2HMOB

Crystal structure of naphthalene 1,2-dioxygenase bound to 3-nitrotoluene.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmoB00
5DRVA 1ASKA 1QJGA 3OWUA 2PZVA 4HJLB 2BMOB 3DXOA 1SJWA 4XM4A 1AR0A 2HMOB 5D81A 3EF8A 3MHEA 1OCVA 3MKIA 5TGNA 4FCMA 2XSOB 3STDA 3UJMA 1S5AA 3JUQA 3ECFA 3FSDA 4HM8B 1ULIB 2JQ5A 3B4OA 5AIIA 2XSHB 3G16A 3S5CA 3IPTA 4LMIA 1Q40A 1ISKA 3F9SA 1GYBA 2BMQB 2XR8B 1OGXA 5STDA 1E3RA 3EJVA 4HVNA 3NXJA 3NV0A 5IENA 5IG0A 4HKVB 2UX0A 3B7CA 2HMMB 3GZYB 3SOAA 3JUPA 2A15A 3Q90A 2GBXB 5IERA 3EBYA 2Z77A 3CNMA 2B24B 1DMQA 3K7CA 5KP4A 2B1XB 6STDA 3KE7A 3CU3A 4K1VA 2BMRB 1W01A 4R9LA 5CF2A 2YFIB 3F8HA 1OGZA 1O7NB 3KSPA 3H51A 1OF5A 5D82A 5IG4A 3EBTA 3RGRA 3FGYA 5CF1A 2GXFA 4KVHA 1GY6A 1HKXA 3H3HA 3CPOA 1NDOB 1Q40B 4HM5B 1NU3A 3F14A 1GY5A 5DREA 3EN1B 4IIAA 2K54A 3HZPA 3JUMA 4HM3B 1ULJB 1Z1SA 5IEOA 3NV0B 4XBYA 1O7HB 3OX9A 2F86B 3T8UA 5CLKA 2GBWB 1OHSA 2F99A 4L8OA 2Z76A 8CHOA 4PEJA 3DZLA 4X2OA 5IEPA 4L7KA 2YFLB 2IMJA 3G8ZA 2W2CA 4FCJA 3F7SA 5KP3A 1IDPA 3JUNA 1W00A 3ER7A 1OHPA 3FH1A 3RGAA 2GEXA 1Q42A 1JB5A 5HGRA 1CQSA 4XBTA 1WQLB 1O7MB 1OF5B 2OWPA 3T8NA 3E99A 3HX8A 2INXA 1TP6A 3EN8A 3MG2A 3KZTA 4WYKA 5FW5A 4MJDA 1OPYA 3B4PA 2QGUA 3SOYA 3ROBA 5CXOA 3NBRA 1U5OA 3GZXB 4HM7B 1JN5A 5AI1A 4WWUC 5JPUA 2HMKB 3GZRA 3F8XA 5BVBA 1E97A 5AEWB 2R4IA 4XB5A 3FLJA 3BB9A 4HZBB 4HM6B 1NWWA 1GS3A 1QMAA 3G0KA 1VZZA 5BXQA 4HM1B 1ZO2A 5IG5A 3DMCA 3EHCA 1DMNA 1C7HA 4N3VA 4HM2B 3EC9A 4RZMA 3NM2A 3FF2A 3OXAA 3MYTA 4LEHA 1STDA 4H3UA 5EVHA 2RGQA 2YFJB 2Z7AA 1O7WB 1W6YA 1JB2A 1BUQA 1ZX2A 5IF6A 3NUVA 4OVMA 4XDVA 2BNGA 3VSYA 3MSOA 3B8LA 1O7PB 1JB4A 4Q53A 4WYKB 1OH0A 4HM0B 2HMLB 3K0ZA 3F40A 1A2KA 3FF0A 3MG3A 3A76A 5AIFA 3FZWA 4J8TA 4XBXA 1JKGA 2HMJB 3M8CA 4J9AA 1K41A 3UNLA 1JN5B 5IG3A 2I9WA 1EA2A 3EX9A 1OUNA 4L8PA 5AEUB 5CK6A 3OWSA 4STDA 5D83A 4U13A 1OHOA 3BLZA 3CNXA 1TUHA 2STDA 3GRDA 4CDLA 4GB5A 4OUQA 3JUOA 3WMDA 2RCDA 3VGNA 3FKAA 5G2GA 4K1UA 1UUWB 4R1KA 4X2HA 2HMNB 4HZ9B 5AIGA 3OV4A 1EG9B 3HK4A 2F98A 3GWRA 1GY7A 3LZAA 3D9RA 4I4KA 2QIYA 4XDWA 5JPPA 3I0YA 3GZBA 4ORLA 2GEYA 1W02A 2CHCA 2CKFB 1E3VA 7STDA 1DMMA 4WP5A 3LYGA 1JKGB 1O7GB 4LGQA 4R9KA 2RFRA 2XRXB 5KP1A 5AIHA 3F7XA 3MG1A 3EQQB 3NHXA 1UUVB 3DUKA 4HM4B 3DM8A 3OWYA 3KKGA 3SEDA
chains in the Genus database with same CATH superfamily
5DRVA 1ASKA 4FMDA 1U8CB 1QJGA 2CWTA 2PZVA 3OWUA 4BU4A 4HJLB 3CCM3 1HYFA 1WNHA 4LYLB 2BMOB 3DXOA 1SJWA 4XM4A 4BL3A 1B2SA 3K5TA 1LRAA 2BIRA 3DGYA 1AR0A 1G0TA 2HMOB 1BNRA 5D81A 1RLSA 1N8R4 3EF8A 1KD14 1AV4A 3MHEA 1L5GB 1OCVA 3MKIA 5TGNA 4FCMA 1M904 2YX9A 2XSOB 1TTOA 3STDA 1YGWA 3SLUA 3UJMA 1YJ93 1S5AA 1R4YA 1RSNA 2GU1A 3SVAA 1CH0A 3NQYA 3JUQA 3KFQC 3ECFA 3FSDA 4HM8B 3PGBA 3UL6A 1VQM3 1LOYA 3WOEB 2P0XA 1ULIB 3FG1A 2JQ5A 3B4OA 1IU7A 3AGOA 3DGNA 2XH9A 3NBBA 2XSHB 5AIIA 2QEX3 1X1UA 2F4YA 2F5WA 2WOHA 1A67A 3G16A 1G02A 3S5CA 1IQXA 1EQKA 1BNJA 2CFLA 3IPTA 4R4KA 1UGHI 3K9MC 3KIIA 1VQL3 4LMIA 2OCTA 3X3ZA 1VQQA 1RKYA 1TU5A 1GMPA 3WR2A 1RHLA 1Q40A 1ISKA 1LOXA 3F9SA 1GYBA 3HIIA 3N9HA 3CCE3 3FG4A 2RBIA 3WHOA 1UCIA 2BMQB 2KF3A 5FGOA 1FA3A 2XR8B 3LH4A 1NB3I 3D5GA 1OGXA 5STDA 1E3RA 1JBTA 1Q814 3EJVA 4HVNA 4CCVA 3CC23 5G1KA 3NXJA 3NV0A 5IENA 5IG0A 3CC43 1VQK3 4HKVB 2UX0A 1BSBA 2AAEA 3B7CA 2HMMB 1RN7A 3LXUX 4MMZB 1VQN3 3GZYB 1QVF2 1S723 1UDII 3AGNA 1VQ73 3N8BA 3JUPA 5ELUA 3SOAA 4BL2A 1Q824 2GSPA 3ZG5A 2CWVA 1MWRA 2A15A 2CW9A 3Q90A 1RCLA 2GBXB 2SBLA 3X41A 5IERA 1IVUA 3QK9A 1MGWA 1RGAA 1TFOA 3EBYA 7GSPA 2Z77A 2XGLA 3CNMA 1ROAA 2B24B 3EB8A 1W6GA 3URPA 5AYSC 3DGMA 1W7CA 3RNTA 1DMQA 1GOYA 3Q3FA 3K7CA 1GSPA 5KP4A 2B1XB 6STDA 1YGEA 1TRPA 3KE7A 2OOVC 2K0MA 4JRFA 3CU3A 1BANA 4K1VA 3CPW2 4O2HA 2BMRB 3JVCA 1BVIA 1LQMB 1W01A 3WODG 1BRKA 4R9LA 3WDGB 1UCKA 4EW5A 5CF2A 1VQO3 2YFIB 4FMCA 4BIRA 1CYUA 1FGMA 3F8HA 4KFEA 1OGZA 1O7NB 5GSPA 1JRQA 3KSPA 4GHOA 4J5KA 1DE3A 1I2FA 1UCLA 2CC3A 3H51A 4K61A 1OF5A 1MWUA 4OK0A 1K734 1AVLA 5D82A 3AMOA 4TX4A 5IG4A 3EBTA 1BSCA 2JDIH 1YJN3 3PCSA 2W0QA 3RGRA 3FGYA 5CF1A 2PNCA 2GXFA 3LT8A 2UUGC 2W6JH 4KVHA 1GY6A 1JZDA 1Y4KA 1W2ZA 1KWIA 4FMAA 1HKXA 2WOFA 3AHSA 3H3HA 4J5GA 3SX1A 3CPOA 3CMA3 1NDOB 1IYYA 1YIT3 1Q40B 3BIRA 1GMRA 1LVNA 4HM5B 1NU3A 1BRNL 1JBRA 4FR9A 4RNTA 3F14A 4KZ1A 4MEIA 1YIJ3 3J7Yd 1GY5A 5DREA 3EN1B 