4WWUC

Structure of mex67:mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
165
Chain Sequence
MVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPIQMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDSLLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords mRNA export factor MEX67
total genus 37
structure length 165
sequence length 177
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wwuC00
2HMJB 4STDA 3MKIA 3MG2A 4HM7B 3OWUA 5AI1A 4XBYA 3DM8A 5D83A 3S5CA 3B7CA 3GZYB 2RFRA 3K7CA 3G0KA 4U13A 4XDVA 4X2HA 5IG0A 2YFJB 3ROBA 4HVNA 5JPUA 5D82A 1Q42A 1DMNA 3OXAA 4KVHA 1GYBA 1W6YA 3JUQA 3T8NA 5IG5A 5IEOA 4FCJA 1EA2A 4HM8B 1C7HA 1O7WB 2GEYA 2HMMB 2IMJA 5IERA 2B24B 3OWSA 1W01A 2Z76A 1OHPA 4XDWA 4IIAA 2STDA 1DMMA 1S5AA 2R4IA 4I4KA 3KKGA 3LYGA 4MJDA 5AIGA 3EJVA 5AIIA 2HMOB 2XR8B 2GEXA 2B1XB 5HGRA 2A15A 1OH0A 4R1KA 5CK6A 3FSDA 3GZBA 3FLJA 4N3VA 1IDPA 4R9KA 3CPOA 3F9SA 5AIHA 5AIFA 6STDA 2F99A 7STDA 2BNGA 3B4PA 3F8HA 4LGQA 5FW5A 4OVMA 1OHOA 4XM4A 1ISKA 1O7GB 4LMIA 3BB9A 4L7KA 5DREA 4HKVB 2OWPA 4WWUC 3IPTA 3MYTA 3EHCA 1Q40A 2QGUA 3DUKA 3SEDA 1E3VA 3VGNA 1ULJB 2XSOB 3CU3A 3KE7A 3MHEA 4XBTA 1O7MB 3NBRA 5CF2A 1Z1SA 2CHCA 5KP4A 3FZWA 4H3UA 4L8OA 3EC9A 3WMDA 1JKGA 4R9LA 5CXOA 2UX0A 3F40A 3GZXB 1ZX2A 1QJGA 3B4OA 3NUVA 2INXA 1O7PB 1SJWA 3EBTA 3K0ZA 3JUNA 3NHXA 4HJLB 3STDA 5KP1A 3FF0A 2Z7AA 2QIYA 1AR0A 1WQLB 3EN1B 3I0YA 2RCDA 1W02A 3MSOA 1UUWB 3CNXA 5BVBA 5IG4A 1NDOB 5KP3A 3LZAA 2BMRB 1ZO2A 4XB5A 1JB2A 2W2CA 1JB5A 5CLKA 1VZZA 3B8LA 3F8XA 3G8ZA 4L8PA 4X2OA 1UUVB 3EF8A 5IENA 3EN8A 5IF6A 1CQSA 2GBXB 2GXFA 3OV4A 3UJMA 5G2GA 1NU3A 1OGXA 3D9RA 3E99A 1W00A 3JUPA 4RZMA 3HZPA 8CHOA 1TP6A 1NWWA 2Z77A 4GB5A 3HX8A 3Q90A 4HM6B 3MG3A 4HZBB 3FKAA 4J9AA 2XRXB 4WP5A 5CF1A 2BMOB 1E97A 4HM3B 5IEPA 3ER7A 4OUQA 3A76A 5IG3A 1O7NB 1TUHA 4K1UA 2GBWB 3MG1A 3NV0B 1DMQA 1EG9B 3EQQB 3HK4A 1ULIB 3KSPA 3NV0A 5TGNA 3H3HA 4ORLA 3SOYA 1Q40B 3GRDA 2PZVA 3DZLA 4HM2B 4HM4B 1ASKA 3EBYA 3FH1A 1OUNA 4WYKB 2YFIB 3SOAA 4LEHA 4WYKA 4HM0B 5DRVA 3VSYA 2HMNB 3OX9A 3OWYA 1JN5B 2RGQA 1O7HB 5D81A 5STDA 4XBXA 2JQ5A 1JKGB 2HMKB 2XSHB 1OCVA 3KZTA 3NXJA 4CDLA 3JUMA 5BXQA 3RGRA 1OGZA 1A2KA 4HM1B 1E3RA 1BUQA 4J8TA 2F98A 3UNLA 1STDA 1QMAA 3CNMA 2BMQB 3RGAA 1JB4A 3ECFA 1JN5A 1GY7A 4PEJA 1HKXA 3M8CA 2YFLB 3T8UA 3F7XA 1GY6A 3H51A 1OF5B 3DXOA 2I9WA 5AEWB 1OF5A 1U5OA 5JPPA 5EVHA 1GY5A 3BLZA 4FCMA 1K41A 3F14A 3FF2A 3G16A 3F7SA 3FGYA 3GZRA 1GS3A 4HM5B 4Q53A 1OPYA 2HMLB 5AEUB 2F86B 3DMCA 4HZ9B 2K54A 3JUOA 1OHSA 3NM2A 4K1VA 3EX9A 3GWRA 2CKFB
chains in the Genus database with same CATH superfamily
1VQK3 3PCSA 3LTDA 1SARA 3MKIA 3MG2A 5AI1A 2FGTA 3DM8A 1BNEA 2XGLA 2YX9A 2W03A 1DE3A 4U13A 1GOYA 4GL6A 5IG0A 4MMXB 1S723 1RNBA 1J2BA 1T2IA 2BIRA 5JBSA 5JPUA 3D5GA 1W6YA 3S27A 1RN4A 1JZDA 1EA2A 1O7WB 5IERA 2GEYA 2HMMB 1KC84 7RNTA 1BNSA 3OWSA 1JNQA 1OHPA 2RSXA 1YJW3 2Y74A 2P05A 3QRDA 1GD3A 1M1K4 2D1WA 4I4KA 4O8SA 1EUIC 4KZ1A 4RBNA 5EEOA 2QA43 1Q7Y4 3PYJA 4MMZB 1I0VA 5ELJA 2XR8B 1LOVA 2D42A 3V92A 1FZUA 4O3VA 1B21A 3U1WA 2CWVA 4KT3B 4N6UA 8RNTA 2KRTA 5AIFA 1VQO3 1YVBI 7STDA 3B4PA 1JBRA 1B20A 4LGQA 1I0XA 4OVMA 4LMIA 3UL6A 3N9HA 2OWPA 4I5QA 1PYLA 3PXMA 3SEDA 1ULJB 2WO0A 3KE7A 4LSOA 1TRQA 2OTJ3 3SX1A 4BU4A 1A2VA 3PS8A 1I2FA 1NJI4 1Z1SA 2F4YA 3WMDA 1QVF2 3EC9A 1BIRA 3GZXB 1CEWI 1QJGA 3B4OA 4K61A 1UCKA 5KP1A 1GOUA 2KAAA 2CFLA 2K0MA 3JUNA 1LRAA 3EB8A 1UUGB 3DGYA 4FMBA 1WQLB 2F5MA 1V74A 1DYUA 1W02A 1TJDA 2RCDA 2C10A 3BIRA 4AKZA 5BVBA 4GHOA 2F56A 5KP3A 2H0HA 5G1KA 1W6CA 1YNVX 1UDII 3B8LA 1WTHA 1ZS7A 1YVSA 2J8XB 3RNTA 1LQMB 3UL5A 5G2GA 1OGXA 2LYXA 4RZMA 1LQGC 3PGBA 1MWSA 2O3OA 2Z77A 4LEHA 1BNJA 1NB3I 3GSPA 4GB5A 4HM6B 1RKYA 3X41A 4N6NB 2W56A 4BL2A 1I2GA 2BHMA 2KF3A 1O7NB 1YIJ3 1OACA 3MG1A 3RDEA 3EQQB 1BRHA 1ULIB 2IA7A 3HK4A 5G1LA 1FA3A 3GRDA 3DZLA 4KFEA 1ASKA 2YFIB 4WYKA 4ZM8A 4HM0B 5DRVA 3VSYA 2H0GA 4KFDA 3X3XA 4CJNA 2CG0A 1BRIA 2JQ5A 2XSHB 2BO9B 3KZTA 3NQYA 1JBTA 1BUQA 1IT7A 3CCV3 5GSPA 1SQWA 1E3RA 1SIIA 4N6V0 2F98A 4N6LA 2XGNA 4J5KA 4WHAA 1X1UA 1DVDA 4N6TA 1HKXA 2YFLB 1N5HA 2OOVC 3F7XA 3WA2X 1BRJA 2I9WA 2CH9A 3AHSA 1B2XA 5BU4A 5JPPA 1GY5A 1CYVA 3FG4A 3F14A 3URPA 2C11A 3PZWA 2GSPA 3FGYA 1RN1A 1GS3A 1BANA 4HZ9B 5LC7A 1A90A 3IMAB 1N9JA 3EX9A 1OH0A 1KWIA 1YI23 1JRQA 5IW9A 4STDA 1VQ43 