4WWUC

Structure of mex67:mtr2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
165
Chain Sequence
MVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPIQMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDSLLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords mRNA export factor MEX67
total genus 37
structure length 165
sequence length 177
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wwuC00
1JB5A 3B4PA 4GB5A 3KE7A 3NUVA 2B24B 3NXJA 1W01A 4LEHA 1JKGB 1OF5B 2OWPA 3FF2A 4L8OA 4I4KA 3K7CA 5CXOA 3OV4A 5TGNA 4L8PA 4HKVB 3MHEA 5IG3A 3B4OA 3F14A 1W02A 3GWRA 3LYGA 3NHXA 4RZMA 5D81A 4WP5A 5IERA 3F40A 4HVNA 3VGNA 4HM3B 3EF8A 4HM8B 1AR0A 2Z7AA 1ZX2A 2YFIB 3CPOA 5IEPA 2W2CA 1GY5A 3EJVA 3STDA 8CHOA 5IENA 3D9RA 1W6YA 3NBRA 4IIAA 1C7HA 1TP6A 2PZVA 1JN5A 3FF0A 4OVMA 4FCMA 1OF5A 5HGRA 3H3HA 3EHCA 1EG9B 3I0YA 3OWSA 5D82A 5D83A 1W00A 3FZWA 3FSDA 4K1VA 4X2OA 1DMMA 3K0ZA 1ULIB 1OGXA 1NWWA 1E3RA 3F8HA 3Q90A 4MJDA 1OHOA 5AEUB 3F7SA 3OX9A 3GZYB 4HJLB 4HM1B 2RCDA 3VSYA 3JUPA 2A15A 5IG5A 2CHCA 2HMJB 4R9KA 1Q42A 2B1XB 5IG0A 2GXFA 3G16A 3FLJA 1O7MB 1O7WB 2QGUA 4HZ9B 3JUMA 1DMQA 3GZBA 4J8TA 2INXA 3CU3A 2XR8B 3GRDA 1BUQA 1JB2A 1WQLB 2HMMB 1A2KA 3MSOA 3GZRA 4HZBB 3E99A 4XBTA 3SEDA 4N3VA 1OGZA 4XDVA 2RGQA 2QIYA 3S5CA 1JN5B 2F99A 5CK6A 1Q40B 5FW5A 1ZO2A 3EBYA 3ER7A 3MYTA 4J9AA 3DXOA 4R1KA 1ASKA 1ULJB 4FCJA 1O7PB 3SOAA 3T8UA 5BXQA 1OUNA 3B7CA 3MG3A 4XDWA 2XRXB 5IF6A 2XSHB 3F8XA 3KZTA 2K54A 4XBXA 1TUHA 2XSOB 2BMOB 4K1UA 3F9SA 3EN8A 1GY6A 2Z77A 4STDA 7STDA 4X2HA 2F86B 4L7KA 3ROBA 3EX9A 3HX8A 5AI1A 3DZLA 2HMLB 4LGQA 5IG4A 1GY7A 1E3VA 4H3UA 2GBWB 2BMRB 4ORLA 1JKGA 1U5OA 3FH1A 3FKAA 1HKXA 3OWUA 1UUWB 4KVHA 4WYKB 3WMDA 1QJGA 3HZPA 4HM0B 3DMCA 1NU3A 4R9LA 2JQ5A 1GS3A 3CNXA 2HMNB 3MG2A 4WYKA 1OH0A 3UNLA 1NDOB 1UUVB 5CLKA 3ECFA 1Z1SA 1ISKA 1DMNA 2GEXA 3SOYA 3MKIA 2IMJA 1SJWA 1S5AA 1JB4A 3EC9A 3DUKA 3EBTA 3H51A 3BLZA 4XBYA 4XM4A 2YFJB 5STDA 5AIFA 1OHSA 2HMOB 2HMKB 1O7NB 2RFRA 3EQQB 3JUOA 5AIHA 5EVHA 3NM2A 4Q53A 3RGRA 1OCVA 3M8CA 5G2GA 3KSPA 3MG1A 1OPYA 2BMQB 3A76A 2R4IA 4PEJA 3RGAA 1K41A 2STDA 3F7XA 3JUNA 1CQSA 1E97A 2I9WA 3LZAA 3T8NA 3NV0B 5CF2A 3UJMA 2CKFB 5KP1A 1Q40A 2BNGA 5DREA 3G0KA 6STDA 5CF1A 1QMAA 3G8ZA 5IEOA 5JPPA 1VZZA 5DRVA 1GYBA 1STDA 5JPUA 1O7GB 1OHPA 3EN1B 4HM2B 5AIGA 3OXAA 4LMIA 4HM5B 3BB9A 4HM7B 4WWUC 2Z76A 2GBXB 3HK4A 3GZXB 3JUQA 3B8LA 4OUQA 5AIIA 2GEYA 4HM6B 2F98A 4HM4B 4U13A 2UX0A 4CDLA 1IDPA 5BVBA 3NV0A 1EA2A 3OWYA 3IPTA 1O7HB 5KP3A 5AEWB 5KP4A 3FGYA 4XB5A 2YFLB 3DM8A 3CNMA 3KKGA
chains in the Genus database with same CATH superfamily
3TDGA 2IY2A 3KE7A 3PYJA 4LEHA 1OF5B 3FF2A 2IA7A 5EQLA 4LSOA 3OV4A 3X41A 4EXRA 2BT3A 3MHEA 3UB1A 2CFLA 2BHMA 6GSPA 2ZL8A 1NNVA 3GSPA 2KF6A 4HVNA 3VGNA 4HM3B 1GD4A 4HM8B 1HYFA 1VQ63 4MEIA 1TTOA 2W2CA 5IEPA 1JJ22 3BU4A 3STDA 1KQS2 4EYCA 1C54A 4H61A 2P05A 3FF0A 1EQKA 4OVMA 4GSPA 1OF5A 2H0HA 3IMAB 7RNTA 1TFKA 3I0YA 1TRQA 4N6LA 4N6NB 3FSDA 4KZ1A 2PNCA 1OGXA 1NWWA 3F8HA 1IVWA 3I563 1WMPA 1VQN3 3F7SA 3LOYA 4GHOA 4WHAA 1BIRA 3VSYA 5AYRB 1YIJ3 1TIJA 2B1XB 2GXFA 1A90A 1O7WB 1BAOA 2L1SA 4N6UA 4LZIA 5RNTA 4J8TA 3V92A 1Q864 3GRDA 1BRGA 1IVXA 1W4NA 3CME3 2XEPA 1SPUA 4HBRA 2R41A 3GZRA 2FXTA 4N3VA 4TX4A 3CC43 4XDVA 2KCDA 3L0RA 3S5CA 2F99A 4MMZB 2F5MA 5FW5A 4HOHA 3DXOA 2FNQA 1N9JA 4R1KA 4O8SA 1W2ZA 1QAFA 3QK9A 3BNEA 3B7CA 4O3VA 2XRXB 1FGRA 3F8XA 1N5HA 1I2EA 4FMCA 1WMNA 3D5GA 2P0XA 4XBXA 5GSPA 2BMOB 1T2IA 1Q7Y4 1TU5A 3EN8A 3X3XA 4KFDA 4CJNA 4N6MA 1VQ83 3DZLA 1JV2B 1UUGB 2CIUA 2BMRB 2ML5A 1JRQA 1B2UA 1SARA 3DGOA 3AMOB 1IU7A 3FH1A 3FKAA 3FG3A 3HIIA 3LTCA 1YNVX 1I2GA 1MWSA 3HZPA 1NU3A 3KSED 4HM0B 3UNLA 1JZDA 2F5WA 2Z6BA 1OH0A 1NDOB 1M1XB 3X40A 2H0GA 2IMJA 3WOEB 1S5AA 3EBTA 4NREA 4LYLB 1MWTA 3BLZA 4XBYA 2XFSA 1YI23 3EQQB 1UDII 3PGBA 5JBSA 1VQQA 2CFDA 4IT7A 2KAAA 5G2GA 3CCJ3 3OW22 2OTL3 2BMQB 2XFTA 4BL3A 1BNIA 3RGAA 1KD14 1CQSA 1GOVA 5EEOA 4JF8A 1LOYA 1Q40A 2BNGA 3HOHA 1VQ73 5CF1A 2W56B 2O9UX 5IW9A 1G02A 2XGLA 5JPUA 1AV4A 4HM2B 5AIGA 4LMIA 1DVDA 4WWUC 2GSPA 2Z76A 3NBBA 3FG4A 3JUQA 1B2MA 3B8LA 2K3DA 2W56A 1MGRA 1IVUA 1RN7A 4G1MB 4HM4B 2F98A 1I0XA 5HOHA 1AVKA 1FZUA 3KFQC 1RJOA 4BIRA 1KC84 5AYSC 3DM8A 1BU4A 3B4PA 1TFOA 1JKGB 5CXOA 2OWPA 5TGNA 1WTHA 3AGNA 3RDEA 3DY5A 1T5YA 3B4OA 2E2VA 3GWRA 