4WWUC

Structure of mex67:mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
165
Chain Sequence
MVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPIQMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDSLLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA export factor MEX67
publication title Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 37
structure length 165
sequence length 177
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wwuC00
5AIGA 3OWYA 4XBTA 5AIIA 4U13A 4XM4A 4XDVA 2IMJA 5BXQA 3NV0A 3DMCA 2HMKB 5JPUA 1OCVA 2BMRB 2HMLB 2CHCA 2HMOB 1STDA 4IIAA 3BLZA 4HM8B 3JUNA 2B24B 3NXJA 3OWUA 2Z77A 1O7MB 5AIFA 1O7WB 5FW5A 1ASKA 4HZBB 4HVNA 1JKGB 2YFLB 4HM4B 3EF8A 2W2CA 3OWSA 2YFIB 5IG3A 2BMQB 5CXOA 1BUQA 4H3UA 1SJWA 1IDPA 4L8OA 5DREA 4R9KA 2GBWB 2R4IA 1JN5B 4X2HA 3FH1A 3KSPA 4FCJA 1VZZA 1DMNA 4HM7B 1QMAA 2BNGA 4OUQA 1W00A 1JB4A 2QIYA 5IG4A 5CF1A 1U5OA 5BVBA 3GZRA 4XBXA 3EX9A 1O7HB 3FF0A 1W02A 3EC9A 4WWUC 2GXFA 3GZBA 3STDA 1TP6A 3NHXA 1O7PB 1Z1SA 5JPPA 3A76A 5D83A 2K54A 1JB2A 4XBYA 5KP3A 4STDA 3HX8A 3M8CA 1E97A 5CK6A 3ER7A 3GRDA 3H3HA 4X2OA 3EJVA 3ECFA 1QJGA 3UNLA 3VSYA 4HJLB 1O7NB 3NUVA 4FCMA 3NV0B 3OXAA 5IENA 2F99A 3FZWA 3B4OA 3D9RA 5AEWB 2CKFB 4J8TA 3F8XA 3HK4A 4I4KA 5G2GA 1S5AA 3JUQA 3OX9A 3WMDA 1OHOA 5HGRA 1TUHA 4CDLA 3F7SA 1OHSA 1DMMA 1NWWA 3T8NA 7STDA 2HMJB 3GWRA 1NU3A 4WYKB 5IEPA 3EN1B 3BB9A 1Q42A 3KZTA 3DXOA 3F14A 3NBRA 3MKIA 2OWPA 5DRVA 4J9AA 2QGUA 1JKGA 4HKVB 1ISKA 4LMIA 1HKXA 3GZYB 5KP4A 2B1XB 3SOYA 3B4PA 1AR0A 4HM5B 5STDA 4HM6B 5CF2A 2STDA 3ROBA 3EQQB 4HM3B 4XB5A 1WQLB 5IEOA 1GY7A 5TGNA 3KE7A 5IERA 3IPTA 4XDWA 3HZPA 1OPYA 1ULIB 1Q40A 2RGQA 5D81A 3DUKA 4L7KA 1OGXA 3EHCA 1EA2A 2JQ5A 2Z76A 4MJDA 1OF5A 5KP1A 3FKAA 2Z7AA 3F7XA 3MYTA 1W01A 3K7CA 2GEYA 1O7GB 2BMOB 1GY5A 1ZX2A 5IG5A 1OHPA 3E99A 2F98A 2YFJB 3T8UA 3MG1A 4RZMA 2XSHB 3F9SA 2UX0A 1GY6A 3UJMA 3G8ZA 2HMMB 4HM1B 4R9LA 3FLJA 2XSOB 4KVHA 3FF2A 1JB5A 2I9WA 5CLKA 4K1UA 5AEUB 2XR8B 3K0ZA 1EG9B 5AIHA 1CQSA 4LEHA 2HMNB 5AI1A 4OVMA 3MG2A 1DMQA 3EBTA 3FGYA 1ZO2A 3VGNA 5D82A 3JUPA 3B8LA 4N3VA 4GB5A 1OUNA 3F40A 2PZVA 2F86B 3LYGA 4WYKA 6STDA 3SEDA 3G16A 3G0KA 3B7CA 8CHOA 3EN8A 1OH0A 4WP5A 2RFRA 3FSDA 4ORLA 3DM8A 3MG3A 4K1VA 3SOAA 4R1KA 1NDOB 1JN5A 3CNXA 3EBYA 1W6YA 1E3RA 3F8HA 4HM0B 4HM2B 1OGZA 3CPOA 4L8PA 2INXA 3CNMA 1K41A 1Q40B 3NM2A 3RGAA 1UUVB 3I0YA 4HZ9B 3DZLA 4LGQA 3CU3A 1OF5B 1ULJB 2GEXA 3KKGA 3S5CA 5IF6A 3Q90A 3MSOA 3JUMA 1UUWB 1E3VA 3LZAA 5IG0A 3OV4A 4PEJA 2XRXB 1C7HA 1GS3A 3GZXB 3RGRA 5EVHA 2GBXB 2A15A 1GYBA 3H51A 3MHEA 3JUOA 4Q53A 1A2KA 2RCDA
chains in the Genus database with same CATH superfamily
5AIGA 1A2VA 3GSPA 1MGWA 3D79A 3OWYA 2CWUA 1K734 2WO0A 4XBTA 5AIIA 1RMSA 4U13A 1AY7A 1HU9A 2P05A 3DH2A 4CJNA 4XM4A 4XDVA 2IMJA 1IVVA 1DYUA 5BXQA 4FMBA 4N6LA 1GMRA 3NV0A 2P0MA 3DMCA 1W2B2 2HMKB 2Y74A 1JV2B 4LYLB 4MMYB 3X40A 2CWVA 1K9M4 1W2ZA 4IT7A 2WGQA 3D3LA 4IPBA 1OCVA 1TIJA 4N6UA 2BMRB 4TX4A 3WA2X 4EV2A 1HYFA 5JPUA 2ZHXB 3ZFZA 1V58A 2HMLB 3IJEB 3CCU3 1KQS2 2CHCA 2HMOB 1STDA 1TU5A 3LTDA 1QVG2 1UGHI 4IIAA 3BLZA 4HM8B 2RBIA 1WMOA 1UGIA 5FGOA 3K63A 3JUNA 4HYZA 1YIT3 2B24B 3NXJA 1GMPA 1RSNA 2XGLA 3OWUA 2CFWA 2Z77A 1O7MB 1FA3A 1FUTA 3K5TA 1D6YA 5AIFA 4RNYA 1MWUA 1O7WB 1T2HA 5FW5A 3LMLA 1ASKA 1SIHA 4HZBB 4HVNA 1JKGB 3DGYA 1IVXA 1K28A 2YFLB 1FYSA 4HM4B 1BRSA 3EF8A 1OACA 2W2CA 1MWTA 3EE1A 3NBBA 3OWSA 4BTXA 2YFIB 4FMDA 1CH0A 3MWZA 2H0IA 1L5GB 5IG3A 1B2MA 1BNEA 2BMQB 5EQLA 5CXOA 1IQ8A 2PNCA 1BUQA 2KAAA 4H3UA 1PYLA 1SJWA 2UUGC 1Q824 1IT8A 4RBNA 1QALA 2OOVA 1CYVA 4RNZA 1STFI 1Q814 1IDPA 2IYJA 4L8OA 1BSDA 2Q07A 4K61A 1J2BA 1N9EA 5DREA 3KCHA 1I0XA 3SLUA 4R9KA 2GBWB 2R4IA 2QEX3 1JN5B 4X2HA 3RNTA 1BNSA 3FH1A 3KSPA 1BAOA 3PGBA 4FCJA 3LTBA 1BOXA 1VZZA 3U1WA 1DMNA 2GU1A 2W6JH 2AADA 4HM7B 4MMZB 2K0MA 4GL6A 1VQ43 2C10A 4BTWA 1QMAA 2BNGA 4OUQA 1M9GA 3AMOA 1W00A 2XF3A 1JB4A 2QIYA 8RNTA 5CF1A 5IG4A 1U5OA 2W03A 1RGAA 1QAKA 5BVBA 3GZRA 1DE3A 4XBXA 3EX9A 3CME3 3BNBA 1O7HB 3FF0A 7RNTA 1W02A 1YVBI 1RKYA 1B20A 3I563 1VQQA 4EC6A 3EC9A 1BNJA 4G1MB 4OK0A 4WWUC 1YI23 1LRAA 1VQN3 2GXFA 3O8YA 1RNBA 3GZBA 1BRKA 3Q1CA 3STDA 1TP6A 1D6UA 1BRGA 3S29A 2CIUA 1EKMA 2CC3A 1Q864 3NHXA 1GOYA 1FUSA 2UGIA 1O7PB 1M1K4 1Z1SA 3URPA 5JPPA 2XGNA 3CCL3 1QVF2 3X3XA 1BGSA 3A76A 