4WWUC

Structure of mex67:mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
165
Chain Sequence
MVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPIQMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDSLLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords mRNA export factor MEX67
publication title Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 37
structure length 165
sequence length 177
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wwuC00
1QMAA 2RCDA 3FSDA 3OV4A 1UUVB 3NV0B 2HMLB 3T8NA 3B8LA 4HJLB 2OWPA 1WQLB 3KZTA 3K0ZA 3GWRA 3NUVA 3FF0A 4HM7B 5IERA 4HVNA 3GRDA 3EHCA 1ULIB 2CHCA 4ORLA 3OWSA 1A2KA 3WMDA 1OUNA 4PEJA 3DMCA 3LYGA 4HM1B 3OWUA 4HM8B 4H3UA 3H3HA 3F7XA 3JUNA 3JUPA 3NXJA 1S5AA 1STDA 4HZ9B 5AIGA 2HMMB 3CNMA 1TP6A 1DMQA 3HZPA 3NBRA 3DZLA 4IIAA 2XSOB 3FKAA 1BUQA 3DXOA 5KP3A 3UNLA 3KE7A 8CHOA 4LEHA 5IEPA 3EN8A 2Z7AA 5HGRA 3DM8A 1E3VA 7STDA 4XBXA 1OHSA 5IG4A 3CU3A 3UJMA 1IDPA 2I9WA 3EQQB 3M8CA 4FCMA 4I4KA 4L8OA 1W6YA 1W00A 3VSYA 3EC9A 1EA2A 4OUQA 5IG5A 2HMJB 4X2OA 1E97A 4N3VA 3FF2A 1ZX2A 1OF5A 1VZZA 3CPOA 3F9SA 4XDVA 2F99A 2STDA 5D81A 2HMNB 1JN5B 3RGRA 5AI1A 1JB2A 4L8PA 3LZAA 1OHOA 4K1UA 3GZBA 3ROBA 3F40A 3HK4A 4HM6B 4WWUC 1GY6A 1JB4A 4HKVB 1JKGB 5EVHA 1GY5A 5IEOA 3JUMA 5BVBA 2RGQA 4J9AA 2W2CA 3B7CA 4CDLA 5JPPA 4HM5B 1QJGA 3A76A 1Q40A 2F86B 3NM2A 4HM4B 4WYKB 1OHPA 5AEUB 4K1VA 3FGYA 2F98A 4STDA 3EBTA 2BMQB 1E3RA 4MJDA 3SEDA 3G0KA 1UUWB 2K54A 1Z1SA 3MYTA 3STDA 3G16A 3FZWA 1W01A 4HM0B 3GZRA 1GY7A 5TGNA 3SOAA 3VGNA 4R9KA 3KKGA 5CF1A 3EN1B 3K7CA 1W02A 5D83A 3OXAA 2XR8B 3IPTA 3F8XA 4KVHA 3Q90A 5IG0A 4XBYA 3SOYA 2XRXB 5DREA 2B1XB 4GB5A 4R1KA 5CK6A 3NV0A 3MKIA 2Z76A 3FH1A 1O7GB 2GBXB 3ECFA 4XDWA 2HMOB 3DUKA 2GEXA 2QGUA 2IMJA 3EJVA 5FW5A 5BXQA 3JUOA 3S5CA 5G2GA 5KP4A 4FCJA 1U5OA 3NHXA 1ULJB 3OX9A 5AIHA 2B24B 2YFJB 2GXFA 1GS3A 3MG2A 3F14A 4L7KA 2RFRA 3G8ZA 4Q53A 1AR0A 2XSHB 3JUQA 2UX0A 5D82A 2R4IA 5CXOA 1K41A 2BMOB 5CF2A 4XBTA 5AIFA 5AIIA 2A15A 5CLKA 3B4OA 1DMMA 1O7WB 1HKXA 4HM2B 1Q42A 4WP5A 4X2HA 3CNXA 5STDA 2CKFB 3F8HA 4OVMA 1OF5B 1O7PB 4HM3B 5IF6A 5DRVA 1CQSA 4R9LA 5AEWB 5IENA 2Z77A 3KSPA 4HZBB 2INXA 3B4PA 1NDOB 5KP1A 1ASKA 3I0YA 1OPYA 1OGZA 3D9RA 2BMRB 2YFIB 2YFLB 3BLZA 3MG1A 3OWYA 3GZXB 3MHEA 3EX9A 1JN5A 2PZVA 6STDA 1O7NB 5IG3A 3EF8A 3F7SA 4XM4A 4U13A 1O7HB 1SJWA 1Q40B 4J8TA 1ISKA 1JKGA 1ZO2A 1C7HA 1EG9B 2BNGA 1NU3A 3FLJA 3GZYB 2HMKB 2GEYA 2QIYA 2JQ5A 4XB5A 3BB9A 4WYKA 5JPUA 4LGQA 3E99A 4LMIA 1GYBA 3ER7A 2GBWB 1OCVA 3RGAA 3T8UA 3H51A 3MG3A 4RZMA 1TUHA 3EBYA 1NWWA 3MSOA 1OH0A 1O7MB 1DMNA 1JB5A 1OGXA 3HX8A
chains in the Genus database with same CATH superfamily
3LOYA 1UCJA 1QMAA 2RCDA 2W0QA 3FSDA 4RNTA 1SARA 3OV4A 1UUVB 4FCZA 5AYSC 1YJN3 3I553 3X3XA 1D6YA 2MF7A 4N6OB 2IA7A 3NV0B 1B2UA 2HMLB 3Q1CA 4N6UA 3T8NA 3B8LA 2CWVA 4HJLB 2OWPA 1RGAA 1WQLB 2CWUA 3KZTA 2W6JH 3K0ZA 3I563 3GWRA 3NUVA 3FF0A 4HM7B 5IERA 1YI23 2LQVA 3LXUX 4HVNA 4HOHA 3GRDA 3EHCA 1VQP3 1EQKA 1ULIB 3J7Yd 2CHCA 2F4YA 4ORLA 2W56B 3OWSA 1A2KA 3WMDA 1FUTA 1JZOA 4MEIA 1RGHA 2O9UX 1OUNA 1WMOA 4PEJA 1Y4KA 3S29A 3DMCA 5RNTA 3CME3 3LYGA 4HM1B 3PCSA 2CC3A 1DVCA 1WNHA 2CG0A 1QAKA 3OWUA 5BU4A 4HM8B 4H3UA 3T0UA 3KSED 3H3HA 4EXRA 1CEWI 4FMBA 3AHSA 2OQEC 3F7XA 1V58A 1G96A 3JUNA 1K9M4 3JUPA 2OOVC 3NXJA 1JRQA 1S5AA 1STDA 2CFDA 4HZ9B 1NB5I 3SVAA 5AIGA 2HMMB 3WR2A 4EV5A 2H0IA 3CNMA 3S27A 1DMQA 1TP6A 3BU4A 4NREA 3HZPA 3NBRA 5HOHA 2FGTA 2WOFA 3DZLA 1STFI 4IIAA 2XSOB 3FKAA 1BUQA 1N5PA 1OACA 3AGNA 1VQ63 3DXOA 5KP3A 3UNLA 3KE7A 8CHOA 4LEHA 5IEPA 3EN8A 2Z7AA 3WA2X 1YGWA 1YJ93 1RGKA 4BL3A 4NPBA 5HGRA 2AADA 2KF5A 3DM8A 1WMNA 1E3VA 8RNTA 1I70A 1BSBA 1DYUA 1RGEA 1FGTA 1MWRA 4XBXA 2IUJA 7STDA 3CC43 1BANA 1OHSA 5IG4A 1B2MA 2Y73A 3CU3A 5LC6A 4N6NB 3FG3A 3UJMA 1IDPA 2I9WA 1RCKA 3EQQB 3M8CA 4FCMA 4I4KA 3CCS3 4HBRA 1NNVA 1X1XA 4L8OA 1JBTA 1W6YA 3CCJ3 1W00A 1M9GA 4LZIA 2E2TA 1MWSA 1ZGXA 2P0MA 2BU4A 3HI7A 1UUGB 3EC9A 5AYRB 3VSYA 1Q824 5M19A 1JJ22 1CH0A 5M1AA 1I2GA 2F56A 2GU3A 1BRIA 4BTWA 1BNRA 1LRAA 3CXC2 3MPHA 4FMAA 3AMOA 3HIGA 2F5MA 9RNTA 1BNEA 4LYLB 1EA2A 7RNTA 1F8NA 1RTUA 1UGIA 4FR9A 1TFOA 4OUQA 3VF1A 1IV7A 3MWZA 4OK0A 3WOFB 2CH9A 3DY5A 5IG5A 1RKYA 2HMJB 4X2OA 4BL2A 1E97A 4N3VA 2H0GA 1HU9A 1PFPA 4GHOA 4KFFA 1SPUA 2W9QA 3FF2A 1ZX2A 3OW22 2LYXA 