNHA 1W6GA 1GY5A 2YFIB 1K8A4 4HBRA 3I0YA 5JPUA 3LYGA 2MC8A 5AIFA 1LXEA 4FMCA 2LQVA 2IUKA 3HIGA 4FCMA 4HM0B 2QA43 1O7HB 4I4KA 3JVCA 3DGMA 1QMAA 4RZMA 2MF7A 3FZWA 3EBYA 1AVKA 1O7PB 2BT3A 3LMLA 3S29A 1VQO3 1DMQA 3EX9A 4LEHA 1IV7A 3CCS3 3CMA3 1K41A 4NHFA 3RDEA 1RJOA 3DY5A 3JUQA 4XM4A 3DGNA 3PYJA 4R1KA 3CPW2 1T5YA 2FGTA 3H51A 1WMOA 4WFOA 3KFQC 1Q864 3X42A 3CNXA 2CFWA 3ALAA 3CME3 2V1LA 4K61A 1GS3A 3F9SA 2M7OA 4BTYA 3GAXA 1AR0A 3G0KA 1DYUA 1C7HA 3O8YA 3BLZA 1M904 1UUWB 3NM7A 2XR8B 2K54A 2WOHA 1K734 1OHOA 1YJW3 4RBNA 1Q40B 1SJWA 4ORLA 2CG1A 3K9MC 1FGRA 4WP5A 1JB4A 1VQ43 2W56A 1BUQA 4CCVA 1KQS2 1NDOB 3OWSA 5IG5A 2OTJ3 3E99A 3DZLA 1S5AA 1CYUA 4JRFA 3CCM3 3G16A 2A15A 1GY7A 3MKIA 5KP4A 1RN7A 4NREA 1YVBI 4EV5A 1SPUA 3AMOA 3FKAA 2XSHB 1UI7A 3FH1A 1LVNA 1TFKA 1IK3A 2D1WA 1WMNA 3HI7A 4FMBA 3F14A 1WQLB 4L7KA 3KKGA 1US1A 2JQ5A 1QAKA 3WOEB 1JNQA 3BNDA 4KVHA 2RGQA 2CIUA 3GRDA 3VGNA 5AEWB 3UB1A 3WA3A 1FGQA 3G713 1OCVA 2B1XB 3CCU3 3LZAA 1OHSA 4LSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7C A;  3GZR A;  1TP6 A;  3EQQ B;  1OF5 B;  4K1U A;  4LGQ A;  3GWR A;  4X2H A;  4J9A A;  3T8U A;  7STD A;  4IIA A;  3OWU A;  4WYK B;  2QGU A;  1JB2 A;  5STD A;  8CHO A;  1HKX A;  1DMM A;  3DM8 A;  3FGY A;  4XBY A;  2HMK B;  3EBT A;  3OV4 A;  5HGR A;  3ROB A;  1U5O A;  4STD A;  2IMJ A;  4HJL B;  1ZO2 A;  1IDP A;  2HMM B;  3NV0 B;  4K1V A;  3T8N A;  1TUH A;  2Z77 A;  3EF8 A;  3EN8 A;  2HMO B;  5IEO A;  5CXO A;  3DMC A;  3NBR A;  3SED A;  5IEP A;  3HZP A;  3GZY B;  1E3R A;  1NU3 A;  2PZV A;  5JPP A;  2F86 B;  3FSD A;  4HM6 B;  1UUV B;  3OXA A;  1GYB A;  3G8Z A;  2YFJ B;  3JUP A;  2CHC A;  4J8T A;  3NHX A;  1ZX2 A;  1O7N B;  2GEY A;  4LMI A;  1OUN A;  1VZZ A;  5BVB A;  3KSP A;  5AEU B;  2QIY A;  3F7X A;  2OWP A;  2RFR A;  3MG2 A;  1E97 A;  3M8C A;  5IF6 A;  1W6Y A;  1Q40 A;  2Z7A A;  3DUK A;  6STD A;  3MSO A;  1NWW A;  3F8H A;  4HM4 B;  3STD A;  4HZB B;  1EG9 B;  3JUN A;  1STD A;  3F40 A;  4XB5 A;  4XDW A;  3MYT A;  3CU3 A;  2BMQ B;  3CPO A;  1ISK A;  2INX A;  2R4I A;  4CDL A;  5IG3 A;  5D82 A;  4XDV A;  2BMR B;  5D81 A;  1OHP A;  3RGR A;  1JN5 B;  1W01 A;  3HK4 A;  1A2K A;  1ASK A;  1JKG B;  2BNG A;  4Q53 A;  5AIG A;  5EVH A;  2STD A;  1OF5 A;  4PEJ A;  3EJV A;  1JB5 A;  5DRE A;  3OX9 A;  5AII A;  3F7S A;  3F8X A;  4WYK A;  4U13 A;  2I9W A;  3EC9 A;  3K0Z A;  1ULJ B;  3GZX B;  4HZ9 B;  3FF2 A;  4HM7 B;  3KZT A;  1GY6 A;  5IG4 A;  2UX0 A;  4GB5 A;  5FW5 A;  3VSY A;  3B8L A;  2XRX B;  3JUO A;  4OVM A;  2YFL B;  3NV0 A;  4HM1 B;  5CF1 A;  3NXJ A;  5CF2 A;  4HM8 B;  2XSO B;  5CK6 A;  5D83 A;  5DRV A;  3ECF A;  1CQS A;  2BMO