1IT7A 2K54A 5D83A 1JB2A 2V1LA 1LNHA 1RGGA 4XBYA 4STDA 5KP3A 3HX8A 3JVCA 2CG1A 2FNQA 1I2EA 3BNCA 1N5HA 3M8CA 1E97A 5CK6A 3HIGA 3ER7A 1B21A 3GRDA 3H3HA 1RGLA 3ZG0A 3K9MC 1RN1A 5G1KA 3NBJA 5A0OB 1NB5I 2F56A 1RJOA 3J7Yd 5JBSA 3G4S3 2SARA 4AEQA 2WOHA 1EQKA 3RDEA 2FXTA 3QK9A 4X2OA 1I0VA 2F5MA 2KF6A 3EJVA 3V92A 1BSEA 2R41A 1MOLA 1QJGA 3ECFA 3UNLA 2E2VA 3VSYA 1AV4A 4HJLB 1JRQA 1X1UA 3N9HA 3CXC2 2MC8A 3WOEB 1O7NB 1JZOA 3NUVA 4FCMA 3NV0B 3OXAA 3V98A 4LSOA 2KF3A 5IENA 1VQ93 2F99A 3FZWA 3B4OA 3PZWA 1YGWA 1RN4A 1VQM3 3D9RA 5AEWB 5BU4A 3MPHA 4WHAA 1BNRA 2CKFB 1US1A 1WMPA 1RCLA 3CCR3 2W0QA 4FCZA 1IV9A 1LOXA 4J8TA 3F8XA 3HK4A 1BNFA 4I4KA 3Q3FA 3PCRA 3HOHA 3KN4A 1IV7A 5G2GA 2P0XA 1A2PA 1LQGC 1UUGB 4KZ1A 3A5EA 2KF4A 1S5AA 3PS8A 2ZA4A 3BU4A 4N6TA 1F8NA 4KFEA 3UL5A 4N6MA 1CYUA 3DGLA 3DY5A 4O3VA 1JBTA 3JUQA 2BT3A 3OX9A 3WMDA 1NB3I 1B3SA 1RNTA 1OHOA 1TFOA 4FMCA 4NHFA 5HGRA 4H61A 1JNQA 3U97A 1TUHA 4CDLA 2OTL3 4NPBA 3F7SA 1M1XB 2XH9A 3CCJ3 4FMAA 1B2ZA 1OHSA 1VQP3 1W5ZA 1M904 1DMMA 1NWWA 3T8NA 1X1XA 7STDA 2P38A 2HMJB 3GWRA 1NU3A 4WYKB 5IEPA 1TJDA 4N6V0 3S27A 3EN1B 3BB9A 1Q42A 1TRQA 3KZTA 1FGQA 1B2XA 2CX1A 1UI8A 2XFSA 3DXOA 3CPW2 2ML5A 3F14A 2CFDA 3NBRA 1BNIA 1JBRA 3MKIA 1I3FA 4N6NB 1TFKA 4LZIA 1UCIA 2SBLA 1BSBA 1YIJ3 2OWPA 4K90B 3CCE3 1RDSA 1X1WA 2D42A 2O9UX 5DRVA 1UCKA 6RNTA 4J9AA 2W56A 2QGUA 2IA7A 3X3YA 3BNDA 5M1AA 4ZM8A 1JKGA 1MGRA 4HKVB 5LC6A 1NNVA 1R4CA 4JF8A 1I70A 3X41A 1ISKA 1LNIA 4LMIA 1GD4A 3ZG5A 1HKXA 3AMOB 1YVSA 1RHLA 4DKIA 3GZYB 3CMA3 2QA43 5EEOA 3CCV3 3FG3A 2CX0A 4KFFA 1VQ83 5KP4A 2B1XB 4GSPA 1PFPA 1BSAA 1T2IA 2GU3A 3LT8A 3SOYA 3B4PA 2O3OA 3BNEA 2OQEA 1AR0A 1IQXA 1Q7Y4 1AQZA 4HM5B 3OW22 2W04A 5STDA 4HM6B 5CF2A 4HOHA 2OOVC 4BU4A 3UL6A 2STDA 2CK3H 4N6OB 1DVCA 2H0GA 3ROBA 1VQ73 4I5QA 2MF7A 3EQQB 4HM3B 1WQLB 4XB5A 5IEOA 1GOUA 5GSPA 1V74A 2CFKA 1GY7A 1LOYA 5LC7A 1FGMA 3S28A 2KXGA 4AKZA 1RGEA 1UDII 5TGNA 3KE7A 5IERA 1GOVA 3LT9A 1YNVX 3IPTA 1T3BA 2BHMA 4RNTA 3CC23 3SXXA 1CEWI 1BRJA 3LXUX 4XDWA 2OTJ3 2WOFA 1T5YA 3HZPA 1LVNA 1V57A 1QAFA 1SARA 3KSED 4EXRA 2L4VA 1Q7HA 1OPYA 1ULIB 1FUWA 5AYRB 3G6E3 1Q40A 1IYYA 1BRIA 1X1YA 3X3ZA 3N54B 3PXMA 2RGQA 5ELUA 1LXEA 2KRTA 5D81A 2IUJA 1A90A 1C54A 4KT3B 1DVDA 1AVLA 1YHQ3 4MEIA 3DUKA 4L7KA 2D1WA 3FCSB 3D5GA 3L0RA 1ZS7A 1YGEA 1OGXA 3EHCA 1EA2A 1A67A 2JQ5A 2Z76A 4BIRA 3IMAB 4MJDA 1OF5A 3QRDA 1FGOA 1BRNL 2CG0A 1VQO3 3PYJA 5KP1A 1RGCA 3FKAA 2Z7AA 3KIIA 3F7XA 4GHOA 1EEJA 3MYTA 3X42A 3D5IA 3LTCA 4EYCA 2KF5A 1W01A 1FW7A 1BANA 1IVWA 2BIRA 3K7CA 2GEYA 3CC73 3NM7A 1O7GB 1W4NA 1RGHA 4NREA 1WTHA 3CCQ3 1N8R4 1SIIA 2OCTA 2BMOB 1GY5A 1ZX2A 1TRPA 1WNHA 3G713 3KFQC 5IG5A 1OHPA 3DGOA 1YJ93 3E99A 2F98A 2YFJB 3T8UA 3MG1A 1I8VA 1RGFA 4EBGA 5I97A 1YJN3 3AGOA 1HZ1A 1WMNA 2Z6BA 4RZMA 1R4YA 1LOVA 1G02A 1RRLA 2IUKA 1MWRA 1BIRA 2UX0A 2XSHB 3F9SA 3PCSA 1GY6A 3WR2A 1IU7A 2Y73A 3UJMA 3WDGB 2CFLA 3G8ZA 2HMMB 1UI7A 1S723 1PY3A 4HM1B 1ROAA 1RN7A 3DGMA 5G1LA 4R9LA 3V99A 4KFDA 1IVUA 3FLJA 1FGTA 1BRHA 5IW9A 2E2UA 1LQMB 2JDIH 1KWIA 1DETA 1N5PA 1UW1A 2XSOB 3NQZA 3FF2A 4KVHA 1JZDA 1PU4A 1I2FA 1KD14 1JB5A 1B2UA 1U8CB 2E2TA 2I9WA 3WOFB 5CLKA 4K1UA 2P09A 2HOHA 5AEUB 2J8XB 5M18A 2FGTA 2XR8B 3K0ZA 1EG9B 4FR9A 5AIHA 1CQSA 4LEHA 2HMNB 6GSPA 5AI1A 1BVIA 1W6GA 2H0HA 2CWTA 3ALAA 4OVMA 1I2GA 2AAEA 4O8SA 3MG2A 1DMQA 3EBTA 1KC84 1RLSA 3FGYA 1B27A 1ZO2A 2W56B 3VGNA 5D82A 1VQL3 3CCM3 1D6ZA 2BO9B 1I3IA 1W7CA 3N8BA 4WFOA 3D4AA 3CC43 3JUPA 3VF1A 1N9JA 3B8LA 4N3VA 3CD63 1BU4A 1BNGA 2ZL8A 1ZGXA 4GB5A 4HAAA 3SVAA 3AHWA 1GMQA 4BL3A 1OUNA 1MWSA 3F40A 2PZVA 2F86B 3FG1A 3LYGA 4WYKA 3AGNA 6STDA 4JRFA 3SEDA 3G16A 1RRHA 2F4YA 2C11A 3LTAA 3G0KA 4ILFA 2CW9A 4AKYA 1UCJA 3B7CA 1FGRA 1NJI4 1N8QA 8CHOA 1RTUA 3EN8A 3NX0A 1OH0A 4WP5A 1SQWA 4J5KA 2BU4A 2K3DA 2RFRA 4EW5A 3FSDA 3TDGA 4ORLA 3DM8A 3MG3A 1G0TA 1LOWA 4K1VA 3SOAA 4BTYA 1JJ22 4R1KA 1NDOB 1W6CA 3WHOA 1ROVA 1IQYA 1JN5A 3CNXA 3EBYA 2KCDA 4O2HA 3HIIA 2LQVA 1W6YA 2CH9A 1UCLA 2M7OA 1IK3A 3LOYA 3WODG 1E3RA 1K8A4 1VQ53 3F8HA 2W9QA 4HM0B 4HM2B 1OGZA 3CPOA 4L8PA 2WGOA 2ML6A 2RNTA 1B2SA 2INXA 3AHSA 1FZUA 1VQK3 3CNMA 1K41A 1Q40B 3NM2A 3RGAA 1GSPA 1UUVB 4R80A 4QWTA 3CCS3 1NO3A 2GSPA 4BL2A 2OQEC 3I0YA 1YJW3 4J5GA 4HZ9B 1GD3A 3DZLA 3S67A 1RCKA 4LGQA 9RNTA 1SPUA 3CU3A 1OF5B 4CPKA 3T0UA 4CCVA 1ULJB 5AYSC 2C4BA 2GEXA 3KKGA 2YX9A 3S5CA 3HI7A 3UB1A 4MMXB 5BIRA 5IF6A 3Q90A 3SYUA 2ZDJA 2RSXA 3JUMA 3MSOA 1JBSA 1Q9EA 1UUWB 2W9PA 1E3VA 1AVKA 3Q2PA 4HBRA 1TTOA 3BIRA 3FG4A 3LZAA 5IG0A 5M19A 3OV4A 1BUJA 3GAXA 2IY2A 2XRXB 4PEJA 1C7HA 1KSIA 4O02B 5RNTA 1GS3A 3GZXB 3RGRA 2XEPA 2XFTA 1EUIC 4EV5A 1G96A 1RGKA 1Y4KA 3LH4A 5EVHA 2GBXB 2A15A 2CFGA 4R4KA 2L1SA 1MNLA 2F5WA 2LYXA 1GYBA 3SX1A 3H51A 5ELJA 1VQ63 1BSCA 5HOHA 3I553 3EB8A 3JUOA 3MHEA 3NQYA 4Q53A 1A2KA 3DGNA 7GSPA 2RCDA 3WA3A