3LYGA 1W6GA 5D81A 1YJN3 4WP5A 1VQ53 1I0VA 3F40A 4I5QA 1IV7A 1F8NA 4AKYA 3KIIA 1QVF2 1YIT3 5M1AA 1J2BA 1K28A 4AEQA 4BL2A 3LT8A 2KF3A 3BNBA 1W6YA 3EE1A 3PCRA 4IIAA 1I2FA 5G1LA 2PZVA 3CCU3 3G6E3 4FCMA 5D82A 3EHCA 3OWSA 1LRAA 3MWZA 4FR9A 5D83A 1PU4A 3FZWA 2H0IA 1DETA 1B2XA 1IV9A 1GD3A 5LC6A 5AEUB 2W0QA 2M7OA 1I3IA 1GMQA 1A2PA 1DYUA 4HM1B 1BRSA 1Q824 1LVNA 4R9KA 1PY3A 5IG0A 1SIHA 2KF4A 3G16A 3FLJA 3G4S3 2QGUA 4FMDA 1TRPA 3JUMA 3GZBA 2INXA 3HIGA 2MC8A 1FYSA 2KRTA 3CU3A 2XR8B 1BUQA 2W9QA 1YVSA 2C10A 1JB2A 4K61A 1BNRA 5AI1A 3VF1A 2QIYA 1R4YA 7GSPA 1M1K4 3Q2PA 5CK6A 3LH4A 1VQ93 3PXMA 4GL6A 3SOAA 3DH2A 5BXQA 2L4VA 1M9GA 4XDWA 3V98A 4BTYA 4J5GA 3CMA3 1GOYA 2XSOB 3F9SA 3CC23 3WA3A 1I8VA 1FA3A 2Z77A 4STDA 7STDA 1EKMA 4X2HA 3HX8A 1CEWI 2CW9A 5IG4A 1JNQA 1E3VA 3LTBA 3URPA 1UGIA 4ORLA 3CC73 4KVHA 1HKXA 4WYKB 1UUWB 4EC6A 2KXGA 1QJGA 1FGMA 4R9LA 3BIRA 2IUKA 4WYKA 2HMNB 3MG2A 1MOLA 1HU9A 1SIIA 1UUVB 1Z1SA 2GEXA 3SOYA 3PCSA 3EC9A 4RNZA 1PYLA 5AIFA 1OHSA 2HMOB 1OACA 5BU4A 1RLSA 2CH9A 1DVCA 1A2VA 1B3SA 4IPBA 2ZDJA 3M8CA 2WO0A 1RDSA 3KSPA 5A0OB 5BIRA 3SLUA 3JUNA 2I9WA 1RCLA 1UCIA 1UW1A 5CF2A 1N8R4 3UJMA 3SYUA 1FUTA 5DREA 2HOHA 2OOVA 3G8ZA 1QALA 1X1WA 5IEOA 1FW7A 2CK3H 1MNLA 1STDA 1FUWA 1OHPA 3EN1B 2BO9B 4HM5B 1YHQ3 3BB9A 3X42A 1QAKA 3LMLA 1IT7A 1LOXA 3GZXB 2FGTA 5ELUA 1G96A 1W7CA 4FMBA 2GEYA 3FG1A 2ZHXB 1Q9EA 1RTUA 3KN4A 1BRJA 4CDLA 1LNIA 1KSIA 5AEWB 1BRHA 1O7HB 1LOVA 1JBTA 3WA2X 1M904 3CNMA 2OCTA 5AIHA 1JB5A 4DKIA 3AMOA 1W01A 4L8OA 3G713 1UGHI 1VQP3 2UUGC 5IG3A 3ALAA 1YGEA 3CXC2 4N6V0 5IERA 3JVCA 1W2B2 1IVVA 2WGQA 3EF8A 3NQZA 1AR0A 2Z7AA 1ZX2A 2YFIB 2K0MA 3CPOA 4OK0A 1US1A 1GY5A 1JBRA 1K734 1FGQA 8CHOA 2OQEA 5IENA 2WOHA 1IQXA 1C7HA 9RNTA 4R80A 1BNEA 2SARA 1CH0A 1K8A4 1MWUA 1W00A 4K1VA 1NB3I 3K0ZA 1ULIB 3SXXA 1I70A 1E3RA 1GOUA 4MJDA 6RNTA 1BRIA 1W6CA 3OX9A 1GMPA 3QRDA 5ELJA 5IG5A 1AQZA 2A15A 1I3FA 1V57A 4KT3B 5G1KA 3UL6A 4HYZA 1O7MB 1BANA 3CCE3 1BUJA 1RGAA 3NM7A 1DMQA 1G0TA 3X3ZA 2QA43 1RRLA 2OQEC 3DGLA 1BSCA 2Q07A 1VQL3 4FMAA 3Q1CA 3D3LA 1RN1A 3OWUA 1ROVA 3MSOA 4HZBB 4XBTA 3SEDA 5LC7A 3ZFZA 1HZ1A 1RNTA 2E2UA 1ZO2A 3EBYA 4J9AA 4R4KA 2OTJ3 1R4CA 4FCJA 3DGMA 3T8UA 2CWUA 1KWIA 1JBSA 2XSHB 1RCKA 3KZTA 3S27A 1YJ93 1D6UA 1TUHA 2BU4A 1B2SA 4K1UA 3N9HA 2F86B 2UGIA 3BNDA 1BNFA 3D5IA 3O8YA 1BSDA 4L7KA 2HMLB 4LGQA 4NPBA 1GY7A 4K90B 3HI7A 2WGOA 4H3UA 2GBWB 2GU3A 1JKGA 3DGYA 2GU1A 1V58A 3T0UA 1VQK3 3A5EA 1RNBA 1A67A 2P38A 1BOXA 3DMCA 2YX9A 1UCJA 2F4YA 1UI8A 4KFFA 5CLKA 1ISKA 3GAXA 2C11A 3H51A 5JPPA 1JB4A 1YJW3 1RGFA 2W9PA 2YFJB 5BVBA 1BNSA 2HMKB 1RGHA 5EVHA 3CCV3 3JUOA 3NM2A 2P09A 2ZA4A 2JDIH 8RNTA 1CYVA 3F7XA 3LZAA 3T8NA 1V74A 2CWVA 3WODG 2RSXA 2CKFB 2RBIA 1FGOA 4EBGA 5I97A 1BVIA 1X1XA 2IUJA 6STDA 4HAAA 5DRVA 4EW5A 3N8BA 4RNYA 1O7GB 1K9M4 1RMSA 1W5ZA 2V1LA 1RN4A 4CPKA 1RGEA 4RNTA 4EV5A 2GBXB 3LXUX 3K5TA 1RSNA 4KFEA 4U13A 1N9EA 2WOFA 3D79A 1JZOA 2UX0A 1IYYA 1B27A 2E2TA 4CCVA 1EA2A 3OWYA 4N6TA 1BNJA 5KP3A 5KP4A 1NB5I 1Q7HA 1BGSA 2SBLA 3FGYA 2CG1A 4GB5A 3WDGB 2W6JH 1WMOA 3I553 3NUVA 2B24B 3NXJA 4I4KA 3K7CA 3X3YA 1RGKA 3CD63 4L8PA 1BSEA 4HKVB 1B20A 1T2HA 2AAEA 3F14A 2QEX3 4O02B 1W02A 3SVAA 3CCM3 3NHXA 4RZMA 3FCSB 3S29A 2O3OA 2LYXA 1N5PA 2F56A 4QWTA 3N54B 3ZG0A 1L5GB 1NJI4 1EUIC 2D42A 1WNHA 3EJVA 1ZS7A 3Q3FA 3D9RA 1RGLA 3NBRA 2W04A 1FGTA 1TP6A 3NBJA 4WFOA 1JN5A 3NQYA 1Q814 2CG0A 1LNHA 1T3BA 1RKYA 1B2ZA 1UCKA 3H3HA 5HGRA 1EG9B 1MGWA 4ILFA 2OOVC 1RHLA 2RNTA 3WOFB 2W03A 4X2OA 1DMMA 2AADA 2MF7A 3Q90A 3WR2A 1DE3A 1OHOA 3GZYB 4HJLB 2RCDA 2XH9A 3JUPA 2CHCA 2HMJB 1Q42A 4JRFA 5M19A 4HZ9B 3CCL3 4O2HA 3AHWA 3S67A 1IK3A 3V99A 1RRHA 1WQLB 1BRKA 3ZG5A 2HMMB 1A2KA 1RGCA 1STFI 1IQYA 3E99A 4BTXA 1UCLA 1OGZA 4J5KA 2RGQA 1X1YA 1JN5B 2LQVA 3CCS3 1Q40B 3WHOA 3MYTA 3ER7A 1ASKA 1ULJB 1D6YA 1O7PB 2CC3A 1TJDA 3BNCA 3DGNA 3U97A 5M18A 1VQO3 4RBNA 1VQM3 1OUNA 1NO3A 3MG3A 2XF3A 1FUSA 5IF6A 4BU4A 3LT9A 2K54A 1MWRA 3CPW2 1LOWA 1D6ZA 3PZWA 1U8CB 1CYUA 1BRNL 1GY6A 2P0MA 3NX0A 3K9MC 3ROBA 1B21A 1UI7A 3EX9A 4AKZA 2CX0A 1EEJA 1LQMB 1BSAA 1LXEA 4BTWA 3AGOA 4NHFA 2Y73A 1U5OA 1GMRA 3J7Yd 4MMXB 3SX1A 3CCR3 1IQ8A 1X1UA 2XGNA 2C4BA 1YVBI 3WMDA 2JQ5A 1GS3A 1SQWA 3CNXA 2IYJA 1QVG2 3ECFA 1IT8A 1DMNA 3MKIA 4MMYB 1SJWA 1Y4KA 1LQGC 4XM4A 3DUKA 3UL5A 5STDA 1AVLA 2D1WA 1O7NB 2RFRA 3EB8A 4N6OB 3LTAA 3RGRA 4Q53A 1OCVA 3K63A 3MG1A 1OPYA 4FCZA 3A76A 2R4IA 4PEJA 3CCQ3 1K41A 2STDA 1ZGXA 1E97A 3AHSA 3PS8A 3MPHA 3NV0B 1BSBA 1N8QA 5KP1A 1ROAA 3KCHA 3G0KA 1QMAA 2BIRA 1VZZA 1GYBA 1VQ43 3D4AA 3OXAA 1S723 1RGGA 4HM7B 3IJEB 4ZM8A 3HK4A 2CFGA 2CFWA 2KF5A 2Y74A 1AY7A 4OUQA 2ML6A 5AIIA 3S28A 4HM6B 2CFKA 1PFPA 1BNGA 5FGOA 3U1WA 2J8XB 1IDPA 2CX1A 4EV2A 3NV0A 3IPTA 2CWTA 1YGWA 4XB5A 2YFLB 3LTDA 3RNTA 3KKGA 1GSPA