B;  1DMN A;  3WMD A;  4X2O A;  3H3H A;  3NUV A;  2HMN B;  1W00 A;  5CLK A;  3Q90 A;  4R9K A;  3DXO A;  2GBW B;  2GXF A;  4WWU C;  2GEX A;  3IPT A;  1OPY A;  2CKF B;  5IER A;  3MG1 A;  1Z1S A;  4L8O A;  3GZB A;  5IEN A;  3UNL A;  2GBX B;  3K7C A;  4HM3 B;  3HX8 A;  3SOA A;  2B24 B;  3UJM A;  1ULI B;  4FCJ A;  3ER7 A;  4L8P A;  2W2C A;  1OGZ A;  4N3V A;  1O7W B;  4XBX A;  1QJG A;  2RCD A;  4H3U A;  5AIH A;  2HMJ B;  3A76 A;  5KP3 A;  1OH0 A;  3MHE A;  4HVN A;  2F98 A;  4XBT A;  3JUM A;  1OGX A;  3OWY A;  3FLJ A;  5IG0 A;  3B4P A;  5BXQ A;  3B4O A;  1O7G B;  5KP1 A;  2F99 A;  1Q42 A;  2Z76 A;  3RGA A;  2HML B;  3EHC A;  4HKV B;  3EN1 B;  1O7M B;  3MG3 A;  4HM5 B;  3SOY A;  3CNM A;  3FF0 A;  1W02 A;  3NM2 A;  1JN5 A;  3D9R A;  3S5C A;  4OUQ A;  4MJD A;  5AI1 A;  1JKG A;  5G2G A;  5TGN A;  1EA2 A;  4R9L A;  1E3V A;  3KE7 A;  4HM2 B;  3BB9 A;  1GY5 A;  2YFI B;  3I0Y A;  5JPU A;  3LYG A;  5AIF A;  4FCM A;  4HM0 B;  1O7H B;  4I4K A;  1QMA A;  4RZM A;  3FZW A;  3EBY A;  1O7P B;  1DMQ A;  3EX9 A;  4LEH A;  1K41 A;  4XM4 A;  3JUQ A;  4R1K A;  3H51 A;  3CNX A;  1GS3 A;  3F9S A;  1AR0 A;  3G0K A;  1C7H A;  3BLZ A;  1UUW B;  2XR8 B;  2K54 A;  1OHO A;  1Q40 B;  1SJW A;  4ORL A;  4WP5 A;  1JB4 A;  1BUQ A;  1NDO B;  3OWS A;  5IG5 A;  3E99 A;  3DZL A;  1S5A A;  3G16 A;  2A15 A;  1GY7 A;  3MKI A;  5KP4 A;  3FKA A;  2XSH B;  3FH1 A;  3F14 A;  1WQL B;  4L7K A;  3KKG A;  2JQ5 A;  4KVH A;  2RGQ A;  3GRD A;  3VGN A;  5AEW B;  1OCV A;  2B1X B;  3LZA A;  1OHS A; 
#chains in the Genus database with same CATH topology
 2L4V A;  2SBL A;  1RN1 A;  2OQE C;  1LRA A;  1IT7 A;  4HAA A;  1Q81 4;  1V74 A;  1RLS A;  3K5T A;  1I70 A;  3X3X A;  3B7C A;  1W2B 2;  1TRP A;  2P38 A;  1UCJ A;  4KFD A;  4N6V 0;  2GU1 A;  4EC6 A;  2XH9 A;  1B20 A;  2RSX A;  1RNB A;  3GZR A;  1W4N A;  1VQL 3;  2C11 A;  1TP6 A;  1M9G A;  4O8S A;  3EQQ B;  1OF5 B;  4K1U A;  4MMZ B;  4LGQ A;  4TX4 A;  1FUW A;  3GWR A;  1YJ9 3;  3D4A A;  3G4S 3;  1IQ8 A;  3CCV 3;  2W6J H;  4X2H A;  1ZS7 A;  4J9A A;  3T8U A;  1J2B A;  3X41 A;  7STD A;  1RKY A;  4IIA A;  1K28 A;  3OWU A;  2QGU A;  1JB2 A;  4WYK B;  2IUJ A;  3PS8 A;  1MGW A;  4ZM8 A;  1Q82 4;  5STD A;  8CHO A;  1IT8 A;  1HKX A;  1DMM A;  1AQZ A;  2C10 A;  3DM8 A;  3D5I A;  3FGY A;  3V98 A;  4XBY A;  2HMK B;  3EBT A;  1G02 A;  3OV4 A;  1VQK 3;  1A2V A;  5ELU A;  3DGY A;  1RGA A;  3NBB A;  4O3V A;  3CC2 3;  1RGC A;  5HGR A;  1JBR A;  4CPK A;  3ROB A;  2BO9 B;  5M1A A;  1K9M 4;  4GHO A;  1U5O A;  2QEX 3;  1AVL A;  4STD A;  1RGK A;  1LOX A;  2H0G A;  2IMJ A;  4HJL B;  1ZO2 A;  1RRL A;  1T2H A;  6GSP A;  3K63 