1BNGA 1BNFA 1V58A 3I553 3OWUA 1WMOA 4XBYA 1WMPA 1F8NA 4EBGA 4XDVA 1BRSA 3ROBA 2YFJB 4HVNA 1NO3A 4R4KA 5D82A 2JDIH 1DMNA 3OXAA 4KVHA 1U8CB 2V1LA 5IEOA 4AEQA 2WOFA 1C7HA 3ZG0A 2IMJA 1Q7HA 1W01A 2H0IA 5AYRB 3DGOA 2STDA 3LMLA 4IIAA 1BSDA 5M1AA 1K8A4 3ZFZA 3OW22 1B27A 1YGEA 1D6YA 2FNQA 2OOVA 1BRKA 3NQZA 1KD14 2HMOB 1CYUA 1RRHA 3AHWA 4RNYA 3CC43 2A15A 3GZBA 3FLJA 1B3SA 2FXTA 3LH4A 2MF7A 5AIHA 1AY7A 1AQZA 1VQM3 3CCE3 5FW5A 3CME3 1BUJA 1BNIA 1TFOA 3HOHA 4XM4A 1ISKA 1O7GB 2RBIA 1IQ8A 4BL3A 4L7KA 5LC6A 1QVG2 3CCL3 1PY3A 2PNCA 3EHCA 2ML6A 3VGNA 1YHQ3 4FMAA 2IUKA 1EEJA 1NNVA 2QEX3 3DGLA 4H3UA 3CCU3 1A2PA 5CXOA 2CWTA 1R4YA 2Q07A 5BIRA 1ZX2A 1BRGA 2INXA 1O7PB 3EBTA 1BSCA 3STDA 3HIGA 1RN7A 3NUVA 3EN1B 1RMSA 1UW1A 1SIHA 3CPW2 1N5PA 3LZAA 3CC23 1AVKA 1AV4A 1VQQA 2CFKA 3LTCA 3X42A 2C4BA 2CWUA 1VZZA 2OQEC 1EKMA 5IENA 1UI8A 4X2OA 1UI7A 1W2ZA 4NHFA 1CQSA 2LQVA 2GXFA 4AKYA 1MWUA 1W5ZA 1NU3A 3UB1A 3J7Yd 1RCKA 3DY5A 3K9MC 3MG3A 3D79A 1MNLA 2CIUA 4HM3B 3WOFB 5RNTA 3K5TA 4OUQA 1QAFA 3A76A 4HAAA 5IG3A 3JVCA 3NV0B 4KFFA 2GU3A 4N6OB 3X3YA 3SOYA 1IU7A 3BNDA 1RSNA 3H3HA 4DKIA 1Q40B 4HM4B 4HM2B 5DREA 3SOAA 1OUNA 1UCJA 3X40A 3KN4A 1IVVA 1RLSA 4H61A 3S67A 2XEPA 3SYUA 3OWYA 1O7HB 4EC6A 4XBXA 1ROAA 3NXJA 4CDLA 6GSPA 3LOYA 5BXQA 3JUMA 3LT8A 1PFPA 1VQ53 1A2KA 3HIIA 1JJ22 1JZOA 1K9M4 1STDA 1IYYA 1HZ1A 2ZDJA 1JB4A 3ECFA 1JN5A 2L4VA 5ELUA 4PEJA 4OK0A 3T8UA 1VQN3 4IT7A 5HOHA 2L1SA 1K28A 5AEWB 1OF5A 3U97A 3WHOA 3BLZA 1LNHA 1B2MA 2CFGA 1VQ73 4HM5B 2ML5A 4Q53A 5FGOA 4EV5A 2RNTA 3VF1A 1G02A 3JUOA 3NM2A 1Q864 3GWRA 1MWRA 2CKFB 3LTBA 1T3BA 5EQLA 4HM7B 1HU9A 3S29A 4JF8A 5D83A 3CCS3 3K7CA 1MGRA 1X1YA 3Q3FA 1CH0A 3CMA3 1RGHA 1GYBA 3IJEB 2W9PA 3JUQA 3T8NA 3LTAA 2MC8A 3CD63 1US1A 3AMOB 1RRLA 1W7CA 3A5EA 3I563 1KQS2 4CPKA 2Z76A 1ROVA 1DMMA 3G4S3 2OCTA 2R4IA 4O2HA 2E2UA 3LYGA 2BU4A 2CFDA 2E2VA 3L0RA 1EQKA 3EJVA 3Q1CA 1K734 1A67A 1NB5I 2GEXA 6RNTA 2Y73A 1VQP3 4R1KA 1IV9A 5CK6A 3DH2A 1IT8A 3FSDA 3ZG5A 2CX1A 2OTL3 4FMDA 1JV2B 4N3VA 1D6UA 1IDPA 3F9SA 2ZL8A 4HBRA 1BAOA 2BNGA 3F8HA 3S28A 2P0XA 1GSPA 2GU1A 1N8QA 1FGRA 1I3IA 1RJOA 4WWUC 3IPTA 1YIT3 2E2TA 2QGUA 3DUKA 2IYJA 1FYSA 3LT9A 3CU3A 4RNTA 9RNTA 1O7MB 1N9EA 1Q814 5CF2A 5KP4A 3FZWA 4L8OA 1JKGA 1BOXA 4BTYA 3G6E3 2UX0A 2UGIA 4LYLB 1UCLA 1SJWA 4HJLB 4FR9A 3MPHA 1VQ63 3ALAA 3MSOA 1GOVA 5IG4A 3G713 1UUWB 3CNXA 3AMOA 1NDOB 3FG3A 1B2UA 2XF3A 1X1XA 1YJ93 3CXC2 4G1MB 5CLKA 3G8ZA 4J5GA 1UUVB 5IF6A 2O9UX 1G0TA 3BU4A 2GBXB 1FGOA 3OV4A 3UJMA 3JUPA 8CHOA 4BTXA 4HZBB 1Y4KA 1RDSA 3Q90A 4J9AA 1BRNL 4WP5A 2WGQA 2BMOB 1GMRA 2IUJA 3V98A 1IVXA 3TDGA 1QAKA 3ER7A 5A0OB 1UGIA 1DMQA 1EG9B 1M9GA 3K63A 3KSPA 5TGNA 3NV0A 1MWTA 2KXGA 1V57A 3NX0A 3Q2PA 3PCRA 2CFWA 2W56B 1LOWA 3CC73 2PZVA 2CC3A 3EBYA 3FH1A 2KF6A 6STDA 2HMNB 5D81A 3KIIA 2CX0A 5STDA 2XFTA 1BU4A 1IVUA 2Z6BA 1JKGB 2HMKB 1B2SA 1OCVA 3QK9A 1TRPA 2W04A 1OGZA 4HM1B 7GSPA 4J8TA 3T0UA 1IK3A 1DETA 1RNTA 3UNLA 3N8BA 4IPBA 2BMQB 1GY7A 3M8CA 1RHLA 1TFKA 1OF5B 2CW9A 3DXOA 1RTUA 2SARA 1U5OA 3FF2A 3G16A 3WDGB 4LZIA 1T2HA 3GZRA 1OPYA 2HMLB 5AEUB 2F86B 3DMCA 2R41A 1LVNA 1OHSA 4XDWA 1FUTA 3SLUA 1FUWA 2HMJB 2WGOA 4HYZA 1FW7A 3S5CA 1FGMA 1I70A 1YGWA 1I2EA 3B7CA 2IY2A 3GZYB 2RFRA 2OQEA 1TIJA 3G0KA 4R80A 4X2HA 1HYFA 2W0QA 3CCQ3 1JBSA 1BNRA 3FG1A 1Q42A 3AGNA 1YJN3 2HOHA 4RNZA 4MEIA 4JRFA 1R4CA 1BGSA 2P0MA 4FCJA 1RGAA 3EE1A 2WOHA 5IG5A 1I3FA 4FMCA 4HM8B 2ZHXB 3MWZA 4N6MA 2B24B 1TU5A 2W6JH 1UCIA 1S5AA 3O8YA 4K90B 3KCHA 1VQ93 2W9QA 3KKGA 2CK3H 4MJDA 5AIGA 2XH9A 5AIIA 4EYCA 1VQL3 3DGNA 2B1XB 5M19A 3CCR3 4GSPA 3KFQC 5HGRA 1C54A 4EV2A 1Q824 3X3ZA 1RGEA 4R9KA 3CPOA 2F99A 3WOEB 4EW5A 2KCDA 1N8R4 1OHOA 1X1WA 4QWTA 1TTOA 3NBJA 1AVLA 3BB9A 4HKVB 3MYTA 1PU4A 1Q40A 1WMNA 2UUGC 1E3VA 1ZGXA 2XSOB 3MHEA 2CG1A 3SVAA 1LNIA 5M18A 1RGLA 4XBTA 2ZA4A 3NBRA 1BSBA 2CHCA 1SPUA 1Q9EA 2BT3A 5I97A 2AADA 3NM7A 4R9LA 3F40A 3NHXA 3BNBA 3K0ZA 1RGCA 3V99A 4FCZA 3FF0A 2Z7AA 1KSIA 1AR0A 2QIYA 3I0YA 1IQXA 1IQYA 1BVIA 2AAEA 4WFOA 1FUSA 2BMRB 1G96A 1ZO2A 2XFSA 1JB2A 2P38A 1GMPA 1JB5A 2W2CA 3BNEA 4XB5A 1W2B2 1T5YA 4MMYB 1LOYA 4L8PA 3WA3A 1L5GB 3EF8A 1I8VA 3EN8A 4HOHA 4EXRA 3D9RA 3E99A 1STFI 1W00A 3N54B 5AYSC 3HZPA 3WR2A 1MGWA 2KF5A 1TP6A 1NWWA 2KF4A 3HX8A 3DGMA 3CCM3 3FKAA 2XRXB 5CF1A 3CCJ3 1E97A 1GD4A 3FCSB 4BTWA 5IEPA 1RGFA 1RGGA 1IV7A 3LXUX 1TUHA 4K1UA 1M904 1IVWA 2GBWB 4CCVA 3D4AA 2K3DA 4ORLA 1RCLA 2F5WA 4NREA 4WYKB 1GMQA 1BSAA 3OX9A 1JN5B 2RGQA 3BNCA 4ILFA 3D3LA 1D6ZA 1FGTA 1MOLA 3D5IA 4TX4A 3AGOA 1W4NA 3RGRA 1B2ZA 1LOXA 1WNHA 1BSEA 3WODG 1QALA 1QMAA 3CNMA 3RGAA 1RGKA 1DVCA 3GAXA 1UGHI 4O02B 1GY6A 3H51A 1VQ83 5EVHA 3KSED 1LXEA 3HI7A 1K41A 4FCMA 1W6GA 3SXXA 2SBLA 3F7SA 1M1XB 4BIRA 1FGQA 2M7OA 2K54A 4NPBA 3F8XA 3NBBA 4K1VA 2P09A