chains in the Genus database with same CATH topology
5AIGA 1A2VA 3OWYA 2CWUA 1K734 2WO0A 4XBTA 5AIIA 4U13A 1HU9A 2P05A 4XM4A 4XDVA 2IMJA 1IVVA 1DYUA 5BXQA 4FMBA 4N6LA 3NV0A 2P0MA 3DMCA 1W2B2 2HMKB 2Y74A 1JV2B 4MMYB 3X40A 1K9M4 2CWVA 1W2ZA 4IT7A 2WGQA 3D3LA 4IPBA 1OCVA 1TIJA 4N6UA 2BMRB 4TX4A 3WA2X 4EV2A 5JPUA 2HMLB 3IJEB 3CCU3 1KQS2 2CHCA 2HMOB 1STDA 1TU5A 3LTDA 1QVG2 4IIAA 3BLZA 4HM8B 1WMOA 5FGOA 3K63A 3JUNA 4HYZA 1YIT3 2B24B 3NXJA 3OWUA 1FA3A 2XGLA 2CFWA 2Z77A 1O7MB 3K5TA 1D6YA 5AIFA 4RNYA 1O7WB 5FW5A 3LMLA 1ASKA 1SIHA 4HZBB 4HVNA 1JKGB 1IVXA 1K28A 2YFLB 4HM4B 3EF8A 1OACA 2W2CA 3EE1A 3NBBA 3OWSA 4BTXA 2YFIB 4FMDA 3MWZA 1L5GB 5IG3A 2BMQB 5EQLA 5CXOA 1IQ8A 2PNCA 1BUQA 4H3UA 1SJWA 1Q824 1IT8A 4RBNA 1QALA 2OOVA 1CYVA 4RNZA 1STFI 1Q814 1IDPA 4L8OA 2Q07A 4K61A 1J2BA 1N9EA 5DREA 3SLUA 4R9KA 2GBWB 2R4IA 2QEX3 1JN5B 4X2HA 3FH1A 3KSPA 3PGBA 4FCJA 3LTBA 1VZZA 3U1WA 1DMNA 2GU1A 2W6JH 4HM7B 4MMZB 2K0MA 4GL6A 1VQ43 2C10A 4BTWA 1QMAA 2BNGA 4OUQA 1M9GA 3AMOA 1W00A 2XF3A 1JB4A 2QIYA 5IG4A 5CF1A 1U5OA 2W03A 1QAKA 5BVBA 3GZRA 4XBXA 3EX9A 3CME3 3BNBA 1O7HB 3FF0A 1RKYA 1W02A 1YVBI 3I563 1VQ53 4EC6A 3EC9A 4OK0A 4G1MB 4WWUC 1YI23 1VQN3 2GXFA 3O8YA 3GZBA 3Q1CA 3STDA 1TP6A 1D6UA 3S29A 2CIUA 1EKMA 2CC3A 1Q864 3NHXA 1O7PB 1M1K4 1Z1SA 5JPPA 2XGNA 3CCL3 1QVF2 3X3XA 3A76A 5D83A 1IT7A 2K54A 1JB2A 2V1LA 1LNHA 4XBYA 5KP3A 4STDA 3HX8A 3JVCA 2CG1A 2FNQA 3BNCA 1N5HA 3M8CA 1E97A 5CK6A 3HIGA 3ER7A 3GRDA 3H3HA 3K9MC 3NBJA 5A0OB 1NB5I 1RJOA 3J7Yd 5JBSA 3G4S3 4AEQA 2WOHA 1EQKA 3RDEA 2FXTA 3QK9A 4X2OA 3V92A 1DVDA 3EJVA 3ECFA 1MOLA 1QJGA 3UNLA 2E2VA 3VSYA 1AV4A 4HJLB 1JRQA 3N9HA 3CXC2 2MC8A 3WOEB 1O7NB 3NUVA 4FCMA 3NV0B 3OXAA 3V98A 4LSOA 1VQ93 5IENA 2F99A 3FZWA 3B4OA 3PZWA 1VQM3 3D9RA 5AEWB 3MPHA 4WHAA 2CKFB 1US1A 1WMPA 3CCR3 2W0QA 4FCZA 1IV9A 1LOXA 4J8TA 3F8XA 3HK4A 4I4KA 3PCRA 3KN4A 1IV7A 5G2GA 2P0XA 4KZ1A 1S5AA 3PS8A 4N6TA 1F8NA 4KFEA 3UL5A 4N6MA 1CYUA 3DGLA 3DY5A 4O3VA 3JUQA 2BT3A 3OX9A 3WMDA 1NB3I 1OHOA 1TFOA 4FMCA 4NHFA 5HGRA 4H61A 1JNQA 3U97A 1TUHA 4CDLA 2OTL3 3F7SA 1M1XB 2XH9A 3CCJ3 4FMAA 1OHSA 1VQP3 1W5ZA 1M904 1DMMA 1NWWA 3T8NA 7STDA 2P38A 2HMJB 3GWRA 1NU3A 4WYKB 5IEPA 4N6V0 3S27A 3EN1B 3BB9A 1Q42A 3KZTA 1FGQA 2XFSA 1UI8A 3DXOA 3CPW2 2ML5A 3F14A 2CFDA 3NBRA 3MKIA 4N6NB 1TFKA 4LZIA 2SBLA 1YIJ3 2OWPA 4K90B 3CCE3 2D42A 2O9UX 5DRVA 4J9AA 2W56A 2QGUA 2IA7A 3X3YA 3BNDA 4ZM8A 1JKGA 4HKVB 5LC6A 1R4CA 4JF8A 3X41A 1ISKA 4LMIA 1GD4A 1HKXA 3AMOB 3GZYB 3CMA3 2QA43 5EEOA 3CCV3 3FG3A 4KFFA 1VQ83 5KP4A 2B1XB 1PFPA 2GU3A 3LT8A 3SOYA 3B4PA 2O3OA 3BNEA 2OQEA 1IQXA 1AR0A 1Q7Y4 4HM5B 3OW22 2W04A 5STDA 4HM6B 5CF2A 2OOVC 3UL6A 2STDA 2CK3H 4N6OB 1DVCA 3ROBA 1VQ73 2MF7A 3EQQB 4HM3B 1WQLB 4XB5A 5IEOA 1V74A 2CFKA 1GY7A 5LC7A 1FGMA 3S28A 2KXGA 4AKZA 5TGNA 3KE7A 5IERA 3LT9A 3IPTA 2BHMA 3CC23 3SXXA 1CEWI 2OTJ3 3LXUX 4XDWA 2WOFA 1T5YA 3HZPA 1LVNA 1QAFA 3KSED 4EXRA 2L4VA 1OPYA 1ULIB 1FUWA 5AYRB 3G6E3 1Q40A 3X3ZA 3N54B 3PXMA 2RGQA 5ELUA 1LXEA 2KRTA 5D81A 2IUJA 1A90A 1AVLA 1YHQ3 4MEIA 3DUKA 4L7KA 2D1WA 3FCSB 3L0RA 1YGEA 1OGXA 3EHCA 1EA2A 1A67A 2JQ5A 2Z76A 3IMAB 4MJDA 1OF5A 3QRDA 1FGOA 2CG0A 1VQO3 3PYJA 5KP1A 3FKAA 2Z7AA 3KIIA 3F7XA 3MYTA 3X42A 3LTCA 4EYCA 1W01A 1IVWA 3K7CA 2GEYA 3CC73 3NM7A 1O7GB 1W4NA 4NREA 1WTHA 3CCQ3 1N8R4 1SIIA 2OCTA 2BMOB 1GY5A 1ZX2A 1WNHA 3G713 3KFQC 5IG5A 1OHPA 3DGOA 1YJ93 3E99A 2F98A 2YFJB 3T8UA 3MG1A 4EBGA 5I97A 1YJN3 1WMNA 2Z6BA 4RZMA 1RRLA 2IUKA 2XSHB 2UX0A 3F9SA 3PCSA 1GY6A 2Y73A 1IU7A 3UJMA 3WDGB 2CFLA 3G8ZA 2HMMB 1UI7A 1S723 4HM1B 1ROAA 1RN7A 3DGMA 4R9LA 3V99A 4KFDA 1IVUA 3FLJA 1FGTA 5IW9A 2E2UA 2JDIH 1KWIA 1N5PA 1UW1A 2XSOB 3NQZA 3FF2A 4KVHA 1PU4A 1KD14 1JB5A 2I9WA 1U8CB 2E2TA 3WOFB 5CLKA 4K1UA 2P09A 5AEUB 2FGTA 2XR8B 3K0ZA 1EG9B 4FR9A 5AIHA 1CQSA 4LEHA 2HMNB 5AI1A 1W6GA 2CWTA 3ALAA 4OVMA 