A;  1IU7 A;  1IDP A;  3G6E 3;  2HMM B;  2KAA A;  3NV0 B;  1WTH A;  5BU4 A;  5ELJ A;  3PZW A;  1MNL A;  3PXM A;  1I0X A;  3LH4 A;  2ZL8 A;  1BNF A;  4K1V A;  1B3S A;  3BU4 A;  1RGH A;  3LT9 A;  1TUH A;  1X1W A;  2Z77 A;  3PGB A;  3T8N A;  1IVW A;  1PFP A;  1W5Z A;  3EF8 A;  3EN8 A;  1RRH A;  3SXX A;  3CCQ 3;  1W6C A;  2HMO B;  3GSP A;  5IW9 A;  1DVD A;  1NB5 I;  5IEO A;  1D6Z A;  5G1K A;  2GU3 A;  1QVG 2;  4BTW A;  1W2Z A;  4N6N B;  5G1L A;  3FG1 A;  3DH2 A;  3Q1C A;  1L5G B;  5CXO A;  3DMC A;  1BU4 A;  2KRT A;  3NBR A;  4BIR A;  1T2I A;  2WGQ A;  3SED A;  5IEP A;  2UUG C;  1UDI I;  3VF1 A;  1HU9 A;  5M18 A;  3KII A;  1Q9E A;  3HZP A;  1VQQ A;  3U1W A;  4CJN A;  1UGI A;  3GZY B;  2CX0 A;  4N6O B;  1E3R A;  1NU3 A;  1UGH I;  1GSP A;  2PZV A;  3Q3F A;  5JPP A;  2CFL A;  3AHS A;  4H61 A;  3WA2 X;  1VQ8 3;  2CG0 A;  2CK3 H;  2ZA4 A;  2HOH A;  4FCZ A;  2F86 B;  2XFS A;  3FSD A;  4HM6 B;  1UUV B;  2W03 A;  1GYB A;  3IMA B;  1SII A;  2AAD A;  2CC3 A;  3OXA A;  3G8Z A;  2YFJ B;  3JUP A;  1BAO A;  3LOY A;  1A67 A;  2CHC A;  4J8T A;  4LZI A;  3MWZ A;  1FGO A;  3WHO A;  1LOV A;  2XGL A;  3U97 A;  2AAE A;  3FCS B;  4AEQ A;  3CCE 3;  5LC6 A;  3NHX A;  1ZX2 A;  1I8V A;  1IVV A;  3URP A;  1BNI A;  2XGN A;  1X1Y A;  1EKM A;  1SIH A;  1O7N B;  2GEY A;  1M1X B;  2E2U A;  4KZ1 A;  4LMI A;  1OUN A;  1NO3 A;  1VZZ A;  2ZDJ A;  3V99 A;  5BVB A;  3KSP A;  5AEU B;  1RGF A;  4FMD A;  3MPH A;  2QIY A;  1W7C A;  3F7X A;  4WHA A;  1QAF A;  1VQ9 3;  2OWP A;  3RNT A;  2RFR A;  1AV4 A;  3MG2 A;  3Q2P A;  4EXR A;  5JBS A;  1YHQ 3;  1E97 A;  3M8C A;  2F5W A;  3CC7 3;  5IF6 A;  1YJN 3;  1W6Y A;  1JZO A;  1R4C A;  2K3D A;  1Q7Y 4;  1Y4K A;  5I97 A;  3WOF B;  1A2P A;  1Q40 A;  4RNZ A;  1N5H A;  2Z7A A;  3DUK A;  3NBJ A;  4QWT A;  2IA7 A;  6STD A;  3MSO A;  1V57 A;  1NWW A;  5M19 A;  3F8H A;  1RCL A;  3LTB A;  2JDI H;  4HM4 B;  1MWU A;  2IY2 A;  1N9J A;  3STD A;  3T0U A;  2CWT A;  4HZB B;  3FG3 A;  2D42 A;  1EG9 B;  3JUN A;  3NX0 A;  1STD A;  3F40 A;  2CFD A;  3I56 3;  4AKZ A;  4XB5 A;  4XDW A;  3MYT A;  2XFT A;  3WOD G;  1BRI A;  1OAC A;  1BOX A;  3CU3 A;  2W04 A;  5AYR B;  5A0O B;  1BSD A;  1BIR A;  2CH9 A;  3CD6 3;  1BNR A;  2BMQ B;  3CPO A;  4N6L A;  2INX A;  2R4I A;  1ISK A;  3BNC A;  5FGO A;  4KFE A;  2Q07 A;  4CDL A;  5IG3 A;  1BSE A;  1BRJ A;  2OCT A;  3AHW A;  4GSP A;  1CH0 A;  1N8Q A;  3FG4 A;  5GSP A;  1JV2 B;  5D82 A;  1VQ5 3;  2RBI A;  4XDV A;  1IVU A;  2BMR B;  3UL5 A;  2P09 A;  1ROA A;  4R4K A;  5D81 A;  3N9H A;  4AKY A;  5RNT A;  1OHP A;  1V58 A;  4R80 A;  3RGR A;  1S72 3;  1JN5 B;  1C54 A;  1A90 A;  3I55 