chains in the Genus database with same CATH topology
1VQK3 3PCSA 3LTDA 3MKIA 3MG2A 5AI1A 2FGTA 3DM8A 2XGLA 2YX9A 2W03A 4U13A 4GL6A 5IG0A 4MMXB 1S723 1J2BA 5JBSA 5JPUA 1W6YA 3S27A 1EA2A 1O7WB 5IERA 2GEYA 2HMMB 1KC84 3OWSA 1JNQA 1OHPA 2RSXA 1YJW3 2Y74A 2P05A 3QRDA 1GD3A 1M1K4 2D1WA 4I4KA 4O8SA 4RBNA 4KZ1A 2QA43 5EEOA 1Q7Y4 3PYJA 4MMZB 5ELJA 2XR8B 2D42A 3V92A 4O3VA 3U1WA 2CWVA 4N6UA 2KRTA 5AIFA 1VQO3 1YVBI 7STDA 3B4PA 4LGQA 4OVMA 4LMIA 3UL6A 3N9HA 2OWPA 3PXMA 3SEDA 1ULJB 2WO0A 3KE7A 4LSOA 2OTJ3 3SX1A 1A2VA 3PS8A 1NJI4 1Z1SA 3WMDA 1QVF2 3EC9A 3GZXB 1CEWI 1QJGA 3B4OA 4K61A 5KP1A 2CFLA 2K0MA 3JUNA 3EB8A 4FMBA 1WQLB 1V74A 2RCDA 1DYUA 1W02A 2C10A 5BVBA 4AKZA 5KP3A 1W6CA 3B8LA 1WTHA 3UL5A 5G2GA 1OGXA 2LYXA 4RZMA 3PGBA 2O3OA 2Z77A 4LEHA 1NB3I 4GB5A 4HM6B 1RKYA 3X41A 4N6NB 2W56A 2BHMA 1O7NB 1YIJ3 1OACA 3MG1A 3RDEA 3EQQB 3HK4A 1ULIB 2IA7A 1FA3A 3GRDA 3DZLA 4KFEA 1ASKA 2YFIB 4WYKA 4ZM8A 4HM0B 5DRVA 3VSYA 4KFDA 3X3XA 2CG0A 2JQ5A 2XSHB 3KZTA 2BO9B 3NQYA 1BUQA 1IT7A 3CCV3 1SQWA 1E3RA 1SIIA 4N6V0 2F98A 4N6LA 2XGNA 4WHAA 1DVDA 4N6TA 1HKXA 2YFLB 1N5HA 2OOVC 3F7XA 3WA2X 2I9WA 2CH9A 5JPPA 1GY5A 1CYVA 3FG4A 3F14A 2C11A 3PZWA 3FGYA 1GS3A 4HZ9B 5LC7A 1A90A 3IMAB 1N9JA 3EX9A 1OH0A 1KWIA 1YI23 1JRQA 5IW9A 4STDA 1VQ43 3I553 3OWUA 1WMOA 4XBYA 1WMPA 1F8NA 4EBGA 4XDVA 3ROBA 2YFJB 4HVNA 1NO3A 4R4KA 5D82A 2JDIH 1DMNA 3OXAA 4KVHA 1U8CB 2V1LA 5IEOA 4AEQA 2WOFA 1C7HA 2IMJA 1W01A 5AYRB 3DGOA 2STDA 3LMLA 4IIAA 1K8A4 3OW22 1YGEA 1D6YA 2FNQA 2OOVA 3NQZA 1KD14 2HMOB 1CYUA 1RRHA 4RNYA 3CC43 2A15A 3GZBA 3FLJA 2FXTA 3LH4A 2MF7A 5AIHA 1VQM3 3CCE3 5FW5A 3CME3 1TFOA 4XM4A 1ISKA 1O7GB 1IQ8A 4L7KA 5LC6A 1QVG2 3CCL3 2PNCA 3EHCA 2ML6A 3VGNA 1YHQ3 4FMAA 2IUKA 2QEX3 3DGLA 4H3UA 3CCU3 5CXOA 2CWTA 2Q07A 1ZX2A 2INXA 1O7PB 3EBTA 3STDA 3HIGA 1RN7A 3NUVA 3EN1B 1UW1A 1SIHA 3CPW2 1N5PA 3LZAA 3CC23 1AVKA 1AV4A 2CFKA 3LTCA 3X42A 2CWUA 1VZZA 2OQEC 1EKMA 5IENA 1UI8A 4X2OA 1UI7A 1W2ZA 4NHFA 1CQSA 2LQVA 2GXFA 4AKYA 1W5ZA 1NU3A 3UB1A 3J7Yd 3DY5A 3K9MC 3MG3A 1MNLA 2CIUA 4HM3B 3WOFB 3K5TA 4OUQA 1QAFA 3A76A 5IG3A 3JVCA 3NV0B 4KFFA 2GU3A 4N6OB 3X3YA 3SOYA 1IU7A 3BNDA 3H3HA 1Q40B 4HM4B 4HM2B 5DREA 3SOAA 1OUNA 3X40A 3KN4A 1IVVA 4H61A 3S67A 2XEPA 3OWYA 1O7HB 4EC6A 4XBXA 1ROAA 3NXJA 4CDLA 3LOYA 5BXQA 3JUMA 3LT8A 1PFPA 1VQ53 1A2KA 3HIIA 1JJ22 1K9M4 1STDA 2ZDJA 1JB4A 3ECFA 1JN5A 2L4VA 5ELUA 4PEJA 4OK0A 3T8UA 1VQN3 4IT7A 1K28A 5AEWB 1OF5A 3U97A 3BLZA 1LNHA 2CFGA 1VQ73 4HM5B 2ML5A 4Q53A 5FGOA 4EV5A 3VF1A 3JUOA 3NM2A 1Q864 3GWRA 2CKFB 3LTBA 5EQLA 4HM7B 1HU9A 3S29A 4JF8A 5D83A 3CCS3 3K7CA 3CMA3 1GYBA 3IJEB 2W9PA 3JUQA 3T8NA 3LTAA 2MC8A 3CD63 1US1A 3AMOB 1RRLA 1W7CA 3I563 1KQS2 2Z76A 1ROVA 1DMMA 3G4S3 2OCTA 2R4IA 4O2HA 2E2UA 3LYGA 2CFDA 2E2VA 3L0RA 1EQKA 3EJVA 3Q1CA 1K734 1A67A 1NB5I 2GEXA 2Y73A 1VQP3 4R1KA 1IV9A 5CK6A 3FSDA 1IT8A 2OTL3 4FMDA 1JV2B 4N3VA 1D6UA 1IDPA 3F9SA 2ZL8A 4HBRA 2BNGA 3F8HA 3S28A 2P0XA 2GU1A 1N8QA 1FGRA 1RJOA 4WWUC 3IPTA 1YIT3 2E2TA 2QGUA 3DUKA 3LT9A 3CU3A 1O7MB 1N9EA 1Q814 5CF2A 5KP4A 3FZWA 4L8OA 1JKGA 4BTYA 3G6E3 2UX0A 1SJWA 4HJLB 4FR9A 3MPHA 1VQ63 3ALAA 3MSOA 5IG4A 3G713 1UUWB 3CNXA 3AMOA 1NDOB 3FG3A 2XF3A 1YJ93 3CXC2 4G1MB 5CLKA 3G8ZA 5IF6A 1UUVB 2O9UX 2GBXB 1FGOA 3OV4A 3UJMA 3JUPA 8CHOA 4BTXA 4HZBB 1Y4KA 3Q90A 4J9AA 4WP5A 2WGQA 2BMOB 2IUJA 3V98A 1IVXA 3TDGA 1QAKA 3ER7A 5A0OB 1DMQA 1EG9B 1M9GA 3K63A 3KSPA 5TGNA 3NV0A 3CC73 2KXGA 3NX0A 3Q2PA 3PCRA 2CFWA 2W56B 2PZVA 2CC3A 3EBYA 3FH1A 6STDA 2HMNB 5D81A 3KIIA 5STDA 2XFTA 2Z6BA 1IVUA 1JKGB 2HMKB 1OCVA 3QK9A 2W04A 1OGZA 4HM1B 4J8TA 3T0UA 1IK3A 3UNLA 3N8BA 4IPBA 2BMQB 1GY7A 3M8CA 1TFKA 1OF5B 2CW9A 3DXOA 1U5OA 3FF2A 3G16A 3WDGB 4LZIA 3GZRA 1OPYA 2HMLB 5AEUB 2F86B 3DMCA 1LVNA 1OHSA 4XDWA 3SLUA 1FUWA 2HMJB 2WGOA 4HYZA 3S5CA 1FGMA 3B7CA 2OQEA 3GZYB 2RFRA 1TIJA 3G0KA 4R80A 4X2HA 2W0QA 3CCQ3 3FG1A 1Q42A 1YJN3 