4IIAA 3G713 2KRTA 4N6UA 2K54A 2KF6A 3HZPA 3JUMA 1RGEA 1X1XA 1I8VA 1TIJA 1ULJB 1CYVA 4HM3B 4KT3B 5EEOA 1Z1SA 3D5IA 5IEOA 2RSXA 3DH2A 3DGOA 1IVVA 1IVXA 1K28A 1STFI 3NV0B 4XBYA 1HU9A 2F5MA 1O7HB 3OX9A 2F86B 2CFDA 1RGKA 1BRIA 1GMQA 5CLKA 3T8UA 1I0VA 2GBWB 1DETA 1OHSA 3KSED 1W5ZA 2XGNA 3MWZA 2F99A 4L8OA 2Z76A 8CHOA 1UI8A 4PEJA 2IYJA 1KQS2 1BRHA 3NQZA 2CH9A 3DZLA 3GSPA 4X2OA 3X3XA 3CXC2 5IEPA 1YVBI 1EEJA 3PXMA 1V57A 1QAKA 1QALA 2YFLB 4L7KA 5AYRB 5LC6A 4CPKA 4IPBA 2Y73A 4QWTA 2IMJA 1FZUA 3G8ZA 2W2CA 2K3DA 3CCU3 1B20A 1T3BA 4FCJA 3F7SA 5BIRA 3G4S3 1LNIA 2C4BA 5KP3A 1M1K4 1IDPA 1JV2B 1TFKA 2KF4A 3RDEA 1K8A4 4EYCA 3JUNA 3HIGA 1W00A 3FCSB 1NO3A 3ER7A 1OHPA 3FH1A 1N5HA 3RGAA 2GEXA 3V99A 1Q42A 3G6E3 3LT9A 2KF5A 1WMOA 2J8XB 1JB5A 3HI7A 3AHWA 3NM7A 2CFKA 4N6OB 5HGRA 3S29A 3I563 1CQSA 4BTYA 4XBTA 5A0OB 2CG1A 1V58A 1FUWA 1WQLB 1UGIA 4EXRA 1O7MB 4FMBA 1OF5B 1GD4A 2ML5A 2OWPA 3AMOB 8RNTA 1Q7Y4 1SIHA 3O8YA 4N6V0 1IT8A 3T8NA 3E99A 2C10A 4AKZA 3HX8A 1PFPA 3D4AA 2INXA 4N6NB 6GSPA 1RDSA 1D6ZA 3D3LA 4MMYB 1RN4A 4RNYA 1TP6A 3WOFB 2HOHA 3FG3A 3CCL3 2IUKA 3EN8A 1MOLA 2L4VA 3KN4A 5M18A 3ALAA 4H61A 1BU4A 1G96A 1I3IA 3MG2A 4O8SA 1IQYA 3NBJA 2E2VA 3KZTA 4WYKA 1B21A 1N9JA 3SXXA 1I2GA 1JJ22 1RNBA 3T0UA 1CEWI 2LQVA 2BO9B 5FW5A 1YJW3 1BNIA 2LYXA 3LTBA 4MJDA 3I553 4N6TA 5LC7A 1QAFA 1OPYA 4AKYA 3B4PA 4BTWA 3HOHA 2XFTA 1BSAA 1PY3A 2P0MA 2QGUA 2ML6A 1UCJA 2E2TA 3SOYA 4HBRA 3ROBA 3K63A 2F56A 4DKIA 1W4NA 1GD3A 5CXOA 1J2BA 4WFOA 2OQEA 4N6LA 3NBRA 1U5OA 2OTL3 4EV2A 1YI23 4ILFA 3GZXB 2WGQA 2ZDJA 7RNTA 1MWSA 4HM7B 2UGIA 1UI7A 2W9QA 2H0HA 2W56A 1TRQA 3TDGA 1JN5A 5AI1A 4WWUC 2BT3A 5JPUA 2CIUA 2HMKB 3X42A 3GZRA 3F8XA 3L0RA 1X1YA 2CK3H 4NREA 5BVBA 1FUSA 1E97A 1SPUA 1ZGXA 5AEWB 3CCQ3 2R4IA 3UB1A 6RNTA 4XB5A 5M19A 4N6MA 1AVKA 3FLJA 1BNSA 3BB9A 1FGRA 3IMAB 1NWWA 4HM6B 4HZBB 1B2MA 1GS3A 1QMAA 1SARA 2KCDA 1T2IA 3G0KA 1VZZA 5BXQA 4HM1B 1YHQ3 1C54A 4O3VA 1BAOA 1ZO2A 3NX0A 5IG5A 3CCR3 3ZFZA 1RCKA 1OACA 3DMCA 1DMNA 3EHCA 1C7HA 3BNEA 4N3VA 3PZWA 1HZ1A 1BNGA 4NHFA 4HM2B 3Q2PA 1RGLA 1LQGC 1RGCA 2CG0A 3EC9A 1ZS7A 3LTAA 2ZL8A 1MGRA 4RZMA 3NM2A 3VF1A 1IV9A 3FF2A 1D6YA 1BUJA 4GL6A 3OXAA 1WMPA 3MYTA 2R41A 1B27A 1N5PA 4LEHA 4LZIA 1STDA 1M1XB 1IK3A 4H3UA 4I5QA 2RGQA 5EVHA 2BU4A 2YFJB 2Z7AA 3UL5A 1O7WB 1GOUA 1W6YA 3S27A 1JB2A 1VQ53 1VQ63 1QVG2 3CD63 1BUQA 1ZX2A 5IF6A 3NUVA 3V98A 4OVMA 5JBSA 4XDVA 1BGSA 1KSIA 2BNGA 1B3SA 1LOVA 1NNVA 5BU4A 3VSYA 3MSOA 3B8LA 1IVWA 1VQP3 1BNFA 1O7PB 4EC6A 1JB4A 1JZOA 3BU4A 4HOHA 4Q53A 4WYKB 5I97A 1A90A 1OH0A 4HM0B 2HMLB 4MMXB 3WA3A 4BTXA 1X1WA 3K0ZA 4ZM8A 1RTUA 3D79A 1W6CA 3F40A 1A2PA 1A2KA 1RJOA 4HAAA 3FF0A 5G1LA 3S28A 3MG3A 2FXTA 3A76A 5AIFA 4CJNA 3FZWA 1B2UA 4J8TA 2ZHXB 4K90B 4XBXA 1DVDA 2OTJ3 2CWUA 1JKGA 4G1MB 1VQ83 1F8NA 3BNDA 1PU4A 2MF7A 1BSEA 2C11A 5RNTA 1RRHA 1RMSA 2P38A 2Z6BA 2HMJB 3M8CA 4O02B 3U1WA 3X40A 3CME3 3MPHA 1Q7HA 2Y74A 1K41A 4J9AA 1I0XA 1FGTA 2W56B 3UNLA 2CX1A 1JN5B 5IG3A 4KFDA 1UW1A 2IY2A 2XFSA 3DY5A 2I9WA 3LTCA 4IT7A 1EA2A 2W03A 3EX9A 1PYLA 1OUNA 2IA7A 2CX0A 1R4CA 2OQEC 1FW7A 1AQZA 3OW22 4L8PA 1NJI4 3BNBA 5AEUB 2Q07A 1I2EA 5CK6A 1B2XA 3OWSA 4STDA 1RRLA 1FGQA 5D83A 1RNTA 2KAAA 5ELJA 2H0IA 3PYJA 4U13A 3LOYA 1OHOA 1IQ8A 1DVCA 3BLZA 3CNXA 1TUHA 1RN1A 2GU3A 3CC73 4JF8A 1LNHA 3LMLA 1D6UA 2STDA 1MWTA 1I3FA 3GRDA 4CDLA 4GB5A 2D1WA 4LSOA 3BNCA 1JNQA 4OUQA 1RGGA 2V1LA 5EQLA 1KC84 3JUOA 1YVSA 3U97A 3WMDA 1N9EA 4KFFA 2RCDA 3VGNA 1EUIC 1K9M4 3FKAA 5G2GA 4K1UA 1UUWB 4RBNA 2FNQA 1IT7A 4R80A 4R1KA 4X2HA 2HMNB 4HZ9B 1TJDA 5AIGA 3OV4A 3DGLA 1SIIA 1T5YA 1RGFA 1EG9B 3HK4A 1MNLA 2F98A 9RNTA 3GWRA 1BRSA 1M9GA 1GY7A 2RNTA 2SARA 2XEPA 3D9RA 3LZAA 3Q1CA 4I4KA 3PCRA 3QRDA 3WA2X 2H0GA 4EBGA 1Q9EA 2QIYA 4AEQA 3CCS3 4XDWA 2MC8A 1EKMA 3V92A 3CCJ3 5JPPA 3I0YA 2D42A 4NPBA 3SYUA 1FGOA 5IW9A 3GZBA 1NB5I 1B2ZA 4ORLA 2GEYA 1W02A 2CHCA 4FCZA 3N54B 2CKFB 3LTDA 1N8QA 1E3VA 3EE1A 3PS8A 1IV7A 3CCV3 2KXGA 2WGOA 3A5EA 7STDA 1JBSA 1BSDA 3S67A 1DMMA 4WP5A 4RNZA 1WMNA 4EV5A 3LYGA 4GSPA 5HOHA 1JKGB 1O7GB 4LGQA 2QA43 4R9KA 1LXEA 1BOXA 1UUGB 2P05A 1BIRA 2RFRA 2CFGA 2M7OA 2XRXB 1GOVA 2XF3A 1AY7A 3GAXA 5KP1A 2BHMA 5AIHA 2W9PA 1FYSA 1T2HA 2CFWA 1LOWA 1BRJA 3IJEB 3F7XA 3MG1A 3EQQB 1BNEA 1DYUA 3NHXA 2ZA4A 5M1AA 1A2VA 2IUJA 3X3YA 1UUVB 1W2B2 3DUKA 1I70A 3KCHA 4HYZA 1VQ43 2W04A 4HM4B 2OOVA 2O3OA 1FUTA 2E2UA 3DM8A 4WHAA 1V74A 2AADA 1ROVA 1SQWA 2O9UX 1Q864 1WTHA 3ZG0A 1RGHA 2FGTA 3OWYA 2WO0A 3KKGA 1BRGA 1VQ93 2L1SA 3SEDA 1YNVX 2P09A 1US1A