4O8SA 3MG2A 1DMQA 3EBTA 1KC84 3FGYA 1ZO2A 2W56B 3VGNA 5D82A 1VQL3 3CCM3 1D6ZA 2BO9B 1W7CA 3N8BA 4WFOA 3CC43 3JUPA 3VF1A 1N9JA 3B8LA 4N3VA 3CD63 2ZL8A 4GB5A 3SVAA 1OUNA 3F40A 2PZVA 2F86B 3FG1A 3LYGA 4WYKA 6STDA 4JRFA 3SEDA 3G16A 1RRHA 3LTAA 2C11A 3G0KA 2CW9A 4AKYA 3B7CA 1FGRA 1NJI4 1N8QA 8CHOA 3EN8A 3NX0A 1OH0A 4WP5A 1SQWA 2RFRA 3FSDA 3TDGA 4ORLA 3DM8A 3MG3A 4K1VA 3SOAA 4BTYA 1JJ22 4R1KA 1NDOB 1W6CA 1ROVA 1IQYA 1JN5A 3CNXA 3EBYA 2KCDA 4O2HA 3HIIA 2LQVA 1W6YA 2CH9A 2M7OA 1IK3A 3LOYA 3WODG 1E3RA 1K8A4 3F8HA 2W9QA 4HM0B 4HM2B 1OGZA 3CPOA 4L8PA 2WGOA 2ML6A 2INXA 1VQK3 3CNMA 1K41A 1Q40B 3NM2A 3RGAA 1UUVB 4R80A 4QWTA 3CCS3 1NO3A 2OQEC 3I0YA 1YJW3 4HZ9B 1GD3A 3DZLA 3S67A 4LGQA 1SPUA 3CU3A 1OF5B 3T0UA 4CCVA 1ULJB 5AYSC 2GEXA 3KKGA 2YX9A 3S5CA 3HI7A 3UB1A 4MMXB 5IF6A 3Q90A 2ZDJA 2RSXA 3JUMA 3MSOA 1UUWB 2W9PA 1E3VA 1AVKA 3Q2PA 4HBRA 3FG4A 3LZAA 5IG0A 3OV4A 3GAXA 4PEJA 2XRXB 1C7HA 1KSIA 4O02B 1GS3A 3GZXB 3RGRA 2XEPA 2XFTA 4EV5A 1G96A 3LH4A 1Y4KA 5EVHA 2GBXB 2A15A 2CFGA 4R4KA 1MNLA 2LYXA 1GYBA 3SX1A 3H51A 5ELJA 1VQ63 3I553 3EB8A 3JUOA 3MHEA 3NQYA 4Q53A 1A2KA 3DGNA 2RCDA 3WA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIG A;  3OWY A;  4XBT A;  5AII A;  4U13 A;  4XM4 A;  4XDV A;  2IMJ A;  5BXQ A;  3NV0 A;  3DMC A;  2HMK B;  5JPU A;  1OCV A;  2BMR B;  2HML B;  2CHC A;  2HMO B;  1STD A;  4IIA A;  3BLZ A;  4HM8 B;  3JUN A;  2B24 B;  3NXJ A;  3OWU A;  2Z77 A;  1O7M B;  5AIF A;  1O7W B;  5FW5 A;  1ASK A;  4HZB B;  4HVN A;  1JKG B;  2YFL B;  4HM4 B;  3EF8 A;  2W2C A;  3OWS A;  2YFI B;  5IG3 A;  2BMQ B;  5CXO A;  1BUQ A;  4H3U A;  1SJW A;  1IDP A;  4L8O A;  5DRE A;  4R9K A;  2GBW B;  2R4I A;  1JN5 B;  4X2H A;  3FH1 A;  3KSP A;  4FCJ A;  1VZZ A;  1DMN A;  4HM7 B;  1QMA A;  2BNG A;  4OUQ A;  1W00 A;  1JB4 A;  2QIY A;  5IG4 A;  5CF1 A;  1U5O A;  5BVB A;  3GZR A;  4XBX A;  3EX9 A;  1O7H B;  3FF0 A;  1W02 A;  3EC9 A;  4WWU C;  2GXF A;  3GZB A;  3STD A;  1TP6 A;  3NHX A;  1O7P B;  1Z1S A;  5JPP A;  3A76 A;  5D83 A;  2K54 A;  1JB2 A;  4XBY A;  5KP3 A;  4STD A;  3HX8 A;  3M8C A;  1E97 A;  5CK6 A;  3ER7 A;  3GRD A;  3H3H A;  4X2O A;  3EJV A;  3ECF A;  1QJG A;  3UNL A;  3VSY A;  4HJL B;  1O7N B;  3NUV A;  4FCM A;  3NV0 B;  3OXA A;  5IEN A;  2F99 A;  3FZW A;  3B4O A;  3D9R A;  5AEW B;  2CKF B;  4J8T A;  3F8X A;  3HK4 A;  4I4K A;  5G2G A;  1S5A A;  3JUQ A;  3OX9 A;  3WMD A;  1OHO A;  5HGR A;  1TUH A;  4CDL A;  3F7S A;  1OHS A;  1DMM A;  1NWW A;  3T8N A;  7STD A;  2HMJ B;  3GWR A;  1NU3 A;  4WYK B;  5IEP A;  3EN1 B;  3BB9 A;  1Q42 A;  3KZT A;  3DXO A;  3F14 A;  3NBR A;  3MKI A;  2OWP A;  5DRV A;  4J9A A;  2QGU A;  1JKG A;  4HKV B;  1ISK A;  4LMI A;  1HKX A;  3GZY B;  5KP4 A;  2B1X B;  3SOY A;  3B4P A;  1AR0 A;  4HM5 B;  5STD A;  4HM6 B;  5CF2 A;  2STD A;  3ROB A;  3EQQ B;  4HM3 B;  4XB5 A;  1WQL B;  5IEO A;  1GY7 A;  5TGN A;  3KE7 A;  5IER A;  3IPT A;  4XDW A;  3HZP A;  1OPY A;  1ULI B;  1Q40 A;  2RGQ A;  5D81 A;  3DUK A;  4L7K A;  1OGX A;  3EHC A;  1EA2 A;  2JQ5 A;  2Z76 A;  4MJD A;  1OF5 A;  5KP1 A;  3FKA A;  2Z7A A;  3F7X A;  3MYT A;  1W01 A;  3K7C A;  2GEY A;  1O7G B;  2BMO B;  1GY5 A;  1ZX2 A;  5IG5 A;  1OHP A;  3E99 A;  2F98 A;  2YFJ B;  3T8U A;  3MG1 A;  4RZM A;  2XSH B;  3F9S A;  2UX0 A;  1GY6 A;  3UJM A;  3G8Z A;  2HMM B;  4HM1 B;  4R9L A;  3FLJ A;  2XSO B;  4KVH A;  3FF2 A;  1JB5 A;  2I9W A;  5CLK A;  4K1U A;  5AEU B;  2XR8 B;  3K0Z A;  1EG9 B;  5AIH A;  1CQS A;  4LEH A;  2HMN B;  5AI1 A;  4OVM A;  3MG2 A;  1DMQ A;  3EBT A;  3FGY A;  1ZO2 A;  3VGN A;  5D82 A;  3JUP A;  3B8L A;  4N3V A;  4GB5 A;  1OUN A;  3F40 A;  2PZV A;  2F86 B;  3LYG A;  4WYK A;  6STD A;  3SED A;  3G16 A;  3G0K A;  3B7C A;  8CHO A;  3EN8 A;  1OH0 A;  4WP5 A;  2RFR A;  3FSD A;  4ORL A;  3DM8 A;  3MG3 A;  4K1V A;  3SOA A;  4R1K A;  1NDO B;  1JN5 A;  3CNX A;  3EBY A;  1W6Y A;  1E3R A;  3F8H A;  4HM0 B;  4HM2 B;  1OGZ A;  3CPO A;  4L8P A;  2INX A;  3CNM A;  1K41 A;  1Q40 B;  3NM2 A;  3RGA A;  1UUV B;  3I0Y A;  4HZ9 B;  3DZL A;  4LGQ A;  3CU3 A;  1OF5 B;  1ULJ B;  2GEX A;  3KKG A;  3S5C A;  5IF6 A;  3Q90 A;  3MSO A;  3JUM A;  1UUW B;  1E3V A;  3LZA A;  5IG0 A;  3OV4 A;  4PEJ A;  2XRX B;  1C7H A;  1GS3 A;  3GZX B;  3RGR A;  5EVH A;  2GBX B;  2A15 A;  1GYB A;  3H51 A;  3MHE A;  3JUO A;  4Q53 A;  1A2K A;  2RCD A; 