3Q2PA 1D6UA 1D6ZA 2RSXA 1IT7A 1OF5A 1VZZA 3CPOA 1SIHA 3F9SA 4XDVA 2F99A 1GOVA 2UGIA 3K5TA 2OCTA 3LTDA 2STDA 1IYYA 1YGEA 3WOEB 1FA3A 3PGBA 1FZUA 3NQZA 5D81A 1IQ8A 1V74A 4NHFA 1QAFA 2HMNB 3BNEA 1JN5B 1X1WA 3RGRA 1VQO3 1BRGA 1EEJA 5AI1A 1FGRA 3GSPA 1KQS2 1BU4A 1JB2A 3LZAA 1OHOA 1R4CA 3AHWA 4K1UA 4L8PA 4LSOA 2XFSA 3GZBA 3LT8A 3ROBA 1LNHA 3F40A 3N9HA 3HK4A 1RHLA 2XGNA 3KCHA 1UCIA 1LNIA 3D4AA 1Q7HA 4HM6B 3BNCA 4J5GA 4WWUC 1GY6A 5ELUA 1BNGA 1JB4A 3URPA 1M904 4FMDA 1LOVA 4HKVB 1Q9EA 2C10A 1JKGB 5G1KA 4WFOA 5EVHA 1GY5A 5IEOA 3JUMA 3X3YA 1BSAA 2RGQA 2XFTA 4IT7A 2W2CA 4J9AA 4BU4A 1JZDA 3LTBA 3SX1A 3B7CA 4CDLA 5JPPA 2FXTA 2SBLA 4EV2A 1JNQA 1US1A 1X1UA 3JVCA 1LVNA 3L0RA 2O3OA 5BIRA 1W2B2 2CFWA 4K90B 1W6CA 1TIJA 1BNSA 4FMCA 4HM5B 3BIRA 3UL6A 1TRQA 1RN4A 2V1LA 1TFKA 1BRSA 1MNLA 1QJGA 3DGOA 4EBGA 1RCLA 1LQMB 3A76A 2CW9A 2CX0A 3V99A 4O3VA 1YIJ3 1Q40A 1I8VA 1YNVX 2F86B 1BRJA 3NM2A 1ROVA 3DGYA 4HM4B 4WYKB 2M7OA 1OHPA 1MWUA 3S28A 2P09A 1UW1A 1WTHA 5AEUB 1N8QA 2F5WA 4K1VA 1JBSA 2BIRA 1FUSA 3FGYA 3X40A 2CIUA 5IW9A 1GSPA 2KCDA 2F98A 4STDA 4RNZA 5M18A 1VQ73 3EBTA 1UCLA 2BMQB 1G0TA 1E3RA 4MJDA 4MMXB 1DVDA 5JBSA 3SEDA 3G0KA 1V57A 1PYLA 2XF3A 2OTJ3 1EKMA 2FNQA 4EW5A 2W03A 3IJEB 1UCKA 3D5IA 1RJOA 1SQWA 3DGNA 4KT3B 1UUWB 6RNTA 2K54A 3HIIA 3CCE3 1Z1SA 1T5YA 3MYTA 1AVLA 1B21A 3CC73 3STDA 2J8XB 3KFQC 2CFKA 1YIT3 3BNBA 3G16A 3FZWA 3AGOA 3CD63 1IVVA 1LQGC 6GSPA 1RGFA 1VQ83 1W01A 4HM0B 3GZRA 1GY7A 4HAAA 5TGNA 3SOAA 3LT9A 1N5HA 2E2UA 3VGNA 1Q7Y4 1NJI4 1VQL3 1FGMA 2GU1A 1FYSA 4J5KA 4R9KA 5I97A 2UUGC 3KKGA 5BVBA 1BRHA 1MWTA 2Q07A 3EN1B 5CF1A 1Q864 1KD14 1ZS7A 4N6V0 1A67A 1VQ43 1ROAA 1B2XA 3K7CA 1YHQ3 1W02A 2OQEA 1JBRA 2D1WA 2OOVA 2MC8A 1I2EA 1I2FA 1IVUA 1BVIA 3OXAA 5D83A 3ALAA 1BAOA 4DKIA 3SXXA 3V98A 2XR8B 2WO0A 3IPTA 2BO9B 1I0XA 3F8XA 4KVHA 4CPKA 3NBBA 3Q90A 5IG0A 1UI8A 1GMQA 2JDIH 4KFEA 4XBYA 3SOYA 2L4VA 1GD4A 1LOYA 1N9JA 2XRXB 1W4NA 2RBIA 4JRFA 5DREA 3LTCA 3ZG5A 2B1XB 4EYCA 3WA3A 1RNTA 3CCU3 1Q814 3DGMA 4GB5A 1A2VA 4G1MB 4R1KA 1TU5A 5CK6A 4N6TA 3NV0A 3MKIA 3K63A 1N9EA 2Z76A 1RGCA 1BNJA 3FH1A 1O7GB 2PNCA 2GBXB 3ECFA 3PXMA 5FGOA 4KFDA 4XDWA 2HMOB 1A2PA 1B20A 2P05A 1PY3A 1KWIA 3HOHA 3DUKA 2CFLA 2GEXA 1VQ53 1AVKA 2CX1A 2L1SA 2R41A 1NO3A 4I5QA 2QGUA 1L5GB 2IMJA 3D79A 2W04A 2H0HA 3EJVA 3PCRA 3DH2A 3PZWA 1SIIA 2IYJA 5FW5A 3ZFZA 1FGQA 1S723 5BXQA 3JUOA 2GSPA 4N6MA 4N6LA 2SARA 3S5CA 7GSPA 1UGHI 2D42A 2CFGA 2XEPA 3FCSB 1RN1A 5G2GA 4CCVA 5KP4A 1N8R4 4FCJA 4EC6A 1U5OA 4GSPA 2K3DA 3NHXA 1ULJB 4HYZA 2C11A 3OX9A 5AIHA 2CG1A 1AY7A 2B24B 2YFJB 3S67A 1PU4A 3QK9A 2GXFA 4RBNA 2Z6BA 3EB8A 3SLUA 4ILFA 3CCV3 1GS3A 1LOXA 2YX9A 2WGQA 3MG2A 3CCQ3 1AQZA 2CK3H 1B3SA 2ZHXB 1CYVA 3F14A 3LMLA 4L7KA 3EE1A 1BNFA 1T3BA 2RFRA 5ELJA 3WDGB 1BUJA 3NM7A 3CCR3 1DE3A 1YVBI 3G8ZA 1AR0A 4Q53A 2KXGA 2XSHB 3JUQA 2K0MA 2UX0A 3D5GA 5D82A 2R4IA 1TRPA 3X42A 1RNBA 3RDEA 4IPBA 2QA43 5CXOA 1K41A 1YVSA 3SYUA 1B27A 2BMOB 1I3IA 1MGWA 4XBTA 5AIFA 5CF2A 5AIIA 2A15A 1AV4A 3AMOB 1RN7A 3G6E3 5CLKA 3B4OA 2IY2A 4WHAA 1MOLA 2E2VA 1DMMA 1O7WB 1HKXA 4HM2B 3X3ZA 1BIRA 3LTAA 5LC7A 1KSIA 1Q42A 4WP5A 1RLSA 2KF4A 1IVXA 4R4KA 4X2HA 3CNXA 5STDA 1VQQA 1A90A 5EQLA 4BTXA 2CKFB 1W7CA 3G4S3 3F8HA 4OVMA 1BRNL 3KIIA 1OF5B 1O7PB 4HM3B 3RNTA 5IF6A 1VQM3 1RRHA 1CQSA 2AAEA 3NQYA 1FGOA 1U8CB 3Q3FA 3D3LA 5DRVA 1T2HA 2ZL8A 4R9LA 5AEWB 2BT3A 1WMPA 1T2IA 4R80A 5IENA 2Z77A 3QRDA 2KF6A 1FW7A 2XH9A 1DETA 1TJDA 2IUKA 3U1WA 2OTL3 3KSPA 3LH4A 1M1K4 4HZBB 2INXA 1QVF2 1K28A 1GD3A 2ZDJA 3B4PA 1K734 4CJNA 4KZ1A 2KF3A 3V92A 1NDOB 1I3FA 3CC23 4H61A 4O02B 1VQ93 1I0VA 1BSCA 5KP1A 1ASKA 3I0YA 1OPYA 1OGZA 4MMYB 2W9PA 3D9RA 2BMRB 1X1YA 2YFIB 2YFLB 3BLZA 3MG1A 3OWYA 3GZXB 3MHEA 1LOWA 1BGSA 2P38A 3EX9A 1JN5A 2PZVA 3A5EA 3ZG0A 6STDA 1IU7A 1O7NB 1JV2B 1K8A4 1B2SA 1GOYA 1LXEA 5IG3A 1IVWA 1J2BA 4ZM8A 2Y74A 2QEX3 1BNIA 3CMA3 1VQK3 3EF8A 3F7SA 1RSNA 4U13A 4XM4A 5GSPA 1O7HB 1RRLA 2HOHA 1EUIC 1SJWA 3FG4A 4K61A 1FUWA 1Q40B 1VQN3 1GOUA 4GL6A 1QVG2 2BHMA 4J8TA 4TX4A 1ISKA 3UB1A 1JKGA 3PS8A 2ML5A 2KAAA 1ZO2A 1C7HA 3IMAB 3UL5A 3DGLA 1IV9A 2ML6A 3X41A 1KC84 1EG9B 1W2ZA 2BNGA 1NU3A 5A0OB 3FLJA 1R4YA 1IQXA 3BNDA 1BSEA 1BRKA 3N8BA 2W56A 3GZYB 2HMKB 4RNYA 1RGGA 5EEOA 4AEQA 4AKYA 1YJW3 3NBJA 1IT8A 2GEYA 2JQ5A 2P0XA 2QIYA 1G02A 4O2HA 4JF8A 4XB5A 1W6GA 4MMZB 3BB9A 4WYKA 3TDGA 5JPUA 3CCL3 4LGQA 3E99A 4LMIA 1GYBA 3ER7A 3K9MC 1NB3I 2GBWB 1C54A 1IK3A 1IQYA 1HZ1A 1OCVA 4BTYA 3RGAA 3WODG 3CCM3 1RDSA 1B2ZA 1UDII 3T8UA 3G713 2CWTA 3H51A 3NX0A 3GAXA 3CPW2 1BOXA 1BSDA 2KRTA 1MGRA 1RGLA 1CYUA 2C4BA 3MG3A 4BIRA 2XGLA 4RZMA 1GMRA 1M1XB 3O8YA 1TUHA 2RNTA 4QWTA 4AKZA 1GMPA 5G1LA 3PYJA 3EBYA 1NWWA 1TTOA 1QALA 2WGOA 1RMSA 3FG1A 3WHOA 3MSOA 3KN4A 1HYFA 3N54B 2WOHA 1W5ZA 1OH0A 4O8SA 1O7MB 1DMNA 1JB5A 2ZA4A 3U97A 1OGXA 3HX8A 1UI7A