4RNZA 4MEIA 4JRFA 1R4CA 5IG5A 2P0MA 4FCJA 3EE1A 2WOHA 4HM8B 4FMCA 3MWZA 4N6MA 2B24B 1TU5A 2W6JH 1S5AA 3O8YA 4K90B 1VQ93 2W9QA 3KKGA 2CK3H 4MJDA 5AIGA 2XH9A 5AIIA 4EYCA 1VQL3 3DGNA 2B1XB 3CCR3 3KFQC 5HGRA 4EV2A 1Q824 3X3ZA 4R9KA 3CPOA 2F99A 3WOEB 1N8R4 2KCDA 1OHOA 4QWTA 3NBJA 1AVLA 3BB9A 4HKVB 3MYTA 1PU4A 1Q40A 1WMNA 1E3VA 3MHEA 2XSOB 2CG1A 3SVAA 4XBTA 3NBRA 2CHCA 1SPUA 2BT3A 5I97A 3NM7A 4R9LA 3F40A 3NHXA 3BNBA 3K0ZA 3V99A 4FCZA 3FF0A 2Z7AA 1KSIA 1AR0A 2QIYA 3I0YA 1IQXA 1IQYA 4WFOA 2BMRB 1G96A 1ZO2A 2XFSA 1JB2A 2P38A 2W2CA 1JB5A 3BNEA 4XB5A 1W2B2 1T5YA 4MMYB 4L8PA 3WA3A 1L5GB 3EF8A 3EN8A 4EXRA 3D9RA 3E99A 1STFI 1W00A 3N54B 5AYSC 3HZPA 1TP6A 1NWWA 3HX8A 3DGMA 3CCM3 3FKAA 2XRXB 5CF1A 3CCJ3 1E97A 1GD4A 3FCSB 4BTWA 5IEPA 1IV7A 3LXUX 1TUHA 4K1UA 1M904 1IVWA 2GBWB 4CCVA 4ORLA 4NREA 4WYKB 3OX9A 1JN5B 2RGQA 3BNCA 3D3LA 1D6ZA 1FGTA 1MOLA 4TX4A 1W4NA 3RGRA 1LOXA 1WNHA 3WODG 1QALA 1QMAA 3CNMA 3RGAA 1DVCA 3GAXA 4O02B 1GY6A 3H51A 1VQ83 5EVHA 3KSED 1LXEA 3HI7A 1K41A 4FCMA 1W6GA 3SXXA 2SBLA 3F7SA 1M1XB 1FGQA 2M7OA 2K54A 3F8XA 3NBBA 4K1VA 2P09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMJ B;  4STD A;  3MKI A;  3MG2 A;  4HM7 B;  3OWU A;  5AI1 A;  4XBY A;  3DM8 A;  5D83 A;  3S5C A;  3B7C A;  3GZY B;  2RFR A;  3K7C A;  3G0K A;  4U13 A;  4XDV A;  4X2H A;  5IG0 A;  2YFJ B;  3ROB A;  4HVN A;  5JPU A;  5D82 A;  1Q42 A;  1DMN A;  3OXA A;  4KVH A;  1GYB A;  1W6Y A;  3JUQ A;  3T8N A;  5IG5 A;  5IEO A;  4FCJ A;  1EA2 A;  4HM8 B;  1C7H A;  1O7W B;  2GEY A;  2HMM B;  2IMJ A;  5IER A;  2B24 B;  3OWS A;  1W01 A;  2Z76 A;  1OHP A;  4XDW A;  4IIA A;  2STD A;  1DMM A;  1S5A A;  2R4I A;  4I4K A;  3KKG A;  3LYG A;  4MJD A;  5AIG A;  3EJV A;  5AII A;  2HMO B;  2XR8 B;  2GEX A;  2B1X B;  5HGR A;  2A15 A;  1OH0 A;  4R1K A;  5CK6 A;  3FSD A;  3GZB A;  3FLJ A;  4N3V A;  1IDP A;  4R9K A;  3CPO A;  3F9S A;  5AIH A;  5AIF A;  6STD A;  2F99 A;  7STD A;  2BNG A;  3B4P A;  3F8H A;  4LGQ A;  5FW5 A;  4OVM A;  1OHO A;  4XM4 A;  1ISK A;  1O7G B;  4LMI A;  3BB9 A;  4L7K A;  5DRE A;  4HKV B;  2OWP A;  4WWU C;  3IPT A;  3MYT A;  3EHC A;  1Q40 A;  2QGU A;  3DUK A;  3SED A;  1E3V A;  3VGN A;  1ULJ B;  2XSO B;  3CU3 A;  3KE7 A;  3MHE A;  4XBT A;  1O7M B;  3NBR A;  5CF2 A;  1Z1S A;  2CHC A;  5KP4 A;  3FZW A;  4H3U A;  4L8O A;  3EC9 A;  3WMD A;  1JKG A;  4R9L A;  5CXO A;  2UX0 A;  3F40 A;  3GZX B;  1ZX2 A;  1QJG A;  3B4O A;  3NUV A;  2INX A;  1O7P B;  1SJW A;  3EBT A;  3K0Z A;  3JUN A;  3NHX A;  4HJL B;  3STD A;  5KP1 A;  3FF0 A;  2Z7A A;  2QIY A;  1AR0 A;  1WQL B;  3EN1 B;  3I0Y A;  2RCD A;  1W02 A;  3MSO A;  1UUW B;  3CNX A;  5BVB A;  5IG4 A;  1NDO B;  5KP3 A;  3LZA A;  2BMR B;  1ZO2 A;  4XB5 A;  1JB2 A;  2W2C A;  1JB5 A;  5CLK A;  1VZZ A;  3B8L A;  3F8X A;  3G8Z A;  4L8P A;  4X2O A;  1UUV B;  3EF8 A;  5IEN A;  3EN8 A;  5IF6 A;  1CQS A;  2GBX B;  2GXF A;  3OV4 A;  3UJM A;  5G2G A;  1NU3 A;  1OGX A;  3D9R A;  3E99 A;  1W00 A;  3JUP A;  4RZM A;  3HZP A;  8CHO A;  1TP6 A;  1NWW A;  2Z77 A;  4GB5 A;  3HX8 A;  3Q90 A;  4HM6 B;  3MG3 A;  4HZB B;  3FKA A;  4J9A A;  2XRX B;  4WP5 A;  5CF1 A;  2BMO B;  1E97 A;  4HM3 B;  5IEP A;  3ER7 A;  4OUQ A;  3A76 A;  5IG3 A;  1O7N B;  1TUH A;  4K1U A;  2GBW B;  3MG1 A;  3NV0 B;  1DMQ A;  1EG9 B;  3EQQ B;  3HK4 A;  1ULI B;  3KSP A;  3NV0 A;  5TGN A;  3H3H A;  4ORL A;  3SOY A;  1Q40 B;  3GRD A;  2PZV A;  3DZL A;  4HM2 B;  4HM4 B;  1ASK A;  3EBY A;  3FH1 A;  1OUN A;  4WYK B;  2YFI B;  3SOA A;  4LEH A;  4WYK A;  4HM0 B;  5DRV A;  3VSY A;  2HMN B;  3OX9 A;  3OWY A;  1JN5 B;  2RGQ A;  1O7H B;  5D81 A;  5STD A;  4XBX A;  2JQ5 A;  1JKG B;  2HMK B;  2XSH B;  1OCV A;  3KZT A;  3NXJ A;  4CDL A;  3JUM A;  5BXQ A;  3RGR A;  1OGZ A;  1A2K A;  4HM1 B;  1E3R A;  1BUQ A;  4J8T A;  2F98 A;  3UNL A;  1STD A;  1QMA A;  3CNM A;  2BMQ B;  3RGA A;  1JB4 A;  3ECF A;  1JN5 A;  1GY7 A;  4PEJ A;  1HKX A;  3M8C A;  2YFL B;  3T8U A;  3F7X A;  1GY6 A;  3H51 A;  1OF5 B;  3DXO A;  2I9W A;  5AEW B;  1OF5 A;  1U5O A;  5JPP A;  5EVH A;  1GY5 A;  3BLZ A;  4FCM A;  1K41 A;  3F14 A;  3FF2 A;  3G16 A;  3F7S A;  3FGY A;  3GZR A;  1GS3 A;  4HM5 B;  4Q53 A;  1OPY A;  2HML B;  5AEU B;  2F86 B;  3DMC A;  4HZ9 B;  2K54 A;  3JUO A;  1OHS A;  3NM2 A;  4K1V A;  3EX9 A;  3GWR A;  2CKF B; 
