4WWUC

Structure of mex67:mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
165
Chain Sequence
b'MVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPIQMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDSLLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA export factor MEX67
publication title Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 37
structure length 165
sequence length 177
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wwuC00
2QGUA 1ISKA 3NUVA 1GY5A 3EX9A 5AIHA 3HK4A 3JUMA 3MYTA 4XM4A 3EBTA 1TP6A 1OHSA 2HMLB 3EBYA 4R9KA 3EQQB 3KZTA 3OV4A 1HKXA 2XR8B 3RGAA 3MG2A 3ROBA 4WWUC 1W6YA 2RCDA 1W02A 1JKGA 1VZZA 3DM8A 1QJGA 4LGQA 3G16A 2A15A 3H3HA 3DUKA 3EN1B 2HMNB 1O7WB 3OXAA 4I4KA 4X2OA 3JUNA 5IF6A 3KE7A 5AEWB 5KP4A 3F14A 2I9WA 4FCMA 4HKVB 2HMJB 3FGYA 1U5OA 1GY6A 3KKGA 4HM5B 3UJMA 1OHPA 1EG9B 5D83A 2GEXA 1OHOA 1O7MB 4J8TA 1GS3A 2XRXB 3NV0B 4HM0B 2RFRA 3EC9A 3CU3A 1K41A 4HZ9B 3BB9A 2JQ5A 3CNMA 4H3UA 3B8LA 2B1XB 5CXOA 3FSDA 4STDA 4LMIA 2BMQB 5BVBA 3FZWA 4Q53A 2CHCA 3EN8A 4MJDA 2GXFA 3MSOA 3HZPA 1GY7A 5IERA 5AIIA 2Z77A 4IIAA 4WYKA 1TUHA 4L7KA 1QMAA 4HM8B 5AI1A 1OF5A 4OVMA 3EHCA 5EVHA 1JB4A 4R1KA 1NWWA 3B7CA 5JPPA 4XBYA 4N3VA 5IG0A 1NU3A 2RGQA 1W00A 1OGXA 2B24B 3DXOA 1UUWB 3F7XA 3FLJA 3ECFA 5BXQA 2YFIB 3I0YA 1DMNA 5IG4A 4R9LA 3G0KA 5FW5A 4HM6B 2OWPA 1NDOB 5G2GA 1WQLB 1JN5A 2HMMB 3MG3A 1Q40B 6STDA 3BLZA 3GRDA 2GBWB 5TGNA 1JB5A 3F9SA 1OPYA 3IPTA 2R4IA 1CQSA 2BMRB 3DZLA 1GYBA 5D82A 4XBXA 4HZBB 5AIGA 1OUNA 2GEYA 3DMCA 3SOAA 5KP1A 1Q42A 1EA2A 4K1UA 4HJLB 1W01A 2UX0A 3NBRA 3GZYB 3E99A 4X2HA 4HVNA 3KSPA 3A76A 3FH1A 5DREA 3STDA 7STDA 1OGZA 4CDLA 3OWYA 2K54A 5CF2A 2GBXB 3WMDA 1DMQA 1ASKA 1OF5B 3GZRA 4XBTA 2F98A 3M8CA 1IDPA 3HX8A 3GZXB 1OCVA 3K7CA 2F99A 5IEPA 2PZVA 3MKIA 5KP3A 3NHXA 3LYGA 3F7SA 4GB5A 4LEHA 2BMOB 3JUPA 5AEUB 5JPUA 2XSHB 4HM4B 1JKGB 1JB2A 2CKFB 5CLKA 1AR0A 5D81A 3SOYA 3OWSA 2YFLB 2HMOB 3F40A 3EJVA 4HM2B 3F8XA 2STDA 2INXA 2XSOB 1BUQA 1E3RA 2IMJA 5IEOA 3ER7A 5IG3A 1A2KA 1UUVB 1ULIB 3CNXA 4XDVA 3OWUA 5CK6A 3D9RA 4U13A 4L8PA 2YFJB 2HMKB 3FF0A 1O7HB 4RZMA 4PEJA 3NM2A 1E3VA 1S5AA 1SJWA 8CHOA 5DRVA 5HGRA 1DMMA 3GWRA 4XB5A 1O7GB 1OH0A 2Z76A 4HM7B 3B4PA 1ZO2A 5IENA 4J9AA 2W2CA 5CF1A 3K0ZA 3MG1A 3JUQA 3H51A 4WP5A 4HM1B 3GZBA 2QIYA 3S5CA 4FCJA 4WYKB 3LZAA 4L8OA 1Z1SA 1Q40A 4OUQA 3Q90A 4XDWA 1ULJB 3EF8A 4ORLA 1ZX2A 3FF2A 3VGNA 1C7HA 3UNLA 4HM3B 3MHEA 1E97A 3JUOA 3NXJA 4KVHA 3G8ZA 5AIFA 2Z7AA 2BNGA 5STDA 2F86B 3T8NA 1O7NB 3F8HA 3T8UA 5IG5A 3RGRA 3OX9A 3CPOA 3SEDA 3B4OA 1STDA 3NV0A 3FKAA 1O7PB 4K1VA 1JN5B 3VSYA
chains in the Genus database with same CATH superfamily
1LQGC 3D3LA 2QGUA 3DGLA 4O3VA 3RDEA 1I3IA 1ISKA 1KC84 4FCZA 1IV9A 2YX9A 3NUVA 3ALAA 3K9MC 2IA7A 1TRPA 4G1MB 1GY5A 1QALA 3EX9A 1BSBA 2CG0A 3LTDA 1UCJA 5GSPA 5AIHA 2ML6A 2IY2A 1CH0A 3HK4A 1PY3A 3PS8A 4IT7A 3JUMA 4LSOA 3MYTA 1IT8A 4XM4A 4FR9A 5IW9A 2XGNA 3EBTA 1M1XB 1LRAA 4RNYA 4EW5A 3V99A 1EUIC 2D1WA 3EB8A 1RSNA 1RGKA 1VQP3 3D5IA 1TP6A 1OHSA 4MMYB 2HMLB 3EBYA 5G1KA 4R9KA 3EQQB 1I0XA 3KZTA 1KSIA 2E2VA 5M18A 3OV4A 1HKXA 1RGGA 3SX1A 2XR8B 4I5QA 3RGAA 1I2EA 3MG2A 3GSPA 1MWUA 1GMPA 4TX4A 1D6ZA 3ROBA 1B3SA 1MNLA 2CX0A 1UCLA 1W6YA 2P05A 3DH2A 2RSXA 4HBRA 4WWUC 3RNTA 1YHQ3 2WGOA 2RCDA 3PZWA 1RNBA 3G713 1QVF2 3WHOA 1FUWA 4KT3B 3BNCA 1W02A 5A0OB 1JKGA 1VQN3 1VZZA 1TJDA 3DM8A 1QJGA 1HU9A 5LC6A 3QK9A 1NNVA 4LGQA 3G16A 1VQ73 2A15A 3H3HA 3G4S3 3DUKA 1Q7HA 1JJ22 3EN1B 2HMNB 3LOYA 3O8YA 2CWTA 3I553 1HYFA 2RNTA 1O7WB 3OXAA 1NJI4 1JBTA 1V57A 4FMDA 3D79A 3VF1A 2KF5A 1BNSA 2GU3A 3LTBA 2CFGA 1YJN3 3U1WA 3DGNA 4BTXA 4I4KA 4X2OA 3JUNA 1GSPA 7GSPA 2BU4A 1N8QA 5IF6A 3KE7A 5AEWB 1A90A 5KP4A 1YIJ3 2P38A 1YVBI 3F14A 1AQZA 4JRFA 1IVUA 2I9WA 4FCMA 1RJOA 5AYSC 5M1AA 3AHWA 4HKVB 3FG1A 1I2GA 1RN7A 3NM7A 2HMJB 3S27A 3FGYA 1LOYA 1Q7Y4 4DKIA 3FG3A 1U5OA 1B27A 1GY6A 4R4KA 1VQM3 3LMLA 3KKGA 4HM5B 1AV4A 2BIRA 1GOYA 3GAXA 2C10A 1BNFA 1A2PA 5BIRA 3UJMA 3CME3 3AHSA 2OTL3 3PGBA 1OHPA 1EG9B 5D83A 5EEOA 2GEXA 1OHOA 3CCS3 1O7MB 4J8TA 4JF8A 4MMXB 3T0UA 3NBJA 1GS3A 2XRXB 1VQO3 3NV0B 3HI7A 4HM0B 2RFRA 3EC9A 1NB5I 4H61A 3CU3A 3BU4A 1K41A 4HZ9B 3Q3FA 1STFI 2KF3A 3LT9A 4IPBA 2W56A 3BB9A 3FG4A 1PFPA 2ZDJA 2JQ5A 2OCTA 1ZGXA 4CJNA 3CNMA 4H3UA 1SIHA 1VQ43 1RCLA 3B8LA 1VQ93 2B1XB 