chains in the Genus database with same CATH topology
3LOYA 1QMAA 2RCDA 2W0QA 3FSDA 3OV4A 1UUVB 4FCZA 5AYSC 1YJN3 3I553 3X3XA 1D6YA 2MF7A 4N6OB 2IA7A 3NV0B 2HMLB 3Q1CA 4N6UA 3T8NA 3B8LA 2CWVA 4HJLB 2OWPA 1WQLB 2CWUA 3KZTA 3I563 2W6JH 3K0ZA 3GWRA 3NUVA 3FF0A 4HM7B 5IERA 1YI23 2LQVA 3LXUX 4HVNA 1VQP3 3GRDA 3EHCA 1EQKA 1ULIB 3J7Yd 2CHCA 4ORLA 2W56B 3OWSA 1A2KA 3WMDA 4MEIA 2O9UX 1OUNA 1WMOA 4PEJA 1Y4KA 3S29A 3DMCA 3CME3 3LYGA 4HM1B 3PCSA 2CC3A 1DVCA 1WNHA 2CG0A 1QAKA 3OWUA 4HM8B 4H3UA 3T0UA 3KSED 3H3HA 4EXRA 1CEWI 4FMBA 2OQEC 3F7XA 1G96A 3JUNA 1K9M4 3JUPA 2OOVC 3NXJA 1JRQA 1S5AA 1STDA 2CFDA 4HZ9B 1NB5I 3SVAA 5AIGA 2HMMB 4EV5A 3CNMA 3S27A 1DMQA 1TP6A 4NREA 3HZPA 3NBRA 2FGTA 2WOFA 3DZLA 1STFI 4IIAA 2XSOB 3FKAA 1BUQA 1N5PA 1OACA 1VQ63 3DXOA 5KP3A 3UNLA 3KE7A 8CHOA 4LEHA 5IEPA 3EN8A 2Z7AA 3WA2X 1YJ93 5HGRA 3DM8A 1WMNA 1E3VA 1DYUA 1FGTA 4XBXA 7STDA 2IUJA 3CC43 1OHSA 5IG4A 2Y73A 3CU3A 5LC6A 4N6NB 3FG3A 3UJMA 1IDPA 2I9WA 3EQQB 3M8CA 4FCMA 4I4KA 3CCS3 4HBRA 4L8OA 1W6YA 3CCJ3 1W00A 1M9GA 4LZIA 2E2TA 2P0MA 5AYRB 3HI7A 3EC9A 3VSYA 1Q824 1JJ22 2GU3A 4BTWA 3CXC2 3MPHA 4FMAA 3AMOA 3HIGA 1EA2A 1F8NA 4FR9A 4OUQA 1TFOA 3VF1A 1IV7A 3MWZA 4OK0A 3WOFB 2CH9A 3DY5A 5IG5A 1RKYA 2HMJB 4X2OA 1E97A 4N3VA 1HU9A 1PFPA 4KFFA 1SPUA 2W9QA 3FF2A 1ZX2A 3OW22 2LYXA 3Q2PA 1D6UA 1D6ZA 2RSXA 1IT7A 1OF5A 1VZZA 3CPOA 1SIHA 3F9SA 4XDVA 2F99A 3K5TA 3LTDA 2OCTA 2STDA 1FA3A 1YGEA 3WOEB 3PGBA 3NQZA 5D81A 1IQ8A 1V74A 4NHFA 1QAFA 2HMNB 3BNEA 1JN5B 3RGRA 1VQO3 5AI1A 1KQS2 1FGRA 1JB2A 4L8PA 3LZAA 1OHOA 1R4CA 4LSOA 4K1UA 2XFSA 3GZBA 3LT8A 3ROBA 1LNHA 3F40A 3N9HA 3HK4A 2XGNA 4HM6B 3BNCA 4WWUC 1GY6A 5ELUA 1JB4A 1M904 4FMDA 4HKVB 2C10A 1JKGB 4WFOA 5EVHA 1GY5A 5IEOA 3JUMA 3X3YA 2RGQA 2XFTA 4IT7A 4J9AA 2W2CA 5BVBA 3LTBA 3SX1A 3B7CA 4CDLA 5JPPA 2FXTA 2SBLA 4EV2A 1JNQA 1US1A 3JVCA 1LVNA 3L0RA 2O3OA 1W2B2 2CFWA 4K90B 1W6CA 1TIJA 4FMCA 4HM5B 3UL6A 2V1LA 1TFKA 3DGOA 1MNLA 1QJGA 4EBGA 3A76A 2CW9A 3V99A 4O3VA 1YIJ3 1Q40A 2F86B 3NM2A 1ROVA 4HM4B 4WYKB 2M7OA 1OHPA 3S28A 2P09A 1UW1A 1WTHA 5AEUB 1N8QA 4K1VA 3FGYA 3X40A 5IW9A 2CIUA 2KCDA 2F98A 4STDA 4RNZA 1VQ73 3EBTA 2BMQB 1E3RA 4MJDA 4MMXB 1DVDA 5JBSA 3SEDA 3G0KA 2XF3A 2OTJ3 1EKMA 2FNQA 2W03A 3IJEB 1RJOA 1SQWA 3DGNA 1UUWB 2K54A 3HIIA 3CCE3 1Z1SA 1T5YA 3MYTA 1AVLA 3CC73 3STDA 3KFQC 2CFKA 1YIT3 3BNBA 3G16A 3FZWA 3CD63 1IVVA 1VQ83 1W01A 4HM0B 3GZRA 1GY7A 5TGNA 3SOAA 1NJI4 3LT9A 1N5HA 2E2UA 3VGNA 1Q7Y4 1VQL3 1FGMA 2GU1A 4R9KA 5I97A 3KKGA 5CF1A 1Q864 3EN1B 2Q07A 1KD14 4N6V0 1A67A 1VQ43 1ROAA 3K7CA 1YHQ3 1W02A 2OQEA 2D1WA 2OOVA 2MC8A 1IVUA 3OXAA 5D83A 3ALAA 3SXXA 3V98A 2XR8B 2WO0A 3IPTA 2BO9B 3F8XA 4KVHA 3NBBA 3Q90A 5IG0A 1UI8A 2JDIH 4KFEA 4XBYA 3SOYA 2L4VA 1GD4A 1N9JA 2XRXB 1W4NA 5DREA 4JRFA 4EYCA 3LTCA 3WA3A 2B1XB 3CCU3 1Q814 3DGMA 4GB5A 1A2VA 4G1MB 4R1KA 1TU5A 5CK6A 4N6TA 3NV0A 3MKIA 3K63A 1N9EA 2Z76A 3FH1A 1O7GB 2PNCA 2GBXB 3ECFA 3PXMA 5FGOA 4KFDA 4XDWA 2HMOB 2P05A 1KWIA 3DUKA 2CFLA 2GEXA 1VQ53 1AVKA 1NO3A 2QGUA 1L5GB 2IMJA 2W04A 3EJVA 3PCRA 3PZWA 1SIIA 5FW5A 1FGQA 1S723 5BXQA 3JUOA 4N6MA 4N6LA 3S5CA 2D42A 2CFGA 2XEPA 3FCSB 5G2GA 4CCVA 5KP4A 1N8R4 4FCJA 4EC6A 1U5OA 3NHXA 1ULJB 4HYZA 2C11A 3OX9A 5AIHA 2CG1A 2B24B 2YFJB 3S67A 1PU4A 3QK9A 2GXFA 4RBNA 2Z6BA 3EB8A 3SLUA 3CCV3 1GS3A 1LOXA 2YX9A 2WGQA 3MG2A 3CCQ3 3LMLA 2CK3H 1CYVA 3F14A 4L7KA 3EE1A 2RFRA 5ELJA 3WDGB 3NM7A 3CCR3 1YVBI 3G8ZA 1AR0A 4Q53A 2KXGA 2XSHB 3JUQA 2K0MA 2UX0A 5D82A 2R4IA 3X42A 3RDEA 4IPBA 2QA43 5CXOA 1K41A 2BMOB 5CF2A 4XBTA 5AIFA 5AIIA 2A15A 1AV4A 3AMOB 1RN7A 3G6E3 5CLKA 3B4OA 4WHAA 1MOLA 2E2VA 1DMMA 1O7WB 1HKXA 4HM2B 3X3ZA 3LTAA 5LC7A 1KSIA 1Q42A 4WP5A 1IVXA 4R4KA 4X2HA 3CNXA 5STDA 1A90A 5EQLA 4BTXA 2CKFB 1W7CA 3G4S3 3F8HA 4OVMA 3KIIA 1OF5B 1O7PB 4HM3B 5IF6A 1VQM3 1RRHA 1CQSA 5DRVA 3NQYA 1FGOA 1U8CB 3D3LA 2ZL8A 