#chains in the Genus database with same CATH topology
 1VQK 3;  3PCS A;  3LTD A;  1SAR A;  3MKI A;  3MG2 A;  5AI1 A;  2FGT A;  3DM8 A;  1BNE A;  2XGL A;  2YX9 A;  2W03 A;  1DE3 A;  4U13 A;  1GOY A;  4GL6 A;  5IG0 A;  4MMX B;  1S72 3;  1RNB A;  1J2B A;  1T2I A;  2BIR A;  5JBS A;  5JPU A;  3D5G A;  1W6Y A;  3S27 A;  1RN4 A;  1JZD A;  1EA2 A;  1O7W B;  5IER A;  2GEY A;  2HMM B;  1KC8 4;  7RNT A;  1BNS A;  3OWS A;  1JNQ A;  1OHP A;  2RSX A;  1YJW 3;  2Y74 A;  2P05 A;  3QRD A;  1GD3 A;  1M1K 4;  2D1W A;  4I4K A;  4O8S A;  1EUI C;  4KZ1 A;  4RBN A;  5EEO A;  2QA4 3;  1Q7Y 4;  3PYJ A;  4MMZ B;  1I0V A;  5ELJ A;  2XR8 B;  1LOV A;  2D42 A;  3V92 A;  1FZU A;  4O3V A;  1B21 A;  3U1W A;  2CWV A;  4KT3 B;  4N6U A;  8RNT A;  2KRT A;  5AIF A;  1VQO 3;  1YVB I;  7STD A;  3B4P A;  1JBR A;  1B20 A;  4LGQ A;  1I0X A;  4OVM A;  4LMI A;  3UL6 A;  3N9H A;  2OWP A;  4I5Q A;  1PYL A;  3PXM A;  3SED A;  1ULJ B;  2WO0 A;  3KE7 A;  4LSO A;  1TRQ A;  2OTJ 3;  3SX1 A;  4BU4 A;  1A2V A;  3PS8 A;  1I2F A;  1NJI 4;  1Z1S A;  2F4Y A;  3WMD A;  1QVF 2;  3EC9 A;  1BIR A;  3GZX B;  1CEW I;  1QJG A;  3B4O A;  4K61 A;  1UCK A;  5KP1 A;  1GOU A;  2KAA A;  2CFL A;  2K0M A;  3JUN A;  1LRA A;  3EB8 A;  1UUG B;  3DGY A;  4FMB A;  1WQL B;  2F5M A;  1V74 A;  1DYU A;  1W02 A;  1TJD A;  2RCD A;  2C10 A;  3BIR A;  4AKZ A;  5BVB A;  4GHO A;  2F56 A;  5KP3 A;  2H0H A;  5G1K A;  1W6C A;  1YNV X;  1UDI I;  3B8L A;  1WTH A;  1ZS7 A;  1YVS A;  2J8X B;  3RNT A;  1LQM B;  3UL5 A;  5G2G A;  1OGX A;  2LYX A;  4RZM A;  1LQG C;  3PGB A;  1MWS A;  2O3O A;  2Z77 A;  4LEH A;  1BNJ A;  1NB3 I;  3GSP A;  4GB5 A;  4HM6 B;  1RKY A;  3X41 A;  4N6N B;  2W56 A;  4BL2 A;  1I2G A;  2BHM A;  2KF3 A;  1O7N B;  1YIJ 3;  1OAC A;  3MG1 A;  3RDE A;  3EQQ B;  1BRH A;  1ULI B;  2IA7 A;  3HK4 A;  5G1L A;  1FA3 A;  3GRD A;  3DZL A;  4KFE A;  1ASK A;  2YFI B;  4WYK A;  4ZM8 A;  4HM0 B;  5DRV A;  3VSY A;  2H0G A;  4KFD A;  3X3X A;  4CJN A;  2CG0 A;  1BRI A;  2JQ5 A;  2XSH B;  2BO9 B;  3KZT A;  3NQY A;  1JBT A;  1BUQ A;  1IT7 A;  3CCV 3;  5GSP A;  1SQW A;  1E3R A;  1SII A;  4N6V 0;  2F98 A;  4N6L A;  2XGN A;  4J5K A;  4WHA A;  1X1U A;  1DVD A;  4N6T A;  1HKX A;  2YFL B;  1N5H A;  2OOV C;  3F7X A;  3WA2 X;  1BRJ A;  2I9W A;  2CH9 A;  3AHS A;  1B2X A;  5BU4 A;  5JPP A;  1GY5 A;  1CYV A;  3FG4 A;  3F14 A;  3URP A;  2C11 A;  3PZW A;  2GSP A;  3FGY A;  1RN1 A;  1GS3 A;  1BAN A;  4HZ9 B;  5LC7 A;  1A90 A;  3IMA B;  1N9J A;  3EX9 A;  1OH0 A;  1KWI A;  1YI2 3;  1JRQ A;  5IW9 A;  4STD A;  1VQ4 3;  1BNG A;  1BNF A;  1V58 A;  3I55 3;  3OWU A;  1WMO A;  4XBY A;  1WMP A;  1F8N A;  4EBG A;  4XDV A;  1BRS A;  3ROB A;  2YFJ B;  4HVN A;  1NO3 A;  4R4K A;  5D82 A;  2JDI H;  1DMN A;  3OXA A;  4KVH A;  1U8C B;  2V1L A;  5IEO A;  4AEQ A;  2WOF A;  1C7H A;  3ZG0 A;  2IMJ A;  1Q7H A;  1W01 A;  2H0I A;  5AYR B;  3DGO A;  2STD A;  3LML A;  4IIA A;  1BSD A;  5M1A A;  1K8A 4;  3ZFZ A;  3OW2 2;  1B27 A;  1YGE A;  1D6Y A;  2FNQ A;  2OOV A;  1BRK A;  3NQZ A;  1KD1 4;  2HMO B;  1CYU A;  1RRH A;  3AHW A;  4RNY A;  3CC4 3;  2A15 A;  3GZB A;  3FLJ A;  1B3S A;  2FXT A;  3LH4 A;  2MF7 A;  5AIH A;  1AY7 A;  1AQZ A;  1VQM 3;  3CCE 3;  5FW5 A;  3CME 3;  1BUJ A;  1BNI A;  1TFO A;  3HOH A;  4XM4 A;  1ISK A;  1O7G B;  2RBI A;  1IQ8 A;  4BL3 A;  4L7K A;  5LC6 A;  1QVG 2;  3CCL 3;  1PY3 A;  2PNC A;  3EHC A;  2ML6 A;  3VGN A;  1YHQ 3;  4FMA A;  2IUK A;  1EEJ A;  1NNV A;  2QEX 3;  3DGL A;  4H3U A;  3CCU 3;  1A2P A;  5CXO A;  2CWT A;  1R4Y A;  2Q07 A;  5BIR A;  1ZX2 A;  1BRG A;  2INX A;  1O7P B;  3EBT A;  1BSC A;  3STD A;  3HIG A;  1RN7 A;  3NUV A;  3EN1 B;  1RMS A;  1UW1 A;  1SIH A;  3CPW 2;  1N5P A;  3LZA A;  3CC2 3;  1AVK A;  1AV4 A;  1VQQ A;  2CFK A;  3LTC A;  3X42 A;  2C4B A;  2CWU A;  1VZZ A;  2OQE C;  1EKM A;  5IEN A;  1UI8 A;  4X2O A;  1UI7 A;  1W2Z A;  4NHF A;  1CQS A;  2LQV A;  2GXF A;  4AKY A;  1MWU A;  1W5Z A;  1NU3 A;  3UB1 A;  3J7Y d;  1RCK A;  3DY5 A;  3K9M C;  3MG3 A;  3D79 A;  1MNL A;  2CIU A;  4HM3 B;  3WOF B;  5RNT A;  3K5T A;  4OUQ A;  1QAF A;  3A76 A;  4HAA A;  5IG3 A;  3JVC A;  3NV0 B;  4KFF A;  2GU3 A;  4N6O B;  3X3Y A;  3SOY A;  1IU7 A;  3BND A;  1RSN A;  3H3H A;  4DKI A;  