1SIIA 5CXOA 1KQS2 5FGOA 5G1LA 4EC6A 3FSDA 4STDA 5JBSA 4LMIA 1YJW3 1DYUA 1D6UA 4O02B 3ZFZA 2CW9A 1HZ1A 2KXGA 1TRQA 1UDII 1W4NA 1YGWA 1MWTA 2BMQB 2V1LA 2XH9A 1KD14 1BRNL 5BVBA 1ZS7A 1FW7A 5EQLA 3FZWA 4KFEA 2CX1A 1BRGA 1IVVA 4Q53A 2CHCA 1X1UA 3EN8A 3OW22 3UB1A 1DVDA 4MJDA 3HIGA 2GXFA 3MSOA 1BNIA 2CC3A 2PNCA 3HZPA 5I97A 3MPHA 3CCJ3 1GY7A 5IERA 1T5YA 3S28A 5AIIA 2Z77A 3Q2PA 1B20A 3X41A 1MOLA 3CCM3 1BSDA 3LT8A 1R4YA 3TDGA 1Q9EA 3G6E3 4IIAA 1S723 1A67A 1LOVA 3N9HA 3UL5A 1T3BA 2GSPA 1RHLA 4WYKA 2QA43 1TUHA 1UGHI 3KIIA 3IJEB 4L7KA 1QMAA 6RNTA 1ROVA 2KRTA 4HM8B 5AI1A 3ZG0A 1T2IA 1OF5A 4OVMA 3EHCA 2CFKA 2OOVA 5EVHA 1I70A 1BNGA 3CC23 4BU4A 1LNIA 2Q07A 1GD3A 2H0IA 1JB4A 2F5MA 1I2FA 1FGOA 2J8XB 4R1KA 1KWIA 1CEWI 4N6OB 4EYCA 1NWWA 1UW1A 3S29A 3J7Yd 3B7CA 1UCIA 4CPKA 3EE1A 3JVCA 1RCKA 2RBIA 2K3DA 4XBYA 1V74A 4N3VA 5IG0A 5JPPA 3AMOB 2QEX3 1NU3A 1G02A 1RN4A 2RGQA 1SPUA 1OGXA 1W00A 2CFWA 4K61A 2B24B 1YVSA 3DXOA 1UUWB 3F7XA 1C54A 1LNHA 2H0GA 2WOFA 1RMSA 3BNEA 3FLJA 3ECFA 5BXQA 1YJ93 1K734 2UGIA 1W7CA 1DVCA 4OK0A 2YFIB 3I0YA 4FMCA 1DMNA 5IG4A 8RNTA 1M904 4R9LA 1BSEA 3G0KA 5FW5A 1WMPA 4HM6B 1CYUA 2WGQA 2OWPA 4EV2A 1NDOB 2OQEC 5G2GA 2W0QA 4BL2A 1RGFA 1WQLB 1PU4A 1JN5A 1JZOA 2HMMB 3KFQC 3MG3A 3WOFB 1RTUA 1Q40B 1RRHA 1BSAA 2F5WA 4RBNA 1IQYA 1QVG2 6STDA 3K5TA 4EV5A 3BLZA 2XFSA 3CC43 1MWRA 2O9UX 1N9JA 3GRDA 1BAOA 3NQZA 2GBWB 5TGNA 4EBGA 1J2BA 2CH9A 1JB5A 1W6CA 2W56B 1BIRA 1F8NA 3PCRA 3F9SA 1OPYA 1YIT3 3IPTA 3X3YA 2R4IA 1JBSA 5ELJA 1EEJA 1BOXA 1CQSA 2BMRB 2XF3A 1BANA 3DZLA 2OQEA 1GYBA 5D82A 3X3XA 4HZBB 4XBXA 5AIGA 1BRIA 1OUNA 1JRQA 2HOHA 2W6JH 3DGOA 3BIRA 2GEYA 3DMCA 4GHOA 3N54B 3D5GA 3SOAA 5KP1A 3KN4A 4GSPA 3PCSA 1RDSA 2WO0A 3X40A 1N5PA 1Q42A 1RNTA 3HIIA 1IYYA 3URPA 3CPW2 3U97A 3L0RA 1BGSA 3SYUA 1I0VA 1EA2A 1B2SA 2LYXA 4K1UA 3UL6A 4GL6A 1G96A 3NX0A 1IVXA 1W01A 4HJLB 3WA3A 4KFFA 4RNTA 1YI23 2UX0A 1W6GA 3WODG 3CMA3 3NBRA 3GZYB 3E99A 5BU4A 4X2HA 4MMZB 2ML5A 1B21A 2AAEA 4HVNA 2SARA 1WNHA 3KSPA 3A76A 3ZG5A 2KAAA 3FH1A 1IU7A 5DREA 1NO3A 4WHAA 3STDA 7STDA 1GOUA 1RN1A 3SVAA 1OGZA 4CDLA 4AEQA 1FGRA 2CK3H 3OWYA 1IVWA 2K54A 1RGAA 4EXRA 2GBXB 3WMDA 5CF2A 3KCHA 4NHFA 1DMQA 3CCV3 1ASKA 1IV7A 2P0XA 2P0MA 4N6TA 2K0MA 1OF5B 3I563 3GZRA 4RNZA 3FCSB 3NQYA 4XBTA 2F98A 2BHMA 3M8CA 4KZ1A 1IDPA 1VQQA 4K90B 3CC73 3HX8A 1BSCA 1RGLA 3PYJA 1FGQA 3GZXB 4NREA 1TTOA 1OCVA 1QAKA 2E2UA 2F99A 1R4CA 2MF7A 3K7CA 2OOVC 4FMBA 5IEPA 1FA3A 1I8VA 3HOHA 1I3FA 2PZVA 4AKZA 2LQVA 3MKIA 2FGTA 3N8BA 5KP3A 4HOHA 1US1A 3NHXA 3LYGA 3F7SA 2L1SA 4GB5A 4LEHA 1VQ63 1YNVX 2BMOB 1BU4A 2F56A 4HYZA 3JUPA 3KSED 1RGCA 5AEUB 5JPUA 2XFTA 2XSHB 4O8SA 4HM4B 1BUJA 5LC7A 3SLUA 3X3ZA 1JB2A 1JKGB 4LZIA 1VQK3 3NBBA 1UI8A 2FXTA 1UGIA 1LXEA 2CKFB 2E2TA 3IMAB 2BO9B 5CLKA 1W2B2 1AR0A 3PXMA 5D81A 4ILFA 3SOYA 1TFOA 3OWSA 2O3OA 2YFLB 1TIJA 1N5HA 1D6YA 3BNDA 2HMOB 1IQXA 4O2HA 1RKYA 3DY5A 1Q814 1VQ83 3F40A 4J5GA 2C4BA 3EJVA 4HM2B 2R41A 1GOVA 1JV2B 1X1YA 3F8XA 1N8R4 4N6V0 1GMQA 1SQWA 1RGHA 1AVLA 1B2UA 2STDA 3WA2X 1LOXA 2F4YA 1MGWA 2XEPA 1LVNA 2GU1A 1B2XA 2INXA 3V92A 2XSOB 1NB3I 1BVIA 2M7OA 1BUQA 4N6MA 4BTWA 4R80A 2KF6A 1E3RA 1OACA 2IMJA 1FGMA 3AGNA 4QWTA 3WR2A 1Q864 1UUGB 1JZDA 2IUKA 5IEOA 3ER7A 5IG3A 1A2KA 1UUVB 1QAFA 3CXC2 1ULIB 1Y4KA 3CCQ3 4HAAA 1B2ZA 3CNXA 3A5EA 4XDVA 1LOWA 2D42A 1B2MA 3OWUA 5CK6A 3D9RA 1WMNA 6GSPA 1FZUA 3LH4A 1VQ53 3LTAA 7RNTA 4U13A 5ELUA 4MEIA 3MWZA 2C11A 4L8PA 2YFJB 1N9EA 2HMKB 3FF0A 1O7HB 4RZMA 3CCE3 1K8A4 4PEJA 3NM2A 1E3VA 2SBLA 2Y73A 3S67A 1S5AA 2CIUA 1T2HA 1SJWA 3QRDA 8CHOA 1Q824 2P09A 5DRVA 5HGRA 1EQKA 4WFOA 1A2VA 1DMMA 1G0TA 3GWRA 4XB5A 1VQL3 5AYRB 2Y74A 2IUJA 2UUGC 4J5KA 2CFDA 9RNTA 2WOHA 4AKYA 1O7GB 1OH0A 1SARA 1FGTA 2ZL8A 1DE3A 3D4AA 2Z76A 1BRJA 4HM7B 3AMOA 4KFDA 2W9QA 2ZA4A 3B4PA 2CWUA 1ZO2A 3DGMA 5IENA 1U8CB 4J9AA 3K63A 2W2CA 4NPBA 1JBRA 5CF1A 3AGOA 1RRLA 2W04A 3K0ZA 1TFKA 3MG1A 3JUQA 1JNQA 3H51A 3WDGB 3X42A 3WOEB 2XGLA 4FMAA 4WP5A 1WMOA 1BNJA 3LTCA 3GZBA 4HM1B 1IK3A 2L4VA 1MGRA 2CFLA 2QIYA 1BRSA 2Z6BA 1YGEA 3S5CA 4FCJA 1UCKA 4WYKB 3LZAA 2FNQA 4L8OA 4BIRA 3CCL3 1BNEA 4BL3A 1Z1SA 1Q40A 2IYJA 4LYLB 1UI7A 4OUQA 1K28A 2W9PA 3Q90A 4XDWA 2JDIH 1ULJB 2CG1A 1L5GB 1ROAA 1RLSA 1X1WA 3EF8A 2KCDA 4ORLA 1ZX2A 3FF2A 3VGNA 1C7HA 1GMRA 1BRKA 4CCVA 3UNLA 1IQ8A 5HOHA 1AY7A 4HM3B 1DETA 2BT3A 1TU5A 2W03A 4N6UA 3MHEA 1FUSA 4N6LA 3CCR3 1K9M4 2AADA 1E97A 3BNBA 2H0HA 1LQMB 3JUOA 3NXJA 3LXUX 1PYLA 4KVHA 1V58A 3Q1CA 3SXXA 1BNRA 3G8ZA 5AIFA 2Z7AA 2KF4A 2BNGA 1RGEA 5STDA 2F86B 2CWVA 1EKMA 3T8NA 1M1K4 1O7NB 3F8HA 3T8UA 5IG5A 1BRHA 3CD63 1FUTA 1FYSA 1GD4A 4N6NB 3RGRA 3V98A 1CYVA 1AVKA 3CPOA 2ZHXB 3OX9A 3B4OA 2MC8A 3SEDA 1STDA 3NV0A 5RNTA 2OTJ3 4ZM8A 1W2ZA 1IT7A 1WTHA 1W5ZA 3FKAA 4BTYA 1O7PB 1MWSA 3CCU3 1X1XA 1M9GA 3DGYA 5M19A 4K1VA 1JN5B 3VSYA