chains in the Genus database with same CATH topology
5DRVA 1ASKA 4FMDA 1U8CB 1QJGA 2CWTA 2PZVA 3OWUA 4HJLB 3CCM3 1WNHA 2BMOB 3DXOA 1SJWA 4XM4A 3K5TA 1AR0A 2HMOB 5D81A 1N8R4 3EF8A 1KD14 1AV4A 3MHEA 1L5GB 1OCVA 3MKIA 5TGNA 4FCMA 1M904 2YX9A 2XSOB 3STDA 3SLUA 3UJMA 1YJ93 1S5AA 2GU1A 3NQYA 3JUQA 3KFQC 3ECFA 3FSDA 4HM8B 3PGBA 3UL6A 1VQM3 3WOEB 2P0XA 1ULIB 3FG1A 2JQ5A 3B4OA 1IU7A 5AIIA 3DGNA 2XH9A 3NBBA 2XSHB 2QEX3 1A67A 2WOHA 3G16A 3S5CA 1IQXA 1EQKA 2CFLA 3IPTA 4R4KA 3K9MC 3KIIA 1VQL3 4LMIA 2OCTA 3X3ZA 1RKYA 1TU5A 1Q40A 1ISKA 1LOXA 3F9SA 1GYBA 3HIIA 3N9HA 3CCE3 3FG4A 2BMQB 5FGOA 1FA3A 2XR8B 3LH4A 1NB3I 1OGXA 5STDA 1E3RA 1Q814 3EJVA 4HVNA 4CCVA 3CC23 3NXJA 3NV0A 5IENA 5IG0A 3CC43 1VQK3 4HKVB 2UX0A 3B7CA 2HMMB 1RN7A 3LXUX 4MMZB 1VQN3 3GZYB 1QVF2 1S723 1VQ73 3N8BA 3JUPA 5ELUA 3SOAA 1Q824 2CWVA 2A15A 2CW9A 3Q90A 2SBLA 2GBXB 3X41A 5IERA 1IVUA 3QK9A 1TFOA 3EBYA 2Z77A 2XGLA 3CNMA 1ROAA 2B24B 3EB8A 1W6GA 5AYSC 3DGMA 1W7CA 1DMQA 3K7CA 5KP4A 2B1XB 6STDA 1YGEA 3KE7A 2OOVC 2K0MA 4JRFA 3CU3A 3CPW2 4K1VA 4O2HA 2BMRB 3JVCA 1W01A 3WODG 4R9LA 3WDGB 5CF2A 1VQO3 2YFIB 4FMCA 1CYUA 1FGMA 3F8HA 4KFEA 1OGZA 1O7NB 1JRQA 3KSPA 2CC3A 3H51A 4K61A 1OF5A 4OK0A 1K734 1AVLA 5D82A 3AMOA 4TX4A 5IG4A 3EBTA 2JDIH 1YJN3 3PCSA 2W0QA 3RGRA 3FGYA 5CF1A 2PNCA 2GXFA 3LT8A 4KVHA 2W6JH 1GY6A 1Y4KA 4FMAA 1W2ZA 1KWIA 1HKXA 2WOFA 3H3HA 3CMA3 3SX1A 3CPOA 1NDOB 1YIT3 1Q40B 1LVNA 4HM5B 1NU3A 4FR9A 3F14A 4KZ1A 4MEIA 1YIJ3 3J7Yd 1GY5A 5DREA 3EN1B 4IIAA 3G713 2KRTA 4N6UA 2K54A 3HZPA 3JUMA 3SVAA 4HM3B 1TIJA 1ULJB 1CYVA 5EEOA 1Z1SA 5IEOA 2RSXA 3DGOA 1IVVA 1IVXA 1K28A 1STFI 3NV0B 4XBYA 1HU9A 1O7HB 3OX9A 2F86B 2CFDA 3T8UA 5CLKA 2GBWB 1OHSA 3KSED 1W5ZA 2XGNA 3MWZA 2F99A 4L8OA 2Z76A 8CHOA 1UI8A 4PEJA 1KQS2 3NQZA 2CH9A 3DZLA 3X3XA 4X2OA 3CXC2 5IEPA 1YVBI 4L7KA 1QAKA 1QALA 2YFLB 5LC6A 5AYRB 4IPBA 2Y73A 4QWTA 2IMJA 3G8ZA 2W2CA 3CCU3 4FCJA 3F7SA 3G4S3 1M1K4 5KP3A 1IDPA 1JV2B 1TFKA 3RDEA 1K8A4 4EYCA 3JUNA 3HIGA 1W00A 3FCSB 1NO3A 3ER7A 1OHPA 3FH1A 1N5HA 3RGAA 2GEXA 3V99A 1Q42A 3G6E3 3LT9A 1WMOA 1JB5A 3HI7A 3NM7A 2CFKA 4N6OB 5HGRA 3S29A 3I563 1CQSA 4BTYA 4XBTA 5A0OB 2CG1A 1FUWA 1WQLB 4EXRA 1O7MB 4FMBA 1OF5B 1GD4A 2ML5A 2OWPA 3AMOB 1Q7Y4 1SIHA 3O8YA 4N6V0 1IT8A 3T8NA 3E99A 2C10A 4AKZA 3HX8A 1PFPA 2INXA 4N6NB 1D6ZA 3D3LA 4MMYB 3CCL3 4RNYA 1TP6A 3WOFB 3FG3A 2IUKA 3EN8A 1MOLA 2L4VA 3KN4A 3ALAA 4H61A 1G96A 3MG2A 4O8SA 1IQYA 3NBJA 2E2VA 3KZTA 4WYKA 1N9JA 3SXXA 1JJ22 3T0UA 1CEWI 2LQVA 2BO9B 5FW5A 1YJW3 3LTBA 2LYXA 4MJDA 3I553 4N6TA 5LC7A 1QAFA 1OPYA 4AKYA 3B4PA 4BTWA 2XFTA 2P0MA 2QGUA 2ML6A 2E2TA 3SOYA 4HBRA 3ROBA 3K63A 1W4NA 1GD3A 5CXOA 1J2BA 4WFOA 2OQEA 4N6LA 3NBRA 1U5OA 2OTL3 4EV2A 1YI23 3GZXB 2WGQA 2ZDJA 4HM7B 1UI7A 2W9QA 2W56A 3TDGA 1JN5A 5AI1A 4WWUC 2BT3A 5JPUA 2CIUA 2HMKB 3X42A 3GZRA 3F8XA 3L0RA 2CK3H 4NREA 5BVBA 1SPUA 1E97A 5AEWB 3CCQ3 2R4IA 3UB1A 4XB5A 4N6MA 1AVKA 3FLJA 3BB9A 3IMAB 1FGRA 4HM6B 1NWWA 4HZBB 1GS3A 1QMAA 2KCDA 3G0KA 1VZZA 5BXQA 4HM1B 1YHQ3 4O3VA 1ZO2A 3NX0A 5IG5A 3CCR3 3DMCA 1OACA 3EHCA 1DMNA 1C7HA 3BNEA 4N3VA 3PZWA 4NHFA 4HM2B 3Q2PA 2CG0A 3LTAA 3EC9A 2ZL8A 4RZMA 3NM2A 3VF1A 1IV9A 3FF2A 1D6YA 4GL6A 3OXAA 1WMPA 3MYTA 1N5PA 4LEHA 4LZIA 1STDA 1M1XB 1IK3A 4H3UA 5EVHA 2RGQA 2YFJB 2Z7AA 3UL5A 1O7WB 1W6YA 3S27A 1JB2A 1VQ53 1VQ63 1QVG2 3CD63 1BUQA 1ZX2A 5IF6A 3NUVA 3V98A 4OVMA 5JBSA 4XDVA 1KSIA 2BNGA 3VSYA 3MSOA 3B8LA 1IVWA 1VQP3 1O7PB 4EC6A 1JB4A 4Q53A 4WYKB 5I97A 1A90A 1OH0A 4HM0B 2HMLB 4MMXB 3WA3A 4BTXA 3K0ZA 4ZM8A 1W6CA 3F40A 1RJOA 1A2KA 3S28A 3FF0A 3MG3A 2FXTA 3A76A 5AIFA 3FZWA 4J8TA 4K90B 4XBXA 1DVDA 2OTJ3 2CWUA 1JKGA 4G1MB 1VQ83 1F8NA 3BNDA 1PU4A 2MF7A 2C11A 1RRHA 2P38A 2Z6BA 2HMJB 3M8CA 4O02B 3U1WA 3X40A 3CME3 3MPHA 2Y74A 1K41A 4J9AA 1FGTA 2W56B 3UNLA 1JN5B 5IG3A 4KFDA 1UW1A 2XFSA 3DY5A 2I9WA 3LTCA 4IT7A 1EA2A 2W03A 3EX9A 1OUNA 2IA7A 2OQEC 1R4CA 1NJI4 3OW22 4L8PA 3BNBA 5AEUB 2Q07A 5CK6A 3OWSA 4STDA 1RRLA 1FGQA 5D83A 5ELJA 3PYJA 4U13A 3LOYA 1OHOA 1IQ8A 1DVCA 3BLZA 3CNXA 1TUHA 2GU3A 3CC73 4JF8A 1LNHA 3LMLA 1D6UA 2STDA 