chains in the Genus database with same CATH topology
3TDGA 3KE7A 3PYJA 4LEHA 1OF5B 3FF2A 2IA7A 5EQLA 4LSOA 3OV4A 3X41A 4EXRA 2BT3A 3MHEA 3UB1A 2CFLA 2BHMA 2ZL8A 4HVNA 3VGNA 4HM3B 1GD4A 4HM8B 1VQ63 4MEIA 2W2CA 5IEPA 1JJ22 3STDA 1KQS2 4EYCA 4H61A 2P05A 3FF0A 1EQKA 4OVMA 1OF5A 3IMAB 1TFKA 3I0YA 4N6NB 4N6LA 3FSDA 4KZ1A 2PNCA 1OGXA 1NWWA 3F8HA 1IVWA 3I563 1WMPA 1VQN3 3F7SA 3LOYA 4WHAA 3VSYA 5AYRB 1YIJ3 1TIJA 2B1XB 2GXFA 1A90A 1O7WB 4N6UA 4LZIA 4J8TA 3V92A 1Q864 3GRDA 1IVXA 1W4NA 3CME3 2XEPA 1SPUA 4HBRA 3GZRA 2FXTA 4N3VA 4TX4A 3CC43 4XDVA 2KCDA 3L0RA 3S5CA 2F99A 4MMZB 5FW5A 3DXOA 2FNQA 1N9JA 4R1KA 4O8SA 1W2ZA 1QAFA 3QK9A 3BNEA 3B7CA 4O3VA 2XRXB 1FGRA 3F8XA 1N5HA 4FMCA 1WMNA 2P0XA 4XBXA 2BMOB 1Q7Y4 1TU5A 3EN8A 3X3XA 4KFDA 4N6MA 1VQ83 3DZLA 1JV2B 2CIUA 2BMRB 2ML5A 1JRQA 3DGOA 3FH1A 3FKAA 3AMOB 1IU7A 3HIIA 3FG3A 3OWUA 3LTCA 3HZPA 4HM0B 1NU3A 3KSED 3UNLA 2Z6BA 1OH0A 1NDOB 1M1XB 3X40A 2IMJA 3WOEB 3EBTA 1S5AA 4NREA 3BLZA 4XBYA 2XFSA 1YI23 3EQQB 5JBSA 3PGBA 2CFDA 4IT7A 3CCJ3 5G2GA 3OW22 2OTL3 2BMQB 2XFTA 1KD14 3RGAA 1CQSA 5EEOA 4JF8A 1Q40A 2BNGA 1VQ73 5CF1A 2W56B 2O9UX 5IW9A 2XGLA 5JPUA 1AV4A 4HM2B 5AIGA 4LMIA 1DVDA 4WWUC 2Z76A 3NBBA 3FG4A 3JUQA 3B8LA 2W56A 4G1MB 1RN7A 1IVUA 4HM4B 2F98A 1AVKA 3KFQC 1RJOA 1KC84 5AYSC 3DM8A 3B4PA 1TFOA 1JKGB 5CXOA 2OWPA 5TGNA 1WTHA 3RDEA 3DY5A 1T5YA 3B4OA 2E2VA 3GWRA 3LYGA 1W6GA 5D81A 1YJN3 4WP5A 1VQ53 3F40A 1IV7A 1F8NA 4AKYA 3KIIA 1QVF2 1YIT3 1J2BA 1K28A 4AEQA 3LT8A 3BNBA 3EE1A 1W6YA 3PCRA 4IIAA 2PZVA 3CCU3 3G6E3 4FCMA 5D82A 3EHCA 3OWSA 3MWZA 4FR9A 1PU4A 5D83A 3FZWA 1IV9A 1GD3A 5LC6A 5AEUB 2W0QA 2M7OA 1DYUA 4HM1B 1Q824 1LVNA 4R9KA 5IG0A 1SIHA 3G16A 3FLJA 3G4S3 2QGUA 4FMDA 3JUMA 3GZBA 2INXA 3HIGA 2MC8A 2KRTA 3CU3A 2XR8B 1BUQA 2W9QA 2C10A 1JB2A 4K61A 3VF1A 2QIYA 1M1K4 3Q2PA 5CK6A 3LH4A 1VQ93 3PXMA 4GL6A 3SOAA 5BXQA 2L4VA 1M9GA 4XDWA 3V98A 4BTYA 3CMA3 2XSOB 3F9SA 3CC23 3WA3A 1FA3A 2Z77A 4STDA 7STDA 1EKMA 4X2HA 3HX8A 1CEWI 2CW9A 5IG4A 1JNQA 1E3VA 3LTBA 4ORLA 3CC73 4KVHA 1HKXA 4WYKB 1UUWB 4EC6A 2KXGA 1QJGA 1FGMA 4R9LA 4WYKA 2IUKA 2HMNB 3MG2A 1MOLA 1HU9A 1SIIA 1UUVB 1Z1SA 2GEXA 3SOYA 3PCSA 3EC9A 4RNZA 5AIFA 1OHSA 2HMOB 1OACA 4IPBA 2CH9A 1DVCA 1A2VA 5AIHA 2ZDJA 3M8CA 2WO0A 3KSPA 5A0OB 3SLUA 3JUNA 2I9WA 1UW1A 1N8R4 5CF2A 3UJMA 5DREA 2OOVA 3G8ZA 1QALA 5IEOA 2CK3H 1MNLA 1STDA 1FUWA 1OHPA 3EN1B 2BO9B 4HM5B 1YHQ3 3BB9A 3X42A 1QAKA 3LMLA 1IT7A 1LOXA 3GZXB 2FGTA 5ELUA 1G96A 1W7CA 4FMBA 2GEYA 3FG1A 3KN4A 4CDLA 1KSIA 5AEWB 1O7HB 3WA2X 1M904 3CNMA 2OCTA 1JB5A 3AMOA 1W01A 4L8OA 3G713 1VQP3 5IG3A 3ALAA 1YGEA 3CXC2 4N6V0 5IERA 3JVCA 1W2B2 1IVVA 2WGQA 3EF8A 3NQZA 1AR0A 2Z7AA 1ZX2A 2YFIB 2K0MA 3CPOA 4OK0A 1US1A 1GY5A 1K734 1FGQA 8CHOA 2OQEA 5IENA 2WOHA 1IQXA 1C7HA 4R80A 1K8A4 1W00A 4K1VA 1NB3I 3K0ZA 1ULIB 3SXXA 1E3RA 4MJDA 1W6CA 3OX9A 3QRDA 5ELJA 5IG5A 2A15A 3UL6A 4HYZA 1O7MB 3CCE3 3NM7A 1DMQA 3X3ZA 2QA43 1RRLA 2OQEC 3DGLA 2Q07A 1VQL3 4FMAA 3Q1CA 3D3LA 1ROVA 3MSOA 4HZBB 4XBTA 3SEDA 5LC7A 2E2UA 1ZO2A 3EBYA 4J9AA 4R4KA 2OTJ3 1R4CA 4FCJA 3DGMA 3T8UA 2CWUA 1KWIA 2XSHB 3KZTA 3S27A 1YJ93 1D6UA 1TUHA 4K1UA 3N9HA 2F86B 3BNDA 4L7KA 5AI1A 3O8YA 2HMLB 4LGQA 1GY7A 4K90B 3HI7A 2WGOA 4H3UA 2GBWB 2GU3A 1JKGA 3T0UA 2GU1A 1VQK3 1A67A 2P38A 3DMCA 2YX9A 1UI8A 4KFFA 5CLKA 1ISKA 3GAXA 2C11A 3H51A 5JPPA 1JB4A 1YJW3 2W9PA 2YFJB 5BVBA 2HMKB 5EVHA 3CCV3 3JUOA 3NM2A 2P09A 2JDIH 1CYVA 3F7XA 3LZAA 3T8NA 1V74A 2CWVA 3WODG 2RSXA 2CKFB 1FGOA 4EBGA 5I97A 2IUJA 6STDA 5DRVA 3N8BA 4RNYA 1O7GB 1K9M4 1W5ZA 2V1LA 4EV5A 2GBXB 3LXUX 3K5TA 4KFEA 4U13A 1N9EA 2WOFA 2UX0A 2E2TA 4CCVA 1EA2A 3OWYA 4N6TA 5KP4A 5KP3A 1NB5I 2SBLA 3FGYA 2CG1A 4GB5A 3WDGB 2W6JH 1WMOA 3I553 3NUVA 2B24B 3NXJA 4I4KA 3K7CA 3X3YA 3CD63 4L8PA 4HKVB 3F14A 2QEX3 4O02B 1W02A 3SVAA 3CCM3 3NHXA 4RZMA 3FCSB 3S29A 2O3OA 2LYXA 1N5PA 4QWTA 3N54B 1L5GB 1NJI4 2D42A 1WNHA 