1Q40 B;  4HM4 B;  4HM2 B;  5DRE A;  3SOA A;  1OUN A;  1UCJ A;  3X40 A;  3KN4 A;  1IVV A;  1RLS A;  4H61 A;  3S67 A;  2XEP A;  3SYU A;  3OWY A;  1O7H B;  4EC6 A;  4XBX A;  1ROA A;  3NXJ A;  4CDL A;  6GSP A;  3LOY A;  5BXQ A;  3JUM A;  3LT8 A;  1PFP A;  1VQ5 3;  1A2K A;  3HII A;  1JJ2 2;  1JZO A;  1K9M 4;  1STD A;  1IYY A;  1HZ1 A;  2ZDJ A;  1JB4 A;  3ECF A;  1JN5 A;  2L4V A;  5ELU A;  4PEJ A;  4OK0 A;  3T8U A;  1VQN 3;  4IT7 A;  5HOH A;  2L1S A;  1K28 A;  5AEW B;  1OF5 A;  3U97 A;  3WHO A;  3BLZ A;  1LNH A;  1B2M A;  2CFG A;  1VQ7 3;  4HM5 B;  2ML5 A;  4Q53 A;  5FGO A;  4EV5 A;  2RNT A;  3VF1 A;  1G02 A;  3JUO A;  3NM2 A;  1Q86 4;  3GWR A;  1MWR A;  2CKF B;  3LTB A;  1T3B A;  5EQL A;  4HM7 B;  1HU9 A;  3S29 A;  4JF8 A;  5D83 A;  3CCS 3;  3K7C A;  1MGR A;  1X1Y A;  3Q3F A;  1CH0 A;  3CMA 3;  1RGH A;  1GYB A;  3IJE B;  2W9P A;  3JUQ A;  3T8N A;  3LTA A;  2MC8 A;  3CD6 3;  1US1 A;  3AMO B;  1RRL A;  1W7C A;  3A5E A;  3I56 3;  1KQS 2;  4CPK A;  2Z76 A;  1ROV A;  1DMM A;  3G4S 3;  2OCT A;  2R4I A;  4O2H A;  2E2U A;  3LYG A;  2BU4 A;  2CFD A;  2E2V A;  3L0R A;  1EQK A;  3EJV A;  3Q1C A;  1K73 4;  1A67 A;  1NB5 I;  2GEX A;  6RNT A;  2Y73 A;  1VQP 3;  4R1K A;  1IV9 A;  5CK6 A;  3DH2 A;  1IT8 A;  3FSD A;  3ZG5 A;  2CX1 A;  2OTL 3;  4FMD A;  1JV2 B;  4N3V A;  1D6U A;  1IDP A;  3F9S A;  2ZL8 A;  4HBR A;  1BAO A;  2BNG A;  3F8H A;  3S28 A;  2P0X A;  1GSP A;  2GU1 A;  1N8Q A;  1FGR A;  1I3I A;  1RJO A;  4WWU C;  3IPT A;  1YIT 3;  2E2T A;  2QGU A;  3DUK A;  2IYJ A;  1FYS A;  3LT9 A;  3CU3 A;  4RNT A;  9RNT A;  1O7M B;  1N9E A;  1Q81 4;  5CF2 A;  5KP4 A;  3FZW A;  4L8O A;  1JKG A;  1BOX A;  4BTY A;  3G6E 3;  2UX0 A;  2UGI A;  4LYL B;  1UCL A;  1SJW A;  4HJL B;  4FR9 A;  3MPH A;  1VQ6 3;  3ALA A;  3MSO A;  1GOV A;  5IG4 A;  3G71 3;  1UUW B;  3CNX A;  3AMO A;  1NDO B;  3FG3 A;  1B2U A;  2XF3 A;  1X1X A;  1YJ9 3;  3CXC 2;  4G1M B;  5CLK A;  3G8Z A;  4J5G A;  1UUV B;  5IF6 A;  2O9U X;  1G0T A;  3BU4 A;  2GBX B;  1FGO A;  3OV4 A;  3UJM A;  3JUP A;  8CHO A;  4BTX A;  4HZB B;  1Y4K A;  1RDS A;  3Q90 A;  4J9A A;  1BRN L;  4WP5 A;  2WGQ A;  2BMO B;  1GMR A;  2IUJ A;  3V98 A;  1IVX A;  3TDG A;  1QAK A;  3ER7 A;  5A0O B;  1UGI A;  1DMQ A;  1EG9 B;  1M9G A;  3K63 A;  3KSP A;  5TGN A;  3NV0 A;  1MWT A;  2KXG A;  1V57 A;  3NX0 A;  3Q2P A;  3PCR A;  2CFW A;  2W56 B;  1LOW A;  3CC7 3;  2PZV A;  2CC3 A;  3EBY A;  3FH1 A;  2KF6 A;  6STD A;  2HMN B;  5D81 A;  3KII A;  2CX0 A;  5STD A;  2XFT A;  1BU4 A;  1IVU A;  2Z6B A;  1JKG B;  2HMK B;  1B2S A;  1OCV A;  3QK9 A;  1TRP A;  2W04 A;  1OGZ A;  4HM1 B;  7GSP A;  4J8T A;  3T0U A;  1IK3 A;  1DET A;  1RNT A;  3UNL A;  3N8B A;  4IPB A;  2BMQ B;  1GY7 A;  3M8C A;  1RHL A;  1TFK A;  1OF5 B;  2CW9 A;  3DXO A;  1RTU A;  2SAR A;  1U5O A;  3FF2 A;  3G16 A;  3WDG B;  4LZI A;  1T2H A;  3GZR A;  1OPY A;  2HML B;  5AEU B;  2F86 B;  3DMC A;  2R41 A;  1LVN A;  1OHS A;  4XDW A;  1FUT A;  3SLU A;  1FUW A;  2HMJ B;  2WGO A;  4HYZ A;  1FW7 A;  3S5C A;  1FGM A;  1I70 A;  1YGW A;  1I2E A;  3B7C A;  2IY2 A;  3GZY B;  2RFR A;  2OQE A;  1TIJ A;  3G0K A;  4R80 A;  4X2H A;  1HYF A;  2W0Q A;  3CCQ 3;  1JBS A;  1BNR A;  3FG1 A;  1Q42 A;  3AGN A;  1YJN 3;  2HOH A;  4RNZ A;  4MEI A;  4JRF A;  1R4C A;  1BGS A;  2P0M A;  4FCJ A;  1RGA A;  3EE1 A;  2WOH A;  5IG5 A;  1I3F A;  4FMC A;  4HM8 B;  2ZHX B;  3MWZ A;  4N6M A;  2B24 B;  1TU5 A;  2W6J H;  1UCI A;  1S5A A;  3O8Y A;  4K90 B;  3KCH A;  1VQ9 3;  2W9Q A;  3KKG A;  2CK3 H;  4MJD A;  5AIG A;  2XH9 A;  5AII A;  4EYC A;  1VQL 3;  3DGN A;  2B1X B;  5M19 A;  3CCR 3;  4GSP A;  3KFQ C;  5HGR A;  1C54 A;  4EV2 A;  1Q82 4;  3X3Z A;  1RGE A;  4R9K A;  3CPO A;  2F99 A;  3WOE B;  4EW5 A;  2KCD A;  1N8R 4;  1OHO A;  1X1W A;  4QWT A;  1TTO A;  3NBJ A;  1AVL A;  3BB9 A;  4HKV B;  3MYT A;  1PU4 A;  1Q40 A;  1WMN A;  2UUG C;  1E3V A;  1ZGX A;  2XSO B;  3MHE A;  2CG1 A;  3SVA A;  1LNI A;  5M18 A;  1RGL A;  4XBT A;  2ZA4 A;  3NBR A;  1BSB A;  2CHC A;  1SPU A;  1Q9E A;  2BT3 A;  5I97 A;  2AAD A;  3NM7 A;  4R9L A;  3F40 A;  3NHX A;  3BNB A;  3K0Z A;  1RGC A;  3V99 A;  4FCZ A;  3FF0 A;  2Z7A A;  1KSI A;  1AR0 A;  2QIY A;  3I0Y A;  1IQX A;  1IQY A;  1BVI A;  2AAE A;  4WFO A;  1FUS A;  