3;  1IVX A;  1W01 A;  3HK4 A;  1RGE A;  4G1M B;  4N6M A;  1A2K A;  3SVA A;  1RSN A;  4EV2 A;  3CCL 3;  1KC8 4;  1ASK A;  1JKG B;  2BNG A;  4Q53 A;  5AIG A;  1F8N A;  5EVH A;  1EQK A;  4MMY B;  1IQY A;  1PU4 A;  2STD A;  1YIT 3;  1IQX A;  1R4Y A;  1BRG A;  4MMX B;  2CFK A;  1OF5 A;  1QVF 2;  4PEJ A;  2OOV A;  3EJV A;  1RN4 A;  1JB5 A;  1TIJ A;  2BU4 A;  4N6U A;  1BRK A;  5DRE A;  4OK0 A;  3OX9 A;  4EYC A;  1BRN L;  3LTC A;  5AII A;  3IJE B;  4HYZ A;  1JRQ A;  1GMQ A;  3SYU A;  2P05 A;  4IPB A;  1U8C B;  3F7S A;  3F8X A;  4WYK A;  1BSB A;  3LTA A;  4U13 A;  2LYX A;  2R41 A;  1YI2 3;  2CWU A;  2I9W A;  2SAR A;  3EC9 A;  1VQ7 3;  6RNT A;  2CFG A;  3K0Z A;  3X3Z A;  1ULJ B;  2P0M A;  2Y73 A;  3GZX B;  4HZ9 B;  1FYS A;  3FF2 A;  1CYV A;  4HM7 B;  1MWT A;  2L1S A;  3KZT A;  1BNJ A;  2KCD A;  1N8R 4;  1IYY A;  3KSE D;  4O2H A;  1GY6 A;  5IG4 A;  1N5P A;  1YGW A;  5EQL A;  1MWR A;  1TJD A;  2UX0 A;  1TFO A;  2ML6 A;  4GB5 A;  3AGN A;  5FW5 A;  3VSY A;  1RCK A;  1ZGX A;  2WGO A;  3B8L A;  2XRX B;  3JUO A;  3N8B A;  1EEJ A;  1YGE A;  4LYL B;  4OVM A;  2YFL B;  3NV0 A;  4BL3 A;  1I3F A;  1VQP 3;  1FUS A;  1JZD A;  4HM1 B;  1DET A;  3CCR 3;  5CF1 A;  4GL6 A;  3NXJ A;  9RNT A;  3S67 A;  4BL2 A;  5CF2 A;  4HM8 B;  2XSO B;  5CK6 A;  5D83 A;  2Z6B A;  1STF I;  1HZ1 A;  1VQM 3;  5DRV A;  1GMP A;  3ECF A;  4BU4 A;  1CQS A;  3BNE A;  2BMO B;  1BNS A;  1I2F A;  1DMN A;  2P0X A;  3A5E A;  3WMD A;  4X2O A;  1PY3 A;  1NJI 4;  3H3H A;  1BSA A;  1LQG C;  3CXC 2;  1BSC A;  1UW1 A;  3NUV A;  2W56 B;  3X40 A;  2YX9 A;  1RGG A;  2WOF A;  1AY7 A;  1T3B A;  2HMN B;  1W00 A;  1N9E A;  3LTD A;  4RNY A;  5CLK A;  1RMS A;  3Q90 A;  1FUT A;  4R9K A;  4BTX A;  3DXO A;  2GBW B;  2GXF A;  3LT8 A;  3KCH A;  3WDG B;  4WWU C;  1GOV A;  2GEX A;  3IPT A;  1OPY A;  1JJ2 2;  2CKF B;  5IER A;  3BNB A;  1X1X A;  3MG1 A;  1Z1S A;  3QRD A;  4N6T A;  4L8O A;  3N54 B;  2CW9 A;  3GZB A;  3AMO B;  1B2M A;  5IEN A;  1G0T A;  4K90 B;  3CCJ 3;  1FGM A;  3UNL A;  3D3L A;  1M1K 4;  1NB3 I;  3QK9 A;  4EBG A;  4JF8 A;  2GBX B;  1IV9 A;  3K7C A;  3L0R A;  1SAR A;  1MOL A;  2J8X B;  4HM3 B;  3D5G A;  1UUG B;  1ROV A;  2CWV A;  2KF4 A;  3HX8 A;  3SOA A;  3BIR A;  5LC7 A;  2H0I A;  1YVS A;  3AGO A;  2B24 B;  3ZG5 A;  1TTO A;  2XEP A;  1KD1 4;  3CC4 3;  2W9P A;  3LXU X;  3KN4 A;  3UJM A;  4FR9 A;  3UL6 A;  1ULI B;  2W9Q A;  4FCJ A;  1BUJ A;  3ER7 A;  3NQY A;  1WMP A;  4IT7 A;  4L8P A;  1BNG A;  1DE3 A;  3V92 A;  2OQE A;  3TDG A;  4O02 B;  1B2X A;  1KWI A;  2W2C A;  1LQM B;  1OGZ A;  1YNV X;  2O9U X;  4EW5 A;  4N3V A;  1GOU A;  3PCS A;  1O7W B;  1JBS A;  