2HMOB

Crystal structure of naphthalene 1,2-dioxygenase bound to 3-nitrotoluene.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmoB00
5IG3A 2HMMB 1U5OA 5D82A 4FCJA 3CU3A 2Z77A 5EVHA 4MJDA 2HMNB 2Z76A 5IG4A 3D9RA 4HVNA 1BUQA 3MG3A 1C7HA 3H51A 1NDOB 4IIAA 3EQQB 5D83A 3UJMA 3JUOA 6STDA 5CF2A 3VSYA 2UX0A 1OCVA 5HGRA 4GB5A 4XDWA 3RGRA 1OF5A 1QJGA 4WYKA 2HMKB 3KE7A 4X2OA 2JQ5A 4ORLA 1UUWB 1O7PB 5JPPA 5IERA 3ECFA 1OUNA 1OHOA 3FLJA 3I0YA 2STDA 1JKGA 3F7XA 3DMCA 3CNXA 3RGAA 3G8ZA 3DXOA 3NBRA 1EG9B 5KP4A 2HMOB 3B4PA 2GEXA 2F98A 1Q40B 2R4IA 3F8XA 1JB5A 3KKGA 2I9WA 3IPTA 3T8UA 3FF0A 2IMJA 3A76A 4R9LA 5IG0A 4XBXA 1ZO2A 4WWUC 2B24B 3EF8A 5IEOA 5BXQA 3LZAA 5KP3A 4U13A 3LYGA 3G16A 5CK6A 2HMJB 4HJLB 3OWUA 4HZBB 2RFRA 3GZRA 1UUVB 2BMRB 1E97A 2A15A 3F9SA 5D81A 3ROBA 1K41A 3FZWA 2F99A 4L8OA 3EJVA 2YFLB 4LGQA 1SJWA 1HKXA 5IF6A 1W6YA 4J9AA 1DMNA 3MKIA 5AIHA 3NV0B 2INXA 3HZPA 3GWRA 3FF2A 2BMQB 1TUHA 5IEPA 3NM2A 3EC9A 1ISKA 7STDA 3K7CA 1OH0A 4LEHA 3SOYA 1ASKA 2RGQA 4HM2B 3FSDA 4J8TA 4HM3B 2Z7AA 4OVMA 3B8LA 3ER7A 1OPYA 5AIIA 3F8HA 4LMIA 1AR0A 1GY5A 2GXFA 3OXAA 1QMAA 1Q40A 1S5AA 3MSOA 1O7HB 5G2GA 3OWSA 4H3UA 4OUQA 3NUVA 3OV4A 4L7KA 2XR8B 3EN1B 1STDA 3T8NA 2YFIB 2GEYA 4HM0B 5JPUA 3JUQA 3EX9A 2XRXB 4HM4B 4HM1B 4XDVA 3KZTA 1A2KA 2QGUA 3JUMA 5AI1A 1JN5B 3VGNA 4RZMA 1EA2A 5IG5A 3F14A 1NU3A 3OWYA 1W02A 3FH1A 4R9KA 5IENA 1Q42A 5AIGA 1ULIB 3MYTA 3BLZA 1E3RA 1VZZA 3GRDA 1OGZA 1OGXA 2K54A 3NV0A 5AIFA 4HM5B 3WMDA 4I4KA 3JUPA 1DMQA 3G0KA 2XSHB 2CKFB 5CLKA 1JKGB 2B1XB 3HK4A 2RCDA 1IDPA 3M8CA 2GBWB 3SEDA 2F86B 4FCMA 5CF1A 4HZ9B 5TGNA 5STDA 2HMLB 1E3VA 3MG2A 3DZLA 1ZX2A 4K1VA 4Q53A 3FKAA 3EHCA 1GYBA 3B7CA 1WQLB 2CHCA 1CQSA 3B4OA 3K0ZA 3DUKA 3FGYA 3GZXB 5KP1A 3SOAA 1GY6A 3Q90A 1O7NB 3CPOA 2BNGA 4HM8B 2BMOB 2QIYA 4HKVB 5DREA 5AEUB 3NXJA 1OHSA 1JN5A 3F40A 3EBTA 1W01A 4XBTA 2W2CA 3STDA 4WP5A 2OWPA 1OHPA 2YFJB 1O7GB 1GY7A 3EBYA 1JB4A 1W00A 3BB9A 3CNMA 3DM8A 3MG1A 4CDLA 4XM4A 4HM7B 3GZYB 3E99A 1OF5B 5BVBA 1Z1SA 4WYKB 3EN8A 3F7SA 3UNLA 1JB2A 1NWWA 2PZVA 1DMMA 3JUNA 5AEWB 4HM6B 4XB5A 3GZBA 5FW5A 4N3VA 3S5CA 1TP6A 2XSOB 4R1KA 5CXOA 3NHXA 5DRVA 2GBXB 4PEJA 3OX9A 4X2HA 3H3HA 3KSPA 4STDA 4XBYA 1O7WB 4K1UA 1ULJB 8CHOA 3HX8A 3MHEA 1O7MB 1GS3A 4KVHA 4L8PA