3GRDA 4CDLA 4GB5A 2D1WA 4LSOA 3BNCA 1JNQA 4OUQA 2V1LA 5EQLA 1KC84 3JUOA 3U97A 3WMDA 1N9EA 4KFFA 2RCDA 3VGNA 1K9M4 3FKAA 5G2GA 4K1UA 1UUWB 4RBNA 2FNQA 1IT7A 4R80A 4R1KA 4X2HA 2HMNB 4HZ9B 5AIGA 3OV4A 3DGLA 1SIIA 1T5YA 1EG9B 3HK4A 1MNLA 2F98A 3GWRA 1M9GA 1GY7A 2XEPA 3D9RA 3LZAA 3Q1CA 4I4KA 3PCRA 3QRDA 3WA2X 4EBGA 2QIYA 4AEQA 3CCS3 4XDWA 2MC8A 1EKMA 3V92A 3CCJ3 5JPPA 3I0YA 2D42A 1FGOA 5IW9A 3GZBA 1NB5I 4ORLA 2GEYA 1W02A 2CHCA 4FCZA 3N54B 2CKFB 3LTDA 1N8QA 1E3VA 3EE1A 3PS8A 1IV7A 3CCV3 2KXGA 2WGOA 7STDA 3S67A 1DMMA 4WP5A 4RNZA 1WMNA 4EV5A 3LYGA 1JKGB 1O7GB 4LGQA 2QA43 4R9KA 1LXEA 2P05A 2RFRA 2CFGA 2M7OA 2XRXB 2XF3A 3GAXA 5KP1A 2BHMA 5AIHA 2W9PA 2CFWA 3IJEB 3F7XA 3MG1A 3EQQB 1DYUA 3NHXA 2IUJA 1A2VA 3X3YA 1UUVB 1W2B2 3DUKA 1VQ43 4HYZA 2W04A 4HM4B 2OOVA 2O3OA 2E2UA 3DM8A 4WHAA 1V74A 1ROVA 1SQWA 2O9UX 1Q864 1WTHA 2FGTA 3OWYA 2WO0A 3KKGA 1VQ93 3PXMA 3SEDA 2P09A 1US1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DRV A;  1ASK A;  1QJG A;  3OWU A;  2PZV A;  4HJL B;  2BMO B;  3DXO A;  1SJW A;  4XM4 A;  1AR0 A;  2HMO B;  5D81 A;  3EF8 A;  3MHE A;  1OCV A;  3MKI A;  5TGN A;  4FCM A;  2XSO B;  3STD A;  3UJM A;  1S5A A;  3JUQ A;  3ECF A;  3FSD A;  4HM8 B;  1ULI B;  2JQ5 A;  3B4O A;  5AII A;  2XSH B;  3G16 A;  3S5C A;  3IPT A;  4LMI A;  1Q40 A;  1ISK A;  3F9S A;  1GYB A;  2BMQ B;  2XR8 B;  1OGX A;  5STD A;  1E3R A;  3EJV A;  4HVN A;  3NXJ A;  3NV0 A;  5IEN A;  5IG0 A;  4HKV B;  2UX0 A;  3B7C A;  2HMM B;  3GZY B;  3SOA A;  3JUP A;  2A15 A;  3Q90 A;  2GBX B;  5IER A;  3EBY A;  2Z77 A;  3CNM A;  2B24 B;  1DMQ A;  3K7C A;  5KP4 A;  2B1X B;  6STD A;  3KE7 A;  3CU3 A;  4K1V A;  2BMR B;  1W01 A;  4R9L A;  5CF2 A;  2YFI B;  3F8H A;  1OGZ A;  1O7N B;  3KSP A;  3H51 A;  1OF5 A;  5D82 A;  5IG4 A;  3EBT A;  3RGR A;  3FGY A;  5CF1 A;  2GXF A;  4KVH A;  1GY6 A;  1HKX A;  3H3H A;  3CPO A;  1NDO B;  1Q40 B;  4HM5 B;  1NU3 A;  3F14 A;  1GY5 A;  5DRE A;  3EN1 B;  4IIA A;  2K54 A;  3HZP A;  3JUM A;  4HM3 B;  1ULJ B;  1Z1S A;  5IEO A;  3NV0 B;  4XBY A;  1O7H B;  3OX9 A;  2F86 B;  3T8U A;  5CLK A;  2GBW B;  1OHS A;  2F99 A;  4L8O A;  2Z76 A;  8CHO A;  4PEJ A;  3DZL A;  4X2O A;  5IEP A;  4L7K A;  2YFL B;  2IMJ A;  3G8Z A;  2W2C A;  4FCJ A;  3F7S A;  5KP3 A;  1IDP A;  3JUN A;  1W00 A;  3ER7 A;  1OHP A;  3FH1 A;  3RGA A;  2GEX A;  1Q42 A;  1JB5 A;  5HGR A;  1CQS A;  4XBT A;  1WQL B;  1O7M B;  1OF5 B;  2OWP A;  3T8N A;  3E99 A;  3HX8 A;  2INX A;  1TP6 A;  3EN8 A;  3MG2 A;  3KZT A;  4WYK A;  5FW5 A;  4MJD A;  1OPY A;  3B4P A;  2QGU A;  3SOY A;  3ROB A;  5CXO A;  3NBR A;  1U5O A;  3GZX B;  4HM7 B;  1JN5 A;  5AI1 A;  4WWU C;  5JPU A;  2HMK B;  3GZR A;  3F8X A;  5BVB A;  1E97 A;  5AEW B;  2R4I A;  4XB5 A;  3FLJ A;  3BB9 A;  4HZB B;  4HM6 B;  1NWW A;  1GS3 A;  1QMA A;  3G0K A;  1VZZ A;  5BXQ A;  4HM1 B;  1ZO2 A;  5IG5 A;  3DMC A;  3EHC A;  1DMN A;  1C7H A;  4N3V A;  4HM2 B;  3EC9 A;  4RZM A;  3NM2 A;  3FF2 A;  3OXA A;  3MYT A;  4LEH A;  1STD A;  4H3U A;  5EVH A;  2RGQ A;  2YFJ B;  2Z7A A;  1O7W B;  1W6Y A;  1JB2 A;  1BUQ A;  1ZX2 A;  5IF6 A;  3NUV A;  4OVM A;  4XDV A;  2BNG A;  3VSY A;  3MSO A;  3B8L A;  1O7P B;  1JB4 A;  4Q53 A;  4WYK B;  1OH0 A;  4HM0 B;  2HML B;  3K0Z A;  3F40 A;  1A2K A;  3FF0 A;  3MG3 A;  3A76 A;  5AIF A;  3FZW A;  4J8T A;  4XBX A;  1JKG A;  2HMJ B;  3M8C A;  4J9A A;  1K41 A;  3UNL A;  1JN5 B;  5IG3 A;  2I9W A;  1EA2 A;  3EX9 A;  1OUN A;  4L8P A;  5AEU B;  5CK6 A;  3OWS A;  4STD A;  5D83 A;  4U13 A;  1OHO A;  3BLZ A;  3CNX A;  1TUH A;  2STD A;  3GRD A;  4CDL A;  4GB5 A;  4OUQ A;  3JUO A;  3WMD A;  2RCD A;  3VGN A;  3FKA A;  5G2G A;  4K1U A;  1UUW B;  4R1K A;  4X2H A;  2HMN B;  4HZ9 B;  5AIG A;  3OV4 A;  1EG9 B;  3HK4 A;  2F98 A;  3GWR A;  1GY7 A;  3LZA A;  3D9R A;  4I4K A;  2QIY A;  4XDW A;  5JPP A;  3I0Y A;  3GZB A;  4ORL A;  2GEY A;  1W02 A;  2CHC A;  2CKF B;  1E3V A;  7STD A;  1DMM A;  4WP5 A;  3LYG A;  1JKG B;  1O7G B;  4LGQ A;  4R9K A;  2RFR A;  2XRX B;  5KP1 A;  5AIH A;  3F7X A;  3MG1 A;  3EQQ B;  3NHX A;  1UUV B;  3DUK A;  4HM4 B;  3DM8 A;  3OWY A;  3KKG A;  3SED A; 
#chains in the Genus database with same CATH topology