4FMA A;  4XBX A;  3HOH A;  1QJG A;  2CX1 A;  2RCD A;  4H3U A;  1DVC A;  1EUI C;  2W0Q A;  5AIH A;  2HMJ B;  1BGS A;  3NQZ A;  1UCL A;  3A76 A;  3PCR A;  1SQW A;  3J7Y d;  3OW2 2;  5KP3 A;  3DGL A;  1CEW I;  1BAN A;  1OH0 A;  2XF3 A;  3MHE A;  5EEO A;  1TRQ A;  7GSP A;  4KFF A;  1MGR A;  4HVN A;  2F98 A;  4XBT A;  2Y74 A;  2O3O A;  3JUM A;  1OGX A;  2UGI A;  3OWY A;  3SLU A;  1YIJ 3;  3FLJ A;  5IG0 A;  1VQ6 3;  1UI8 A;  1FGT A;  3B4P A;  3B4O A;  5BXQ A;  3DGO A;  1D6U A;  1KSI A;  1FA3 A;  2E2V A;  1O7G B;  5KP1 A;  2F99 A;  1LNH A;  2IYJ A;  1Q42 A;  2Z76 A;  3RGA A;  2HML B;  3EHC A;  4HKV B;  3EN1 B;  1D6Y A;  1O7M B;  1HYF A;  1UCI A;  3MG3 A;  2PNC A;  4HM5 B;  3CNM A;  1LNI A;  3S28 A;  3FF0 A;  3SOY A;  1W02 A;  2ZHX B;  5AYS C;  2FNQ A;  2OTL 3;  3NM2 A;  3EB8 A;  1JN5 A;  1RTU A;  3D9R A;  4MEI A;  1VQN 3;  2RNT A;  3X3Y A;  1FZU A;  1GD3 A;  3S5C A;  2K0M A;  4OUQ A;  4MJD A;  1RDS A;  2WO0 A;  2ML5 A;  2OOV C;  4RNT A;  1RHL A;  3EE1 A;  5AI1 A;  3HII A;  3SX1 A;  1JKG A;  5G2G A;  3WR2 A;  1GD4 A;  5TGN A;  2BHM A;  1B2U A;  2E2T A;  1BRH A;  1EA2 A;  1I2E A;  2KXG A;  4R9L A;  2KF3 A;  1E3V A;  3KE7 A;  1X1U A;  3S27 A;  1FW7 A;  1G96 A;  2FXT A;  4HM2 B;  2C4B A;  1GOY A;  1TU5 A;  3BB9 A;  1QAL A;  1WNH A;  1W6G A;  1GY5 A;  1I0V A;  2YFI B;  1K8A 4;  4HBR A;  3I0Y A;  5JPU A;  3LYG A;  1B2Z A;  4I5Q A;  5AIF A;  2MC8 A;  3ZG0 A;  1BVI A;  1RNT A;  1LXE A;  4FMC A;  1BRS A;  2LQV A;  2IUK A;  3HIG A;  2KF5 A;  4FCM A;  4HM0 B;  2QA4 3;  1O7H B;  4I4K A;  3JVC A;  3DGM A;  1QMA A;  4RZM A;  1LOY A;  2MF7 A;  3FZW A;  3EBY A;  1AVK A;  1O7P B;  1RGL A;  2BT3 A;  4NPB A;  3LML A;  3S29 A;  1I3I A;  1VQO 3;  1DMQ A;  3EX9 A;  2GSP A;  4LEH A;  1IV7 A;  2H0H A;  3CCS 3;  3CMA 3;  5BIR A;  1K41 A;  1GMR A;  4NHF A;  3RDE A;  1RJO A;  3DY5 A;  3JUQ A;  4XM4 A;  2F56 A;  3DGN A;  3PYJ A;  4R1K A;  3CPW 2;  1T5Y A;  2FGT A;  3H51 A;  1WMO A;  4WFO A;  3KFQ C;  1B27 A;  3X42 A;  1Q86 4;  3CNX A;  2CFW A;  3ALA A;  3CME 3;  2V1L A;  2F5M A;  4K61 A;  5HOH A;  1GS3 A;  1BNE A;  3F9S A;  2M7O A;  4BTY A;  1NNV A;  3GAX A;  1AR0 A;  3G0K A;  1DYU A;  1C7H A;  3O8Y A;  1B2S A;  4DKI A;  3BLZ A;  1M90 4;  1UUW B;  3NM7 A;  2XR8 B;  1B21 A;  4HOH A;  2K54 A;  2WOH A;  1K73 4;  1I2G A;  1UCK A;  1OHO A;  4J5G A;  1YJW 3;  8RNT A;  4RBN A;  1Q40 B;  1SJW A;  4ORL A;  2BIR A;  3K9M C;  2CG1 A;  1FGR A;  4WP5 A;  3ZFZ A;  1JB4 A;  1VQ4 3;  2W56 A;  4ILF A;  1BUQ A;  4CCV A;  1KQS 2;  1NDO B;  3OWS A;  5IG5 A;  2OTJ 3;  3E99 A;  3DZL A;  1S5A A;  1CYU A;  3D79 A;  4JRF A;  3CCM 3;  3G16 A;  