3EJVA 3D9RA 3NBRA 2W04A 1FGTA 1TP6A 3NBJA 4WFOA 1JN5A 3NQYA 1Q814 2CG0A 1LNHA 1RKYA 5HGRA 3H3HA 1EG9B 3WOFB 2OOVC 2W03A 4X2OA 1DMMA 2MF7A 3Q90A 1OHOA 3GZYB 4HJLB 2RCDA 2XH9A 3JUPA 2CHCA 2HMJB 1Q42A 4JRFA 4HZ9B 3CCL3 4O2HA 3S67A 1IK3A 3V99A 1RRHA 1WQLB 2HMMB 1A2KA 1STFI 1IQYA 3E99A 4BTXA 1OGZA 2RGQA 1JN5B 2LQVA 3CCS3 1Q40B 3MYTA 3ER7A 1ASKA 1ULJB 1D6YA 1O7PB 2CC3A 3BNCA 3DGNA 3U97A 1VQO3 4RBNA 1VQM3 1OUNA 1NO3A 3MG3A 2XF3A 5IF6A 3LT9A 2K54A 3CPW2 1D6ZA 3PZWA 1U8CB 1CYUA 1GY6A 2P0MA 3NX0A 3K9MC 3ROBA 1UI7A 3EX9A 4AKZA 4BTWA 1LXEA 4NHFA 2Y73A 1U5OA 3J7Yd 4MMXB 3SX1A 3CCR3 1IQ8A 2XGNA 3WMDA 1YVBI 2JQ5A 1GS3A 1SQWA 3CNXA 1QVG2 3ECFA 1IT8A 1DMNA 3MKIA 4MMYB 1SJWA 1Y4KA 4XM4A 3DUKA 3UL5A 5STDA 3EB8A 2RFRA 1AVLA 1O7NB 2D1WA 4N6OB 3LTAA 3RGRA 4Q53A 1OCVA 3K63A 3MG1A 1OPYA 4FCZA 3A76A 2R4IA 4PEJA 3CCQ3 1K41A 2STDA 1E97A 3PS8A 3MPHA 3NV0B 1N8QA 5KP1A 1ROAA 3G0KA 1QMAA 1VZZA 1GYBA 1VQ43 3OXAA 1S723 4HM7B 3IJEB 4ZM8A 3HK4A 2CFGA 2CFWA 2Y74A 4OUQA 5AIIA 3S28A 2ML6A 4HM6B 2CFKA 1PFPA 5FGOA 3U1WA 4EV2A 1IDPA 3NV0A 3IPTA 2CWTA 4XB5A 2YFLB 3LTDA 3KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB5 A;  3B4P A;  4GB5 A;  3KE7 A;  3NUV A;  2B24 B;  3NXJ A;  1W01 A;  4LEH A;  1JKG B;  1OF5 B;  2OWP A;  3FF2 A;  4L8O A;  4I4K A;  3K7C A;  5CXO A;  3OV4 A;  5TGN A;  4L8P A;  4HKV B;  3MHE A;  5IG3 A;  3B4O A;  3F14 A;  1W02 A;  3GWR A;  3LYG A;  3NHX A;  4RZM A;  5D81 A;  4WP5 A;  5IER A;  3F40 A;  4HVN A;  3VGN A;  4HM3 B;  3EF8 A;  4HM8 B;  1AR0 A;  2Z7A A;  1ZX2 A;  2YFI B;  3CPO A;  5IEP A;  2W2C A;  1GY5 A;  3EJV A;  3STD A;  8CHO A;  5IEN A;  3D9R A;  1W6Y A;  3NBR A;  4IIA A;  1C7H A;  1TP6 A;  2PZV A;  1JN5 A;  3FF0 A;  4OVM A;  4FCM A;  1OF5 A;  5HGR A;  3H3H A;  3EHC A;  1EG9 B;  3I0Y A;  3OWS A;  5D82 A;  5D83 A;  1W00 A;  3FZW A;  3FSD A;  4K1V A;  4X2O A;  1DMM A;  3K0Z A;  1ULI B;  1OGX A;  1NWW A;  1E3R A;  3F8H A;  3Q90 A;  4MJD A;  1OHO A;  5AEU B;  3F7S A;  3OX9 A;  3GZY B;  4HJL B;  4HM1 B;  2RCD A;  3VSY A;  3JUP A;  2A15 A;  5IG5 A;  2CHC A;  2HMJ B;  4R9K A;  1Q42 A;  2B1X B;  5IG0 A;  2GXF A;  3G16 A;  3FLJ A;  1O7M B;  1O7W B;  2QGU A;  4HZ9 B;  3JUM A;  1DMQ A;  3GZB A;  4J8T A;  2INX A;  3CU3 A;  2XR8 B;  3GRD A;  1BUQ A;  1JB2 A;  1WQL B;  2HMM B;  1A2K A;  3MSO A;  3GZR A;  4HZB B;  3E99 A;  4XBT A;  3SED A;  4N3V A;  1OGZ A;  4XDV A;  2RGQ A;  2QIY A;  3S5C A;  1JN5 B;  2F99 A;  5CK6 A;  1Q40 B;  5FW5 A;  1ZO2 A;  3EBY A;  3ER7 A;  3MYT A;  4J9A A;  3DXO A;  4R1K A;  1ASK A;  1ULJ B;  4FCJ A;  1O7P B;  3SOA A;  3T8U A;  5BXQ A;  1OUN A;  3B7C A;  3MG3 A;  4XDW A;  2XRX B;  5IF6 A;  2XSH B;  3F8X A;  3KZT A;  2K54 A;  4XBX A;  1TUH A;  2XSO B;  2BMO B;  4K1U A;  3F9S A;  3EN8 A;  1GY6 A;  2Z77 A;  4STD A;  7STD A;  4X2H A;  2F86 B;  4L7K A;  3ROB A;  3EX9 A;  3HX8 A;  5AI1 A;  3DZL A;  2HML B;  4LGQ A;  5IG4 A;  1GY7 A;  1E3V A;  4H3U A;  2GBW B;  2BMR B;  4ORL A;  1JKG A;  1U5O A;  3FH1 A;  3FKA A;  1HKX A;  3OWU A;  1UUW B;  4KVH A;  4WYK B;  3WMD A;  1QJG A;  3HZP A;  4HM0 B;  3DMC A;  1NU3 A;  4R9L A;  2JQ5 A;  1GS3 A;  3CNX A;  2HMN B;  3MG2 A;  4WYK A;  1OH0 A;  3UNL A;  1NDO B;  1UUV B;  5CLK A;  3ECF A;  1Z1S A;  1ISK A;  1DMN A;  2GEX A;  3SOY A;  3MKI A;  2IMJ A;  1SJW A;  1S5A A;  1JB4 A;  3EC9 A;  3DUK A;  3EBT A;  3H51 A;  3BLZ A;  4XBY A;  4XM4 A;  2YFJ B;  5STD A;  5AIF A;  1OHS A;  2HMO B;  2HMK B;  1O7N B;  2RFR A;  3EQQ B;  3JUO A;  5AIH A;  5EVH A;  3NM2 A;  4Q53 A;  3RGR A;  1OCV A;  3M8C A;  5G2G A;  3KSP A;  3MG1 A;  1OPY A;  2BMQ B;  3A76 A;  2R4I A;  4PEJ A;  3RGA A;  1K41 A;  2STD A;  3F7X A;  3JUN A;  1CQS A;  1E97 A;  2I9W A;  3LZA A;  3T8N A;  3NV0 B;  5CF2 A;  3UJM A;  2CKF B;  5KP1 A;  1Q40 A;  2BNG A;  5DRE A;  3G0K A;  6STD A;  5CF1 A;  1QMA A;  3G8Z A;  5IEO A;  5JPP A;  1VZZ A;  5DRV A;  1GYB A;  1STD A;  5JPU A;  1O7G B;  1OHP A;  3EN1 B;  4HM2 B;  5AIG A;  3OXA A;  4LMI A;  4HM5 B;  3BB9 A;  4HM7 B;  4WWU C;  2Z76 A;  2GBX B;  3HK4 A;  3GZX B;  3JUQ A;  3B8L A;  4OUQ A;  5AII A;  2GEY A;  4HM6 B;  2F98 A;  4HM4 B;  4U13 A;  2UX0 A;  4CDL A;  1IDP A;  5BVB A;  3NV0 A;  1EA2 A;  3OWY A;  3IPT A;  1O7H B;  5KP3 A;  5AEW B;  5KP4 A;  3FGY A;  4XB5 A;  2YFL B;  3DM8 A;  3CNM A;  3KKG A; 