 5DRV A;  1ASK A;  4FMD A;  1U8C B;  1QJG A;  2CWT A;  2PZV A;  3OWU A;  4BU4 A;  4HJL B;  3CCM 3;  1HYF A;  1WNH A;  4LYL B;  2BMO B;  3DXO A;  1SJW A;  4XM4 A;  4BL3 A;  1B2S A;  3K5T A;  1LRA A;  2BIR A;  3DGY A;  1AR0 A;  1G0T A;  2HMO B;  1BNR A;  5D81 A;  1RLS A;  1N8R 4;  3EF8 A;  1KD1 4;  1AV4 A;  3MHE A;  1L5G B;  1OCV A;  3MKI A;  5TGN A;  4FCM A;  1M90 4;  2YX9 A;  2XSO B;  1TTO A;  3STD A;  1YGW A;  3SLU A;  3UJM A;  1YJ9 3;  1S5A A;  1R4Y A;  1RSN A;  2GU1 A;  3SVA A;  1CH0 A;  3NQY A;  3JUQ A;  3KFQ C;  3ECF A;  3FSD A;  4HM8 B;  3PGB A;  3UL6 A;  1VQM 3;  1LOY A;  3WOE B;  2P0X A;  1ULI B;  3FG1 A;  2JQ5 A;  3B4O A;  1IU7 A;  3AGO A;  3DGN A;  2XH9 A;  3NBB A;  2XSH B;  5AII A;  2QEX 3;  1X1U A;  2F4Y A;  2F5W A;  2WOH A;  1A67 A;  3G16 A;  1G02 A;  3S5C A;  1IQX A;  1EQK A;  1BNJ A;  2CFL A;  3IPT A;  4R4K A;  1UGH I;  3K9M C;  3KII A;  1VQL 3;  4LMI A;  2OCT A;  3X3Z A;  1VQQ A;  1RKY A;  1TU5 A;  1GMP A;  3WR2 A;  1RHL A;  1Q40 A;  1ISK A;  1LOX A;  3F9S A;  1GYB A;  3HII A;  3N9H A;  3CCE 3;  3FG4 A;  2RBI A;  3WHO A;  1UCI A;  2BMQ B;  2KF3 A;  5FGO A;  1FA3 A;  2XR8 B;  3LH4 A;  1NB3 I;  3D5G A;  1OGX A;  5STD A;  1E3R A;  1JBT A;  1Q81 4;  3EJV A;  4HVN A;  4CCV A;  3CC2 3;  5G1K A;  3NXJ A;  3NV0 A;  5IEN A;  5IG0 A;  3CC4 3;  1VQK 3;  4HKV B;  2UX0 A;  1BSB A;  2AAE A;  3B7C A;  2HMM B;  1RN7 A;  3LXU X;  4MMZ B;  1VQN 3;  3GZY B;  1QVF 2;  1S72 3;  1UDI I;  3AGN A;  1VQ7 3;  3N8B A;  3JUP A;  5ELU A;  3SOA A;  4BL2 A;  1Q82 4;  2GSP A;  3ZG5 A;  2CWV A;  1MWR A;  2A15 A;  2CW9 A;  3Q90 A;  1RCL A;  2GBX B;  2SBL A;  3X41 A;  5IER A;  1IVU A;  3QK9 A;  1MGW A;  1RGA A;  1TFO A;  3EBY A;  7GSP A;  2Z77 A;  2XGL A;  3CNM A;  1ROA A;  2B24 B;  3EB8 A;  1W6G A;  3URP A;  5AYS C;  3DGM A;  1W7C A;  3RNT A;  1DMQ A;  1GOY A;  3Q3F A;  3K7C A;  1GSP A;  5KP4 A;  2B1X B;  6STD A;  1YGE A;  1TRP A;  3KE7 A;  2OOV C;  2K0M A;  4JRF A;  3CU3 A;  1BAN A;  4K1V A;  3CPW 2;  4O2H A;  2BMR B;  3JVC A;  1BVI A;  1LQM B;  1W01 A;  3WOD G;  1BRK A;  4R9L A;  3WDG B;  1UCK A;  4EW5 A;  5CF2 A;  1VQO 3;  2YFI B;  4FMC A;  4BIR A;  1CYU A;  1FGM A;  3F8H A;  4KFE A;  1OGZ A;  1O7N B;  5GSP A;  1JRQ A;  3KSP A;  4GHO A;  4J5K A;  1DE3 A;  1I2F A;  1UCL A;  2CC3 A;  3H51 A;  4K61 A;  1OF5 A;  1MWU A;  4OK0 A;  1K73 4;  1AVL A;  5D82 A;  3AMO A;  4TX4 A;  5IG4 A;  3EBT A;  1BSC A;  2JDI H;  1YJN 3;  3PCS A;  2W0Q A;  3RGR A;  3FGY A;  5CF1 A;  2PNC A;  2GXF A;  3LT8 A;  2UUG C;  2W6J H;  4KVH A;  1GY6 A;  1JZD A;  1Y4K A;  1W2Z A;  1KWI A;  4FMA A;  1HKX A;  2WOF A;  3AHS A;  3H3H A;  4J5G A;  3SX1 A;  3CPO A;  3CMA 3;  1NDO B;  1IYY A;  1YIT 3;  1Q40 B;  3BIR A;  1GMR A;  1LVN A;  4HM5 B;  1NU3 A;  1BRN L;  1JBR A;  4FR9 A;  4RNT A;  3F14 A;  4KZ1 A;  4MEI A;  1YIJ 3;  3J7Y d;  1GY5 A;  5DRE A;  3EN1 B;  4IIA A;  3G71 3;  2KRT A;  4N6U A;  2K54 A;  2KF6 A;  3HZP A;  3JUM A;  1RGE A;  1X1X A;  1I8V A;  1TIJ A;  1ULJ B;  1CYV A;  4HM3 B;  4KT3 B;  5EEO A;  1Z1S A;  3D5I A;  5IEO A;  2RSX A;  3DH2 A;  3DGO A;  1IVV A;  1IVX A;  1K28 A;  1STF I;  3NV0 B;  4XBY A;  1HU9 A;  2F5M A;  1O7H B;  3OX9 A;  2F86 B;  2CFD A;  1RGK A;  1BRI A;  1GMQ A;  5CLK A;  3T8U A;  1I0V A;  2GBW B;  1DET A;  1OHS A;  3KSE D;  1W5Z A;  2XGN A;  3MWZ A;  2F99 A;  4L8O A;  2Z76 A;  8CHO A;  1UI8 A;  4PEJ A;  2IYJ A;  1KQS 2;  1BRH A;  3NQZ A;  2CH9 A;  3DZL A;  3GSP A;  4X2O A;  3X3X A;  3CXC 2;  5IEP A;  1YVB I;  1EEJ A;  3PXM A;  1V57 A;  1QAK A;  1QAL A;  2YFL B;  4L7K A;  5AYR B;  5LC6 A;  4CPK A;  4IPB A;  2Y73 A;  4QWT A;  2IMJ A;  1FZU A;  3G8Z A;  2W2C A;  2K3D A;  3CCU 3;  1B20 A;  1T3B A;  4FCJ A;  3F7S A;  5BIR A;  3G4S 3;  1LNI A;  2C4B A;  5KP3 A;  1M1K 4;  1IDP A;  1JV2 B;  1TFK A;  2KF4 A;  3RDE A;  1K8A 4;  4EYC A;  3JUN A;  3HIG A;  1W00 A;  3FCS B;  1NO3 A;  3ER7 A;  1OHP A;  3FH1 A;  1N5H A;  3RGA A;  2GEX A;  3V99 A;  1Q42 A;  3G6E 3;  3LT9 A;  2KF5 A;  1WMO A;  2J8X B;  1JB5 A;  3HI7 A;  3AHW A;  3NM7 A;  2CFK A;  4N6O B;  5HGR A;  3S29 A;  3I56 3;  1CQS A;  4BTY A;  4XBT A;  5A0O B;  2CG1 A;  1V58 A;  1FUW A;  1WQL B;  1UGI A;  4EXR A;  1O7M B;  4FMB A;  1OF5 B;  1GD4 A;  2ML5 A;  2OWP A;  3AMO B;  8RNT A;  1Q7Y 4;  1SIH