chains in the Genus database with same CATH topology
3D3LA 2QGUA 3DGLA 4O3VA 3RDEA 1ISKA 1KC84 4FCZA 1IV9A 2YX9A 3NUVA 3ALAA 3K9MC 2IA7A 4G1MB 1GY5A 1QALA 3EX9A 3LTDA 2CG0A 5AIHA 2ML6A 3HK4A 3PS8A 4IT7A 3JUMA 4LSOA 3MYTA 1IT8A 4XM4A 4FR9A 5IW9A 2XGNA 3EBTA 1M1XB 4RNYA 3V99A 2D1WA 3EB8A 1VQP3 1TP6A 1OHSA 4MMYB 2HMLB 3EBYA 4R9KA 3EQQB 3KZTA 1KSIA 2E2VA 3OV4A 1HKXA 3SX1A 2XR8B 3RGAA 3MG2A 4TX4A 1D6ZA 3ROBA 4WWUC 1MNLA 2P05A 1W6YA 4HBRA 2RSXA 1YHQ3 2WGOA 2RCDA 3PZWA 1FUWA 3G713 1QVF2 3BNCA 1W02A 5A0OB 1JKGA 1VQN3 1VZZA 3DM8A 1QJGA 1HU9A 5LC6A 3QK9A 4LGQA 3G16A 1VQ73 2A15A 3H3HA 3G4S3 3DUKA 1JJ22 3EN1B 2HMNB 3LOYA 3O8YA 2CWTA 3I553 1O7WB 3OXAA 1NJI4 4FMDA 3VF1A 2GU3A 3LTBA 2CFGA 1YJN3 3U1WA 3DGNA 4BTXA 4I4KA 4X2OA 3JUNA 1N8QA 5IF6A 3KE7A 5AEWB 1A90A 5KP4A 1YIJ3 2P38A 1YVBI 3F14A 4JRFA 1IVUA 2I9WA 4FCMA 1RJOA 5AYSC 4HKVB 3FG1A 1RN7A 3NM7A 2HMJB 3S27A 3FGYA 1Q7Y4 3FG3A 1U5OA 1VQM3 1GY6A 4R4KA 3LMLA 3KKGA 4HM5B 1AV4A 3GAXA 2C10A 3UJMA 3CME3 3PGBA 1OHPA 1EG9B 5D83A 5EEOA 2GEXA 1OHOA 3CCS3 1O7MB 4J8TA 4JF8A 4MMXB 3T0UA 3NBJA 1GS3A 2XRXB 1VQO3 3NV0B 3HI7A 4HM0B 2RFRA 3EC9A 1NB5I 4H61A 3CU3A 1K41A 4HZ9B 1STFI 3LT9A 4IPBA 2W56A 3BB9A 3FG4A 1PFPA 2ZDJA 2JQ5A 2OCTA 3CNMA 4H3UA 1SIHA 1VQ43 3B8LA 1VQ93 2B1XB 1SIIA 5CXOA 1KQS2 5FGOA 4EC6A 3FSDA 4STDA 5JBSA 4LMIA 1YJW3 1DYUA 1D6UA 4O02B 2CW9A 2KXGA 1W4NA 2BMQB 2V1LA 1KD14 2XH9A 5BVBA 5EQLA 3FZWA 4KFEA 1IVVA 4Q53A 2CHCA 3EN8A 3OW22 3UB1A 1DVDA 4MJDA 3HIGA 2GXFA 3MSOA 2CC3A 2PNCA 3HZPA 5I97A 3MPHA 3CCJ3 1GY7A 5IERA 1T5YA 3S28A 5AIIA 2Z77A 3Q2PA 3X41A 3CCM3 1MOLA 3LT8A 3G6E3 3TDGA 1S723 4IIAA 1A67A 3N9HA 3UL5A 4WYKA 2QA43 1TUHA 3KIIA 4L7KA 3IJEB 1QMAA 1ROVA 2KRTA 4HM8B 5AI1A 1OF5A 4OVMA 3EHCA 2CFKA 2OOVA 5EVHA 3CC23 2Q07A 1GD3A 1JB4A 4R1KA 1FGOA 1KWIA 1CEWI 4N6OB 4EYCA 1NWWA 1UW1A 3S29A 3J7Yd 3B7CA 3EE1A 3JVCA 5JPPA 4XBYA 1V74A 4N3VA 5IG0A 3AMOB 2QEX3 1NU3A 2RGQA 1SPUA 1OGXA 1W00A 2CFWA 4K61A 2B24B 3DXOA 1UUWB 3F7XA 1LNHA 2WOFA 3BNEA 3FLJA 1K734 2OTL3 3ECFA 5BXQA 1YJ93 1W7CA 1DVCA 4OK0A 2YFIB 3I0YA 4FMCA 1DMNA 5IG4A 1M904 4R9LA 3G0KA 5FW5A 1WMPA 4HM6B 1CYUA 2WGQA 2OWPA 4EV2A 1NDOB 2OQEC 5G2GA 2W0QA 1PU4A 1WQLB 1JN5A 2HMMB 3MG3A 3KFQC 3WOFB 1Q40B 1RRHA 4RBNA 1IQYA 1QVG2 6STDA 3K5TA 4EV5A 3BLZA 2XFSA 3CC43 2O9UX 1N9JA 3GRDA 3NQZA 4EBGA 2GBWB 5TGNA 1J2BA 2CH9A 1JB5A 1W6CA 2W56B 1F8NA 3PCRA 3F9SA 1OPYA 1YIT3 3IPTA 3X3YA 2R4IA 5ELJA 1CQSA 2BMRB 2XF3A 2OQEA 3DZLA 1GYBA 5D82A 3X3XA 4HZBB 4XBXA 5AIGA 1OUNA 1JRQA 2W6JH 3DGOA 2GEYA 3DMCA 3N54B 3SOAA 5KP1A 3KN4A 3PCSA 2WO0A 3X40A 1N5PA 1Q42A 3HIIA 3CPW2 3U97A 3L0RA 1EA2A 2LYXA 4K1UA 3UL6A 4GL6A 1G96A 3NX0A 1IVXA 1W01A 4HJLB 3WA3A 4KFFA 1YI23 2UX0A 1W6GA 3WODG 3CMA3 3NBRA 3GZYB 3E99A 4X2HA 4MMZB 2ML5A 4HVNA 1WNHA 3KSPA 3A76A 3FH1A 1IU7A 5DREA 1NO3A 4WHAA 3STDA 7STDA 3SVAA 1OGZA 4CDLA 4AEQA 1FGRA 2CK3H 3OWYA 1IVWA 2K54A 4EXRA 2GBXB 3WMDA 5CF2A 4NHFA 1DMQA 3CCV3 1ASKA 1IV7A 2P0XA 2P0MA 4N6TA 2K0MA 1OF5B 3I563 3GZRA 4RNZA 3FCSB 3NQYA 4XBTA 2F98A 2BHMA 3M8CA 4KZ1A 1IDPA 4K90B 3CC73 3HX8A 3PYJA 1FGQA 3GZXB 4NREA 1OCVA 1QAKA 2E2UA 2F99A 1R4CA 2MF7A 3K7CA 2OOVC 4FMBA 5IEPA 1FA3A 2PZVA 4AKZA 2LQVA 3MKIA 2FGTA 3N8BA 5KP3A 1US1A 3NHXA 3LYGA 3F7SA 4GB5A 4LEHA 1VQ63 2BMOB 4HYZA 3JUPA 3KSED 5AEUB 5JPUA 2XFTA 2XSHB 4O8SA 4HM4B 5LC7A 3SLUA 3X3ZA 1JB2A 1JKGB 4LZIA 1VQK3 3NBBA 1UI8A 2FXTA 1LXEA 2CKFB 2E2TA 3IMAB 2BO9B 5CLKA 1W2B2 1AR0A 3PXMA 5D81A 3SOYA 1TFOA 3OWSA 2O3OA 2YFLB 1TIJA 1N5HA 1D6YA 3BNDA 2HMOB 1IQXA 4O2HA 1RKYA 3DY5A 1Q814 1VQ83 3F40A 3EJVA 4HM2B 1JV2B 3F8XA 1N8R4 4N6V0 1SQWA 2STDA 1AVLA 3WA2X 1LOXA 2XEPA 1LVNA 2GU1A 2INXA 3V92A 2XSOB 1NB3I 1BUQA 2M7OA 4N6MA 4BTWA 4R80A 1E3RA 1OACA 2IMJA 1FGMA 4QWTA 1Q864 2IUKA 5IEOA 3ER7A 5IG3A 1A2KA 1UUVB 1QAFA 3CXC2 1ULIB 1Y4KA 3CCQ3 3CNXA 4XDVA 2D42A 3OWUA 