#chains in the Genus database with same CATH topology
 3TDG A;  2IY2 A;  3KE7 A;  3PYJ A;  4LEH A;  1OF5 B;  3FF2 A;  2IA7 A;  5EQL A;  4LSO A;  3OV4 A;  3X41 A;  4EXR A;  2BT3 A;  3MHE A;  3UB1 A;  2CFL A;  2BHM A;  6GSP A;  2ZL8 A;  1NNV A;  3GSP A;  2KF6 A;  4HVN A;  3VGN A;  4HM3 B;  1GD4 A;  4HM8 B;  1HYF A;  1VQ6 3;  4MEI A;  1TTO A;  2W2C A;  5IEP A;  1JJ2 2;  3BU4 A;  3STD A;  1KQS 2;  4EYC A;  1C54 A;  4H61 A;  2P05 A;  3FF0 A;  1EQK A;  4OVM A;  4GSP A;  1OF5 A;  2H0H A;  3IMA B;  7RNT A;  1TFK A;  3I0Y A;  1TRQ A;  4N6L A;  4N6N B;  3FSD A;  4KZ1 A;  2PNC A;  1OGX A;  1NWW A;  3F8H A;  1IVW A;  3I56 3;  1WMP A;  1VQN 3;  3F7S A;  3LOY A;  4GHO A;  4WHA A;  1BIR A;  3VSY A;  5AYR B;  1YIJ 3;  1TIJ A;  2B1X B;  2GXF A;  1A90 A;  1O7W B;  1BAO A;  2L1S A;  4N6U A;  4LZI A;  5RNT A;  4J8T A;  3V92 A;  1Q86 4;  3GRD A;  1BRG A;  1IVX A;  1W4N A;  3CME 3;  2XEP A;  1SPU A;  4HBR A;  2R41 A;  3GZR A;  2FXT A;  4N3V A;  4TX4 A;  3CC4 3;  4XDV A;  2KCD A;  3L0R A;  3S5C A;  2F99 A;  4MMZ B;  2F5M A;  5FW5 A;  4HOH A;  3DXO A;  2FNQ A;  1N9J A;  4R1K A;  4O8S A;  1W2Z A;  1QAF A;  3QK9 A;  3BNE A;  3B7C A;  4O3V A;  2XRX B;  1FGR A;  3F8X A;  1N5H A;  1I2E A;  4FMC A;  1WMN A;  3D5G A;  2P0X A;  4XBX A;  5GSP A;  2BMO B;  1T2I A;  1Q7Y 4;  1TU5 A;  3EN8 A;  3X3X A;  4KFD A;  4CJN A;  4N6M A;  1VQ8 3;  3DZL A;  1JV2 B;  1UUG B;  2CIU A;  2BMR B;  2ML5 A;  1JRQ A;  1B2U A;  1SAR A;  3DGO A;  3AMO B;  1IU7 A;  3FH1 A;  3FKA A;  3FG3 A;  3HII A;  3LTC A;  1YNV X;  1I2G A;  1MWS A;  3HZP A;  1NU3 A;  3KSE D;  4HM0 B;  3UNL A;  1JZD A;  2F5W A;  2Z6B A;  1OH0 A;  1NDO B;  1M1X B;  3X40 A;  2H0G A;  2IMJ A;  3WOE B;  1S5A A;  3EBT A;  4NRE A;  4LYL B;  1MWT A;  3BLZ A;  4XBY A;  2XFS A;  1YI2 3;  3EQQ B;  1UDI I;  3PGB A;  5JBS A;  1VQQ A;  2CFD A;  4IT7 A;  2KAA A;  5G2G A;  3CCJ 3;  3OW2 2;  2OTL 3;  2BMQ B;  2XFT A;  4BL3 A;  1BNI A;  3RGA A;  1KD1 4;  1CQS A;  1GOV A;  5EEO A;  4JF8 A;  1LOY A;  1Q40 A;  2BNG A;  3HOH A;  1VQ7 3;  5CF1 A;  2W56 B;  2O9U X;  5IW9 A;  1G02 A;  2XGL A;  5JPU A;  1AV4 A;  4HM2 B;  5AIG A;  4LMI A;  1DVD A;  4WWU C;  2GSP A;  2Z76 A;  3NBB A;  3FG4 A;  3JUQ A;  1B2M A;  3B8L A;  2K3D A;  2W56 A;  1MGR A;  1IVU A;  1RN7 A;  4G1M B;  4HM4 B;  2F98 A;  1I0X A;  5HOH A;  1AVK A;  1FZU A;  3KFQ C;  1RJO A;  4BIR A;  1KC8 4;  5AYS C;  3DM8 A;  1BU4 A;  3B4P A;  1TFO A;  1JKG B;  5CXO A;  2OWP A;  5TGN A;  1WTH A;  3AGN A;  3RDE A;  3DY5 A;  1T5Y A;  3B4O A;  2E2V A;  3GWR A;  3LYG A;  1W6G A;  5D81 A;  1YJN 3;  4WP5 A;  1VQ5 3;  1I0V A;  3F40 A;  4I5Q A;  1IV7 A;  1F8N A;  4AKY A;  3KII A;  1QVF 2;  1YIT 3;  5M1A A;  1J2B A;  1K28 A;  4AEQ A;  4BL2 A;  3LT8 A;  2KF3 A;  3BNB A;  1W6Y A;  3EE1 A;  3PCR A;  4IIA A;  1I2F A;  5G1L A;  2PZV A;  3CCU 3;  3G6E 3;  4FCM A;  5D82 A;  3EHC A;  3OWS A;  1LRA A;  3MWZ A;  4FR9 A;  5D83 A;  1PU4 A;  3FZW A;  2H0I A;  1DET A;  1B2X A;  1IV9 A;  1GD3 A;  5LC6 A;  5AEU B;  2W0Q A;  2M7O A;  1I3I A;  1GMQ A;  1A2P A;  1DYU A;  4HM1 B;  1BRS A;  1Q82 4;  1LVN A;  4R9K A;  1PY3 A;  5IG0 A;  1SIH A;  2KF4 A;  3G16 A;  3FLJ A;  3G4S 3;  2QGU A;  4FMD A;  1TRP A;  3JUM A;  3GZB A;  2INX A;  3HIG A;  2MC8 A;  1FYS A;  2KRT A;  3CU3 A;  2XR8 B;  1BUQ A;  2W9Q A;  1YVS A;  2C10 A;  1JB2 A;  4K61 A;  1BNR A;  5AI1 A;  3VF1 A;  2QIY A;  1R4Y A;  7GSP A;  1M1K 4;  3Q2P A;  5CK6 A;  3LH4 A;  1VQ9 3;  3PXM A;  4GL6 A;  3SOA A;  3DH2 A;  5BXQ A;  2L4V A;  1M9G A;  4XDW A;  3V98 A;  4BTY A;  4J5G A;  3CMA 3;  1GOY A;  2XSO B;  3F9S A;  3CC2 3;  3WA3 A;  1I8V A;  1FA3 A;  2Z77 A;  4STD A;  7STD A;  1EKM A;  4X2H A;  3HX8 A;  1CEW I;  2CW9 A;  5IG4 A;  1JNQ A;  1E3V A;  3LTB A;  3URP A;  1UGI A;  4ORL A;  3CC7 3;  4KVH A;  1HKX A;  4WYK B;  1UUW B;  4EC6 A;  2KXG A;  1QJG A;  1FGM A;  4R9L A;  3BIR A;  2IUK A;  4WYK A;  2HMN B;  3MG2 A;  1MOL A;  1HU9 A;  1SII A;  1UUV B;  1Z1S A;  2GEX A;  3SOY A;  3PCS A;  3EC9 A;  4RNZ A;  1PYL A;  5AIF A;  1OHS A;  2HMO B;  1OAC A;  5BU4 A;  1RLS A;  2CH9 A;  1DVC A;  1A2V A;  1B3S A;  4IPB A;  2ZDJ A;  3M8C A;  2WO0 A;  1RDS A;  3KSP A;  5A0O B;  5BIR A;  3SLU A;  3JUN A;  2I9W A;  1RCL