4R9LA 5AEWB 2BT3A 1WMPA 4R80A 5IENA 2Z77A 3QRDA 2XH9A 3U1WA 2IUKA 1QVF2 2OTL3 3KSPA 3LH4A 1M1K4 4HZBB 2INXA 1K28A 1GD3A 2ZDJA 3B4PA 1K734 4KZ1A 3V92A 1NDOB 3CC23 4H61A 4O02B 1VQ93 5KP1A 1ASKA 3I0YA 1OPYA 1OGZA 4MMYB 2W9PA 3D9RA 2BMRB 2YFIB 2YFLB 3BLZA 3MG1A 3OWYA 3GZXB 3MHEA 2P38A 3EX9A 1JN5A 2PZVA 6STDA 1IU7A 1O7NB 1JV2B 1K8A4 1LXEA 5IG3A 1IVWA 1J2BA 4ZM8A 2Y74A 2QEX3 3CMA3 1VQK3 3EF8A 3F7SA 4U13A 4XM4A 1O7HB 1RRLA 1SJWA 3FG4A 4K61A 1FUWA 1Q40B 1VQN3 4GL6A 1QVG2 2BHMA 4J8TA 4TX4A 1ISKA 3UB1A 1JKGA 3PS8A 2ML5A 1ZO2A 1C7HA 3IMAB 3UL5A 3DGLA 1IV9A 2ML6A 3X41A 1KC84 1EG9B 1W2ZA 2BNGA 1NU3A 5A0OB 3FLJA 1IQXA 3BNDA 3N8BA 2W56A 3GZYB 2HMKB 4RNYA 5EEOA 1YJW3 4AEQA 4AKYA 3NBJA 1IT8A 2GEYA 2JQ5A 2P0XA 2QIYA 4O2HA 4JF8A 4XB5A 1W6GA 4MMZB 3BB9A 4WYKA 3TDGA 5JPUA 3CCL3 4LGQA 3E99A 4LMIA 1GYBA 3ER7A 3K9MC 1NB3I 2GBWB 1IK3A 1IQYA 1OCVA 4BTYA 3RGAA 3WODG 3CCM3 3T8UA 3G713 2CWTA 3H51A 3NX0A 3GAXA 3CPW2 2KRTA 1CYUA 3MG3A 2XGLA 4RZMA 1M1XB 3O8YA 1TUHA 4QWTA 4AKZA 3PYJA 3EBYA 1NWWA 2WGOA 1QALA 3FG1A 3MSOA 3KN4A 3N54B 2WOHA 1W5ZA 1OH0A 4O8SA 1O7MB 1DMNA 1JB5A 3U97A 1OGXA 3HX8A 1UI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMA A;  2RCD A;  3FSD A;  3OV4 A;  1UUV B;  3NV0 B;  2HML B;  3T8N A;  3B8L A;  4HJL B;  2OWP A;  1WQL B;  3KZT A;  3K0Z A;  3GWR A;  3NUV A;  3FF0 A;  4HM7 B;  5IER A;  4HVN A;  3GRD A;  3EHC A;  1ULI B;  2CHC A;  4ORL A;  3OWS A;  1A2K A;  3WMD A;  1OUN A;  4PEJ A;  3DMC A;  3LYG A;  4HM1 B;  3OWU A;  4HM8 B;  4H3U A;  3H3H A;  3F7X A;  3JUN A;  3JUP A;  3NXJ A;  1S5A A;  1STD A;  4HZ9 B;  5AIG A;  2HMM B;  3CNM A;  1TP6 A;  1DMQ A;  3HZP A;  3NBR A;  3DZL A;  4IIA A;  2XSO B;  3FKA A;  1BUQ A;  3DXO A;  5KP3 A;  3UNL A;  3KE7 A;  8CHO A;  4LEH A;  5IEP A;  3EN8 A;  2Z7A A;  5HGR A;  3DM8 A;  1E3V A;  7STD A;  4XBX A;  1OHS A;  5IG4 A;  3CU3 A;  3UJM A;  1IDP A;  2I9W A;  3EQQ B;  3M8C A;  4FCM A;  4I4K A;  4L8O A;  1W6Y A;  1W00 A;  3VSY A;  3EC9 A;  1EA2 A;  4OUQ A;  5IG5 A;  2HMJ B;  4X2O A;  1E97 A;  4N3V A;  3FF2 A;  1ZX2 A;  1OF5 A;  1VZZ A;  3CPO A;  3F9S A;  4XDV A;  2F99 A;  2STD A;  5D81 A;  2HMN B;  1JN5 B;  3RGR A;  5AI1 A;  1JB2 A;  4L8P A;  3LZA A;  1OHO A;  4K1U A;  3GZB A;  3ROB A;  3F40 A;  3HK4 A;  4HM6 B;  4WWU C;  1GY6 A;  1JB4 A;  4HKV B;  1JKG B;  5EVH A;  1GY5 A;  5IEO A;  3JUM A;  5BVB A;  2RGQ A;  4J9A A;  2W2C A;  3B7C A;  4CDL A;  5JPP A;  4HM5 B;  1QJG A;  3A76 A;  1Q40 A;  2F86 B;  3NM2 A;  4HM4 B;  4WYK B;  1OHP A;  5AEU B;  4K1V A;  3FGY A;  2F98 A;  4STD A;  3EBT A;  2BMQ B;  1E3R A;  4MJD A;  3SED A;  3G0K A;  1UUW B;  2K54 A;  1Z1S A;  3MYT A;  3STD A;  3G16 A;  3FZW A;  1W01 A;  4HM0 B;  3GZR A;  1GY7 A;  5TGN A;  3SOA A;  3VGN A;  4R9K A;  3KKG A;  5CF1 A;  3EN1 B;  3K7C A;  1W02 A;  5D83 A;  3OXA A;  2XR8 B;  3IPT A;  3F8X A;  4KVH A;  3Q90 A;  5IG0 A;  4XBY A;  3SOY A;  2XRX B;  5DRE A;  2B1X B;  4GB5 A;  4R1K A;  5CK6 A;  3NV0 A;  3MKI A;  2Z76 A;  3FH1 A;  1O7G B;  2GBX B;  3ECF A;  4XDW A;  2HMO B;  3DUK A;  2GEX A;  2QGU A;  2IMJ A;  3EJV A;  5FW5 A;  5BXQ A;  3JUO A;  3S5C A;  5G2G A;  5KP4 A;  4FCJ A;  1U5O A;  3NHX A;  1ULJ B;  3OX9 A;  5AIH A;  2B24 B;  2YFJ B;  2GXF A;  1GS3 A;  3MG2 A;  3F14 A;  4L7K A;  2RFR A;  3G8Z A;  4Q53 A;  1AR0 A;  2XSH B;  3JUQ A;  2UX0 A;  5D82 A;  2R4I A;  5CXO A;  1K41 A;  2BMO B;  5CF2 A;  4XBT A;  5AIF A;  5AII A;  2A15 A;  5CLK A;  3B4O A;  1DMM A;  1O7W B;  1HKX A;  4HM2 B;  1Q42 A;  4WP5 A;  4X2H A;  3CNX A;  5STD A;  2CKF B;  3F8H A;  4OVM A;  1OF5 B;  1O7P B;  4HM3 B;  5IF6 A;  5DRV A;  1CQS A;  4R9L A;  5AEW B;  5IEN A;  2Z77 A;  3KSP A;  4HZB B;  2INX A;  3B4P A;  1NDO B;  5KP1 A;  1ASK A;  3I0Y A;  1OPY A;  1OGZ A;  3D9R A;  2BMR B;  2YFI B;  2YFL B;  3BLZ A;  3MG1 A;  3OWY A;  3GZX B;  3MHE A;  3EX9 A;  1JN5 A;  2PZV A;  6STD A;  1O7N B;  5IG3 A;  3EF8 A;  3F7S A;  4XM4 A;  4U13 A;  1O7H B;  1SJW A;  1Q40 B;  4J8T A;  1ISK A;  1JKG A;  1ZO2 A;  1C7H A;  1EG9 B;  2BNG A;  1NU3 A;  3FLJ A;  3GZY B;  2HMK B;  2GEY A;  2QIY A;  2JQ5 A;  4XB5 A;  3BB9 A;  4WYK A;  5JPU A;  4LGQ A;  3E99 A;  4LMI A;  1GYB A;  3ER7 A;  2GBW B;  1OCV A;  3RGA A;  3T8U A;  3H51 A;  3MG3 A;  4RZM A;  1TUH A;  3EBY A;  1NWW A;  3MSO A;  1OH0 A;  1O7M B;  1DMN A;  1JB5 A;  1OGX A;  3HX8 A; 