5CK6A 3D9RA 1WMNA 3LH4A 1VQ53 3LTAA 4U13A 5ELUA 4MEIA 3MWZA 2C11A 4L8PA 2YFJB 1N9EA 2HMKB 3FF0A 1O7HB 4RZMA 3CCE3 1K8A4 4PEJA 3NM2A 1E3VA 2SBLA 2Y73A 3S67A 1S5AA 2CIUA 1SJWA 3QRDA 8CHOA 1Q824 2P09A 5DRVA 5HGRA 1EQKA 4WFOA 1A2VA 1DMMA 1VQL3 3GWRA 4XB5A 5AYRB 2Y74A 2IUJA 2CFDA 2WOHA 4AKYA 1O7GB 1OH0A 1FGTA 2ZL8A 2Z76A 4HM7B 3AMOA 4KFDA 2W9QA 3B4PA 2CWUA 1ZO2A 3DGMA 5IENA 1U8CB 4J9AA 3K63A 2W2CA 5CF1A 1RRLA 2W04A 3K0ZA 1TFKA 3MG1A 3JUQA 1JNQA 3H51A 3WDGB 3X42A 3WOEB 2XGLA 4FMAA 4WP5A 1WMOA 3LTCA 4HM1B 3GZBA 1IK3A 2L4VA 2CFLA 2QIYA 2Z6BA 1YGEA 3S5CA 4FCJA 4WYKB 3LZAA 2FNQA 4L8OA 3CCL3 1Z1SA 1Q40A 1UI7A 4OUQA 1K28A 2W9PA 3Q90A 4XDWA 2JDIH 1ULJB 2CG1A 1L5GB 1ROAA 3EF8A 2KCDA 4ORLA 1ZX2A 3FF2A 3VGNA 1C7HA 4CCVA 3UNLA 1IQ8A 4HM3B 2BT3A 1TU5A 2W03A 4N6UA 3MHEA 4N6LA 3CCR3 1K9M4 1E97A 3BNBA 3JUOA 3NXJA 3LXUX 4KVHA 3SXXA 3Q1CA 3G8ZA 5AIFA 2Z7AA 2BNGA 5STDA 2F86B 2CWVA 1EKMA 3T8NA 1M1K4 1O7NB 3F8HA 3T8UA 5IG5A 3CD63 1GD4A 4N6NB 3RGRA 3V98A 1CYVA 1AVKA 3CPOA 3OX9A 3SEDA 3B4OA 2MC8A 1STDA 3NV0A 2OTJ3 4ZM8A 1W2ZA 1IT7A 1WTHA 1W5ZA 3FKAA 4BTYA 1O7PB 3CCU3 1M9GA 4K1VA 1JN5B 3VSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGU A;  1ISK A;  3NUV A;  1GY5 A;  3EX9 A;  5AIH A;  3HK4 A;  3JUM A;  3MYT A;  4XM4 A;  3EBT A;  1TP6 A;  1OHS A;  2HML B;  3EBY A;  4R9K A;  3EQQ B;  3KZT A;  3OV4 A;  1HKX A;  2XR8 B;  3RGA A;  3MG2 A;  3ROB A;  4WWU C;  1W6Y A;  2RCD A;  1W02 A;  1JKG A;  1VZZ A;  3DM8 A;  1QJG A;  4LGQ A;  3G16 A;  2A15 A;  3H3H A;  3DUK A;  3EN1 B;  2HMN B;  1O7W B;  3OXA A;  4I4K A;  4X2O A;  3JUN A;  5IF6 A;  3KE7 A;  5AEW B;  5KP4 A;  3F14 A;  2I9W A;  4FCM A;  4HKV B;  2HMJ B;  3FGY A;  1U5O A;  1GY6 A;  3KKG A;  4HM5 B;  3UJM A;  1OHP A;  1EG9 B;  5D83 A;  2GEX A;  1OHO A;  1O7M B;  4J8T A;  1GS3 A;  2XRX B;  3NV0 B;  4HM0 B;  2RFR A;  3EC9 A;  3CU3 A;  1K41 A;  4HZ9 B;  3BB9 A;  2JQ5 A;  3CNM A;  4H3U A;  3B8L A;  2B1X B;  5CXO A;  3FSD A;  4STD A;  4LMI A;  2BMQ B;  5BVB A;  3FZW A;  4Q53 A;  2CHC A;  3EN8 A;  4MJD A;  2GXF A;  3MSO A;  3HZP A;  1GY7 A;  5IER A;  5AII A;  2Z77 A;  4IIA A;  4WYK A;  1TUH A;  4L7K A;  1QMA A;  4HM8 B;  5AI1 A;  1OF5 A;  4OVM A;  3EHC A;  5EVH A;  1JB4 A;  4R1K A;  1NWW A;  3B7C A;  5JPP A;  4XBY A;  4N3V A;  5IG0 A;  1NU3 A;  2RGQ A;  1W00 A;  1OGX A;  2B24 B;  3DXO A;  1UUW B;  3F7X A;  3FLJ A;  3ECF A;  5BXQ A;  2YFI B;  3I0Y A;  1DMN A;  5IG4 A;  4R9L A;  3G0K A;  5FW5 A;  4HM6 B;  2OWP A;  1NDO B;  5G2G A;  1WQL B;  1JN5 A;  2HMM B;  3MG3 A;  1Q40 B;  6STD A;  3BLZ A;  3GRD A;  2GBW B;  5TGN A;  1JB5 A;  3F9S A;  1OPY A;  3IPT A;  2R4I A;  1CQS A;  2BMR B;  3DZL A;  1GYB A;  5D82 A;  4XBX A;  4HZB B;  5AIG A;  1OUN A;  2GEY A;  3DMC A;  3SOA A;  5KP1 A;  1Q42 A;  1EA2 A;  4K1U A;  4HJL B;  1W01 A;  2UX0 A;  3NBR A;  3GZY B;  3E99 A;  4X2H A;  4HVN A;  3KSP A;  3A76 A;  3FH1 A;  5DRE A;  3STD A;  7STD A;  1OGZ A;  4CDL A;  3OWY A;  2K54 A;  5CF2 A;  2GBX B;  3WMD A;  1DMQ A;  1ASK A;  1OF5 B;  3GZR A;  4XBT A;  2F98 A;  3M8C A;  1IDP A;  3HX8 A;  3GZX B;  1OCV A;  3K7C A;  2F99 A;  5IEP A;  2PZV A;  3MKI A;  5KP3 A;  3NHX A;  3LYG A;  3F7S A;  4GB5 A;  4LEH A;  2BMO B;  3JUP A;  5AEU B;  5JPU A;  2XSH B;  4HM4 B;  1JKG B;  1JB2 A;  2CKF B;  5CLK A;  1AR0 A;  5D81 A;  3SOY A;  3OWS A;  2YFL B;  2HMO B;  3F40 A;  3EJV A;  4HM2 B;  3F8X A;  2STD A;  2INX A;  2XSO B;  1BUQ A;  1E3R A;  2IMJ A;  5IEO A;  3ER7 A;  5IG3 A;  1A2K A;  1UUV B;  1ULI B;  3CNX A;  4XDV A;  3OWU A;  5CK6 A;  3D9R A;  4U13 A;  4L8P A;  2YFJ B;  2HMK B;  3FF0 A;  1O7H B;  4RZM A;  4PEJ A;  3NM2 A;  1E3V A;  1S5A A;  1SJW A;  8CHO A;  5DRV A;  5HGR A;  1DMM A;  3GWR A;  4XB5 A;  1O7G B;  1OH0 A;  2Z76 A;  4HM7 B;  3B4P A;  1ZO2 A;  5IEN A;  4J9A A;  2W2C A;  5CF1 A;  3K0Z A;  3MG1 A;  3JUQ A;  3H51 A;  4WP5 A;  4HM1 B;  3GZB A;  2QIY A;  3S5C A;  4FCJ A;  4WYK B;  3LZA A;  4L8O A;  1Z1S A;  1Q40 A;  4OUQ A;  3Q90 A;  4XDW A;  1ULJ B;  3EF8 A;  4ORL A;  1ZX2 A;  3FF2 A;  3VGN A;  1C7H A;  3UNL A;  4HM3 B;  3MHE A;  1E97 A;  3JUO A;  3NXJ A;  4KVH A;  3G8Z A;  5AIF A;  2Z7A A;  2BNG A;  5STD A;  2F86 B;  3T8N A;  1O7N B;  3F8H A;  3T8U A;  5IG5 A;  3RGR A;  3OX9 A;  3CPO A;  3SED A;  3B4O A;  1STD A;  3NV0 A;  3FKA A;  1O7P B;  4K1V A;  1JN5 B;  3VSY A; 