#chains in the Genus database with same CATH topology
 5AIG A;  1A2V A;  3GSP A;  1MGW A;  3D79 A;  3OWY A;  2CWU A;  1K73 4;  2WO0 A;  4XBT A;  5AII A;  1RMS A;  4U13 A;  1AY7 A;  1HU9 A;  2P05 A;  3DH2 A;  4CJN A;  4XM4 A;  4XDV A;  2IMJ A;  1IVV A;  1DYU A;  5BXQ A;  4FMB A;  4N6L A;  1GMR A;  3NV0 A;  2P0M A;  3DMC A;  1W2B 2;  2HMK B;  2Y74 A;  1JV2 B;  4LYL B;  4MMY B;  3X40 A;  2CWV A;  1K9M 4;  1W2Z A;  4IT7 A;  2WGQ A;  3D3L A;  4IPB A;  1OCV A;  1TIJ A;  4N6U A;  2BMR B;  4TX4 A;  3WA2 X;  4EV2 A;  1HYF A;  5JPU A;  2ZHX B;  3ZFZ A;  1V58 A;  2HML B;  3IJE B;  3CCU 3;  1KQS 2;  2CHC A;  2HMO B;  1STD A;  1TU5 A;  3LTD A;  1QVG 2;  1UGH I;  4IIA A;  3BLZ A;  4HM8 B;  2RBI A;  1WMO A;  1UGI A;  5FGO A;  3K63 A;  3JUN A;  4HYZ A;  1YIT 3;  2B24 B;  3NXJ A;  1GMP A;  1RSN A;  2XGL A;  3OWU A;  2CFW A;  2Z77 A;  1O7M B;  1FA3 A;  1FUT A;  3K5T A;  1D6Y A;  5AIF A;  4RNY A;  1MWU A;  1O7W B;  1T2H A;  5FW5 A;  3LML A;  1ASK A;  1SIH A;  4HZB B;  4HVN A;  1JKG B;  3DGY A;  1IVX A;  1K28 A;  2YFL B;  1FYS A;  4HM4 B;  1BRS A;  3EF8 A;  1OAC A;  2W2C A;  1MWT A;  3EE1 A;  3NBB A;  3OWS A;  4BTX A;  2YFI B;  4FMD A;  1CH0 A;  3MWZ A;  2H0I A;  1L5G B;  5IG3 A;  1B2M A;  1BNE A;  2BMQ B;  5EQL A;  5CXO A;  1IQ8 A;  2PNC A;  1BUQ A;  2KAA A;  4H3U A;  1PYL A;  1SJW A;  2UUG C;  1Q82 4;  1IT8 A;  4RBN A;  1QAL A;  2OOV A;  1CYV A;  4RNZ A;  1STF I;  1Q81 4;  1IDP A;  2IYJ A;  4L8O A;  1BSD A;  2Q07 A;  4K61 A;  1J2B A;  1N9E A;  5DRE A;  3KCH A;  1I0X A;  3SLU A;  4R9K A;  2GBW B;  2R4I A;  2QEX 3;  1JN5 B;  4X2H A;  3RNT A;  1BNS A;  3FH1 A;  3KSP A;  1BAO A;  3PGB A;  4FCJ A;  3LTB A;  1BOX A;  1VZZ A;  3U1W A;  1DMN A;  2GU1 A;  2W6J H;  2AAD A;  4HM7 B;  4MMZ B;  2K0M A;  4GL6 A;  1VQ4 3;  2C10 A;  4BTW A;  1QMA A;  2BNG A;  4OUQ A;  1M9G A;  3AMO A;  1W00 A;  2XF3 A;  1JB4 A;  2QIY A;  8RNT A;  5CF1 A;  5IG4 A;  1U5O A;  2W03 A;  1RGA A;  1QAK A;  5BVB A;  3GZR A;  1DE3 A;  4XBX A;  3EX9 A;  3CME 3;  3BNB A;  1O7H B;  3FF0 A;  7RNT A;  1W02 A;  1YVB I;  1RKY A;  1B20 A;  3I56 3;  1VQQ A;  4EC6 A;  3EC9 A;  1BNJ A;  4G1M B;  4OK0 A;  4WWU C;  1YI2 3;  1LRA A;  1VQN 3;  2GXF A;  3O8Y A;  1RNB A;  3GZB A;  1BRK A;  3Q1C A;  3STD A;  1TP6 A;  1D6U A;  1BRG A;  3S29 A;  2CIU A;  1EKM A;  2CC3 A;  1Q86 4;  3NHX A;  1GOY A;  1FUS A;  2UGI A;  1O7P B;  1M1K 4;  1Z1S A;  3URP A;  5JPP A;  2XGN A;  3CCL 3;  1QVF 2;  3X3X A;  1BGS A;  3A76 A;  1IT7 A;  2K54 A;  5D83 A;  1JB2 A;  2V1L A;  1LNH A;  1RGG A;  4XBY A;  4STD A;  5KP3 A;  3HX8 A;  3JVC A;  2CG1 A;  2FNQ A;  1I2E A;  3BNC A;  1N5H A;  3M8C A;  1E97 A;  5CK6 A;  3HIG A;  3ER7 A;  1B21 A;  3GRD A;  3H3H A;  1RGL A;  3ZG0 A;  3K9M C;  1RN1 A;  5G1K A;  3NBJ A;  5A0O B;  1NB5 I;  2F56 A;  1RJO A;  3J7Y d;  5JBS A;  3G4S 3;  2SAR A;  4AEQ A;  2WOH A;  1EQK A;  3RDE A;  2FXT A;  3QK9 A;  4X2O A;  1I0V A;  2F5M A;  2KF6 A;  3EJV A;  3V92 A;  1BSE A;  2R41 A;  1MOL A;  1QJG A;  3ECF A;  3UNL A;  2E2V A;  3VSY A;  1AV4 A;  4HJL B;  1JRQ A;  1X1U A;  3N9H A;  3CXC 2;  2MC8 A;  3WOE B;  1O7N B;  1JZO A;  3NUV A;  4FCM A;  3NV0 B;  3OXA A;  3V98 A;  4LSO A;  2KF3 A;  5IEN A;  1VQ9 3;  2F99 A;  3FZW A;  3B4O A;  3PZW A;  1YGW A;  1RN4 A;  1VQM 3;  3D9R A;  5AEW B;  5BU4 A;  3MPH A;  4WHA A;  1BNR A;  2CKF B;  1US1 A;  1WMP A;  1RCL A;  3CCR 3;  2W0Q A;  4FCZ A;  1IV9 A;  1LOX A;  4J8T A;  3F8X A;  3HK4 A;  1BNF A;  4I4K A;  3Q3F A;  3PCR A;  3HOH A;  3KN4 A;  1IV7 A;  5G2G A;  2P0X A;  1A2P A;  1LQG C;  1UUG B;  4KZ1 A;  3A5E A;  2KF4 A;  1S5A A;  3PS8 A;  2ZA4 A;  3BU4 A;  4N6T A;  1F8N A;  4KFE A;  3UL5 A;  4N6M A;  1CYU A;  3DGL A;  3DY5 A;  4O3V A;  1JBT A;  3JUQ A;  2BT3 A;  3OX9 A;  3WMD A;  1NB3 I;  1B3S A;  1RNT A;  1OHO A;  1TFO A;  4FMC A;  4NHF A;  5HGR A;  4H61 A;  1JNQ A;  3U97 A;  1TUH A;  4CDL A;  2OTL 3;  4NPB A;  3F7S A;  1M1X B;  2XH9 A;  3CCJ 3;  4FMA A;  1B2Z A;  1OHS A;  1VQP 3;  1W5Z A;  1M90 4;  1DMM A;  1NWW A;  3T8N A;  1X1X A;  7STD A;  2P38 A;  2HMJ B;  3GWR A;  1NU3 A;  4WYK B;  5IEP A;  1TJD A;  4N6V 0;  3S27 A;  3EN1 B;  3BB9 A;  1Q42 A;  1TRQ A;  3KZT A;  1FGQ A;  1B2X A;  2CX1 A;  