A;  1UCI A;  1UW1 A;  5CF2 A;  1N8R 4;  3UJM A;  3SYU A;  1FUT A;  5DRE A;  2HOH A;  2OOV A;  3G8Z A;  1QAL A;  1X1W A;  5IEO A;  1FW7 A;  2CK3 H;  1MNL A;  1STD A;  1FUW A;  1OHP A;  3EN1 B;  2BO9 B;  4HM5 B;  1YHQ 3;  3BB9 A;  3X42 A;  1QAK A;  3LML A;  1IT7 A;  1LOX A;  3GZX B;  2FGT A;  5ELU A;  1G96 A;  1W7C A;  4FMB A;  2GEY A;  3FG1 A;  2ZHX B;  1Q9E A;  1RTU A;  3KN4 A;  1BRJ A;  4CDL A;  1LNI A;  1KSI A;  5AEW B;  1BRH A;  1O7H B;  1LOV A;  1JBT A;  3WA2 X;  1M90 4;  3CNM A;  2OCT A;  5AIH A;  1JB5 A;  4DKI A;  3AMO A;  1W01 A;  4L8O A;  3G71 3;  1UGH I;  1VQP 3;  2UUG C;  5IG3 A;  3ALA A;  1YGE A;  3CXC 2;  4N6V 0;  5IER A;  3JVC A;  1W2B 2;  1IVV A;  2WGQ A;  3EF8 A;  3NQZ A;  1AR0 A;  2Z7A A;  1ZX2 A;  2YFI B;  2K0M A;  3CPO A;  4OK0 A;  1US1 A;  1GY5 A;  1JBR A;  1K73 4;  1FGQ A;  8CHO A;  2OQE A;  5IEN A;  2WOH A;  1IQX A;  1C7H A;  9RNT A;  4R80 A;  1BNE A;  2SAR A;  1CH0 A;  1K8A 4;  1MWU A;  1W00 A;  4K1V A;  1NB3 I;  3K0Z A;  1ULI B;  3SXX A;  1I70 A;  1E3R A;  1GOU A;  4MJD A;  6RNT A;  1BRI A;  1W6C A;  3OX9 A;  1GMP A;  3QRD A;  5ELJ A;  5IG5 A;  1AQZ A;  2A15 A;  1I3F A;  1V57 A;  4KT3 B;  5G1K A;  3UL6 A;  4HYZ A;  1O7M B;  1BAN A;  3CCE 3;  1BUJ A;  1RGA A;  3NM7 A;  1DMQ A;  1G0T A;  3X3Z A;  2QA4 3;  1RRL A;  2OQE C;  3DGL A;  1BSC A;  2Q07 A;  1VQL 3;  4FMA A;  3Q1C A;  3D3L A;  1RN1 A;  3OWU A;  1ROV A;  3MSO A;  4HZB B;  4XBT A;  3SED A;  5LC7 A;  3ZFZ A;  1HZ1 A;  1RNT A;  2E2U A;  1ZO2 A;  3EBY A;  4J9A A;  4R4K A;  2OTJ 3;  1R4C A;  4FCJ A;  3DGM A;  3T8U A;  2CWU A;  1KWI A;  1JBS A;  2XSH B;  1RCK A;  3KZT A;  3S27 A;  1YJ9 3;  1D6U A;  1TUH A;  2BU4 A;  1B2S A;  4K1U A;  3N9H A;  2F86 B;  2UGI A;  3BND A;  1BNF A;  3D5I A;  3O8Y A;  1BSD A;  4L7K A;  2HML B;  4LGQ A;  4NPB A;  1GY7 A;  4K90 B;  3HI7 A;  2WGO A;  4H3U A;  2GBW B;  2GU3 A;  1JKG A;  3DGY A;  2GU1 A;  1V58 A;  3T0U A;  1VQK 3;  3A5E A;  1RNB A;  1A67 A;  2P38 A;  1BOX A;  3DMC A;  2YX9 A;  1UCJ A;  2F4Y A;  1UI8 A;  4KFF A;  5CLK A;  1ISK A;  3GAX A;  2C11 A;  3H51 A;  5JPP A;  1JB4 A;  1YJW 3;  1RGF A;  2W9P A;  2YFJ B;  5BVB A;  1BNS A;  2HMK B;  1RGH A;  5EVH A;  3CCV 3;  3JUO A;  3NM2 A;  2P09 A;  2ZA4 A;  2JDI H;  8RNT A;  1CYV A;  3F7X A;  3LZA A;  3T8N A;  1V74 A;  2CWV A;  3WOD G;  2RSX A;  2CKF B;  2RBI A;  1FGO A;  4EBG A;  5I97 A;  1BVI A;  1X1X A;  2IUJ A;  6STD A;  4HAA A;  5DRV A;  4EW5 A;  3N8B A;  4RNY A;  1O7G B;  1K9M 4;  1RMS A;  1W5Z A;  2V1L A;  1RN4 A;  4CPK A;  1RGE A;  4RNT A;  4EV5 A;  2GBX B;  3LXU X;  3K5T A;  1RSN A;  4KFE A;  4U13 A;  1N9E A;  2WOF A;  3D79 A;  1JZO A;  2UX0 A;  1IYY A;  1B27 A;  2E2T A;  4CCV A;  1EA2 A;  3OWY A;  4N6T A;  1BNJ A;  5KP3 A;  5KP4 A;  1NB5 I;  1Q7H A;  1BGS A;  2SBL A;  3FGY A;  2CG1 A;  4GB5 A;  3WDG B;  2W6J H;  1WMO A;  3I55 3;  3NUV A;  2B24 B;  3NXJ A;  4I4K A;  3K7C A;  3X3Y A;  1RGK A;  3CD6 3;  4L8P A;  1BSE A;  4HKV B;  1B20 A;  1T2H A;  2AAE A;  3F14 A;  2QEX 3;  4O02 B;  1W02 A;  3SVA A;  3CCM 3;  3NHX A;  4RZM A;  3FCS B;  3S29 A;  2O3O A;  2LYX A;  1N5P A;  2F56 A;  4QWT A;  3N54 B;  3ZG0 A;  1L5G B;  1NJI 4;  1EUI C;  2D42 A;  1WNH A;  3EJV A;  1ZS7 A;  3Q3F A;  3D9R A;  1RGL A;  3NBR A;  2W04 A;  1FGT A;  1TP6 A;  3NBJ A;  4WFO A;  1JN5 A;  3NQY A;  1Q81 4;  2CG0 A;  1LNH A;  1T3B A;  1RKY A;  1B2Z A;  1UCK A;  3H3H A;  5HGR A;  1EG9 B;  1MGW A;  4ILF A;  2OOV C;  1RHL A;  2RNT A;  3WOF B;  2W03 A;  4X2O A;  1DMM A;  2AAD A;  2MF7 A;  3Q90 A;  3WR2 A;  1DE3 A;  1OHO A;  3GZY B;  4HJL B;  2RCD A;  2XH9 A;  3JUP A;  2CHC A;  2HMJ B;  1Q42 A;  4JRF A;  5M19 A;  4HZ9 B;  3CCL 3;  4O2H A;  3AHW A;  3S67 A;  1IK3 A;  3V99 A;  1RRH A;  1WQL B;  1BRK A;  3ZG5 A;  2HMM B;  1A2K A;  1RGC A;  1STF I;  1IQY A;  3E99 A;  4BTX A;  1UCL A;  1OGZ A;  4J5K A;  2RGQ A;  1X1Y A;  1JN5 B;  2LQV A;  3CCS 3;  1Q40 B;  3WHO A;  3MYT A;  3ER7 A;  1ASK A;  1ULJ B;  1D6Y A;  1O7P B;  2CC3 A;  1TJD A;  3BNC A;  3DGN A;  3U97 A;  5M18 A;  1VQO 3;  4RBN A;  1VQM 3;  1OUN A;  1NO3 A;  3MG3 A;  2XF3 A;  1FUS A;  5IF6 A;  4BU4 A;  3LT9 A;  2K54 A;  1MWR A;  3CPW 2;  1LOW A;  1D6Z A;  3PZW A;  1U8C B;  1CYU A;  1BRN L;  1GY6 A;  2P0M A;  3NX0 A;  3K9M C;  