#chains in the Genus database with same CATH topology
 3LOY A;  1UCJ A;  1QMA A;  2RCD A;  2W0Q A;  3FSD A;  4RNT A;  1SAR A;  3OV4 A;  1UUV B;  4FCZ A;  5AYS C;  1YJN 3;  3I55 3;  3X3X A;  1D6Y A;  2MF7 A;  4N6O B;  2IA7 A;  3NV0 B;  1B2U A;  2HML B;  3Q1C A;  4N6U A;  3T8N A;  3B8L A;  2CWV A;  4HJL B;  2OWP A;  1RGA A;  1WQL B;  2CWU A;  3KZT A;  2W6J H;  3K0Z A;  3I56 3;  3GWR A;  3NUV A;  3FF0 A;  4HM7 B;  5IER A;  1YI2 3;  2LQV A;  3LXU X;  4HVN A;  4HOH A;  3GRD A;  3EHC A;  1VQP 3;  1EQK A;  1ULI B;  3J7Y d;  2CHC A;  2F4Y A;  4ORL A;  2W56 B;  3OWS A;  1A2K A;  3WMD A;  1FUT A;  1JZO A;  4MEI A;  1RGH A;  2O9U X;  1OUN A;  1WMO A;  4PEJ A;  1Y4K A;  3S29 A;  3DMC A;  5RNT A;  3CME 3;  3LYG A;  4HM1 B;  3PCS A;  2CC3 A;  1DVC A;  1WNH A;  2CG0 A;  1QAK A;  3OWU A;  5BU4 A;  4HM8 B;  4H3U A;  3T0U A;  3KSE D;  3H3H A;  4EXR A;  1CEW I;  4FMB A;  3AHS A;  2OQE C;  3F7X A;  1V58 A;  1G96 A;  3JUN A;  1K9M 4;  3JUP A;  2OOV C;  3NXJ A;  1JRQ A;  1S5A A;  1STD A;  2CFD A;  4HZ9 B;  1NB5 I;  3SVA A;  5AIG A;  2HMM B;  3WR2 A;  4EV5 A;  2H0I A;  3CNM A;  3S27 A;  1DMQ A;  1TP6 A;  3BU4 A;  4NRE A;  3HZP A;  3NBR A;  5HOH A;  2FGT A;  2WOF A;  3DZL A;  1STF I;  4IIA A;  2XSO B;  3FKA A;  1BUQ A;  1N5P A;  1OAC A;  3AGN A;  1VQ6 3;  3DXO A;  5KP3 A;  3UNL A;  3KE7 A;  8CHO A;  4LEH A;  5IEP A;  3EN8 A;  2Z7A A;  3WA2 X;  1YGW A;  1YJ9 3;  1RGK A;  4BL3 A;  4NPB A;  5HGR A;  2AAD A;  2KF5 A;  3DM8 A;  1WMN A;  1E3V A;  8RNT A;  1I70 A;  1BSB A;  1DYU A;  1RGE A;  1FGT A;  1MWR A;  4XBX A;  2IUJ A;  7STD A;  3CC4 3;  1BAN A;  1OHS A;  5IG4 A;  1B2M A;  2Y73 A;  3CU3 A;  5LC6 A;  4N6N B;  3FG3 A;  3UJM A;  1IDP A;  2I9W A;  1RCK A;  3EQQ B;  3M8C A;  4FCM A;  4I4K A;  3CCS 3;  4HBR A;  1NNV A;  1X1X A;  4L8O A;  1JBT A;  1W6Y A;  3CCJ 3;  1W00 A;  1M9G A;  4LZI A;  2E2T A;  1MWS A;  1ZGX A;  2P0M A;  2BU4 A;  3HI7 A;  1UUG B;  3EC9 A;  5AYR B;  3VSY A;  1Q82 4;  5M19 A;  1JJ2 2;  1CH0 A;  5M1A A;  1I2G A;  2F56 A;  2GU3 A;  1BRI A;  4BTW A;  1BNR A;  1LRA A;  3CXC 2;  3MPH A;  4FMA A;  3AMO A;  3HIG A;  2F5M A;  9RNT A;  1BNE A;  4LYL B;  1EA2 A;  7RNT A;  1F8N A;  1RTU A;  1UGI A;  4FR9 A;  1TFO A;  4OUQ A;  3VF1 A;  1IV7 A;  3MWZ A;  4OK0 A;  3WOF B;  2CH9 A;  3DY5 A;  5IG5 A;  1RKY A;  2HMJ B;  4X2O A;  4BL2 A;  1E97 A;  4N3V A;  2H0G A;  1HU9 A;  1PFP A;  4GHO A;  4KFF A;  1SPU A;  2W9Q A;  3FF2 A;  1ZX2 A;  3OW2 2;  2LYX A;  3Q2P A;  1D6U A;  1D6Z A;  2RSX A;  1IT7 A;  1OF5 A;  1VZZ A;  3CPO A;  1SIH A;  3F9S A;  4XDV A;  2F99 A;  1GOV A;  2UGI A;  3K5T A;  2OCT A;  3LTD A;  2STD A;  1IYY A;  1YGE A;  3WOE B;  1FA3 A;  3PGB A;  1FZU A;  3NQZ A;  5D81 A;  1IQ8 A;  1V74 A;  4NHF A;  1QAF A;  2HMN B;  3BNE A;  1JN5 B;  1X1W A;  3RGR A;  1VQO 3;  1BRG A;  1EEJ A;  5AI1 A;  1FGR A;  3GSP A;  1KQS 2;  1BU4 A;  1JB2 A;  3LZA A;  1OHO A;  1R4C A;  3AHW A;  4K1U A;  4L8P A;  4LSO A;  2XFS A;  3GZB A;  3LT8 A;  3ROB A;  1LNH A;  3F40 A;  3N9H A;  3HK4 A;  1RHL A;  2XGN A;  3KCH A;  1UCI A;  1LNI A;  3D4A A;  1Q7H A;  4HM6 B;  3BNC A;  4J5G A;  4WWU C;  1GY6 A;  5ELU A;  1BNG A;  1JB4 A;  3URP A;  1M90 4;  4FMD A;  1LOV A;  4HKV B;  1Q9E A;  2C10 A;  1JKG B;  5G1K A;  4WFO A;  5EVH A;  1GY5 A;  5IEO A;  3JUM A;  3X3Y A;  1BSA A;  2RGQ A;  2XFT A;  4IT7 A;  2W2C A;  4J9A A;  4BU4 A;  1JZD A;  3LTB A;  3SX1 A;  3B7C A;  4CDL A;  5JPP A;  2FXT A;  2SBL A;  4EV2 A;  1JNQ A;  1US1 A;  1X1U A;  3JVC A;  1LVN A;  3L0R A;  2O3O A;  5BIR A;  1W2B 2;  2CFW A;  4K90 B;  1W6C A;  1TIJ A;  1BNS A;  4FMC A;  4HM5 B;  3BIR A;  3UL6 A;  1TRQ A;  1RN4 A;  2V1L A;  1TFK A;  1BRS A;  1MNL A;  1QJG A;  3DGO A;  4EBG A;  1RCL A;  1LQM B;  3A76 A;  2CW9 A;  2CX0 A;  3V99 A;  4O3V A;  1YIJ 3;  1Q40 A;  1I8V A;  1YNV X;  2F86 B;  1BRJ A;  3NM2 A;  1ROV A;  3DGY A;  4HM4 B;  4WYK B;  2M7O A;  1OHP A;  1MWU A;  3S28 A;  2P09 A;  1UW1 A;  1WTH A;  5AEU B;  1N8Q A;  2F5W A;  4K1V A;  1JBS A;  2BIR A;  1FUS A;  3FGY A;  3X40 A;  2CIU A;  5IW9 A;  1GSP A;  2KCD A;  2F98 A;  4STD A;  4RNZ A;  5M18 A;  1VQ7 3;  3EBT A;  1UCL A;  2BMQ B;  1G0T A;  1E3R A;  4MJD A;  4MMX B;  1DVD A;  5JBS