2F4Y A;  2A15 A;  1GY7 A;  3MKI A;  5KP4 A;  1RN7 A;  4NRE A;  7RNT A;  1YVB I;  4EV5 A;  1SPU A;  1JBT A;  3AMO A;  3FKA A;  2XSH B;  1UI7 A;  3FH1 A;  1LVN A;  1TFK A;  4J5K A;  2D1W A;  1WMN A;  3HI7 A;  4FMB A;  1IK3 A;  3F14 A;  1WQL B;  1Q7H A;  4L7K A;  3KKG A;  1PYL A;  1US1 A;  2JQ5 A;  3CCU 3;  1MWS A;  1QAK A;  3WOE B;  1JNQ A;  3BND A;  4KVH A;  2RGQ A;  2CIU A;  3GRD A;  3VGN A;  5AEW B;  3UB1 A;  3WA3 A;  1FGQ A;  2KF6 A;  3G71 3;  1OCV A;  2B1X B;  1LOW A;  3LZA A;  1OHS A;  4LSO A;  4KT3 B; 
#chains in the Genus database with same CATH homology
 2L4V A;  2SBL A;  2OQE C;  1IT7 A;  1Q81 4;  1V74 A;  3K5T A;  3X3X A;  3B7C A;  1W2B 2;  2P38 A;  4KFD A;  4N6V 0;  2GU1 A;  4EC6 A;  2XH9 A;  2RSX A;  3GZR A;  1W4N A;  1VQL 3;  2C11 A;  1TP6 A;  1M9G A;  4O8S A;  3EQQ B;  1OF5 B;  4K1U A;  4MMZ B;  4LGQ A;  4TX4 A;  1FUW A;  3GWR A;  1YJ9 3;  3G4S 3;  1IQ8 A;  3CCV 3;  2W6J H;  4X2H A;  4J9A A;  3T8U A;  1J2B A;  3X41 A;  7STD A;  1RKY A;  4IIA A;  1K28 A;  3OWU A;  2QGU A;  1JB2 A;  4WYK B;  2IUJ A;  3PS8 A;  4ZM8 A;  1Q82 4;  5STD A;  8CHO A;  1IT8 A;  1HKX A;  1DMM A;  2C10 A;  3DM8 A;  3FGY A;  3V98 A;  4XBY A;  2HMK B;  3EBT A;  3OV4 A;  1VQK 3;  1A2V A;  5ELU A;  3NBB A;  3CC2 3;  4O3V A;  5HGR A;  3ROB A;  2BO9 B;  1K9M 4;  1U5O A;  2QEX 3;  1AVL A;  4STD A;  1LOX A;  2IMJ A;  4HJL B;  1ZO2 A;  1RRL A;  3K63 A;  1IU7 A;  1IDP A;  3G6E 3;  2HMM B;  3NV0 B;  1WTH A;  5ELJ A;  3PZW A;  1MNL A;  3PXM A;  3LH4 A;  2ZL8 A;  4K1V A;  3PGB A;  3LT9 A;  1TUH A;  2Z77 A;  3T8N A;  1IVW A;  1PFP A;  1W5Z A;  3EF8 A;  3EN8 A;  1RRH A;  3SXX A;  3CCQ 3;  1W6C A;  2HMO B;  5IW9 A;  1DVD A;  1NB5 I;  5IEO A;  1D6Z A;  2GU3 A;  1QVG 2;  4BTW A;  1W2Z A;  4N6N B;  3FG1 A;  3Q1C A;  1L5G B;  5CXO A;  3DMC A;  2KRT A;  3NBR A;  2WGQ A;  3SED A;  5IEP A;  3VF1 A;  1HU9 A;  3KII A;  3HZP A;  3U1W A;  3GZY B;  4N6O B;  1E3R A;  1NU3 A;  2PZV A;  5JPP A;  2CFL A;  4H61 A;  3WA2 X;  1VQ8 3;  2CG0 A;  2CK3 H;  4FCZ A;  2F86 B;  2XFS A;  3FSD A;  4HM6 B;  1UUV B;  2W03 A;  1GYB A;  3IMA B;  1SII A;  3OXA A;  2CC3 A;  3G8Z A;  2YFJ B;  3JUP A;  3LOY A;  1A67 A;  2CHC A;  4J8T A;  4LZI A;  3MWZ A;  1FGO A;  2XGL A;  3U97 A;  3FCS B;  4AEQ A;  3CCE 3;  5LC6 A;  3NHX A;  1ZX2 A;  1IVV A;  2XGN A;  1EKM A;  1SIH A;  1O7N B;  2GEY A;  1M1X B;  2E2U A;  4KZ1 A;  4LMI A;  1OUN A;  1NO3 A;  1VZZ A;  2ZDJ A;  3V99 A;  5BVB A;  3KSP A;  5AEU B;  4FMD A;  3MPH A;  2QIY A;  1W7C A;  3F7X A;  4WHA A;  1QAF A;  1VQ9 3;  2OWP A;  4EXR A;  2RFR A;  1AV4 A;  3MG2 A;  3Q2P A;  1YHQ 3;  5JBS A;  1E97 A;  3M8C A;  