3ROB A;  1B21 A;  1UI7 A;  3EX9 A;  4AKZ A;  2CX0 A;  1EEJ A;  1LQM B;  1BSA A;  1LXE A;  4BTW A;  3AGO A;  4NHF A;  2Y73 A;  1U5O A;  1GMR A;  3J7Y d;  4MMX B;  3SX1 A;  3CCR 3;  1IQ8 A;  1X1U A;  2XGN A;  2C4B A;  1YVB I;  3WMD A;  2JQ5 A;  1GS3 A;  1SQW A;  3CNX A;  2IYJ A;  1QVG 2;  3ECF A;  1IT8 A;  1DMN A;  3MKI A;  4MMY B;  1SJW A;  1Y4K A;  1LQG C;  4XM4 A;  3DUK A;  3UL5 A;  5STD A;  1AVL A;  2D1W A;  1O7N B;  2RFR A;  3EB8 A;  4N6O B;  3LTA A;  3RGR A;  4Q53 A;  1OCV A;  3K63 A;  3MG1 A;  1OPY A;  4FCZ A;  3A76 A;  2R4I A;  4PEJ A;  3CCQ 3;  1K41 A;  2STD A;  1ZGX A;  1E97 A;  3AHS A;  3PS8 A;  3MPH A;  3NV0 B;  1BSB A;  1N8Q A;  5KP1 A;  1ROA A;  3KCH A;  3G0K A;  1QMA A;  2BIR A;  1VZZ A;  1GYB A;  1VQ4 3;  3D4A A;  3OXA A;  1S72 3;  1RGG A;  4HM7 B;  3IJE B;  4ZM8 A;  3HK4 A;  2CFG A;  2CFW A;  2KF5 A;  2Y74 A;  1AY7 A;  4OUQ A;  2ML6 A;  5AII A;  3S28 A;  4HM6 B;  2CFK A;  1PFP A;  1BNG A;  5FGO A;  3U1W A;  2J8X B;  1IDP A;  2CX1 A;  4EV2 A;  3NV0 A;  3IPT A;  2CWT A;  1YGW A;  4XB5 A;  2YFL B;  3LTD A;  3RNT A;  3KKG A;  1GSP A; 
#chains in the Genus database with same CATH homology
 3TDG A;  3KE7 A;  3PYJ A;  4LEH A;  1OF5 B;  3FF2 A;  2IA7 A;  5EQL A;  4LSO A;  3OV4 A;  3X41 A;  4EXR A;  2BT3 A;  3MHE A;  3UB1 A;  2CFL A;  2BHM A;  2ZL8 A;  4HVN A;  3VGN A;  4HM3 B;  1GD4 A;  4HM8 B;  1VQ6 3;  4MEI A;  2W2C A;  5IEP A;  1JJ2 2;  3STD A;  1KQS 2;  4EYC A;  4H61 A;  2P05 A;  3FF0 A;  1EQK A;  4OVM A;  1OF5 A;  3IMA B;  1TFK A;  3I0Y A;  4N6N B;  4N6L A;  3FSD A;  4KZ1 A;  2PNC A;  1OGX A;  1NWW A;  3F8H A;  1IVW A;  3I56 3;  1WMP A;  1VQN 3;  3F7S A;  3LOY A;  4WHA A;  3VSY A;  5AYR B;  1YIJ 3;  1TIJ A;  2B1X B;  2GXF A;  1A90 A;  1O7W B;  4N6U A;  4LZI A;  4J8T A;  3V92 A;  1Q86 4;  3GRD A;  1IVX A;  1W4N A;  3CME 3;  2XEP A;  1SPU A;  4HBR A;  3GZR A;  2FXT A;  4N3V A;  4TX4 A;  3CC4 3;  4XDV A;  2KCD A;  3L0R A;  3S5C A;  2F99 A;  4MMZ B;  5FW5 A;  3DXO A;  2FNQ A;  1N9J A;  4R1K A;  4O8S A;  1W2Z A;  1QAF A;  3QK9 A;  3BNE A;  3B7C A;  4O3V A;  2XRX B;  1FGR A;  3F8X A;  1N5H A;  4FMC A;  1WMN A;  2P0X A;  4XBX A;  2BMO B;  1Q7Y 4;  1TU5 A;  3EN8 A;  3X3X A;  4KFD A;  4N6M A;  1VQ8 3;  3DZL A;  1JV2 B;  2CIU A;  2BMR B;  2ML5 A;  1JRQ A;  3DGO A;  3FH1 A;  3FKA A;  3AMO B;  1IU7 A;  3HII A;  3FG3 A;  3OWU A;  3LTC A;  3HZP A;  4HM0 B;  1NU3 A;  3KSE D;  3UNL A;  2Z6B A;  1OH0 A;  1NDO B;  1M1X B;  3X40 A;  2IMJ A;  3WOE B;  3EBT A;  1S5A A;  4NRE A;  3BLZ A;  4XBY A;  2XFS A;  1YI2 3;  3EQQ B;  5JBS A;  3PGB A;  2CFD A;  4IT7 A;  3CCJ 3;  5G2G A;  3OW2 2;  2OTL 3;  2BMQ B;  2XFT A;  1KD1 4;  3RGA A;  1CQS A;  5EEO A;  4JF8 A;  1Q40 A;  2BNG A;  1VQ7 3;  5CF1 A;  2W56 B;  2O9U X;  5IW9 A;  2XGL A;  5JPU A;  1AV4 A;  4HM2 B;  5AIG A;  4LMI A;  1DVD A;  4WWU C;  2Z76 A;  3NBB A;  3FG4 A;  3JUQ A;  3B8L A;  2W56 A;  4G1M B;  1RN7 A;  1IVU A;  4HM4 B;  2F98 A;  1AVK A;  3KFQ C;  1RJO A;  1KC8 4;  5AYS C;  3DM8 A;  3B4P A;  1TFO A;  1JKG B;  5CXO A;  2OWP A;  5TGN A;  1WTH A;  3RDE A;  3DY5 A;  1T5Y A;  3B4O A;  2E2V A;  3GWR A;  3LYG A;  1W6G A;  5D81 A;  1YJN 3;  4WP5 A;  1VQ5 3;  3F40 A;  1IV7 A;  1F8N A;  4AKY A;  3KII A;  1QVF 2;  1YIT 3;  1J2B A;  1K28 A;  4AEQ A;  3LT8 A;  3BNB A;  3EE1 A;  1W6Y A;  3PCR A;  4IIA A;  2PZV A;  3CCU 3;  3G6E 3;  4FCM A;  5D82 A;  3EHC A;  3OWS A;  3MWZ A;  4FR9 A;  1PU4 A;  5D83 A;  3FZW A;  1IV9 A;  1GD3 A;  5LC6 A;  5AEU B;  2W0Q A;  2M7O A;  1DYU A;  4HM1 B;  1Q82 4;  1LVN A;  4R9K A;  5IG0 A;  1SIH A;  3G16 A;  3FLJ A;  3G4S 3;  2QGU A;  4FMD A;  3JUM A;  3GZB A;  2INX A;  3HIG A;  2MC8 A;  2KRT A;  3CU3 A;  2XR8 B;  1BUQ A;  2W9Q A;  2C10 A;  1JB2 A;  4K61 A;  3VF1 A;  2QIY A;  1M1K 4;  3Q2P A;  5CK6 A;  3LH4 A;  1VQ9 3;  3PXM A;  4GL6 A;  3SOA A;  5BXQ A;  2L4V A;  1M9G A;  4XDW A;  3V98 A;  4BTY A;  3CMA 3;  2XSO B;  3F9S A;  3CC2 3;  3WA3 A;  1FA3 A;  2Z77 A;  4STD A;  7STD A;  1EKM A;  4X2H A;  3HX8 A;  1CEW I;  2CW9 A;  5IG4 A;  1JNQ A;  1E3V A;  3LTB A;  4ORL A;  3CC7 3;  4KVH A;  1HKX A;  4WYK B;  1UUW B;  4EC6 A;  2KXG A;  1QJG A;  1FGM A;  4R9L A;  4WYK A;  2IUK A;  2HMN B;  3MG2 A;  1MOL A;  1HU9 A;  1SII A;  1UUV B;  1Z1S A;  