A;  3SED A;  3G0K A;  1V57 A;  1PYL A;  2XF3 A;  2OTJ 3;  1EKM A;  2FNQ A;  4EW5 A;  2W03 A;  3IJE B;  1UCK A;  3D5I A;  1RJO A;  1SQW A;  3DGN A;  4KT3 B;  1UUW B;  6RNT A;  2K54 A;  3HII A;  3CCE 3;  1Z1S A;  1T5Y A;  3MYT A;  1AVL A;  1B21 A;  3CC7 3;  3STD A;  2J8X B;  3KFQ C;  2CFK A;  1YIT 3;  3BNB A;  3G16 A;  3FZW A;  3AGO A;  3CD6 3;  1IVV A;  1LQG C;  6GSP A;  1RGF A;  1VQ8 3;  1W01 A;  4HM0 B;  3GZR A;  1GY7 A;  4HAA A;  5TGN A;  3SOA A;  3LT9 A;  1N5H A;  2E2U A;  3VGN A;  1Q7Y 4;  1NJI 4;  1VQL 3;  1FGM A;  2GU1 A;  1FYS A;  4J5K A;  4R9K A;  5I97 A;  2UUG C;  3KKG A;  5BVB A;  1BRH A;  1MWT A;  2Q07 A;  3EN1 B;  5CF1 A;  1Q86 4;  1KD1 4;  1ZS7 A;  4N6V 0;  1A67 A;  1VQ4 3;  1ROA A;  1B2X A;  3K7C A;  1YHQ 3;  1W02 A;  2OQE A;  1JBR A;  2D1W A;  2OOV A;  2MC8 A;  1I2E A;  1I2F A;  1IVU A;  1BVI A;  3OXA A;  5D83 A;  3ALA A;  1BAO A;  4DKI A;  3SXX A;  3V98 A;  2XR8 B;  2WO0 A;  3IPT A;  2BO9 B;  1I0X A;  3F8X A;  4KVH A;  4CPK A;  3NBB A;  3Q90 A;  5IG0 A;  1UI8 A;  1GMQ A;  2JDI H;  4KFE A;  4XBY A;  3SOY A;  2L4V A;  1GD4 A;  1LOY A;  1N9J A;  2XRX B;  1W4N A;  2RBI A;  4JRF A;  5DRE A;  3LTC A;  3ZG5 A;  2B1X B;  4EYC A;  3WA3 A;  1RNT A;  3CCU 3;  1Q81 4;  3DGM A;  4GB5 A;  1A2V A;  4G1M B;  4R1K A;  1TU5 A;  5CK6 A;  4N6T A;  3NV0 A;  3MKI A;  3K63 A;  1N9E A;  2Z76 A;  1RGC A;  1BNJ A;  3FH1 A;  1O7G B;  2PNC A;  2GBX B;  3ECF A;  3PXM A;  5FGO A;  4KFD A;  4XDW A;  2HMO B;  1A2P A;  1B20 A;  2P05 A;  1PY3 A;  1KWI A;  3HOH A;  3DUK A;  2CFL A;  2GEX A;  1VQ5 3;  1AVK A;  2CX1 A;  2L1S A;  2R41 A;  1NO3 A;  4I5Q A;  2QGU A;  1L5G B;  2IMJ A;  3D79 A;  2W04 A;  2H0H A;  3EJV A;  3PCR A;  3DH2 A;  3PZW A;  1SII A;  2IYJ A;  5FW5 A;  3ZFZ A;  1FGQ A;  1S72 3;  5BXQ A;  3JUO A;  2GSP A;  4N6M A;  4N6L A;  2SAR A;  3S5C A;  7GSP A;  1UGH I;  2D42 A;  2CFG A;  2XEP A;  3FCS B;  1RN1 A;  5G2G A;  4CCV A;  5KP4 A;  1N8R 4;  4FCJ A;  4EC6 A;  1U5O A;  4GSP A;  2K3D A;  3NHX A;  1ULJ B;  4HYZ A;  2C11 A;  3OX9 A;  5AIH A;  2CG1 A;  1AY7 A;  2B24 B;  2YFJ B;  3S67 A;  1PU4 A;  3QK9 A;  2GXF A;  4RBN A;  2Z6B A;  3EB8 A;  3SLU A;  4ILF A;  3CCV 3;  1GS3 A;  1LOX A;  2YX9 A;  2WGQ A;  3MG2 A;  3CCQ 3;  1AQZ A;  2CK3 H;  1B3S A;  2ZHX B;  1CYV A;  3F14 A;  3LML A;  4L7K A;  3EE1 A;  1BNF A;  1T3B A;  2RFR A;  5ELJ A;  3WDG B;  1BUJ A;  3NM7 A;  3CCR 3;  1DE3 A;  1YVB I;  3G8Z A;  1AR0 A;  4Q53 A;  2KXG A;  2XSH B;  3JUQ A;  2K0M A;  2UX0 A;  3D5G A;  5D82 A;  2R4I A;  1TRP A;  3X42 A;  1RNB A;  3RDE A;  4IPB A;  2QA4 3;  5CXO A;  1K41 A;  1YVS A;  3SYU A;  1B27 A;  2BMO B;  1I3I A;  1MGW A;  4XBT A;  5AIF A;  5CF2 A;  5AII A;  2A15 A;  1AV4 A;  3AMO B;  1RN7 A;  3G6E 3;  5CLK A;  3B4O A;  2IY2 A;  4WHA A;  1MOL A;  2E2V A;  1DMM A;  1O7W B;  1HKX A;  4HM2 B;  3X3Z A;  1BIR A;  3LTA A;  5LC7 A;  1KSI A;  1Q42 A;  4WP5 A;  1RLS A;  2KF4 A;  1IVX A;  4R4K A;  4X2H A;  3CNX A;  5STD A;  1VQQ A;  1A90 A;  5EQL A;  4BTX A;  2CKF B;  1W7C A;  3G4S 3;  3F8H A;  4OVM A;  1BRN L;  3KII A;  1OF5 B;  1O7P B;  4HM3 B;  3RNT A;  5IF6 A;  1VQM 3;  1RRH A;  1CQS A;  2AAE A;  3NQY A;  1FGO A;  1U8C B;  3Q3F A;  3D3L A;  5DRV A;  1T2H A;  2ZL8 A;  4R9L A;  5AEW B;  2BT3 A;  1WMP A;  1T2I A;  4R80 A;  5IEN A;  2Z77 A;  3QRD A;  2KF6 A;  1FW7 A;  2XH9 A;  1DET A;  1TJD A;  2IUK A;  3U1W A;  2OTL 3;  3KSP A;  3LH4 A;  1M1K 4;  4HZB B;  2INX A;  1QVF 2;  1K28 A;  1GD3 A;  2ZDJ A;  3B4P A;  1K73 4;  4CJN A;  4KZ1 A;  2KF3 A;  3V92 A;  1NDO B;  1I3F A;  3CC2 3;  4H61 A;  4O02 B;  1VQ9 3;  1I0V A;  1BSC A;  5KP1 A;  1ASK A;  3I0Y A;  1OPY A;  1OGZ A;  4MMY B;  2W9P A;  3D9R A;  2BMR B;  1X1Y A;  2YFI B;  2YFL B;  3BLZ A;  3MG1 A;  3OWY A;  3GZX B;  3MHE A;  1LOW A;  1BGS A;  2P38 A;  3EX9 A;  1JN5 A;  2PZV A;  3A5E A;  3ZG0 A;  6STD A;  1IU7 A;  1O7N B;  1JV2 B;  1K8A 4;  1B2S A;  1GOY A;  1LXE A;  5IG3 A;  1IVW A;  1J2B A;  4ZM8 A;  2Y74 A;  2QEX 3;  1BNI A;  3CMA 3;  1VQK 3;  3EF8 A;  3F7S A;  1RSN A;  4U13 A;  4XM4 A;  5GSP A;  1O7H B;  1RRL A;  2HOH A;  1EUI C;  1SJW A;  3FG4 A;  4K61 A;  1FUW A;  1Q40 B;  1VQN 3;  1GOU A;  4GL6 A;  1QVG 2;  2BHM A;  4J8T A;  4TX4 A;  1ISK A;  3UB1 A;  1JKG A;  3PS8 A;  2ML5 A;  2KAA