#chains in the Genus database with same CATH topology
 1LQG C;  3D3L A;  2QGU A;  3DGL A;  4O3V A;  3RDE A;  1I3I A;  1ISK A;  1KC8 4;  4FCZ A;  1IV9 A;  2YX9 A;  3NUV A;  3ALA A;  3K9M C;  2IA7 A;  1TRP A;  4G1M B;  1GY5 A;  1QAL A;  3EX9 A;  1BSB A;  2CG0 A;  3LTD A;  1UCJ A;  5GSP A;  5AIH A;  2ML6 A;  2IY2 A;  1CH0 A;  3HK4 A;  1PY3 A;  3PS8 A;  4IT7 A;  3JUM A;  4LSO A;  3MYT A;  1IT8 A;  4XM4 A;  4FR9 A;  5IW9 A;  2XGN A;  3EBT A;  1M1X B;  1LRA A;  4RNY A;  4EW5 A;  3V99 A;  1EUI C;  2D1W A;  3EB8 A;  1RSN A;  1RGK A;  1VQP 3;  3D5I A;  1TP6 A;  1OHS A;  4MMY B;  2HML B;  3EBY A;  5G1K A;  4R9K A;  3EQQ B;  1I0X A;  3KZT A;  1KSI A;  2E2V A;  5M18 A;  3OV4 A;  1HKX A;  1RGG A;  3SX1 A;  2XR8 B;  4I5Q A;  3RGA A;  1I2E A;  3MG2 A;  3GSP A;  1MWU A;  1GMP A;  4TX4 A;  1D6Z A;  3ROB A;  1B3S A;  1MNL A;  2CX0 A;  1UCL A;  1W6Y A;  2P05 A;  3DH2 A;  2RSX A;  4HBR A;  4WWU C;  3RNT A;  1YHQ 3;  2WGO A;  2RCD A;  3PZW A;  1RNB A;  3G71 3;  1QVF 2;  3WHO A;  1FUW A;  4KT3 B;  3BNC A;  1W02 A;  5A0O B;  1JKG A;  1VQN 3;  1VZZ A;  1TJD A;  3DM8 A;  1QJG A;  1HU9 A;  5LC6 A;  3QK9 A;  1NNV A;  4LGQ A;  3G16 A;  1VQ7 3;  2A15 A;  3H3H A;  3G4S 3;  3DUK A;  1Q7H A;  1JJ2 2;  3EN1 B;  2HMN B;  3LOY A;  3O8Y A;  2CWT A;  3I55 3;  1HYF A;  2RNT A;  1O7W B;  3OXA A;  1NJI 4;  1JBT A;  1V57 A;  4FMD A;  3D79 A;  3VF1 A;  2KF5 A;  1BNS A;  2GU3 A;  3LTB A;  2CFG A;  1YJN 3;  3U1W A;  3DGN A;  4BTX A;  4I4K A;  4X2O A;  3JUN A;  1GSP A;  7GSP A;  2BU4 A;  1N8Q A;  5IF6 A;  3KE7 A;  5AEW B;  1A90 A;  5KP4 A;  1YIJ 3;  2P38 A;  1YVB I;  3F14 A;  1AQZ A;  4JRF A;  1IVU A;  2I9W A;  4FCM A;  1RJO A;  5AYS C;  5M1A A;  3AHW A;  4HKV B;  3FG1 A;  1I2G A;  1RN7 A;  3NM7 A;  2HMJ B;  3S27 A;  3FGY A;  1LOY A;  1Q7Y 4;  4DKI A;  3FG3 A;  1U5O A;  1B27 A;  1GY6 A;  4R4K A;  1VQM 3;  3LML A;  3KKG A;  4HM5 B;  1AV4 A;  2BIR A;  1GOY A;  3GAX A;  2C10 A;  1BNF A;  1A2P A;  5BIR A;  3UJM A;  3CME 3;  3AHS A;  2OTL 3;  3PGB A;  1OHP A;  1EG9 B;  5D83 A;  5EEO A;  2GEX A;  1OHO A;  3CCS 3;  1O7M B;  4J8T A;  4JF8 A;  4MMX B;  3T0U A;  3NBJ A;  1GS3 A;  2XRX B;  1VQO 3;  3NV0 B;  3HI7 A;  4HM0 B;  2RFR A;  3EC9 A;  1NB5 I;  4H61 A;  3CU3 A;  3BU4 A;  1K41 A;  4HZ9 B;  3Q3F A;  1STF I;  2KF3 A;  3LT9 A;  4IPB A;  2W56 A;  3BB9 A;  3FG4 A;  1PFP A;  2ZDJ A;  2JQ5 A;  2OCT A;  1ZGX A;  4CJN A;  3CNM A;  4H3U A;  1SIH A;  1VQ4 3;  1RCL A;  3B8L A;  1VQ9 3;  2B1X B;  1SII A;  5CXO A;  1KQS 2;  5FGO A;  5G1L A;  4EC6 A;  3FSD A;  4STD A;  5JBS A;  4LMI A;  1YJW 3;  1DYU A;  1D6U A;  4O02 B;  3ZFZ A;  2CW9 A;  1HZ1 A;  2KXG A;  1TRQ A;  1UDI I;  1W4N A;  1YGW A;  1MWT A;  2BMQ B;  2V1L A;  2XH9 A;  1KD1 4;  1BRN L;  5BVB A;  1ZS7 A;  1FW7 A;  5EQL A;  3FZW A;  4KFE A;  2CX1 A;  1BRG A;  1IVV A;  4Q53 A;  2CHC A;  1X1U A;  3EN8 A;  3OW2 2;  3UB1 A;  1DVD A;  4MJD A;  3HIG A;  2GXF A;  3MSO A;  1BNI A;  2CC3 A;  2PNC A;  3HZP A;  5I97 A;  3MPH A;  3CCJ 3;  1GY7 A;  5IER A;  1T5Y A;  3S28 A;  5AII A;  2Z77 A;  3Q2P A;  1B20 A;  3X41 A;  1MOL A;  3CCM 3;  1BSD A;  3LT8 A;  1R4Y A;  3TDG A;  1Q9E A;  3G6E 3;  4IIA A;  1S72 3;  1A67 A;  1LOV A;  3N9H A;  3UL5 A;  1T3B A;  2GSP A;  1RHL A;  4WYK A;  2QA4 3;  1TUH A;  1UGH I;  3KII A;  3IJE B;  4L7K A;  1QMA A;  6RNT A;  1ROV A;  2KRT A;  4HM8 B;  5AI1 A;  3ZG0 A;  1T2I A;  1OF5 A;  4OVM A;  3EHC A;  2CFK A;  2OOV A;  5EVH A;  1I70 A;  1BNG A;  3CC2 3;  4BU4 A;  1LNI A;  2Q07 A;  1GD3 A;  2H0I A;  1JB4 A;  2F5M A;  1I2F A;  1FGO A;  2J8X B;  4R1K A;  1KWI A;  1CEW I;  4N6O B;  4EYC A;  1NWW A;  1UW1 A;  3S29 A;  3J7Y d;  3B7C A;  1UCI A;  4CPK A;  3EE1 A;  3JVC A;  1RCK A;  2RBI A;  2K3D A;  4XBY A;  1V74 A;  4N3V A;  5IG0 A;  5JPP A;  3AMO B;  2QEX 3;  1NU3 A;  1G02 A;  1RN4 A;  2RGQ A;  1SPU A;  1OGX A;  1W00 A;  2CFW A;  4K61 A;  2B24 B;  1YVS A;  3DXO A;  1UUW B;  3F7X A;  1C54 A;  1LNH A;  2H0G A;  2WOF A;  1RMS A;  3BNE A;  3FLJ A;  3ECF A;  5BXQ A;  1YJ9 3;  1K73 4;  2UGI A;  1W7C A;  1DVC A;  4OK0 A;  2YFI B;  3I0Y A;  4FMC A;  1DMN A;  5IG4 A;  8RNT A;  1M90 4;  4R9L A;  1BSE A;  3G0K A;  5FW5 A;  1WMP A;  4HM6 B;  1CYU A;  2WGQ A;  2OWP A;  4EV2 A;  1NDO B;  2OQE C;  5G2G A;  2W0Q A;  4BL2 A;  1RGF A;  1WQL B;  1PU4 A;  1JN5 A;  1JZO A;  2HMM B;  3KFQ C;  3MG3 A;  3WOF B;  1RTU A;  1Q40 B;  1RRH A;  1BSA A;  2F5W A;  4RBN A;  1IQY A;  1QVG 2;  6STD A;  3K5T A;  4EV5 A;  3BLZ A;  2XFS A;  3CC4 3;  1MWR A;  2O9U X;  1N9J A;  3GRD A;  1BAO A;  3NQZ A;  2GBW B;  5TGN A;  4EBG A;  1J2B A;  2CH9 A;  1JB5 A;  1W6C A;  2W56 B;  1BIR A;  1F8N A;  3PCR A;  3F9S A;  1OPY A;  1YIT 3;  3IPT A;  3X3Y A;  2R4I A;  1JBS A;  5ELJ A;  1EEJ A;  1BOX A;  1CQS A;  2BMR B;  2XF3 A;  1BAN A;  3DZL A;  2OQE A;  1GYB A;  5D82 A;  3X3X A;  4HZB B;  4XBX A;  5AIG A;  1BRI A;  1OUN A;  1JRQ A;  2HOH A;  2W6J H;  3DGO A;  3BIR A;  2GEY A;  3DMC A;  4GHO A;  3N54 B;  3D5G A;  3SOA A;  5KP1 A;  3KN4 A;  4GSP A;  3PCS A;  1RDS A;  2WO0 A;  3X40 A;  1N5P A;  1Q42 A;  1RNT A;  3HII A;  1IYY A;  3URP A;  3CPW 2;  3U97 A;  3L0R A;  1BGS A;  3SYU A;  1I0V A;  1EA2 A;  1B2S A;  2LYX A;  4K1U A;  3UL6 A;  4GL6 A;  1G96 A;  3NX0 A;  1IVX A;  1W01 A;  4HJL B;  3WA3 A;  4KFF A;  4RNT A;  1YI2 3;  2UX0 A;  1W6G A;  3WOD G;  3CMA 3;  3NBR A;  3GZY B;  3E99 A;  5BU4 A;  4X2H A;  4MMZ B;  2ML5 A;  1B21 A;  2AAE A;  4HVN A;  2SAR A;  1WNH A;  3KSP A;  3A76 A;  3ZG5 A;  2KAA A;  3FH1 A;  1IU7 A;  5DRE A;  1NO3 A;  4WHA A;  3STD A;  7STD A;  1GOU A;  1RN1 A;  3SVA A;  1OGZ A;  4CDL A;  4AEQ A;  1FGR A;  2CK3 H;  3OWY A;  1IVW A;  2K54 A;  1RGA A;  4EXR A;  2GBX B;  3WMD A;  5CF2 A;  3KCH A;  4NHF A;  1DMQ A;  3CCV 3;  1ASK A;  1IV7 A;  2P0X A;  2P0M A;  4N6T A;  2K0M A;  1OF5 B;  3I56 3;  3GZR A;  4RNZ A;  3FCS B;  3NQY A;  4XBT A;  2F98 A;  2BHM A;  3M8C A;  4KZ1 A;  1IDP A;  1VQQ A;  4K90 B;  3CC7 3;  3HX8 A;  1BSC A;  1RGL A;  3PYJ A;  1FGQ A;  3GZX B;  4NRE A;  1TTO A;  1OCV A;  1QAK A;  2E2U A;  2F99 A;  1R4C A;  2MF7 A;  3K7C A;  2OOV C;  4FMB A;  5IEP A;  1FA3 A;  1I8V A;  3HOH A;  1I3F A;  2PZV A;  4AKZ A;  2LQV A;  3MKI A;  2FGT A;  3N8B A;  5KP3 A;  4HOH A;  1US1 A;  3NHX A;  3LYG A;  3F7S A;  2L1S A;  4GB5 A;  4LEH A;  1VQ6 3;  1YNV X;  2BMO B;  1BU4 A;  2F56 A;  4HYZ A;  3JUP A;  3KSE D;  1RGC A;  5AEU B;  5JPU A;  2XFT A;  2XSH B;  4O8S A;  4HM4 B;  1BUJ A;  5LC7 A;  3SLU A;  3X3Z A;  1JB2 A;  1JKG B;  4LZI A;  1VQK 3;  3NBB A;  1UI8 A;  2FXT A;  1UGI A;  1LXE A;  2CKF B;  2E2T A;  3IMA B;  2BO9 B;  5CLK A;  1W2B 2;  1AR0 A;  3PXM A;  5D81 A;  4ILF A;  3SOY A;  1TFO A;  3OWS A;  2O3O A;  2YFL B;  1TIJ A;  1N5H A;  1D6Y A;  3BND A;  2HMO B;  1IQX A;  4O2H A;  1RKY A;  3DY5 A;  1Q81 4;  1VQ8 3;  3F40 A;  4J5G A;  2C4B A;  3EJV A;  4HM2 B;  2R41 A;  1GOV A;  1JV2 B;  1X1Y A;  3F8X A;  1N8R 4;  4N6V 0;  1GMQ A;  1SQW A;  1RGH A;  1AVL A;  1B2U A;  2STD A;  3WA2 X;  1LOX A;  2F4Y A;  1MGW A;  2XEP A;  1LVN A;  2GU1 A;  1B2X A;  2INX A;  3V92 A;  2XSO B;  1NB3 I;  1BVI A;  2M7O A;  1BUQ A;  4N6M A;  4BTW A;  4R80 A;  2KF6 A;  1E3R A;  1OAC A;  2IMJ A;  1FGM A;  3AGN A;  4QWT A;  3WR2 A;  1Q86 4;  1UUG B;  1JZD A;  2IUK A;  5IEO A;  3ER7 A;  5IG3 A;  1A2K A;  1UUV B;  1QAF A;  3CXC 2;  1ULI B;  1Y4K A;  3CCQ 3;  4HAA A;  1B2Z A;  3CNX A;  3A5E A;  4XDV A;  1LOW A;  2D42 A;  1B2M A;  3OWU A;  5CK6 A;  3D9R A;  1WMN A;  6GSP A;  1FZU A;  3LH4 A;  1VQ5 3;  3LTA A;  7RNT A;  4U13 A;  5ELU A;  4MEI A;  3MWZ A;  2C11 A;  4L8P A;  2YFJ B;  1N9E A;  2HMK B;  3FF0 A;  1O7H B;  4RZM A;  3CCE 3;  1K8A 4;  4PEJ A;  3NM2 A;  1E3V A;  2SBL A;  2Y73 A;  3S67 A;  1S5A A;  2CIU A;  1T2H A;  1SJW A;  3QRD A;  8CHO A;  1Q82 4;  2P09 A;  5DRV A;  5HGR A;  1EQK A;  4WFO A;  1A2V A;  1DMM A;  1G0T A;  3GWR A;  4XB5 A;  1VQL 3;  5AYR B;  2Y74 A;  2IUJ A;  2UUG C;  4J5K A;  2CFD A;  9RNT A;  2WOH A;  4AKY A;  1O7G B;  1OH0 A;  1SAR A;  1FGT A;  2ZL8 A;  1DE3 A;  3D4A A;  2Z76 A;  1BRJ A;  4HM7 B;  3AMO A;  4KFD A;  2W9Q A;  2ZA4 A;  3B4P A;  2CWU A;  1ZO2 A;  3DGM A;  5IEN A;  1U8C B;  4J9A A;  3K63 A;  2W2C A;  4NPB A;  1JBR A;  5CF1 A;  3AGO A;  1RRL A;  2W04 A;  3K0Z A;  1TFK A;  3MG1 A;  3JUQ A;  1JNQ A;  3H51 A;  3WDG B;  3X42 A;  3WOE B;  2XGL A;  4FMA A;  4WP5 A;  1WMO A;  1BNJ A;  3LTC A;  3GZB A;  4HM1 B;  1IK3 A;  2L4V A;  1MGR A;  2CFL A;  2QIY A;  1BRS A;  2Z6B A;  1YGE A;  3S5C