2GEX A;  3SOY A;  3PCS A;  3EC9 A;  4RNZ A;  5AIF A;  1OHS A;  2HMO B;  1OAC A;  4IPB A;  2CH9 A;  1DVC A;  1A2V A;  5AIH A;  2ZDJ A;  3M8C A;  2WO0 A;  3KSP A;  5A0O B;  3SLU A;  3JUN A;  2I9W A;  1UW1 A;  1N8R 4;  5CF2 A;  3UJM A;  5DRE A;  2OOV A;  3G8Z A;  1QAL A;  5IEO A;  2CK3 H;  1MNL A;  1STD A;  1FUW A;  1OHP A;  3EN1 B;  2BO9 B;  4HM5 B;  1YHQ 3;  3BB9 A;  3X42 A;  1QAK A;  3LML A;  1IT7 A;  1LOX A;  3GZX B;  2FGT A;  5ELU A;  1G96 A;  1W7C A;  4FMB A;  2GEY A;  3FG1 A;  3KN4 A;  4CDL A;  1KSI A;  5AEW B;  1O7H B;  3WA2 X;  1M90 4;  3CNM A;  2OCT A;  1JB5 A;  3AMO A;  1W01 A;  4L8O A;  3G71 3;  1VQP 3;  5IG3 A;  3ALA A;  1YGE A;  3CXC 2;  4N6V 0;  5IER A;  3JVC A;  1W2B 2;  1IVV A;  2WGQ A;  3EF8 A;  3NQZ A;  1AR0 A;  2Z7A A;  1ZX2 A;  2YFI B;  2K0M A;  3CPO A;  4OK0 A;  1US1 A;  1GY5 A;  1K73 4;  1FGQ A;  8CHO A;  2OQE A;  5IEN A;  2WOH A;  1IQX A;  1C7H A;  4R80 A;  1K8A 4;  1W00 A;  4K1V A;  1NB3 I;  3K0Z A;  1ULI B;  3SXX A;  1E3R A;  4MJD A;  1W6C A;  3OX9 A;  3QRD A;  5ELJ A;  5IG5 A;  2A15 A;  3UL6 A;  4HYZ A;  1O7M B;  3CCE 3;  3NM7 A;  1DMQ A;  3X3Z A;  2QA4 3;  1RRL A;  2OQE C;  3DGL A;  2Q07 A;  1VQL 3;  4FMA A;  3Q1C A;  3D3L A;  1ROV A;  3MSO A;  4HZB B;  4XBT A;  3SED A;  5LC7 A;  2E2U A;  1ZO2 A;  3EBY A;  4J9A A;  4R4K A;  2OTJ 3;  1R4C A;  4FCJ A;  3DGM A;  3T8U A;  2CWU A;  1KWI A;  2XSH B;  3KZT A;  3S27 A;  1YJ9 3;  1D6U A;  1TUH A;  4K1U A;  3N9H A;  2F86 B;  3BND A;  4L7K A;  5AI1 A;  3O8Y A;  2HML B;  4LGQ A;  1GY7 A;  4K90 B;  3HI7 A;  2WGO A;  4H3U A;  2GBW B;  2GU3 A;  1JKG A;  3T0U A;  2GU1 A;  1VQK 3;  1A67 A;  2P38 A;  3DMC A;  2YX9 A;  1UI8 A;  4KFF A;  5CLK A;  1ISK A;  3GAX A;  2C11 A;  3H51 A;  5JPP A;  1JB4 A;  1YJW 3;  2W9P A;  2YFJ B;  5BVB A;  2HMK B;  5EVH A;  3CCV 3;  3JUO A;  3NM2 A;  2P09 A;  2JDI H;  1CYV A;  3F7X A;  3LZA A;  3T8N A;  1V74 A;  2CWV A;  3WOD G;  2RSX A;  2CKF B;  1FGO A;  4EBG A;  5I97 A;  2IUJ A;  6STD A;  5DRV A;  3N8B A;  4RNY A;  1O7G B;  1K9M 4;  1W5Z A;  2V1L A;  4EV5 A;  2GBX B;  3LXU X;  3K5T A;  4KFE A;  4U13 A;  1N9E A;  2WOF A;  2UX0 A;  2E2T A;  4CCV A;  1EA2 A;  3OWY A;  4N6T A;  5KP4 A;  5KP3 A;  1NB5 I;  2SBL A;  3FGY A;  2CG1 A;  4GB5 A;  3WDG B;  2W6J H;  1WMO A;  3I55 3;  3NUV A;  2B24 B;  3NXJ A;  4I4K A;  3K7C A;  3X3Y A;  3CD6 3;  4L8P A;  4HKV B;  3F14 A;  2QEX 3;  4O02 B;  1W02 A;  3SVA A;  3CCM 3;  3NHX A;  4RZM A;  3FCS B;  3S29 A;  2O3O A;  2LYX A;  1N5P A;  4QWT A;  3N54 B;  1L5G B;  1NJI 4;  2D42 A;  1WNH A;  3EJV A;  3D9R A;  3NBR A;  2W04 A;  1FGT A;  1TP6 A;  3NBJ A;  4WFO A;  1JN5 A;  3NQY A;  1Q81 4;  2CG0 A;  1LNH A;  1RKY A;  5HGR A;  3H3H A;  1EG9 B;  3WOF B;  2OOV C;  2W03 A;  4X2O A;  1DMM A;  2MF7 A;  3Q90 A;  1OHO A;  3GZY B;  4HJL B;  2RCD A;  2XH9 A;  3JUP A;  2CHC A;  2HMJ B;  1Q42 A;  4JRF A;  4HZ9 B;  3CCL 3;  4O2H A;  3S67 A;  1IK3 A;  3V99 A;  1RRH A;  1WQL B;  2HMM B;  1A2K A;  1STF I;  1IQY A;  3E99 A;  4BTX A;  1OGZ A;  2RGQ A;  1JN5 B;  2LQV A;  3CCS 3;  1Q40 B;  3MYT A;  3ER7 A;  1ASK A;  1ULJ B;  1D6Y A;  1O7P B;  2CC3 A;  3BNC A;  3DGN A;  3U97 A;  1VQO 3;  4RBN A;  1VQM 3;  1OUN A;  1NO3 A;  3MG3 A;  2XF3 A;  5IF6 A;  3LT9 A;  2K54 A;  3CPW 2;  1D6Z A;  3PZW A;  1U8C B;  1CYU A;  1GY6 A;  2P0M A;  3NX0 A;  3K9M C;  3ROB A;  1UI7 A;  3EX9 A;  4AKZ A;  4BTW A;  1LXE A;  4NHF A;  2Y73 A;  1U5O A;  3J7Y d;  4MMX B;  3SX1 A;  3CCR 3;  1IQ8 A;  2XGN A;  3WMD A;  1YVB I;  2JQ5 A;  1GS3 A;  1SQW A;  3CNX A;  1QVG 2;  3ECF A;  1IT8 A;  1DMN A;  3MKI A;  4MMY B;  1SJW A;  1Y4K A;  4XM4 A;  3DUK A;  3UL5 A;  5STD A;  3EB8 A;  2RFR A;  1AVL A;  1O7N B;  2D1W A;  4N6O B;  3LTA A;  3RGR A;  4Q53 A;  1OCV A;  3K63 A;  3MG1 A;  1OPY A;  4FCZ A;  3A76 A;  2R4I A;  4PEJ A;  3CCQ 3;  1K41 A;  2STD A;  1E97 A;  3PS8 A;  3MPH A;  3NV0 B;  1N8Q A;  5KP1 A;  1ROA A;  3G0K A;  1QMA A;  1VZZ A;  1GYB A;  1VQ4 3;  3OXA A;  1S72 3;  4HM7 B;  3IJE B;  4ZM8 A;  3HK4 A;  2CFG A;  2CFW A;  2Y74 A;  4OUQ A;  5AII A;  3S28 A;  2ML6 A;  4HM6 B;  2CFK A;  1PFP A;  5FGO A;  3U1W A;  4EV2 A;  1IDP A;  3NV0 A;  3IPT A;  2CWT A;  4XB5 A;  2YFL B;  3LTD A;  3KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...