2BMR B;  1G96 A;  1ZO2 A;  2XFS A;  1JB2 A;  2P38 A;  1GMP A;  1JB5 A;  2W2C A;  3BNE A;  4XB5 A;  1W2B 2;  1T5Y A;  4MMY B;  1LOY A;  4L8P A;  3WA3 A;  1L5G B;  3EF8 A;  1I8V A;  3EN8 A;  4HOH A;  4EXR A;  3D9R A;  3E99 A;  1STF I;  1W00 A;  3N54 B;  5AYS C;  3HZP A;  3WR2 A;  1MGW A;  2KF5 A;  1TP6 A;  1NWW A;  2KF4 A;  3HX8 A;  3DGM A;  3CCM 3;  3FKA A;  2XRX B;  5CF1 A;  3CCJ 3;  1E97 A;  1GD4 A;  3FCS B;  4BTW A;  5IEP A;  1RGF A;  1RGG A;  1IV7 A;  3LXU X;  1TUH A;  4K1U A;  1M90 4;  1IVW A;  2GBW B;  4CCV A;  3D4A A;  2K3D A;  4ORL A;  1RCL A;  2F5W A;  4NRE A;  4WYK B;  1GMQ A;  1BSA A;  3OX9 A;  1JN5 B;  2RGQ A;  3BNC A;  4ILF A;  3D3L A;  1D6Z A;  1FGT A;  1MOL A;  3D5I A;  4TX4 A;  3AGO A;  1W4N A;  3RGR A;  1B2Z A;  1LOX A;  1WNH A;  1BSE A;  3WOD G;  1QAL A;  1QMA A;  3CNM A;  3RGA A;  1RGK A;  1DVC A;  3GAX A;  1UGH I;  4O02 B;  1GY6 A;  3H51 A;  1VQ8 3;  5EVH A;  3KSE D;  1LXE A;  3HI7 A;  1K41 A;  4FCM A;  1W6G A;  3SXX A;  2SBL A;  3F7S A;  1M1X B;  4BIR A;  1FGQ A;  2M7O A;  2K54 A;  4NPB A;  3F8X A;  3NBB A;  4K1V A;  2P09 A; 
#chains in the Genus database with same CATH homology
 1VQK 3;  3PCS A;  3LTD A;  3MKI A;  3MG2 A;  5AI1 A;  2FGT A;  3DM8 A;  2XGL A;  2YX9 A;  2W03 A;  4U13 A;  4GL6 A;  5IG0 A;  4MMX B;  1S72 3;  1J2B A;  5JBS A;  5JPU A;  1W6Y A;  3S27 A;  1EA2 A;  1O7W B;  5IER A;  2GEY A;  2HMM B;  1KC8 4;  3OWS A;  1JNQ A;  1OHP A;  2RSX A;  1YJW 3;  2Y74 A;  2P05 A;  3QRD A;  1GD3 A;  1M1K 4;  2D1W A;  4I4K A;  4O8S A;  4RBN A;  4KZ1 A;  2QA4 3;  5EEO A;  1Q7Y 4;  3PYJ A;  4MMZ B;  5ELJ A;  2XR8 B;  2D42 A;  3V92 A;  4O3V A;  3U1W A;  2CWV A;  4N6U A;  2KRT A;  5AIF A;  1VQO 3;  1YVB I;  7STD A;  3B4P A;  4LGQ A;  4OVM A;  4LMI A;  3UL6 A;  3N9H A;  2OWP A;  3PXM A;  3SED A;  1ULJ B;  2WO0 A;  3KE7 A;  4LSO A;  2OTJ 3;  3SX1 A;  1A2V A;  3PS8 A;  1NJI 4;  1Z1S A;  3WMD A;  1QVF 2;  3EC9 A;  3GZX B;  1CEW I;  1QJG A;  3B4O A;  4K61 A;  5KP1 A;  2CFL A;  2K0M A;  3JUN A;  3EB8 A;  4FMB A;  1WQL B;  1V74 A;  2RCD A;  1DYU A;  1W02 A;  2C10 A;  5BVB A;  4AKZ A;  5KP3 A;  1W6C A;  3B8L A;  1WTH A;  3UL5 A;  5G2G A;  1OGX A;  2LYX A;  4RZM A;  3PGB A;  2O3O A;  2Z77 A;  4LEH A;  1NB3 I;  4GB5 A;  4HM6 B;  1RKY A;  3X41 A;  4N6N B;  2W56 A;  2BHM A;  1O7N B;  1YIJ 3;  1OAC A;  3MG1 A;  3RDE A;  3EQQ B;  3HK4 A;  1ULI B;  2IA7 A;  1FA3 A;  3GRD A;  3DZL A;  4KFE A;  1ASK A;  2YFI B;  4WYK A;  4ZM8 A;  4HM0 B;  5DRV A;  3VSY A;  4KFD A;  3X3X A;  2CG0 A;  2JQ5 A;  2XSH B;  3KZT A;  2BO9 B;  3NQY A;  1BUQ A;  1IT7 A;  3CCV 3;  1SQW A;  1E3R A;  1SII A;  4N6V 0;  2F98 A;  4N6L A;  2XGN A;  4WHA A;  1DVD A;  4N6T A;  1HKX A;  2YFL B;  1N5H A;  2OOV C;  3F7X A;  3WA2 X;  2I9W A;  2CH9 A;  5JPP A;  1GY5 A;  1CYV A;  3FG4 A;  3F14 A;  2C11 A;  3PZW A;  3FGY A;  1GS3 A;  4HZ9 B;  5LC7 A;  1A90 A;  3IMA B;  1N9J A;  3EX9 A;  1OH0 A;  1KWI A;  1YI2 3;  1JRQ A;  5IW9 A;  4STD A;  1VQ4 3;  3I55 3;  3OWU A;  1WMO A;  4XBY A;  1WMP A;  1F8N A;  4EBG A;  4XDV A;  3ROB A;  2YFJ B;  4HVN A;  1NO3 A;  4R4K A;  5D82 A;  2JDI H;  1DMN A;  3OXA A;  4KVH A;  1U8C B;  2V1L A;  5IEO A;  4AEQ A;  2WOF A;  1C7H A;  2IMJ A;  1W01 A;  5AYR B;  3DGO A;  2STD A;  3LML A;  4IIA A;  1K8A 4;  3OW2 2;  1YGE A;  1D6Y A;  2FNQ A;  2OOV A;  3NQZ A;  1KD1 4;  2HMO B;  1CYU A;  1RRH A;  4RNY A;  3CC4 3;  2A15 A;  3GZB A;  3FLJ A;  2FXT A;  3LH4 A;  2MF7 A;  5AIH A;  1VQM 3;  3CCE 3;  5FW5 A;  3CME 3;  1TFO A;  4XM4 A;  1ISK A;  1O7G B;  1IQ8 A;  4L7K A;  5LC6 A;  1QVG 2;  3CCL 3;  2PNC A;  3EHC A;  2ML6 A;  3VGN A;  1YHQ 3;  4FMA A;  2IUK A;  2QEX 3;  3DGL A;  4H3U A;  3CCU 3;  5CXO A;  2CWT A;  2Q07 A;  1ZX2 A;  2INX A;  1O7P B;  3EBT A;  3STD A;  3HIG A;  1RN7 A;  3NUV A;  3EN1 B;  1UW1 A;  1SIH A;  3CPW 2;  1N5P A;  3LZA A;  3CC2 3;  1AVK A;  1AV4 A;  2CFK A;  3LTC A;  3X42 A;  2CWU A;  1VZZ A;  2OQE C;  1EKM A;  5IEN A;  1UI8 A;  4X2O A;  1UI7 A;  1W2Z A;  4NHF A;  1CQS A;  2LQV A;  2GXF A;  4AKY A;  1W5Z A;  1NU3 A;  3UB1 A;  3J7Y d;  3DY5 A;  3K9M C;  3MG3 A;  1MNL A;  2CIU A;  4HM3 B;  3WOF B;  3K5T A;  4OUQ A;  1QAF A;  3A76 A;  5IG3 A;  3JVC A;  3NV0 B;  4KFF A;  2GU3 A;  4N6O B;  3X3Y A;  3SOY A;  1IU7 