1UI8 A;  2XFS A;  3DXO A;  3CPW 2;  2ML5 A;  3F14 A;  2CFD A;  3NBR A;  1BNI A;  1JBR A;  3MKI A;  1I3F A;  4N6N B;  1TFK A;  4LZI A;  1UCI A;  2SBL A;  1BSB A;  1YIJ 3;  2OWP A;  4K90 B;  3CCE 3;  1RDS A;  1X1W A;  2D42 A;  2O9U X;  5DRV A;  1UCK A;  6RNT A;  4J9A A;  2W56 A;  2QGU A;  2IA7 A;  3X3Y A;  3BND A;  5M1A A;  4ZM8 A;  1JKG A;  1MGR A;  4HKV B;  5LC6 A;  1NNV A;  1R4C A;  4JF8 A;  1I70 A;  3X41 A;  1ISK A;  1LNI A;  4LMI A;  1GD4 A;  3ZG5 A;  1HKX A;  3AMO B;  1YVS A;  1RHL A;  4DKI A;  3GZY B;  3CMA 3;  2QA4 3;  5EEO A;  3CCV 3;  3FG3 A;  2CX0 A;  4KFF A;  1VQ8 3;  5KP4 A;  2B1X B;  4GSP A;  1PFP A;  1BSA A;  1T2I A;  2GU3 A;  3LT8 A;  3SOY A;  3B4P A;  2O3O A;  3BNE A;  2OQE A;  1AR0 A;  1IQX A;  1Q7Y 4;  1AQZ A;  4HM5 B;  3OW2 2;  2W04 A;  5STD A;  4HM6 B;  5CF2 A;  4HOH A;  2OOV C;  4BU4 A;  3UL6 A;  2STD A;  2CK3 H;  4N6O B;  1DVC A;  2H0G A;  3ROB A;  1VQ7 3;  4I5Q A;  2MF7 A;  3EQQ B;  4HM3 B;  1WQL B;  4XB5 A;  5IEO A;  1GOU A;  5GSP A;  1V74 A;  2CFK A;  1GY7 A;  1LOY A;  5LC7 A;  1FGM A;  3S28 A;  2KXG A;  4AKZ A;  1RGE A;  1UDI I;  5TGN A;  3KE7 A;  5IER A;  1GOV A;  3LT9 A;  1YNV X;  3IPT A;  1T3B A;  2BHM A;  4RNT A;  3CC2 3;  3SXX A;  1CEW I;  1BRJ A;  3LXU X;  4XDW A;  2OTJ 3;  2WOF A;  1T5Y A;  3HZP A;  1LVN A;  1V57 A;  1QAF A;  1SAR A;  3KSE D;  4EXR A;  2L4V A;  1Q7H A;  1OPY A;  1ULI B;  1FUW A;  5AYR B;  3G6E 3;  1Q40 A;  1IYY A;  1BRI A;  1X1Y A;  3X3Z A;  3N54 B;  3PXM A;  2RGQ A;  5ELU A;  1LXE A;  2KRT A;  5D81 A;  2IUJ A;  1A90 A;  1C54 A;  4KT3 B;  1DVD A;  1AVL A;  1YHQ 3;  4MEI A;  3DUK A;  4L7K A;  2D1W A;  3FCS B;  3D5G A;  3L0R A;  1ZS7 A;  1YGE A;  1OGX A;  3EHC A;  1EA2 A;  1A67 A;  2JQ5 A;  2Z76 A;  4BIR A;  3IMA B;  4MJD A;  1OF5 A;  3QRD A;  1FGO A;  1BRN L;  2CG0 A;  1VQO 3;  3PYJ A;  5KP1 A;  1RGC A;  3FKA A;  2Z7A A;  3KII A;  3F7X A;  4GHO A;  1EEJ A;  3MYT A;  3X42 A;  3D5I A;  3LTC A;  4EYC A;  2KF5 A;  1W01 A;  1FW7 A;  1BAN A;  1IVW A;  2BIR A;  3K7C A;  2GEY A;  3CC7 3;  3NM7 A;  1O7G B;  1W4N A;  1RGH A;  4NRE A;  1WTH A;  3CCQ 3;  1N8R 4;  1SII A;  2OCT A;  2BMO B;  1GY5 A;  1ZX2 A;  1TRP A;  1WNH A;  3G71 3;  3KFQ C;  5IG5 A;  1OHP A;  3DGO A;  1YJ9 3;  3E99 A;  2F98 A;  2YFJ B;  3T8U A;  3MG1 A;  1I8V A;  1RGF A;  4EBG A;  5I97 A;  1YJN 3;  3AGO A;  1HZ1 A;  1WMN A;  2Z6B A;  4RZM A;  1R4Y A;  1LOV A;  1G02 A;  1RRL A;  2IUK A;  1MWR A;  1BIR A;  2UX0 A;  2XSH B;  3F9S A;  3PCS A;  1GY6 A;  3WR2 A;  1IU7 A;  2Y73 A;  3UJM A;  3WDG B;  2CFL A;  3G8Z A;  2HMM B;  1UI7 A;  1S72 3;  1PY3 A;  4HM1 B;  1ROA A;  1RN7 A;  3DGM A;  5G1L A;  4R9L A;  3V99 A;  4KFD A;  1IVU A;  3FLJ A;  1FGT A;  1BRH A;  5IW9 A;  2E2U A;  1LQM B;  2JDI H;  1KWI A;  1DET A;  1N5P A;  1UW1 A;  2XSO B;  3NQZ A;  3FF2 A;  4KVH A;  1JZD A;  1PU4 A;  1I2F A;  1KD1 4;  1JB5 A;  1B2U A;  1U8C B;  2E2T A;  2I9W A;  3WOF B;  5CLK A;  4K1U A;  2P09 A;  2HOH A;  5AEU B;  2J8X B;  5M18 A;  2FGT A;  2XR8 B;  3K0Z A;  1EG9 B;  4FR9 A;  5AIH A;  1CQS A;  4LEH A;  2HMN B;  6GSP A;  5AI1 A;  1BVI A;  1W6G A;  2H0H A;  2CWT A;  3ALA A;  4OVM A;  1I2G A;  2AAE A;  4O8S A;  3MG2 A;  1DMQ A;  3EBT A;  1KC8 4;  1RLS A;  3FGY A;  1B27 A;  1ZO2 A;  2W56 B;  3VGN A;  5D82 A;  1VQL 3;  3CCM 3;  1D6Z A;  2BO9 B;  1I3I A;  1W7C A;  3N8B A;  4WFO A;  3D4A A;  3CC4 3;  3JUP A;  3VF1 A;  1N9J A;  3B8L A;  4N3V A;  3CD6 3;  1BU4 A;  1BNG A;  2ZL8 A;  1ZGX A;  4GB5 A;  4HAA A;  3SVA A;  3AHW A;  1GMQ A;  4BL3 A;  1OUN A;  1MWS A;  3F40 A;  2PZV A;  2F86 B;  3FG1 A;  3LYG A;  4WYK A;  3AGN A;  6STD A;  4JRF A;  3SED A;  3G16 A;  1RRH A;  2F4Y A;  2C11 A;  3LTA A;  3G0K A;  4ILF A;  2CW9 A;  4AKY A;  1UCJ A;  3B7C A;  1FGR A;  1NJI 4;  1N8Q A;  8CHO A;  1RTU A;  3EN8 A;  3NX0 A;  1OH0 A;  4WP5 A;  1SQW A;  4J5K A;  2BU4 A;  2K3D A;  2RFR A;  4EW5 A;  3FSD A;  3TDG A;  4ORL A;  3DM8 A;  3MG3 A;  1G0T A;  1LOW A;  4K1V A;  3SOA A;  4BTY A;  1JJ2 2;  4R1K A;  1NDO B;  1W6C A;  3WHO A;  1ROV A;  1IQY A;  1JN5 A;  3CNX A;  3EBY A;  2KCD A;  4O2H A;  3HII A;  2LQV A;  1W6Y A;  2CH9 A;  1UCL A;  2M7O A;  1IK3 A;  3LOY A;  3WOD G;  1E3R A;  1K8A 4;  1VQ5 3;  3F8H A;  2W9Q A;  4HM0 B;  4HM2 B;  1OGZ A;  3CPO A;  4L8P A;  2WGO A;  2ML6 A;  2RNT A;  1B2S A;  2INX A;  3AHS A;  1FZU A;  1VQK 3;  3CNM A;  1K41 A;  1Q40 B;  3NM2 A;  3RGA A;  1GSP A;  1UUV B;  4R80 A;  4QWT A;  3CCS 3;  1NO3 A;  2GSP A;  4BL2 A;  2OQE C;  3I0Y A;  1YJW 3;  4J5G A;  4HZ9 B;  1GD3 A;  3DZL A;  3S67 A;  1RCK A;  4LGQ A;  9RNT A;  1SPU A;  3CU3 A;  1OF5 B;  4CPK A;  3T0U A;  4CCV A;  1ULJ B;  5AYS C;  2C4B A;  2GEX A;  3KKG A;  2YX9 A;  3S5C A;  3HI7 A;  3UB1 A;  4MMX B;  5BIR A;  5IF6 A;  3Q90 A;  3SYU A;  2ZDJ A;  2RSX A;  3JUM A;  3MSO A;  1JBS A;  1Q9E A;  1UUW B;  2W9P A;  1E3V A;  1AVK A;  3Q2P A;  4HBR A;  1TTO A;  3BIR A;  3FG4 A;  3LZA A;  5IG0 A;  5M19 A;  3OV4 A;  1BUJ A;  3GAX A;  2IY2 A;  2XRX B;  4PEJ A;  1C7H A;  1KSI A;  4O02 B;  5RNT A;  1GS3 A;  3GZX B;  3RGR A;  2XEP A;  2XFT A;  1EUI C;  4EV5 A;  1G96 A;  1RGK A;  1Y4K A;  3LH4 A;  5EVH A;  2GBX B;  2A15 A;  2CFG A;  4R4K A;  2L1S A;  1MNL A;  2F5W A;  2LYX A;  1GYB A;  3SX1 A;  3H51 A;  5ELJ A;  1VQ6 3;  1BSC A;  5HOH A;  3I55 3;  3EB8 A;  3JUO A;  3MHE A;  3NQY A;  4Q53 A;  1A2K A;  3DGN A;  7GSP A;  2RCD A;  3WA3 A; 
#chains in the Genus database with same CATH homology
 5AIG A;  1A2V A;  3OWY A;  2CWU A;  1K73 4;  2WO0 A;  4XBT A;  5AII A;  4U13 A;  1HU9 A;  2P05 A;  4XM4 A;  4XDV A;  2IMJ A;  1IVV A;  1DYU A;  5BXQ A;  4FMB A;  4N6L A;  3NV0 A;  2P0M A;  3DMC A;  1W2B 2;  2HMK B;  2Y74 A;  1JV2 B;  4MMY B;  3X40 A;  1K9M 4;  2CWV A;  1W2Z A;  4IT7 A;  2WGQ A;  3D3L A;  4IPB A;  1OCV A;  1TIJ A;  4N6U A;  2BMR B;  4TX4 A;  3WA2 X;  4EV2 A;  5JPU A;  2HML B;  3IJE B;  3CCU 3;  1KQS 2;  2CHC A;  2HMO B;  1STD A;  1TU5 A;  3LTD A;  1QVG 2;  4IIA A;  3BLZ A;  4HM8 B;  1WMO A;  5FGO A;  3K63 A;  3JUN A;  4HYZ A;  1YIT 3;  2B24 B;  3NXJ A;  3OWU A;  1FA3 A;  2XGL A;  2CFW A;  2Z77 A;  1O7M B;  3K5T A;  1D6Y A;  5AIF A;  4RNY A;  1O7W B;  5FW5 A;  3LML A;  1ASK A;  1SIH A;  4HZB B;  4HVN A;  1JKG B;  1IVX A;  1K28 A;  2YFL B;  4HM4 B;  3EF8 A;  1OAC A;  2W2C A;  3EE1 A;  3NBB A;  3OWS A;  4BTX A;  2YFI B;  4FMD A;  3MWZ A;  1L5G B;  5IG3 A;  2BMQ B;  5EQL A;  5CXO A;  1IQ8 A;  2PNC A;  1BUQ A;  4H3U A;  1SJW A;  1Q82 4;  1IT8 A;  4RBN A;  1QAL A;  2OOV A;  1CYV A;  4RNZ A;  1STF I;  1Q81 4;  1IDP A;  4L8O A;  2Q07 A;  4K61 A;  1J2B A;  1N9E A;  5DRE A;  3SLU A;  4R9K A;  2GBW B;  2R4I A;  2QEX 3;  1JN5 B;  4X2H A;  3FH1 A;  3KSP A;  3PGB A;  4FCJ A;  3LTB A;  1VZZ A;  3U1W A;  1DMN A;  2GU1 A;  2W6J H;  4HM7 B;  4MMZ B;  2K0M A;  4GL6 A;  1VQ4 3;  2C10 A;  4BTW A;  1QMA A;  2BNG A;  4OUQ A;  1M9G A;  3AMO A;  1W00 A;  2XF3 A;  1JB4 A;  2QIY A;  5IG4 A;  5CF1 A;  1U5O A;  2W03 A;  1QAK A;  5BVB A;  3GZR A;  4XBX A;  3EX9 A;  3CME 3;  3BNB A;  1O7H B;  3FF0 A;  1RKY A;  1W02 A;  1YVB I;  3I56 3;  1VQ5 3;  4EC6 A;  3EC9 A;  4OK0 A;  4G1M B;  4WWU C;  1YI2 3;  1VQN 3;  2GXF A;  3O8Y A;  3GZB A;  3Q1C A;  3STD A;  1TP6 A;  1D6U A;  3S29 A;  2CIU A;  1EKM A;  2CC3 A;  1Q86 4;  3NHX A;  1O7P B;  1M1K 4;  1Z1S A;  5JPP A;  2XGN A;  3CCL 3;  1QVF 2;  3X3X A;  3A76 A;  5D83 A;  1IT7 A;  2K54 A;  1JB2 A;  2V1L A;  1LNH A;  4XBY A;  5KP3 A;  4STD A;  3HX8 A;  3JVC A;  2CG1 A;  2FNQ A;  3BNC A;  1N5H A;  3M8C A;  1E97 A;  5CK6 A;  3HIG A;  3ER7 A;  3GRD A;  3H3H A;  3K9M C;  3NBJ A;  5A0O B;  1NB5 I;  1RJO A;  3J7Y d;  5JBS A;  3G4S 3;  4AEQ A;  2WOH A;  1EQK A;  3RDE A;  2FXT A;  3QK9 A;  4X2O A;  3V92 A;  1DVD A;  3EJV A;  3ECF A;  1MOL A;  1QJG A;  3UNL A;  2E2V A;  3VSY A;  1AV4 A;  4HJL B;  1JRQ A;  3N9H A;  3CXC 2;  2MC8 A;  3WOE B;  1O7N B;  3NUV A;  4FCM A;  3NV0 B;  3OXA A;  3V98 A;  4LSO A;  1VQ9 3;  5IEN A;  2F99 A;  3FZW A;  3B4O A;  3PZW A;  1VQM 3;  3D9R A;  5AEW B;  3MPH A;  4WHA A;  2CKF B;  1US1 A;  1WMP A;  3CCR 3;  2W0Q A;  4FCZ A;  1IV9 A;  1LOX A;  4J8T A;  3F8X A;  3HK4 A;  4I4K A;  3PCR A;  3KN4 A;  1IV7 A;  5G2G A;  2P0X A;  4KZ1 A;  1S5A A;  3PS8 A;  4N6T A;  1F8N A;  4KFE A;  3UL5 A;  4N6M A;  1CYU A;  3DGL A;  3DY5 A;  4O3V A;  3JUQ A;  2BT3 A;  3OX9 A;  3WMD A;  1NB3 I;  1OHO A;  1TFO A;  4FMC A;  4NHF A;  5HGR A;  4H61 A;  1JNQ A;  3U97 A;  1TUH A;  4CDL A;  2OTL 3;  3F7S A;  1M1X B;  2XH9 A;  3CCJ 3;  4FMA A;  1OHS A;  1VQP 3;  1W5Z A;  1M90 4;  1DMM