3CC7 3;  5IF6 A;  1YJN 3;  1W6Y A;  1R4C A;  1Q7Y 4;  1Y4K A;  5I97 A;  3WOF B;  1Q40 A;  4RNZ A;  1N5H A;  2Z7A A;  3DUK A;  3NBJ A;  4QWT A;  2IA7 A;  6STD A;  3MSO A;  1NWW A;  3F8H A;  3LTB A;  2JDI H;  4HM4 B;  1N9J A;  3STD A;  3T0U A;  2CWT A;  4HZB B;  3FG3 A;  2D42 A;  1EG9 B;  3JUN A;  3NX0 A;  1STD A;  3F40 A;  2CFD A;  3I56 3;  4AKZ A;  4XB5 A;  4XDW A;  3MYT A;  2XFT A;  3WOD G;  1OAC A;  3CU3 A;  5A0O B;  2W04 A;  5AYR B;  2CH9 A;  3CD6 3;  2BMQ B;  3CPO A;  4N6L A;  2INX A;  2R4I A;  1ISK A;  3BNC A;  5FGO A;  4KFE A;  2Q07 A;  4CDL A;  5IG3 A;  2OCT A;  1N8Q A;  3FG4 A;  1JV2 B;  5D82 A;  1VQ5 3;  4XDV A;  1IVU A;  2BMR B;  3UL5 A;  2P09 A;  1ROA A;  4R4K A;  5D81 A;  3N9H A;  4AKY A;  1OHP A;  4R80 A;  1S72 3;  3RGR A;  1JN5 B;  1A90 A;  3I55 3;  1IVX A;  1W01 A;  3HK4 A;  4G1M B;  4N6M A;  1KC8 4;  1A2K A;  3SVA A;  4EV2 A;  3CCL 3;  1ASK A;  1JKG B;  2BNG A;  4Q53 A;  5AIG A;  1F8N A;  5EVH A;  1EQK A;  4MMY B;  1IQY A;  1PU4 A;  2STD A;  1YIT 3;  1IQX A;  4MMX B;  2CFK A;  1OF5 A;  1QVF 2;  4PEJ A;  2OOV A;  3EJV A;  1JB5 A;  1TIJ A;  4N6U A;  5DRE A;  4OK0 A;  3OX9 A;  4EYC A;  3LTC A;  5AII A;  3IJE B;  4HYZ A;  1JRQ A;  2P05 A;  4IPB A;  1U8C B;  3F7S A;  3F8X A;  4WYK A;  3LTA A;  4U13 A;  2LYX A;  1YI2 3;  2CWU A;  2I9W A;  3EC9 A;  1VQ7 3;  2CFG A;  3K0Z A;  3X3Z A;  1ULJ B;  2P0M A;  2Y73 A;  3GZX B;  4HZ9 B;  3FF2 A;  1CYV A;  4HM7 B;  3KZT A;  2KCD A;  1N8R 4;  3KSE D;  4O2H A;  1GY6 A;  5IG4 A;  1N5P A;  5EQL A;  2UX0 A;  1TFO A;  2ML6 A;  4GB5 A;  5FW5 A;  3VSY A;  2WGO A;  3B8L A;  2XRX B;  3JUO A;  3N8B A;  4OVM A;  1YGE A;  2YFL B;  3NV0 A;  1VQP 3;  4HM1 B;  3CCR 3;  5CF1 A;  4GL6 A;  3NXJ A;  3S67 A;  5CF2 A;  4HM8 B;  2XSO B;  5CK6 A;  5D83 A;  2Z6B A;  1STF I;  1VQM 3;  5DRV A;  3ECF A;  1CQS A;  3BNE A;  2BMO B;  1DMN A;  2P0X A;  3WMD A;  4X2O A;  1NJI 4;  3H3H A;  3CXC 2;  1UW1 A;  3NUV A;  2W56 B;  3X40 A;  2YX9 A;  2WOF A;  2HMN B;  1W00 A;  1N9E A;  3LTD A;  4RNY A;  5CLK A;  4BTX A;  3Q90 A;  4R9K A;  3DXO A;  2GBW B;  2GXF A;  3LT8 A;  3WDG B;  4WWU C;  2GEX A;  3IPT A;  1OPY A;  1JJ2 2;  2CKF B;  5IER A;  3BNB A;  3MG1 A;  3QRD A;  1Z1S A;  4N6T A;  4L8O A;  3N54 B;  2CW9 A;  3GZB A;  3AMO B;  5IEN A;  4K90 B;  3CCJ 3;  1FGM A;  3UNL A;  3D3L A;  1M1K 4;  1NB3 I;  3QK9 A;  4EBG A;  4JF8 A;  2GBX B;  1IV9 A;  3K7C A;  3L0R A;  1MOL A;  4HM3 B;  2CWV A;  1ROV A;  3HX8 A;  3SOA A;  5LC7 A;  2B24 B;  2XEP A;  1KD1 4;  3CC4 3;  2W9P A;  3LXU X;  3KN4 A;  3UJM A;  4FR9 A;  3UL6 A;  1ULI B;  2W9Q A;  4FCJ A;  3ER7 A;  3NQY A;  1WMP A;  4IT7 A;  4L8P