A;  4FCJ A;  1UCK A;  4WYK B;  3LZA A;  2FNQ A;  4L8O A;  4BIR A;  3CCL 3;  1BNE A;  4BL3 A;  1Z1S A;  1Q40 A;  2IYJ A;  4LYL B;  1UI7 A;  4OUQ A;  1K28 A;  2W9P A;  3Q90 A;  4XDW A;  2JDI H;  1ULJ B;  2CG1 A;  1L5G B;  1ROA A;  1RLS A;  1X1W A;  3EF8 A;  2KCD A;  4ORL A;  1ZX2 A;  3FF2 A;  3VGN A;  1C7H A;  1GMR A;  1BRK A;  4CCV A;  3UNL A;  1IQ8 A;  5HOH A;  1AY7 A;  4HM3 B;  1DET A;  2BT3 A;  1TU5 A;  2W03 A;  4N6U A;  3MHE A;  1FUS A;  4N6L A;  3CCR 3;  1K9M 4;  2AAD A;  1E97 A;  3BNB A;  2H0H A;  1LQM B;  3JUO A;  3NXJ A;  3LXU X;  1PYL A;  4KVH A;  1V58 A;  3Q1C A;  3SXX A;  1BNR A;  3G8Z A;  5AIF A;  2Z7A A;  2KF4 A;  2BNG A;  1RGE A;  5STD A;  2F86 B;  2CWV A;  1EKM A;  3T8N A;  1M1K 4;  1O7N B;  3F8H A;  3T8U A;  5IG5 A;  1BRH A;  3CD6 3;  1FUT A;  1FYS A;  1GD4 A;  4N6N B;  3RGR A;  3V98 A;  1CYV A;  1AVK A;  3CPO A;  2ZHX B;  3OX9 A;  3B4O A;  2MC8 A;  3SED A;  1STD A;  3NV0 A;  5RNT A;  2OTJ 3;  4ZM8 A;  1W2Z A;  1IT7 A;  1WTH A;  1W5Z A;  3FKA A;  4BTY A;  1O7P B;  1MWS A;  3CCU 3;  1X1X A;  1M9G A;  3DGY A;  5M19 A;  4K1V A;  1JN5 B;  3VSY A; 
#chains in the Genus database with same CATH homology
 3D3L A;  2QGU A;  3DGL A;  4O3V A;  3RDE A;  1ISK A;  1KC8 4;  4FCZ A;  1IV9 A;  2YX9 A;  3NUV A;  3ALA A;  3K9M C;  2IA7 A;  4G1M B;  1GY5 A;  1QAL A;  3EX9 A;  3LTD A;  2CG0 A;  5AIH A;  2ML6 A;  3HK4 A;  3PS8 A;  4IT7 A;  3JUM A;  4LSO A;  3MYT A;  1IT8 A;  4XM4 A;  4FR9 A;  5IW9 A;  2XGN A;  3EBT A;  1M1X B;  4RNY A;  3V99 A;  2D1W A;  3EB8 A;  1VQP 3;  1TP6 A;  1OHS A;  4MMY B;  2HML B;  3EBY A;  4R9K A;  3EQQ B;  3KZT A;  1KSI A;  2E2V A;  3OV4 A;  1HKX A;  3SX1 A;  2XR8 B;  3RGA A;  3MG2 A;  4TX4 A;  1D6Z A;  3ROB A;  4WWU C;  1MNL A;  2P05 A;  1W6Y A;  4HBR A;  2RSX A;  1YHQ 3;  2WGO A;  2RCD A;  3PZW A;  1FUW A;  3G71 3;  1QVF 2;  3BNC A;  1W02 A;  5A0O B;  1JKG A;  1VQN 3;  1VZZ A;  3DM8 A;  1QJG A;  1HU9 A;  5LC6 A;  3QK9 A;  4LGQ A;  3G16 A;  1VQ7 3;  2A15 A;  3H3H A;  3G4S 3;  3DUK A;  1JJ2 2;  3EN1 B;  2HMN B;  3LOY A;  3O8Y A;  2CWT A;  3I55 3;  1O7W B;  3OXA A;  1NJI 4;  4FMD A;  3VF1 A;  2GU3 A;  3LTB A;  2CFG A;  1YJN 3;  3U1W A;  3DGN A;  4BTX A;  4I4K A;  4X2O A;  3JUN A;  1N8Q A;  5IF6 A;  3KE7 A;  5AEW B;  1A90 A;  5KP4 A;  1YIJ 3;  2P38 A;  1YVB I;  3F14 A;  4JRF A;  1IVU A;  2I9W A;  4FCM A;  1RJO A;  5AYS C;  4HKV B;  3FG1 A;  1RN7 A;  3NM7 A;  2HMJ B;  3S27 A;  3FGY A;  1Q7Y 4;  3FG3 A;  1U5O A;  1VQM 3;  1GY6 A;  4R4K A;  3LML A;  3KKG A;  4HM5 B;  1AV4 A;  3GAX A;  2C10 A;  3UJM A;  3CME 3;  3PGB A;  1OHP A;  1EG9 B;  5D83 A;  5EEO A;  2GEX A;  1OHO A;  3CCS 3;  1O7M B;  4J8T A;  4JF8 A;  4MMX B;  3T0U A;  3NBJ A;  1GS3 A;  2XRX B;  1VQO 3;  3NV0 B;  3HI7 A;  4HM0 B;  2RFR A;  3EC9 A;  1NB5 I;  4H61 A;  3CU3 A;  1K41 A;  4HZ9 B;  1STF I;  3LT9 A;  4IPB A;  2W56 A;  3BB9 A;  3FG4 A;  1PFP A;  2ZDJ A;  2JQ5 A;  2OCT A;  3CNM A;  4H3U A;  1SIH A;  1VQ4 3;  3B8L A;  1VQ9 3;  2B1X B;  1SII A;  5CXO A;  1KQS 2;  5FGO A;  4EC6 A;  3FSD A;  4STD A;  5JBS A;  4LMI A;  1YJW 3;  1DYU A;  1D6U A;  4O02 B;  2CW9 A;  2KXG A;  1W4N A;  2BMQ B;  2V1L A;  1KD1 4;  2XH9 A;  5BVB A;  5EQL A;  3FZW A;  4KFE A;  1IVV A;  4Q53 A;  2CHC A;  3EN8 A;  3OW2 2;  3UB1 A;  1DVD A;  4MJD A;  3HIG A;  2GXF A;  3MSO A;  2CC3 A;  2PNC A;  3HZP A;  5I97 A;  3MPH A;  3CCJ 3;  1GY7 A;  5IER A;  1T5Y A;  3S28 A;  5AII A;  2Z77 A;  3Q2P A;  3X41 A;  3CCM 3;  1MOL A;  3LT8 A;  3G6E 3;  3TDG A;  1S72 3;  4IIA A;  1A67 A;  3N9H A;  3UL5 A;  4WYK A;  2QA4 3;  1TUH A;  3KII A;  4L7K A;  3IJE B;  1QMA A;  1ROV A;  2KRT A;  4HM8 B;  5AI1 A;  1OF5 A;  4OVM A;  3EHC A;  2CFK A;  2OOV A;  5EVH A;  3CC2 3;  2Q07 A;  1GD3 A;  1JB4 A;  4R1K A;  1FGO A;  1KWI A;  1CEW I;  4N6O B;  4EYC A;  1NWW A;  1UW1 A;  3S29 A;  3J7Y d;  3B7C A;  3EE1 A;  3JVC A;  5JPP A;  4XBY A;  1V74 A;  4N3V A;  5IG0 A;  3AMO B;  2QEX 3;  1NU3 A;  2RGQ A;  1SPU A;  1OGX A;  1W00 A;  2CFW A;  4K61 A;  2B24 B;  3DXO A;  1UUW B;  3F7X A;  1LNH A;  2WOF A;  3BNE A;  3FLJ A;  1K73 4;  2OTL 3;  3ECF A;  5BXQ A;  1YJ9 3;  1W7C A;  1DVC A;  4OK0 A;  2YFI B;  3I0Y A;  4FMC A;  1DMN A;  5IG4 A;  1M90 4;  4R9L A;  3G0K A;  5FW5 A;  1WMP A;  4HM6 B;  1CYU