A;  3O8Y A;  4N6V 0;  1IT8 A;  3T8N A;  3E99 A;  2C10 A;  4AKZ A;  3HX8 A;  1PFP A;  3D4A A;  2INX A;  4N6N B;  6GSP A;  1RDS A;  1D6Z A;  3D3L A;  4MMY B;  1RN4 A;  4RNY A;  1TP6 A;  3WOF B;  2HOH A;  3FG3 A;  3CCL 3;  2IUK A;  3EN8 A;  1MOL A;  2L4V A;  3KN4 A;  5M18 A;  3ALA A;  4H61 A;  1BU4 A;  1G96 A;  1I3I A;  3MG2 A;  4O8S A;  1IQY A;  3NBJ A;  2E2V A;  3KZT A;  4WYK A;  1B21 A;  1N9J A;  3SXX A;  1I2G A;  1JJ2 2;  1RNB A;  3T0U A;  1CEW I;  2LQV A;  2BO9 B;  5FW5 A;  1YJW 3;  1BNI A;  2LYX A;  3LTB A;  4MJD A;  3I55 3;  4N6T A;  5LC7 A;  1QAF A;  1OPY A;  4AKY A;  3B4P A;  4BTW A;  3HOH A;  2XFT A;  1BSA A;  1PY3 A;  2P0M A;  2QGU A;  2ML6 A;  1UCJ A;  2E2T A;  3SOY A;  4HBR A;  3ROB A;  3K63 A;  2F56 A;  4DKI A;  1W4N A;  1GD3 A;  5CXO A;  1J2B A;  4WFO A;  2OQE A;  4N6L A;  3NBR A;  1U5O A;  2OTL 3;  4EV2 A;  1YI2 3;  4ILF A;  3GZX B;  2WGQ A;  2ZDJ A;  7RNT A;  1MWS A;  4HM7 B;  2UGI A;  1UI7 A;  2W9Q A;  2H0H A;  2W56 A;  1TRQ A;  3TDG A;  1JN5 A;  5AI1 A;  4WWU C;  2BT3 A;  5JPU A;  2CIU A;  2HMK B;  3X42 A;  3GZR A;  3F8X A;  3L0R A;  1X1Y A;  2CK3 H;  4NRE A;  5BVB A;  1FUS A;  1E97 A;  1SPU A;  1ZGX A;  5AEW B;  3CCQ 3;  2R4I A;  3UB1 A;  6RNT A;  4XB5 A;  5M19 A;  4N6M A;  1AVK A;  3FLJ A;  1BNS A;  3BB9 A;  1FGR A;  3IMA B;  1NWW A;  4HM6 B;  4HZB B;  1B2M A;  1GS3 A;  1QMA A;  1SAR A;  2KCD A;  1T2I A;  3G0K A;  1VZZ A;  5BXQ A;  4HM1 B;  1YHQ 3;  1C54 A;  4O3V A;  1BAO A;  1ZO2 A;  3NX0 A;  5IG5 A;  3CCR 3;  3ZFZ A;  1RCK A;  1OAC A;  3DMC A;  1DMN A;  3EHC A;  1C7H A;  3BNE A;  4N3V A;  3PZW A;  1HZ1 A;  1BNG A;  4NHF A;  4HM2 B;  3Q2P A;  1RGL A;  1LQG C;  1RGC A;  2CG0 A;  3EC9 A;  1ZS7 A;  3LTA A;  2ZL8 A;  1MGR A;  4RZM A;  3NM2 A;  3VF1 A;  1IV9 A;  3FF2 A;  1D6Y A;  1BUJ A;  4GL6 A;  3OXA A;  1WMP A;  3MYT A;  2R41 A;  1B27 A;  1N5P A;  4LEH A;  4LZI A;  1STD A;  1M1X B;  1IK3 A;  4H3U A;  4I5Q A;  2RGQ A;  5EVH A;  2BU4 A;  2YFJ B;  2Z7A A;  3UL5 A;  1O7W B;  1GOU A;  1W6Y A;  3S27 A;  1JB2 A;  1VQ5 3;  1VQ6 3;  1QVG 2;  3CD6 3;  1BUQ A;  1ZX2 A;  5IF6 A;  3NUV A;  3V98 A;  4OVM A;  5JBS A;  4XDV A;  1BGS A;  1KSI A;  2BNG A;  1B3S A;  1LOV A;  1NNV A;  5BU4 A;  3VSY A;  3MSO A;  3B8L A;  1IVW A;  1VQP 3;  1BNF A;  1O7P B;  4EC6 A;  1JB4 A;  1JZO A;  3BU4 A;  4HOH A;  4Q53 A;  4WYK B;  5I97 A;  1A90 A;  1OH0 A;  4HM0 B;  2HML B;  4MMX B;  3WA3 A;  4BTX A;  1X1W A;  3K0Z A;  4ZM8 A;  1RTU A;  3D79 A;  1W6C A;  3F40 A;  1A2P A;  1A2K A;  1RJO A;  4HAA A;  3FF0 A;  5G1L A;  3S28 A;  3MG3 A;  2FXT A;  3A76 A;  5AIF A;  4CJN A;  3FZW A;  1B2U A;  4J8T A;  2ZHX B;  4K90 B;  4XBX A;  1DVD A;  2OTJ 3;  2CWU A;  1JKG A;  4G1M B;  1VQ8 3;  1F8N A;  3BND A;  1PU4 A;  2MF7 A;  1BSE A;  2C11 A;  5RNT A;  1RRH A;  1RMS A;  2P38 A;  2Z6B A;  2HMJ B;  3M8C A;  4O02 B;  3U1W A;  3X40 A;  3CME 3;  3MPH A;  1Q7H A;  2Y74 A;  1K41 A;  4J9A A;  1I0X A;  1FGT A;  2W56 B;  3UNL A;  2CX1 A;  1JN5 B;  5IG3 A;  4KFD A;  1UW1 A;  2IY2 A;  2XFS A;  3DY5 A;  2I9W A;  3LTC A;  4IT7 A;  1EA2 A;  2W03 A;  3EX9 A;  1PYL A;  1OUN A;  2IA7 A;  2CX0 A;  1R4C A;  2OQE C;  1FW7 A;  1AQZ A;  3OW2 2;  4L8P A;  1NJI 4;  3BNB A;  5AEU B;  2Q07 A;  1I2E A;  5CK6 A;  1B2X A;  3OWS A;  4STD A;  1RRL A;  1FGQ A;  5D83 A;  1RNT A;  2KAA A;  5ELJ A;  2H0I A;  3PYJ A;  4U13 A;  3LOY A;  1OHO A;  1IQ8 A;  1DVC A;  3BLZ A;  3CNX A;  1TUH A;  1RN1 A;  2GU3 A;  3CC7 3;  4JF8 A;  1LNH A;  3LML A;  1D6U A;  2STD A;  1MWT A;  1I3F A;  3GRD A;  4CDL A;  4GB5 A;  2D1W A;  4LSO A;  3BNC A;  1JNQ A;  4OUQ A;  1RGG A;  2V1L A;  5EQL A;  1KC8 4;  3JUO A;  1YVS A;  3U97 A;  3WMD A;  1N9E A;  4KFF A;  2RCD A;  3VGN A;  1EUI C;  1K9M 4;  3FKA A;  5G2G A;  4K1U A;  1UUW B;  4RBN A;  2FNQ A;  1IT7 A;  4R80 A;  4R1K A;  4X2H A;  2HMN B;  4HZ9 B;  1TJD A;  5AIG A;  3OV4 A;  3DGL A;  1SII A;  1T5Y A;  1RGF A;  1EG9 B;  3HK4 A;  1MNL A;  2F98 A;  9RNT A;  3GWR A;  1BRS A;  1M9G A;  1GY7 A;  2RNT A;  2SAR A;  2XEP A;  3D9R A;  3LZA A;  3Q1C A;  4I4K A;  3PCR A;  3QRD A;  3WA2 X;  2H0G A;  4EBG A;  1Q9E A;  2QIY A;  4AEQ A;  3CCS 3;  4XDW A;  2MC8 A;  1EKM A;  3V92 A;  3CCJ 3;  5JPP A;  3I0Y A;  2D42 A;  