A;  1ZO2 A;  1C7H A;  3IMA B;  3UL5 A;  3DGL A;  1IV9 A;  2ML6 A;  3X41 A;  1KC8 4;  1EG9 B;  1W2Z A;  2BNG A;  1NU3 A;  5A0O B;  3FLJ A;  1R4Y A;  1IQX A;  3BND A;  1BSE A;  1BRK A;  3N8B A;  2W56 A;  3GZY B;  2HMK B;  4RNY A;  1RGG A;  5EEO A;  4AEQ A;  4AKY A;  1YJW 3;  3NBJ A;  1IT8 A;  2GEY A;  2JQ5 A;  2P0X A;  2QIY A;  1G02 A;  4O2H A;  4JF8 A;  4XB5 A;  1W6G A;  4MMZ B;  3BB9 A;  4WYK A;  3TDG A;  5JPU A;  3CCL 3;  4LGQ A;  3E99 A;  4LMI A;  1GYB A;  3ER7 A;  3K9M C;  1NB3 I;  2GBW B;  1C54 A;  1IK3 A;  1IQY A;  1HZ1 A;  1OCV A;  4BTY A;  3RGA A;  3WOD G;  3CCM 3;  1RDS A;  1B2Z A;  1UDI I;  3T8U A;  3G71 3;  2CWT A;  3H51 A;  3NX0 A;  3GAX A;  3CPW 2;  1BOX A;  1BSD A;  2KRT A;  1MGR A;  1RGL A;  1CYU A;  2C4B A;  3MG3 A;  4BIR A;  2XGL A;  4RZM A;  1GMR A;  1M1X B;  3O8Y A;  1TUH A;  2RNT A;  4QWT A;  4AKZ A;  1GMP A;  5G1L A;  3PYJ A;  3EBY A;  1NWW A;  1TTO A;  1QAL A;  2WGO A;  1RMS A;  3FG1 A;  3WHO A;  3MSO A;  3KN4 A;  1HYF A;  3N54 B;  2WOH A;  1W5Z A;  1OH0 A;  4O8S A;  1O7M B;  1DMN A;  1JB5 A;  2ZA4 A;  3U97 A;  1OGX A;  3HX8 A;  1UI7 A; 
#chains in the Genus database with same CATH homology
 3LOY A;  1QMA A;  2RCD A;  2W0Q A;  3FSD A;  3OV4 A;  1UUV B;  4FCZ A;  5AYS C;  1YJN 3;  3I55 3;  3X3X A;  1D6Y A;  2MF7 A;  4N6O B;  2IA7 A;  3NV0 B;  2HML B;  3Q1C A;  4N6U A;  3T8N A;  3B8L A;  2CWV A;  4HJL B;  2OWP A;  1WQL B;  2CWU A;  3KZT A;  3I56 3;  2W6J H;  3K0Z A;  3GWR A;  3NUV A;  3FF0 A;  4HM7 B;  5IER A;  1YI2 3;  2LQV A;  3LXU X;  4HVN A;  1VQP 3;  3GRD A;  3EHC A;  1EQK A;  1ULI B;  3J7Y d;  2CHC A;  4ORL A;  2W56 B;  3OWS A;  1A2K A;  3WMD A;  4MEI A;  2O9U X;  1OUN A;  1WMO A;  4PEJ A;  1Y4K A;  3S29 A;  3DMC A;  3CME 3;  3LYG A;  4HM1 B;  3PCS A;  2CC3 A;  1DVC A;  1WNH A;  2CG0 A;  1QAK A;  3OWU A;  4HM8 B;  4H3U A;  3T0U A;  3KSE D;  3H3H A;  4EXR A;  1CEW I;  4FMB A;  2OQE C;  3F7X A;  1G96 A;  3JUN A;  1K9M 4;  3JUP A;  2OOV C;  3NXJ A;  1JRQ A;  1S5A A;  1STD A;  2CFD A;  4HZ9 B;  1NB5 I;  3SVA A;  5AIG A;  2HMM B;  4EV5 A;  3CNM A;  3S27 A;  1DMQ A;  1TP6 A;  4NRE A;  3HZP A;  3NBR A;  2FGT A;  2WOF A;  3DZL A;  1STF I;  4IIA A;  2XSO B;  3FKA A;  1BUQ A;  1N5P A;  1OAC A;  1VQ6 3;  3DXO A;  5KP3 A;  3UNL A;  3KE7 A;  8CHO A;  4LEH A;  5IEP A;  3EN8 A;  2Z7A A;  3WA2 X;  1YJ9 3;  5HGR A;  3DM8 A;  1WMN A;  1E3V A;  1DYU A;  1FGT A;  4XBX A;  7STD A;  2IUJ A;  3CC4 3;  1OHS A;  5IG4 A;  2Y73 A;  3CU3 A;  5LC6 A;  4N6N B;  3FG3 A;  3UJM A;  1IDP A;  2I9W A;  3EQQ B;  3M8C A;  4FCM A;  4I4K A;  3CCS 3;  4HBR A;  4L8O A;  1W6Y A;  3CCJ 3;  1W00 A;  1M9G A;  4LZI A;  2E2T A;  2P0M A;  5AYR B;  3HI7 A;  3EC9 A;  3VSY A;  1Q82 4;  1JJ2 2;  2GU3 A;  4BTW A;  3CXC 2;  3MPH A;  4FMA A;  3AMO A;  3HIG A;  1EA2 A;  1F8N A;  4FR9 A;  4OUQ A;  1TFO A;  3VF1 A;  1IV7 A;  3MWZ A;  4OK0 A;  3WOF B;  2CH9 A;  3DY5 A;  5IG5 A;  1RKY A;  2HMJ B;  4X2O A;  1E97 A;  4N3V A;  1HU9 A;  1PFP A;  4KFF A;  1SPU A;  2W9Q A;  3FF2 A;  1ZX2 A;  3OW2 2;  2LYX A;  3Q2P A;  1D6U A;  1D6Z A;  2RSX A;  1IT7 A;  1OF5 A;  1VZZ A;  3CPO A;  1SIH A;  3F9S A;  4XDV A;  2F99 A;  3K5T A;  3LTD A;  2OCT A;  2STD A;  1FA3 A;  1YGE A;  3WOE B;  3PGB A;  3NQZ A;  5D81 A;  1IQ8 A;  1V74 A;  4NHF A;  1QAF A;  2HMN B;  3BNE A;  1JN5 B;  3RGR A;  1VQO 3;  5AI1 A;  1KQS 2;  1FGR A;  1JB2 A;  4L8P A;  3LZA A;  1OHO A;  1R4C A;  4LSO A;  4K1U A;  2XFS A;  3GZB A;  3LT8 A;  3ROB A;  1LNH A;  3F40 A;  3N9H A;  3HK4 A;  2XGN A;  4HM6 B;  3BNC A;  4WWU C;  1GY6 A;  5ELU A;  1JB4 A;  1M90 4;  4FMD A;  4HKV B;  2C10 A;  1JKG B;  4WFO A;  5EVH A;  1GY5 A;  5IEO A;  3JUM A;  3X3Y A;  2RGQ A;  2XFT A;  4IT7 A;  4J9A A;  2W2C A;  5BVB A;  3LTB A;  3SX1 A;  3B7C A;  4CDL A;  5JPP A;  2FXT A;  2SBL A;  4EV2 A;  1JNQ A;  1US1 A;  3JVC A;  1LVN A;  3L0R A;  2O3O A;  1W2B 2;  2CFW A;  4K90 B;  1W6C A;  1TIJ A;  4FMC A;  4HM5 B;  3UL6 A;  2V1L A;  1TFK A;  3DGO A;  1MNL A;  1QJG A;  4EBG A;  3A76 A;  2CW9 A;  3V99 A;  4O3V A;  1YIJ 3;  1Q40 A;  2F86 B;  3NM2 A;  1ROV A;  4HM4 B;  4WYK B;  2M7O A;  1OHP A;  3S28 A;  2P09 A;  1UW1 A;  1WTH A;  5AEU B;  1N8Q A;  4K1V A;  3FGY A;  3X40 A;  5IW9 A;  2CIU A;  2KCD A;  2F98 A;  4STD A;  4RNZ A;  1VQ7 3;  3EBT A;  2BMQ B;  1E3R A;  4MJD A;  4MMX B;  1DVD A;  5JBS A;  3SED A;  3G0K A;  2XF3 A;  2OTJ 3;  1EKM A;  2FNQ A;  2W03 A;  3IJE B;  1RJO A;  1SQW A;  3DGN A;  1UUW B;  2K54 A;  3HII A;  3CCE 3;  1Z1S A;  1T5Y A;  3MYT A;  1AVL A;  3CC7 3;  3STD A;  3KFQ C;  2CFK A;  1YIT 3;  3BNB A;  3G16 A;  3FZW A;  3CD6 3;  1IVV A;  1VQ8 3;  1W01 A;  4HM0 B;  3GZR A;  1GY7 A;  5TGN A;  3SOA A;  1NJI 4;  3LT9 A;  1N5H A;  2E2U A;  3VGN A;  1Q7Y 4;  1VQL 3;  1FGM A;  2GU1 A;  4R9K A;  5I97 A;  3KKG A;  5CF1 A;  1Q86 4;  3EN1 B;  2Q07 A;  1KD1 4;  4N6V 0;  1A67 A;  1VQ4 3;  1ROA A;  3K7C A;  1YHQ 3;  1W02 A;  2OQE A;  2D1W A;  2OOV A;  2MC8 A;  1IVU A;  3OXA A;  5D83 A;  3ALA A;  3SXX A;  3V98 A;  2XR8 B;  2WO0 A;  3IPT A;  2BO9 B;  3F8X A;  4KVH A;  3NBB A;  3Q90 A;  5IG0 A;  1UI8 A;  2JDI H;  4KFE A;  4XBY A;  3SOY A;  2L4V A;  1GD4 A;  1N9J A;  2XRX B;  1W4N A;  5DRE A;  4JRF A;  4EYC A;  3LTC A;  3WA3 A;  2B1X B;  3CCU 3;  1Q81 4;  3DGM A;  4GB5 A;  1A2V A;  4G1M B;  4R1K A;  1TU5 A;  5CK6 A;  4N6T A;  3NV0 A;  3MKI A;  3K63 A;  1N9E A;  2Z76 A;  3FH1 A;  1O7G B;  2PNC A;  2GBX B;  3ECF A;  3PXM A;  5FGO A;  4KFD A;  4XDW A;  2HMO B;  2P05 A;  1KWI A;  3DUK A;  2CFL A;  2GEX A;  1VQ5 3;  1AVK A;  1NO3 A;  2QGU A;  1L5G B;  2IMJ A;  2W04 A;  3EJV A;  3PCR A;  3PZW A;  1SII A;  5FW5 A;  1FGQ A;  1S72 3;  5BXQ A;  3JUO A;  4N6M A;  4N6L A;  3S5C A;  2D42 A;  2CFG A;  2XEP A;  3FCS B;  5G2G A;  4CCV A;  5KP4 A;  1N8R 4;  4FCJ A;  4EC6 A;  1U5O A;  3NHX A;  1ULJ B;  4HYZ A;  2C11 A;  3OX9 A;  5AIH A;  2CG1 A;  2B24 B;  2YFJ B;  3S67 A;  1PU4 A;  3QK9 A;  2GXF A;  4RBN A;  2Z6B A;  3EB8 A;  3SLU A;  3CCV 3;  1GS3 A;  1LOX A;  2YX9 A;  2WGQ A;  3MG2 A;  3CCQ 3;  3LML A;  2CK3 H;  1CYV A;  3F14 A;  4L7K A;  3EE1 A;  2RFR A;  5ELJ A;  3WDG B;  3NM7 A;  3CCR 3;  1YVB I;  3G8Z A;  1AR0 A;  4Q53 A;  2KXG A;  2XSH B;  3JUQ A;  2K0M A;  2UX0 A;  5D82 A;  2R4I A;  3X42 A;  3RDE A;  4IPB A;  2QA4 3;  5CXO A;  1K41 A;  2BMO B;  5CF2 A;  4XBT A;  5AIF A;  5AII A;  2A15 A;  1AV4 A;  3AMO B;  1RN7 A;  3G6E 3;  5CLK A;  3B4O A;  4WHA A;  1MOL A;  2E2V A;  1DMM A;  1O7W B;  1HKX A;  4HM2 B;  3X3Z A;  3LTA A;  5LC7 A;  1KSI A;  1Q42 A;  4WP5 A;  1IVX A;  4R4K A;  4X2H A;  3CNX A;  5STD A;  1A90 A;  5EQL A;  4BTX A;  2CKF B;  1W7C A;  3G4S 3;  3F8H A;  4OVM A;  3KII A;  1OF5 B;  1O7P B;  4HM3 B;  5IF6 A;  1VQM 3;  1RRH A;  1CQS A;  5DRV A;  3NQY A;  1FGO A;  1U8C B;  3D3L A;  2ZL8 A;  4R9L A;  5AEW B;  2BT3 A;  1WMP A;  4R80 A;  5IEN A;  2Z77 A;  3QRD A;  2XH9 A;  3U1W A;  2IUK A;  1QVF 2;  2OTL 3;  3KSP A;  3LH4 A;  1M1K 4;  4HZB B;  2INX A;  1K28 A;  1GD3 A;  2ZDJ A;  3B4P A;  1K73 4;  4KZ1 A;  3V92 A;  1NDO B;  3CC2 3;  4H61 A;  4O02 B;  1VQ9 3;  5KP1 A;  1ASK A;  3I0Y A;  1OPY A;  1OGZ A;  4MMY B;  2W9P A;  3D9R A;  2BMR B;  2YFI B;  2YFL B;  3BLZ A;  3MG1 A;  3OWY A;  3GZX B;  3MHE A;  2P38 A;  3EX9 A;  1JN5 A;  2PZV A;  6STD A;  1IU7 A;  1O7N B;  1JV2 B;  1K8A 4;  1LXE A;  5IG3 A;  1IVW A;  1J2B A;  4ZM8 A;  2Y74 A;  2QEX 3;  3CMA 3;  1VQK 3;  3EF8 A;  3F7S A;  4U13 A;  4XM4 A;  1O7H B;  1RRL A;  1SJW A;  3FG4 A;  4K61 A;  1FUW A;  1Q40 B;  1VQN 3;  4GL6 A;  1QVG 2;  2BHM A;  4J8T A;  4TX4 A;  1ISK A;  3UB1 A;  1JKG A;  3PS8 A;  2ML5 A;  1ZO2 A;  1C7H A;  3IMA B;  3UL5 A;  3DGL A;  1IV9 A;  2ML6 A;  3X41 A;  1KC8 4;  1EG9 B;  1W2Z A;  2BNG A;  1NU3 A;  5A0O B;  3FLJ A;  1IQX A;  3BND A;  3N8B A;  2W56 A;  3GZY B;  2HMK B;  4RNY A;  5EEO A;  1YJW 3;  4AEQ A;  4AKY A;  3NBJ A;  1IT8 A;  2GEY A;  2JQ5 A;  2P0X A;  2QIY A;  4O2H A;  4JF8 A;  4XB5 A;  1W6G A;  4MMZ B;  3BB9 A;  4WYK A;  3TDG A;  5JPU A;  3CCL 3;  4LGQ A;  3E99 A;  4LMI A;  1GYB A;  3ER7 A;  3K9M C;  1NB3 I;  2GBW B;  1IK3 A;  1IQY A;  1OCV A;  4BTY A;  3RGA A;  3WOD G;  3CCM 3;  3T8U A;  3G71 3;  2CWT A;  3H51 A;  3NX0 A;  3GAX A;  3CPW 2;  2KRT A;  1CYU A;  3MG3 A;  2XGL A;  4RZM A;  1M1X B;  3O8Y A;  1TUH A;  4QWT A;  4AKZ A;  3PYJ A;  3EBY A;  1NWW A;  2WGO A;  1QAL A;  3FG1 A;  3MSO A;  3KN4 A;  3N54 B;  2WOH A;  1W5Z A;  1OH0 A;  4O8S A;  1O7M B;  1DMN A;  1JB5 A;  3U97 A;  1OGX A;  3HX8 A;  1UI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...