chains in the Genus database with same CATH superfamily
2XF3A 5IG3A 2ML6A 2HMMB 1BRHA 1JRQA 2KXGA 1MWTA 1GOVA 5BU4A 3LTBA 3NQZA 1U5OA 1STFI 5D82A 1BSBA 4FCJA 3WA2X 3CU3A 2BU4A 1BNSA 4N6TA 2Z77A 4EBGA 1LXEA 5EVHA 1WNHA 4MJDA 1GD4A 3AMOB 2HMNB 1VQK3 4FCZA 2Z76A 1G02A 3RDEA 3FG4A 5IG4A 4IT7A 1B20A 1RKYA 1Q864 3D9RA 5M18A 1F8NA 4HVNA 3MG3A 1C7HA 1RGEA 4EV5A 9RNTA 1BUQA 1RN4A 3H51A 1NDOB 1GD3A 4IIAA 4FMBA 1FUWA 3EQQB 2FGTA 5D83A 4EC6A 2CFDA 1QVF2 1X1WA 3G713 5FGOA 1VQM3 2OOVA 4WHAA 1TU5A 1FGTA 1I70A 5LC7A 3UJMA 3JUOA 3NM7A 1V74A 6STDA 3CCL3 3Q3FA 4NREA 3HOHA 5CF2A 1BU4A 3VSYA 3I553 2UX0A 1T5YA 1B3SA 1OCVA 2WGQA 4GB5A 2AAEA 2CH9A 4K61A 4KFEA 1RCKA 4XDWA 5HGRA 3RGRA 1RNBA 1OF5A 4NPBA 1B27A 1Q7HA 3LXUX 1Q824 1W4NA 1B2MA 1QJGA 2P09A 1KC84 4WYKA 1YJ93 1K8A4 4N6LA 1BAOA 2K0MA 4O02B 2HMKB 3KE7A 1A2PA 3MWZA 4RNYA 2HOHA 4X2OA 2JQ5A 1TTOA 1WMOA 4ORLA 3X3YA 4BIRA 4CCVA 1BSDA 1IV7A 1TRPA 1UUWB 1KWIA 3D79A 1L5GB 1O7PB 1YIT3 1NB3I 2CW9A 1YVSA 2KF5A 5JPPA 5IERA 3URPA 1G96A 1B2SA 1OUNA 3ECFA 1Q814 1OHOA 3FLJA 1MWSA 2CC3A 3I0YA 3G6E3 3UL5A 3CME3 2STDA 3ZFZA 1MNLA 2O3OA 1JKGA 3F7XA 3N8BA 3X3XA 1RGHA 2K3DA 2UUGC 2OCTA 3DMCA 1Q9EA 3CNXA 3KIIA 1YNVX 3BNEA 1IVWA 1UUGB 3RGAA 3G8ZA 3U1WA 1T2HA 3CPW2 3IMAB 3DXOA 1SPUA 4HAAA 1IVXA 3NBRA 1DETA 1EG9B 1UCIA 3JVCA 3U97A 5KP4A 3LTCA 1I3FA 3S67A 2HMOB 2F5WA 1BRGA 3DGOA 4BTXA 3B4PA 2GEXA 2P38A 2SBLA 2F98A 1Q40B 2R4IA 3F8XA 4IPBA 1JB5A 2F4YA 3KKGA 4KZ1A 1RN7A 2I9WA 1DVDA 3IPTA 3T8UA 2L1SA 1LOXA 2CX1A 3FF0A 2IMJA 2CFKA 3A76A 2GSPA 4R9LA 4HOHA 1Y4KA 1IT7A 5IG0A 1W6GA 4XBXA 1VQQA 1LVNA 4ZM8A 1ZO2A 4WWUC 2B24B 4N6MA 1W7CA 1IV9A 3EF8A 2KF3A 2W0QA 5IEOA 3S28A 3GSPA 1SIHA 3LZAA 3WOFB 5KP3A 5BXQA 4U13A 3LT9A 3LYGA 3G16A 3WA3A 8RNTA 3BNDA 3LMLA 1B2ZA 3DGLA 1JZDA 5CK6A 2HMJB 4HJLB 1JBTA 4MMZB 3AMOA 3RNTA 2GU3A 5M1AA 1YJW3 1RGLA 3OWUA 1LOWA 4HZBB 3CCQ3 2RFRA 1VQ43 3GZRA 1UUVB 2BIRA 2BMRB 1E97A 1FW7A 1FYSA 1UCLA 2A15A 3EE1A 3F9SA 4HYZA 5D81A 1X1UA 2W56A 3ROBA 1K41A 1CEWI 3FZWA 1PU4A 3CCM3 1I2EA 2ZA4A 1RGGA 2F99A 4L8OA 1DYUA 2OTL3 4BL2A 3D5IA 4JF8A 7RNTA 1U8CB 2YFLB 3EJVA 4LGQA 2H0IA 1SJWA 1V58A 2Q07A 6GSPA 1HKXA 5IF6A 1YI23 1GMRA 3PS8A 1EQKA 2W9PA 1CH0A 1R4CA 1W6YA 2E2VA 3ZG5A 1IQ8A 1JBRA 3T0UA 1N8R4 4J9AA 1DMNA 2ZL8A 3MKIA 4LSOA 5AIHA 2CG1A 4BL3A 1QAKA 1KSIA 3NV0B 3CCU3 1BRIA 2INXA 5EQLA 3HZPA 4O3VA 2P0XA 3GWRA 3SLUA 3CD63 2XGLA 3FF2A 4O2HA 2BMQB 1BSEA 4N6OB 3PXMA 4ILFA 3Q1CA 5ELUA 5LC6A 1UI7A 1IVVA 1TUHA 1I0VA 5IEPA 1VQ83 2CX0A 3NM2A 1LQMB 3AHSA 3EC9A 3DY5A 4GSPA 4N6NB 4AKYA 7STDA 1YGWA 3K7CA 3KFQC 1BNGA 3I563 3CCV3 1OACA 1OH0A 4LEHA 3SOYA 1Q7Y4 1QVG2 2OQEC 2ZDJA 2JDIH 5I97A 1ASKA 2RGQA 2Y73A 2LYXA 4HM2B 1B2XA 4R4KA 2CFWA 3ALAA 1FUTA 2BT3A 1RLSA 3K9MC 2E2TA 1K28A 3FSDA 4J8TA 4NHFA 4I5QA 4HM3B 2Z7AA 1IVUA 2KF6A 1GOYA 4OVMA 3B8LA 3ER7A 4BU4A 1N5HA 3CC43 3BNCA 1OPYA 5AIIA 3WR2A 3F8HA 4BTWA 1I0XA 4LMIA 1AR0A 1NO3A 4OK0A 1GMPA 1GY5A 1RNTA 2GXFA 3X42A 1PY3A 3OXAA 4MEIA 1QMAA 2WO0A 1Q40A 1S5AA 1VQP3 1BNFA 1R4YA 1O7HB 3MSOA 3NQYA 3QK9A 1ZGXA 1FA3A 1IQXA 3D4AA 5G2GA 1EEJA 1BRKA 3OWSA 3DGYA 3CXC2 2XEPA 3HIGA 4H3UA 1T3BA 1W2ZA 4OUQA 2XGNA 3KSED 3X3ZA 1QALA 3NUVA 3OV4A 2CWTA 1LOYA 4L7KA 2XR8B 1DVCA 3EN1B 1STDA 2XFSA 2CWVA 3T8NA 1W6CA 2YX9A 3CCS3 1YIJ3 1D6YA 2GEYA 2YFIB 4HM0B 1M1XB 1BANA 2KRTA 5JPUA 2C4BA 4G1MB 1LQGC 1ISKA 2IY2A 3JUQA 3EX9A 1JZOA 3SX1A 1VQ93 2XRXB 1RMSA 3UL6A 4HM4B 3V99A 1US1A 4HM1B 3KZTA 4XDVA 1A2KA 2QGUA 3JUMA 1I2GA 5AI1A 1JN5B 3VGNA 3DH2A 1EA2A 4RZMA 5IG5A 1HU9A 4LYLB 4J5KA 3VF1A 1YVBI 3S29A 1SQWA 3F14A 5GSPA 2IUKA 5G1KA 1NU3A 1BGSA 1RGKA 2BHMA 2GU1A 4K90B 2IYJA 3OWYA 1BNIA 1W02A 3FH1A 1BNEA 3WHOA 4GHOA 2XH9A 4R9KA 1HZ1A 5IENA 1HYFA 1BSCA 1BIRA 1NNVA 1Q42A 2KCDA 3K63A 1ULIB 1YGEA 3MYTA 5AIGA 1NJI4 4H61A 1LNIA 4RNTA 3HI7A 