A;  1NWW A;  3T8N A;  7STD A;  2P38 A;  2HMJ B;  3GWR A;  1NU3 A;  4WYK B;  5IEP A;  4N6V 0;  3S27 A;  3EN1 B;  3BB9 A;  1Q42 A;  3KZT A;  1FGQ A;  2XFS A;  1UI8 A;  3DXO A;  3CPW 2;  2ML5 A;  3F14 A;  2CFD A;  3NBR A;  3MKI A;  4N6N B;  1TFK A;  4LZI A;  2SBL A;  1YIJ 3;  2OWP A;  4K90 B;  3CCE 3;  2D42 A;  2O9U X;  5DRV A;  4J9A A;  2W56 A;  2QGU A;  2IA7 A;  3X3Y A;  3BND A;  4ZM8 A;  1JKG A;  4HKV B;  5LC6 A;  1R4C A;  4JF8 A;  3X41 A;  1ISK A;  4LMI A;  1GD4 A;  1HKX A;  3AMO B;  3GZY B;  3CMA 3;  2QA4 3;  5EEO A;  3CCV 3;  3FG3 A;  4KFF A;  1VQ8 3;  5KP4 A;  2B1X B;  1PFP A;  2GU3 A;  3LT8 A;  3SOY A;  3B4P A;  2O3O A;  3BNE A;  2OQE A;  1IQX A;  1AR0 A;  1Q7Y 4;  4HM5 B;  3OW2 2;  2W04 A;  5STD A;  4HM6 B;  5CF2 A;  2OOV C;  3UL6 A;  2STD A;  2CK3 H;  4N6O B;  1DVC A;  3ROB A;  1VQ7 3;  2MF7 A;  3EQQ B;  4HM3 B;  1WQL B;  4XB5 A;  5IEO A;  1V74 A;  2CFK A;  1GY7 A;  5LC7 A;  1FGM A;  3S28 A;  2KXG A;  4AKZ A;  5TGN A;  3KE7 A;  5IER A;  3LT9 A;  3IPT A;  2BHM A;  3CC2 3;  3SXX A;  1CEW I;  2OTJ 3;  3LXU X;  4XDW A;  2WOF A;  1T5Y A;  3HZP A;  1LVN A;  1QAF A;  3KSE D;  4EXR A;  2L4V A;  1OPY A;  1ULI B;  1FUW A;  5AYR B;  3G6E 3;  1Q40 A;  3X3Z A;  3N54 B;  3PXM A;  2RGQ A;  5ELU A;  1LXE A;  2KRT A;  5D81 A;  2IUJ A;  1A90 A;  1AVL A;  1YHQ 3;  4MEI A;  3DUK A;  4L7K A;  2D1W A;  3FCS B;  3L0R A;  1YGE A;  1OGX A;  3EHC A;  1EA2 A;  1A67 A;  2JQ5 A;  2Z76 A;  3IMA B;  4MJD A;  1OF5 A;  3QRD A;  1FGO A;  2CG0 A;  1VQO 3;  3PYJ A;  5KP1 A;  3FKA A;  2Z7A A;  3KII A;  3F7X A;  3MYT A;  3X42 A;  3LTC A;  4EYC A;  1W01 A;  1IVW A;  3K7C A;  2GEY A;  3CC7 3;  3NM7 A;  1O7G B;  1W4N A;  4NRE A;  1WTH A;  3CCQ 3;  1N8R 4;  1SII A;  2OCT A;  2BMO B;  1GY5 A;  1ZX2 A;  1WNH A;  3G71 3;  3KFQ C;  5IG5 A;  1OHP A;  3DGO A;  1YJ9 3;  3E99 A;  2F98 A;  2YFJ B;  3T8U A;  3MG1 A;  4EBG A;  5I97 A;  1YJN 3;  1WMN A;  2Z6B A;  4RZM A;  1RRL A;  2IUK A;  2XSH B;  2UX0 A;  3F9S A;  3PCS A;  1GY6 A;  2Y73 A;  1IU7 A;  3UJM A;  3WDG B;  2CFL A;  3G8Z A;  2HMM B;  1UI7 A;  1S72 3;  4HM1 B;  1ROA A;  1RN7 A;  3DGM A;  4R9L A;  3V99 A;  4KFD A;  1IVU A;  3FLJ A;  1FGT A;  5IW9 A;  2E2U A;  2JDI H;  1KWI A;  1N5P A;  1UW1 A;  2XSO B;  3NQZ A;  3FF2 A;  4KVH A;  1PU4 A;  1KD1 4;  1JB5 A;  2I9W A;  1U8C B;  2E2T A;  3WOF B;  5CLK A;  4K1U A;  2P09 A;  5AEU B;  2FGT A;  2XR8 B;  3K0Z A;  1EG9 B;  4FR9 A;  5AIH A;  1CQS A;  4LEH A;  2HMN B;  5AI1 A;  1W6G A;  2CWT A;  3ALA A;  4OVM A;  4O8S A;  3MG2 A;  1DMQ A;  3EBT A;  1KC8 4;  3FGY A;  1ZO2 A;  2W56 B;  3VGN A;  5D82 A;  1VQL 3;  3CCM 3;  1D6Z A;  2BO9 B;  1W7C A;  3N8B A;  4WFO A;  3CC4 3;  3JUP A;  3VF1 A;  1N9J A;  3B8L A;  4N3V A;  3CD6 3;  2ZL8 A;  4GB5 A;  3SVA A;  1OUN A;  3F40 A;  2PZV A;  2F86 B;  3FG1 A;  3LYG A;  4WYK A;  6STD A;  4JRF A;  3SED A;  3G16 A;  1RRH A;  3LTA A;  2C11 A;  3G0K A;  2CW9 A;  4AKY A;  3B7C A;  1FGR A;  1NJI 4;  1N8Q A;  8CHO A;  3EN8 A;  3NX0 A;  1OH0 A;  4WP5 A;  1SQW A;  2RFR A;  3FSD A;  3TDG A;  4ORL A;  3DM8 A;  3MG3 A;  4K1V A;  3SOA A;  4BTY A;  1JJ2 2;  4R1K A;  1NDO B;  1W6C A;  1ROV A;  1IQY A;  1JN5 A;  3CNX A;  3EBY A;  2KCD A;  4O2H A;  3HII A;  2LQV A;  1W6Y A;  2CH9 A;  2M7O A;  1IK3 A;  3LOY A;  3WOD G;  1E3R A;  1K8A 4;  3F8H A;  2W9Q A;  4HM0 B;  4HM2 B;  1OGZ A;  3CPO A;  4L8P A;  2WGO A;  2ML6 A;  2INX A;  1VQK 3;  3CNM A;  1K41 A;  1Q40 B;  3NM2 A;  3RGA A;  1UUV B;  4R80 A;  4QWT A;  3CCS 3;  1NO3 A;  2OQE C;  3I0Y A;  1YJW 3;  4HZ9 B;  1GD3 A;  3DZL A;  3S67 A;  4LGQ A;  1SPU A;  3CU3 A;  1OF5 B;  3T0U A;  4CCV A;  1ULJ B;  5AYS C;  2GEX A;  3KKG A;  2YX9 A;  3S5C A;  3HI7 A;  3UB1 A;  4MMX B;  5IF6 A;  3Q90 A;  2ZDJ A;  2RSX A;  3JUM A;  3MSO A;  1UUW B;  2W9P A;  1E3V A;  1AVK A;  3Q2P A;  4HBR A;  3FG4 A;  3LZA A;  5IG0 A;  3OV4 A;  3GAX A;  4PEJ A;  2XRX B;  1C7H A;  1KSI A;  4O02 B;  1GS3 A;  3GZX B;  3RGR A;  2XEP A;  2XFT A;  4EV5 A;  1G96 A;  3LH4 A;  1Y4K A;  5EVH A;  2GBX B;  2A15 A;  2CFG A;  4R4K A;  1MNL A;  2LYX A;  1GYB A;  3SX1 A;  3H51 A;  5ELJ A;  1VQ6 3;  3I55 3;  3EB8 A;  3JUO A;  3MHE A;  3NQY A;  4Q53 A;  1A2K A;  3DGN A;  2RCD A;  3WA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...