A;  3V92 A;  2OQE A;  3TDG A;  4O02 B;  1KWI A;  2W2C A;  1OGZ A;  2O9U X;  4N3V A;  3PCS A;  1O7W B;  4FMA A;  4XBX A;  1QJG A;  2RCD A;  4H3U A;  1DVC A;  2W0Q A;  5AIH A;  2HMJ B;  3NQZ A;  3A76 A;  3PCR A;  1SQW A;  3J7Y d;  3OW2 2;  5KP3 A;  3DGL A;  1CEW I;  1OH0 A;  2XF3 A;  3MHE A;  5EEO A;  4KFF A;  4HVN A;  2F98 A;  4XBT A;  2Y74 A;  2O3O A;  3JUM A;  1OGX A;  3OWY A;  3SLU A;  1YIJ 3;  3FLJ A;  5IG0 A;  1VQ6 3;  3B4P A;  1UI8 A;  1FGT A;  3B4O A;  5BXQ A;  3DGO A;  1D6U A;  1KSI A;  1FA3 A;  2E2V A;  1O7G B;  5KP1 A;  2F99 A;  1LNH A;  1Q42 A;  2Z76 A;  3RGA A;  2HML B;  3EHC A;  4HKV B;  3EN1 B;  1D6Y A;  1O7M B;  3MG3 A;  3S28 A;  2PNC A;  4HM5 B;  3CNM A;  3SOY A;  3FF0 A;  1W02 A;  5AYS C;  2FNQ A;  2OTL 3;  3NM2 A;  3EB8 A;  1JN5 A;  3D9R A;  4MEI A;  1VQN 3;  3X3Y A;  1GD3 A;  3S5C A;  2K0M A;  4OUQ A;  4MJD A;  2WO0 A;  2ML5 A;  2OOV C;  3EE1 A;  5AI1 A;  3HII A;  3SX1 A;  1JKG A;  5G2G A;  1GD4 A;  5TGN A;  2BHM A;  2E2T A;  1EA2 A;  4R9L A;  2KXG A;  1E3V A;  3KE7 A;  3S27 A;  1G96 A;  2FXT A;  4HM2 B;  1TU5 A;  3BB9 A;  1QAL A;  1WNH A;  1W6G A;  1GY5 A;  2YFI B;  1K8A 4;  4HBR A;  3I0Y A;  5JPU A;  3LYG A;  2MC8 A;  5AIF A;  1LXE A;  4FMC A;  2LQV A;  2IUK A;  3HIG A;  4FCM A;  4HM0 B;  2QA4 3;  1O7H B;  4I4K A;  3JVC A;  3DGM A;  1QMA A;  4RZM A;  2MF7 A;  3FZW A;  3EBY A;  1AVK A;  1O7P B;  2BT3 A;  3LML A;  3S29 A;  1VQO 3;  1DMQ A;  3EX9 A;  4LEH A;  1IV7 A;  3CCS 3;  3CMA 3;  1K41 A;  4NHF A;  3RDE A;  1RJO A;  3DY5 A;  3JUQ A;  4XM4 A;  3DGN A;  3PYJ A;  4R1K A;  3CPW 2;  1T5Y A;  2FGT A;  3H51 A;  1WMO A;  4WFO A;  3KFQ C;  1Q86 4;  3X42 A;  3CNX A;  2CFW A;  3ALA A;  3CME 3;  2V1L A;  4K61 A;  1GS3 A;  3F9S A;  2M7O A;  4BTY A;  3GAX A;  1AR0 A;  3G0K A;  1DYU A;  1C7H A;  3O8Y A;  3BLZ A;  1M90 4;  1UUW B;  3NM7 A;  2XR8 B;  2K54 A;  2WOH A;  1K73 4;  1OHO A;  1YJW 3;  4RBN A;  1Q40 B;  1SJW A;  4ORL A;  2CG1 A;  3K9M C;  1FGR A;  4WP5 A;  1JB4 A;  1VQ4 3;  2W56 A;  1BUQ A;  4CCV A;  1KQS 2;  1NDO B;  3OWS A;  5IG5 A;  2OTJ 3;  3E99 A;  3DZL A;  1S5A A;  1CYU A;  4JRF A;  3CCM 3;  3G16 A;  2A15 A;  1GY7 A;  3MKI A;  5KP4 A;  1RN7 A;  4NRE A;  1YVB I;  4EV5 A;  1SPU A;  3AMO A;  3FKA A;  2XSH B;  1UI7 A;  3FH1 A;  1LVN A;  1TFK A;  1IK3 A;  2D1W A;  1WMN A;  3HI7 A;  4FMB A;  3F14 A;  1WQL B;  4L7K A;  3KKG A;  1US1 A;  2JQ5 A;  1QAK A;  3WOE B;  1JNQ A;  3BND A;  4KVH A;  2RGQ A;  2CIU A;  3GRD A;  3VGN A;  5AEW B;  3UB1 A;  3WA3 A;  1FGQ A;  3G71 3;  1OCV A;  2B1X B;  3CCU 3;  3LZA A;  1OHS A;  4LSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...