4NPB A;  3SYU A;  1FGO A;  5IW9 A;  3GZB A;  1NB5 I;  1B2Z A;  4ORL A;  2GEY A;  1W02 A;  2CHC A;  4FCZ A;  3N54 B;  2CKF B;  3LTD A;  1N8Q A;  1E3V A;  3EE1 A;  3PS8 A;  1IV7 A;  3CCV 3;  2KXG A;  2WGO A;  3A5E A;  7STD A;  1JBS A;  1BSD A;  3S67 A;  1DMM A;  4WP5 A;  4RNZ A;  1WMN A;  4EV5 A;  3LYG A;  4GSP A;  5HOH A;  1JKG B;  1O7G B;  4LGQ A;  2QA4 3;  4R9K A;  1LXE A;  1BOX A;  1UUG B;  2P05 A;  1BIR A;  2RFR A;  2CFG A;  2M7O A;  2XRX B;  1GOV A;  2XF3 A;  1AY7 A;  3GAX A;  5KP1 A;  2BHM A;  5AIH A;  2W9P A;  1FYS A;  1T2H A;  2CFW A;  1LOW A;  1BRJ A;  3IJE B;  3F7X A;  3MG1 A;  3EQQ B;  1BNE A;  1DYU A;  3NHX A;  2ZA4 A;  5M1A A;  1A2V A;  2IUJ A;  3X3Y A;  1UUV B;  1W2B 2;  3DUK A;  1I70 A;  3KCH A;  4HYZ A;  1VQ4 3;  2W04 A;  4HM4 B;  2OOV A;  2O3O A;  1FUT A;  2E2U A;  3DM8 A;  4WHA A;  1V74 A;  2AAD A;  1ROV A;  1SQW A;  2O9U X;  1Q86 4;  1WTH A;  3ZG0 A;  1RGH A;  2FGT A;  3OWY A;  2WO0 A;  3KKG A;  1BRG A;  1VQ9 3;  2L1S A;  3SED A;  1YNV X;  2P09 A;  1US1 A; 
#chains in the Genus database with same CATH homology
 5DRV A;  1ASK A;  4FMD A;  1U8C B;  1QJG A;  2CWT A;  2PZV A;  3OWU A;  4HJL B;  3CCM 3;  1WNH A;  2BMO B;  3DXO A;  1SJW A;  4XM4 A;  3K5T A;  1AR0 A;  2HMO B;  5D81 A;  1N8R 4;  3EF8 A;  1KD1 4;  1AV4 A;  3MHE A;  1L5G B;  1OCV A;  3MKI A;  5TGN A;  4FCM A;  1M90 4;  2YX9 A;  2XSO B;  3STD A;  3SLU A;  3UJM A;  1YJ9 3;  1S5A A;  2GU1 A;  3NQY A;  3JUQ A;  3KFQ C;  3ECF A;  3FSD A;  4HM8 B;  3PGB A;  3UL6 A;  1VQM 3;  3WOE B;  2P0X A;  1ULI B;  3FG1 A;  2JQ5 A;  3B4O A;  1IU7 A;  5AII A;  3DGN A;  2XH9 A;  3NBB A;  2XSH B;  2QEX 3;  1A67 A;  2WOH A;  3G16 A;  3S5C A;  1IQX A;  1EQK A;  2CFL A;  3IPT A;  4R4K A;  3K9M C;  3KII A;  1VQL 3;  4LMI A;  2OCT A;  3X3Z A;  1RKY A;  1TU5 A;  1Q40 A;  1ISK A;  1LOX A;  3F9S A;  1GYB A;  3HII A;  3N9H A;  3CCE 3;  3FG4 A;  2BMQ B;  5FGO A;  1FA3 A;  2XR8 B;  3LH4 A;  1NB3 I;  1OGX A;  5STD A;  1E3R A;  1Q81 4;  3EJV A;  4HVN A;  4CCV A;  3CC2 3;  3NXJ A;  3NV0 A;  5IEN A;  5IG0 A;  3CC4 3;  1VQK 3;  4HKV B;  2UX0 A;  3B7C A;  2HMM B;  1RN7 A;  3LXU X;  4MMZ B;  1VQN 3;  3GZY B;  1QVF 2;  1S72 3;  1VQ7 3;  3N8B A;  3JUP A;  5ELU A;  3SOA A;  1Q82 4;  2CWV A;  2A15 A;  2CW9 A;  3Q90 A;  2SBL A;  2GBX B;  3X41 A;  5IER A;  1IVU A;  3QK9 A;  1TFO A;  3EBY A;  2Z77 A;  2XGL A;  3CNM A;  1ROA A;  2B24 B;  3EB8 A;  1W6G A;  5AYS C;  3DGM A;  1W7C A;  1DMQ A;  3K7C A;  5KP4 A;  2B1X B;  6STD A;  1YGE A;  3KE7 A;  2OOV C;  2K0M A;  4JRF A;  3CU3 A;  3CPW 2;  4K1V A;  4O2H A;  2BMR B;  3JVC A;  1W01 A;  3WOD G;  4R9L A;  3WDG B;  5CF2 A;  1VQO 3;  2YFI B;  4FMC A;  1CYU A;  1FGM A;  3F8H A;  4KFE A;  1OGZ A;  1O7N B;  1JRQ A;  3KSP A;  2CC3 A;  3H51 A;  4K61 A;  1OF5 A;  4OK0 A;  1K73 4;  1AVL A;  5D82 A;  3AMO A;  4TX4 A;  5IG4 A;  3EBT A;  2JDI H;  1YJN 3;  3PCS A;  2W0Q A;  3RGR A;  3FGY A;  5CF1 A;  2PNC A;  2GXF A;  3LT8 A;  4KVH A;  2W6J H;  1GY6 A;  1Y4K A;  4FMA A;  1W2Z A;  1KWI A;  1HKX A;  2WOF A;  3H3H A;  3CMA 3;  3SX1 A;  3CPO A;  1NDO B;  1YIT 3;  1Q40 B;  1LVN A;  4HM5 B;  1NU3 A;  4FR9 A;  3F14 A;  4KZ1 A;  4MEI A;  1YIJ 3;  3J7Y d;  1GY5 A;  5DRE A;  3EN1 B;  4IIA A;  3G71 3;  2KRT A;  4N6U A;  2K54 A;  3HZP A;  3JUM A;  3SVA A;  4HM3 B;  1TIJ A;  1ULJ B;  1CYV A;  5EEO A;  1Z1S A;  5IEO A;  2RSX A;  3DGO A;  1IVV A;  1IVX A;  1K28 A;  1STF I;  3NV0 B;  4XBY A;  1HU9 A;  1O7H B;  3OX9 A;  2F86 B;  2CFD A;  3T8U A;  5CLK A;  2GBW B;  1OHS A;  3KSE D;  1W5Z A;  2XGN A;  3MWZ A;  2F99 A;  4L8O A;  2Z76 A;  8CHO A;  1UI8 A;  4PEJ A;  1KQS 2;  3NQZ A;  2CH9 A;  3DZL A;  3X3X A;  4X2O A;  3CXC 2;  5IEP A;  1YVB I;  4L7K A;  1QAK A;  1QAL A;  2YFL B;  5LC6 A;  5AYR B;  4IPB A;  2Y73 A;  4QWT A;  2IMJ A;  3G8Z A;  2W2C A;  3CCU 3;  4FCJ A;  3F7S A;  3G4S 3;  1M1K 4;  5KP3 A;  1IDP A;  1JV2 B;  1TFK A;  3RDE A;  1K8A 4;  4EYC A;  3JUN A;  3HIG A;  1W00 A;  3FCS B;  1NO3 A;  3ER7 A;  1OHP A;  3FH1 A;  1N5H A;  3RGA A;  2GEX A;  3V99 A;  1Q42 A;  3G6E 3;  3LT9 A;  1WMO A;  1JB5 A;  3HI7 A;  3NM7 A;  2CFK A;  4N6O B;  5HGR A;  3S29 A;  3I56 3;  1CQS A;  4BTY A;  4XBT A;  5A0O B;  2CG1 A;  1FUW A;  