A;  3BND A;  3H3H A;  1Q40 B;  4HM4 B;  4HM2 B;  5DRE A;  3SOA A;  1OUN A;  3X40 A;  3KN4 A;  1IVV A;  4H61 A;  3S67 A;  2XEP A;  3OWY A;  1O7H B;  4EC6 A;  4XBX A;  1ROA A;  3NXJ A;  4CDL A;  3LOY A;  5BXQ A;  3JUM A;  3LT8 A;  1PFP A;  1VQ5 3;  1A2K A;  3HII A;  1JJ2 2;  1K9M 4;  1STD A;  2ZDJ A;  1JB4 A;  3ECF A;  1JN5 A;  2L4V A;  5ELU A;  4PEJ A;  4OK0 A;  3T8U A;  1VQN 3;  4IT7 A;  1K28 A;  5AEW B;  1OF5 A;  3U97 A;  3BLZ A;  1LNH A;  2CFG A;  1VQ7 3;  4HM5 B;  2ML5 A;  4Q53 A;  5FGO A;  4EV5 A;  3VF1 A;  3JUO A;  3NM2 A;  1Q86 4;  3GWR A;  2CKF B;  3LTB A;  5EQL A;  4HM7 B;  1HU9 A;  3S29 A;  4JF8 A;  5D83 A;  3CCS 3;  3K7C A;  3CMA 3;  1GYB A;  3IJE B;  2W9P A;  3JUQ A;  3T8N A;  3LTA A;  2MC8 A;  3CD6 3;  1US1 A;  3AMO B;  1RRL A;  1W7C A;  3I56 3;  1KQS 2;  2Z76 A;  1ROV A;  1DMM A;  3G4S 3;  2OCT A;  2R4I A;  4O2H A;  2E2U A;  3LYG A;  2CFD A;  2E2V A;  3L0R A;  1EQK A;  3EJV A;  3Q1C A;  1K73 4;  1A67 A;  1NB5 I;  2GEX A;  2Y73 A;  1VQP 3;  4R1K A;  1IV9 A;  5CK6 A;  3FSD A;  1IT8 A;  2OTL 3;  4FMD A;  1JV2 B;  4N3V A;  1D6U A;  1IDP A;  3F9S A;  2ZL8 A;  4HBR A;  2BNG A;  3F8H A;  3S28 A;  2P0X A;  2GU1 A;  1N8Q A;  1FGR A;  1RJO A;  4WWU C;  3IPT A;  1YIT 3;  2E2T A;  2QGU A;  3DUK A;  3LT9 A;  3CU3 A;  1O7M B;  1N9E A;  1Q81 4;  5CF2 A;  5KP4 A;  3FZW A;  4L8O A;  1JKG A;  4BTY A;  3G6E 3;  2UX0 A;  1SJW A;  4HJL B;  4FR9 A;  3MPH A;  1VQ6 3;  3ALA A;  3MSO A;  5IG4 A;  3G71 3;  1UUW B;  3CNX A;  3AMO A;  1NDO B;  3FG3 A;  2XF3 A;  1YJ9 3;  3CXC 2;  4G1M B;  5CLK A;  3G8Z A;  5IF6 A;  1UUV B;  2O9U X;  2GBX B;  1FGO A;  3OV4 A;  3UJM A;  3JUP A;  8CHO A;  4BTX A;  4HZB B;  1Y4K A;  3Q90 A;  4J9A A;  4WP5 A;  2WGQ A;  2BMO B;  2IUJ A;  3V98 A;  1IVX A;  3TDG A;  1QAK A;  3ER7 A;  5A0O B;  1DMQ A;  1EG9 B;  1M9G A;  3K63 A;  3KSP A;  5TGN A;  3NV0 A;  3CC7 3;  2KXG A;  3NX0 A;  3Q2P A;  3PCR A;  2CFW A;  2W56 B;  2PZV A;  2CC3 A;  3EBY A;  3FH1 A;  6STD A;  2HMN B;  5D81 A;  3KII A;  5STD A;  2XFT A;  2Z6B A;  1IVU A;  1JKG B;  2HMK B;  1OCV A;  3QK9 A;  2W04 A;  1OGZ A;  4HM1 B;  4J8T A;  3T0U A;  1IK3 A;  3UNL A;  3N8B A;  4IPB A;  2BMQ B;  1GY7 A;  3M8C A;  1TFK A;  1OF5 B;  2CW9 A;  3DXO A;  1U5O A;  3FF2 A;  3G16 A;  3WDG B;  4LZI A;  3GZR A;  1OPY A;  2HML B;  5AEU B;  2F86 B;  3DMC A;  1LVN A;  1OHS A;  4XDW A;  3SLU A;  1FUW A;  2HMJ B;  2WGO A;  4HYZ A;  3S5C A;  1FGM A;  3B7C A;  2OQE A;  3GZY B;  2RFR A;  1TIJ A;  3G0K A;  4R80 A;  4X2H A;  2W0Q A;  3CCQ 3;  3FG1 A;  1Q42 A;  1YJN 3;  4RNZ A;  4MEI A;  4JRF A;  1R4C A;  5IG5 A;  2P0M A;  4FCJ A;  3EE1 A;  2WOH A;  4HM8 B;  4FMC A;  3MWZ A;  4N6M A;  2B24 B;  1TU5 A;  2W6J H;  1S5A A;  3O8Y A;  4K90 B;  1VQ9 3;  2W9Q A;  3KKG A;  2CK3 H;  4MJD A;  5AIG A;  2XH9 A;  5AII A;  4EYC A;  1VQL 3;  3DGN A;  2B1X B;  3CCR 3;  3KFQ C;  5HGR A;  4EV2 A;  1Q82 4;  3X3Z A;  4R9K A;  3CPO A;  2F99 A;  3WOE B;  1N8R 4;  2KCD A;  1OHO A;  4QWT A;  3NBJ A;  1AVL A;  3BB9 A;  4HKV B;  3MYT A;  1PU4 A;  1Q40 A;  1WMN A;  1E3V A;  3MHE A;  2XSO B;  2CG1 A;  3SVA A;  4XBT A;  3NBR A;  2CHC A;  1SPU A;  2BT3 A;  5I97 A;  3NM7 A;  4R9L A;  3F40 A;  3NHX A;  3BNB A;  3K0Z A;  3V99 A;  4FCZ A;  3FF0 A;  2Z7A A;  1KSI A;  1AR0 A;  2QIY A;  3I0Y A;  1IQX A;  1IQY A;  4WFO A;  2BMR B;  1G96 A;  1ZO2 A;  2XFS A;  1JB2 A;  2P38 A;  2W2C A;  1JB5 A;  3BNE A;  4XB5 A;  1W2B 2;  1T5Y A;  4MMY B;  4L8P A;  3WA3 A;  1L5G B;  3EF8 A;  3EN8 A;  4EXR A;  3D9R A;  3E99 A;  1STF I;  1W00 A;  3N54 B;  5AYS C;  3HZP A;  1TP6 A;  1NWW A;  3HX8 A;  3DGM A;  3CCM 3;  3FKA A;  2XRX B;  5CF1 A;  3CCJ 3;  1E97 A;  1GD4 A;  3FCS B;  4BTW A;  5IEP A;  1IV7 A;  3LXU X;  1TUH A;  4K1U A;  1M90 4;  1IVW A;  2GBW B;  4CCV A;  4ORL A;  4NRE A;  4WYK B;  3OX9 A;  1JN5 B;  2RGQ A;  3BNC A;  3D3L A;  1D6Z A;  1FGT A;  1MOL A;  4TX4 A;  1W4N A;  3RGR A;  1LOX A;  1WNH A;  3WOD G;  1QAL A;  1QMA A;  3CNM A;  3RGA A;  1DVC A;  3GAX A;  4O02 B;  1GY6 A;  3H51 A;  1VQ8 3;  5EVH A;  3KSE D;  1LXE A;  3HI7 A;  1K41 A;  4FCM A;  1W6G A;  3SXX A;  2SBL A;  3F7S A;  1M1X B;  1FGQ A;  2M7O A;  2K54 A;  3F8X A;  3NBB A;  4K1V A;  2P09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...