A;  2WGQ A;  2OWP A;  4EV2 A;  1NDO B;  2OQE C;  5G2G A;  2W0Q A;  1PU4 A;  1WQL B;  1JN5 A;  2HMM B;  3MG3 A;  3KFQ C;  3WOF B;  1Q40 B;  1RRH A;  4RBN A;  1IQY A;  1QVG 2;  6STD A;  3K5T A;  4EV5 A;  3BLZ A;  2XFS A;  3CC4 3;  2O9U X;  1N9J A;  3GRD A;  3NQZ A;  4EBG A;  2GBW B;  5TGN A;  1J2B A;  2CH9 A;  1JB5 A;  1W6C A;  2W56 B;  1F8N A;  3PCR A;  3F9S A;  1OPY A;  1YIT 3;  3IPT A;  3X3Y A;  2R4I A;  5ELJ A;  1CQS A;  2BMR B;  2XF3 A;  2OQE A;  3DZL A;  1GYB A;  5D82 A;  3X3X A;  4HZB B;  4XBX A;  5AIG A;  1OUN A;  1JRQ A;  2W6J H;  3DGO A;  2GEY A;  3DMC A;  3N54 B;  3SOA A;  5KP1 A;  3KN4 A;  3PCS A;  2WO0 A;  3X40 A;  1N5P A;  1Q42 A;  3HII A;  3CPW 2;  3U97 A;  3L0R A;  1EA2 A;  2LYX A;  4K1U A;  3UL6 A;  4GL6 A;  1G96 A;  3NX0 A;  1IVX A;  1W01 A;  4HJL B;  3WA3 A;  4KFF A;  1YI2 3;  2UX0 A;  1W6G A;  3WOD G;  3CMA 3;  3NBR A;  3GZY B;  3E99 A;  4X2H A;  4MMZ B;  2ML5 A;  4HVN A;  1WNH A;  3KSP A;  3A76 A;  3FH1 A;  1IU7 A;  5DRE A;  1NO3 A;  4WHA A;  3STD A;  7STD A;  3SVA A;  1OGZ A;  4CDL A;  4AEQ A;  1FGR A;  2CK3 H;  3OWY A;  1IVW A;  2K54 A;  4EXR A;  2GBX B;  3WMD A;  5CF2 A;  4NHF A;  1DMQ A;  3CCV 3;  1ASK A;  1IV7 A;  2P0X A;  2P0M A;  4N6T A;  2K0M A;  1OF5 B;  3I56 3;  3GZR A;  4RNZ A;  3FCS B;  3NQY A;  4XBT A;  2F98 A;  2BHM A;  3M8C A;  4KZ1 A;  1IDP A;  4K90 B;  3CC7 3;  3HX8 A;  3PYJ A;  1FGQ A;  3GZX B;  4NRE A;  1OCV A;  1QAK A;  2E2U A;  2F99 A;  1R4C A;  2MF7 A;  3K7C A;  2OOV C;  4FMB A;  5IEP A;  1FA3 A;  2PZV A;  4AKZ A;  2LQV A;  3MKI A;  2FGT A;  3N8B A;  5KP3 A;  1US1 A;  3NHX A;  3LYG A;  3F7S A;  4GB5 A;  4LEH A;  1VQ6 3;  2BMO B;  4HYZ A;  3JUP A;  3KSE D;  5AEU B;  5JPU A;  2XFT A;  2XSH B;  4O8S A;  4HM4 B;  5LC7 A;  3SLU A;  3X3Z A;  1JB2 A;  1JKG B;  4LZI A;  1VQK 3;  3NBB A;  1UI8 A;  2FXT A;  1LXE A;  2CKF B;  2E2T A;  3IMA B;  2BO9 B;  5CLK A;  1W2B 2;  1AR0 A;  3PXM A;  5D81 A;  3SOY A;  1TFO A;  3OWS A;  2O3O A;  2YFL B;  1TIJ A;  1N5H A;  1D6Y A;  3BND A;  2HMO B;  1IQX A;  4O2H A;  1RKY A;  3DY5 A;  1Q81 4;  1VQ8 3;  3F40 A;  3EJV A;  4HM2 B;  1JV2 B;  3F8X A;  1N8R 4;  4N6V 0;  1SQW A;  2STD A;  1AVL A;  3WA2 X;  1LOX A;  2XEP A;  1LVN A;  2GU1 A;  2INX A;  3V92 A;  2XSO B;  1NB3 I;  1BUQ A;  2M7O A;  4N6M A;  4BTW A;  4R80 A;  1E3R A;  1OAC A;  2IMJ A;  1FGM A;  4QWT A;  1Q86 4;  2IUK A;  5IEO A;  3ER7 A;  5IG3 A;  1A2K A;  1UUV B;  1QAF A;  3CXC 2;  1ULI B;  1Y4K A;  3CCQ 3;  3CNX A;  4XDV A;  2D42 A;  3OWU A;  5CK6 A;  3D9R A;  1WMN A;  3LH4 A;  1VQ5 3;  3LTA A;  4U13 A;  5ELU A;  4MEI A;  3MWZ A;  2C11 A;  4L8P A;  2YFJ B;  1N9E A;  2HMK B;  3FF0 A;  1O7H B;  4RZM A;  3CCE 3;  1K8A 4;  4PEJ A;  3NM2 A;  1E3V A;  2SBL A;  2Y73 A;  3S67 A;  1S5A A;  2CIU A;  1SJW A;  3QRD A;  8CHO A;  1Q82 4;  2P09 A;  5DRV A;  5HGR A;  1EQK A;  4WFO A;  1A2V A;  1DMM A;  1VQL 3;  3GWR A;  4XB5 A;  5AYR B;  2Y74 A;  2IUJ A;  2CFD A;  2WOH A;  4AKY A;  1O7G B;  1OH0 A;  1FGT A;  2ZL8 A;  2Z76 A;  4HM7 B;  3AMO A;  4KFD A;  2W9Q A;  3B4P A;  2CWU A;  1ZO2 A;  3DGM A;  5IEN A;  1U8C B;  4J9A A;  3K63 A;  2W2C A;  5CF1 A;  1RRL A;  2W04 A;  3K0Z A;  1TFK A;  3MG1 A;  3JUQ A;  1JNQ A;  3H51 A;  3WDG B;  3X42 A;  3WOE B;  2XGL A;  4FMA A;  4WP5 A;  1WMO A;  3LTC A;  4HM1 B;  3GZB A;  1IK3 A;  2L4V A;  2CFL A;  2QIY A;  2Z6B A;  1YGE A;  3S5C A;  4FCJ A;  4WYK B;  3LZA A;  2FNQ A;  4L8O A;  3CCL 3;  1Z1S A;  1Q40 A;  1UI7 A;  4OUQ A;  1K28 A;  2W9P A;  3Q90 A;  4XDW A;  2JDI H;  1ULJ B;  2CG1 A;  1L5G B;  1ROA A;  3EF8 A;  2KCD A;  4ORL A;  1ZX2 A;  3FF2 A;  3VGN A;  1C7H A;  4CCV A;  3UNL A;  1IQ8 A;  4HM3 B;  2BT3 A;  1TU5 A;  2W03 A;  4N6U A;  3MHE A;  4N6L A;  3CCR 3;  1K9M 4;  1E97 A;  3BNB A;  3JUO A;  3NXJ A;  3LXU X;  4KVH A;  3SXX A;  3Q1C A;  3G8Z A;  5AIF A;  2Z7A A;  2BNG A;  5STD A;  2F86 B;  2CWV A;  1EKM A;  3T8N A;  1M1K 4;  1O7N B;  3F8H A;  3T8U A;  5IG5 A;  3CD6 3;  1GD4 A;  4N6N B;  3RGR A;  3V98 A;  1CYV A;  1AVK A;  3CPO A;  3OX9 A;  3SED A;  3B4O A;  2MC8 A;  1STD A;  3NV0 A;  2OTJ 3;  4ZM8 A;  1W2Z A;  1IT7 A;  1WTH A;  1W5Z A;  3FKA A;  4BTY A;  1O7P B;  3CCU 3;  1M9G A;  4K1V A;  1JN5 B;  3VSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...