1WQL B;  4EXR A;  1O7M B;  4FMB A;  1OF5 B;  1GD4 A;  2ML5 A;  2OWP A;  3AMO B;  1Q7Y 4;  1SIH A;  3O8Y A;  4N6V 0;  1IT8 A;  3T8N A;  3E99 A;  2C10 A;  4AKZ A;  3HX8 A;  1PFP A;  2INX A;  4N6N B;  1D6Z A;  3D3L A;  4MMY B;  3CCL 3;  4RNY A;  1TP6 A;  3WOF B;  3FG3 A;  2IUK A;  3EN8 A;  1MOL A;  2L4V A;  3KN4 A;  3ALA A;  4H61 A;  1G96 A;  3MG2 A;  4O8S A;  1IQY A;  3NBJ A;  2E2V A;  3KZT A;  4WYK A;  1N9J A;  3SXX A;  1JJ2 2;  3T0U A;  1CEW I;  2LQV A;  2BO9 B;  5FW5 A;  1YJW 3;  3LTB A;  2LYX A;  4MJD A;  3I55 3;  4N6T A;  5LC7 A;  1QAF A;  1OPY A;  4AKY A;  3B4P A;  4BTW A;  2XFT A;  2P0M A;  2QGU A;  2ML6 A;  2E2T A;  3SOY A;  4HBR A;  3ROB A;  3K63 A;  1W4N A;  1GD3 A;  5CXO A;  1J2B A;  4WFO A;  2OQE A;  4N6L A;  3NBR A;  1U5O A;  2OTL 3;  4EV2 A;  1YI2 3;  3GZX B;  2WGQ A;  2ZDJ A;  4HM7 B;  1UI7 A;  2W9Q A;  2W56 A;  3TDG A;  1JN5 A;  5AI1 A;  4WWU C;  2BT3 A;  5JPU A;  2CIU A;  2HMK B;  3X42 A;  3GZR A;  3F8X A;  3L0R A;  2CK3 H;  4NRE A;  5BVB A;  1SPU A;  1E97 A;  5AEW B;  3CCQ 3;  2R4I A;  3UB1 A;  4XB5 A;  4N6M A;  1AVK A;  3FLJ A;  3BB9 A;  3IMA B;  1FGR A;  4HM6 B;  1NWW A;  4HZB B;  1GS3 A;  1QMA A;  2KCD A;  3G0K A;  1VZZ A;  5BXQ A;  4HM1 B;  1YHQ 3;  4O3V A;  1ZO2 A;  3NX0 A;  5IG5 A;  3CCR 3;  3DMC A;  1OAC A;  3EHC A;  1DMN A;  1C7H A;  3BNE A;  4N3V A;  3PZW A;  4NHF A;  4HM2 B;  3Q2P A;  2CG0 A;  3LTA A;  3EC9 A;  2ZL8 A;  4RZM A;  3NM2 A;  3VF1 A;  1IV9 A;  3FF2 A;  1D6Y A;  4GL6 A;  3OXA A;  1WMP A;  3MYT A;  1N5P A;  4LEH A;  4LZI A;  1STD A;  1M1X B;  1IK3 A;  4H3U A;  5EVH A;  2RGQ A;  2YFJ B;  2Z7A A;  3UL5 A;  1O7W B;  1W6Y A;  3S27 A;  1JB2 A;  1VQ5 3;  1VQ6 3;  1QVG 2;  3CD6 3;  1BUQ A;  1ZX2 A;  5IF6 A;  3NUV A;  3V98 A;  4OVM A;  5JBS A;  4XDV A;  1KSI A;  2BNG A;  3VSY A;  3MSO A;  3B8L A;  1IVW A;  1VQP 3;  1O7P B;  4EC6 A;  1JB4 A;  4Q53 A;  4WYK B;  5I97 A;  1A90 A;  1OH0 A;  4HM0 B;  2HML B;  4MMX B;  3WA3 A;  4BTX A;  3K0Z A;  4ZM8 A;  1W6C A;  3F40 A;  1RJO A;  1A2K A;  3S28 A;  3FF0 A;  3MG3 A;  2FXT A;  3A76 A;  5AIF A;  3FZW A;  4J8T A;  4K90 B;  4XBX A;  1DVD A;  2OTJ 3;  2CWU A;  1JKG A;  4G1M B;  1VQ8 3;  1F8N A;  3BND A;  1PU4 A;  2MF7 A;  2C11 A;  1RRH A;  2P38 A;  2Z6B A;  2HMJ B;  3M8C A;  4O02 B;  3U1W A;  3X40 A;  3CME 3;  3MPH A;  2Y74 A;  1K41 A;  4J9A A;  1FGT A;  2W56 B;  3UNL A;  1JN5 B;  5IG3 A;  4KFD A;  1UW1 A;  2XFS A;  3DY5 A;  2I9W A;  3LTC A;  4IT7 A;  1EA2 A;  2W03 A;  3EX9 A;  1OUN A;  2IA7 A;  2OQE C;  1R4C A;  1NJI 4;  3OW2 2;  4L8P A;  3BNB A;  5AEU B;  2Q07 A;  5CK6 A;  3OWS A;  4STD A;  1RRL A;  1FGQ A;  5D83 A;  5ELJ A;  3PYJ A;  4U13 A;  3LOY A;  1OHO A;  1IQ8 A;  1DVC A;  3BLZ A;  3CNX A;  1TUH A;  2GU3 A;  3CC7 3;  4JF8 A;  1LNH A;  3LML A;  1D6U A;  2STD A;  3GRD A;  4CDL A;  4GB5 A;  2D1W A;  4LSO A;  3BNC A;  1JNQ A;  4OUQ A;  2V1L A;  5EQL A;  1KC8 4;  3JUO A;  3U97 A;  3WMD A;  1N9E A;  4KFF A;  2RCD A;  3VGN A;  1K9M 4;  3FKA A;  5G2G A;  4K1U A;  1UUW B;  4RBN A;  2FNQ A;  1IT7 A;  4R80 A;  4R1K A;  4X2H A;  2HMN B;  4HZ9 B;  5AIG A;  3OV4 A;  3DGL A;  1SII A;  1T5Y A;  1EG9 B;  3HK4 A;  1MNL A;  2F98 A;  3GWR A;  1M9G A;  1GY7 A;  2XEP A;  3D9R A;  3LZA A;  3Q1C A;  4I4K A;  3PCR A;  3QRD A;  3WA2 X;  4EBG A;  2QIY A;  4AEQ A;  3CCS 3;  4XDW A;  2MC8 A;  1EKM A;  3V92 A;  3CCJ 3;  5JPP A;  3I0Y A;  2D42 A;  1FGO A;  5IW9 A;  3GZB A;  1NB5 I;  4ORL A;  2GEY A;  1W02 A;  2CHC A;  4FCZ A;  3N54 B;  2CKF B;  3LTD A;  1N8Q A;  1E3V A;  3EE1 A;  3PS8 A;  1IV7 A;  3CCV 3;  2KXG A;  2WGO A;  7STD A;  3S67 A;  1DMM A;  4WP5 A;  4RNZ A;  1WMN A;  4EV5 A;  3LYG A;  1JKG B;  1O7G B;  4LGQ A;  2QA4 3;  4R9K A;  1LXE A;  2P05 A;  2RFR A;  2CFG A;  2M7O A;  2XRX B;  2XF3 A;  3GAX A;  5KP1 A;  2BHM A;  5AIH A;  2W9P A;  2CFW A;  3IJE B;  3F7X A;  3MG1 A;  3EQQ B;  1DYU A;  3NHX A;  2IUJ A;  1A2V A;  3X3Y A;  1UUV B;  1W2B 2;  3DUK A;  1VQ4 3;  4HYZ A;  2W04 A;  4HM4 B;  2OOV A;  2O3O A;  2E2U A;  3DM8 A;  4WHA A;  1V74 A;  1ROV A;  1SQW A;  2O9U X;  1Q86 4;  1WTH A;  2FGT A;  3OWY A;  2WO0 A;  3KKG A;  1VQ9 3;  3PXM A;  3SED A;  2P09 A;  1US1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...