1BRJA 3LOYA 1KQS2 3BLZA 1E3RA 2ZHXB 3KCHA 3KN4A 1VZZA 4CJNA 1T2IA 4QWTA 3GRDA 1OGZA 1ZS7A 1OGXA 2K54A 3NV0A 3QRDA 5AIFA 4HM5B 1PFPA 3PCRA 3WOEB 2Y74A 2IUJA 2QA43 1K9M4 3MPHA 3WMDA 1GMQA 2C10A 4I4KA 1G0TA 2W03A 3G4S3 1LOVA 1DMQA 3G0KA 2XSHB 3JUPA 2CKFB 1N5PA 5CLKA 1JKGB 3SXXA 3LTAA 1FZUA 1AVKA 2B1XB 3HK4A 4JRFA 2RCDA 2CWUA 1IU7A 3AHWA 1MGWA 1VQL3 1IDPA 2WOFA 2PNCA 4WFOA 3N54B 2CFGA 3M8CA 2GBWB 3SEDA 4EXRA 1N9EA 1VQO3 1A2VA 2F86B 2J8XB 4FCMA 5CF1A 2MF7A 4HZ9B 2KF4A 1LNHA 1WMPA 2AADA 4HBRA 1TIJA 5TGNA 2Z6BA 5STDA 4FMAA 4RNZA 1RRLA 4AEQA 1VQ73 2HMLB 3O8YA 1E3VA 1TRQA 3DGNA 3EB8A 4N6V0 2H0GA 3MG2A 1SARA 2WOHA 3NBBA 3A5EA 3AGOA 1RJOA 3IJEB 4BTYA 3X41A 1DE3A 3DZLA 3X40A 4FMCA 1ZX2A 1BUJA 5IW9A 4DKIA 1M904 1CYUA 4AKZA 1N9JA 4K1VA 2R41A 3FKAA 4Q53A 4RBNA 3EHCA 3SYUA 1GYBA 3B7CA 2E2UA 4N6UA 2CK3H 1WQLB 2CHCA 1IK3A 1BRNL 1CQSA 3B4OA 1RGAA 1RHLA 3DUKA 3FGYA 2UGIA 3K0ZA 3LTDA 4EYCA 3CC73 3GZXB 5KP1A 3SOAA 2L4VA 2D1WA 3TDGA 3CMA3 4LZIA 1GY6A 1TJDA 4EW5A 2IA7A 3SVAA 2LQVA 3CC23 2W9QA 3ZG0A 1S723 1D6UA 2W04A 3DGMA 3Q90A 4MMXB 1MWRA 1O7NB 3PGBA 1UCKA 1JV2B 3CPOA 1RDSA 2BNGA 1YJN3 4HM8B 1I8VA 2BMOB 1UGIA 2W56B 2KAAA 2QIYA 4HKVB 1I2FA 1GSPA 5DREA 3D3LA 3NXJA 1OHSA 1RGFA 1UCJA 4FR9A 1JN5A 5AEUB 1RGCA 3F40A 4MMYB 3WODG 5M19A 3EBTA 2ML5A 1JBSA 1W01A 4XBTA 1B21A 2P05A 1N8QA 2W2CA 3STDA 1BNRA 5HOHA 1AVLA 1LRAA 4WP5A 2OWPA 1MWUA 1OHPA 2OOVC 2YFJB 2D42A 2RNTA 1O7GB 4KT3B 1GY7A 3CCR3 1RN1A 5AYRB 3WDGB 2FXTA 5BIRA 5ELJA 2QEX3 2MC8A 1X1XA 3EBYA 1V57A 1SIIA 3FCSB 1C54A 1FGQA 1RRHA 1D6ZA 1JB4A 1AQZA 1FGMA 1MOLA 1W00A 2XFTA 2F56A 2SARA 3BB9A 3CNMA 2M7OA 3DM8A 1M1K4 3D5GA 5EEOA 3MG1A 4KFFA 4CPKA 1AV4A 1RTUA 3NBJA 3L0RA 4CDLA 1FGOA 4XM4A 1AY7A 1IQYA 4GL6A 1BRSA 1UI8A 3BNBA 1BOXA 4HM7B 3LH4A 1BNJA 3GZYB 3GAXA 1WMNA 4J5GA 3E99A 1UDII 3FG3A 2OTJ3 1EKMA 1OF5B 1M9GA 1RCLA 1W2B2 1KD14 5BVBA 3PCSA 1RSNA 1TFKA 1Z1SA 4WYKB 3EN8A 4KFDA 2CIUA 2CFLA 2RBIA 5A0OB 1GOUA 1CYVA 3BU4A 4EV2A 3CCJ3 1BSAA 3HIIA 1K734 1IT8A 3F7SA 1MGRA 5AYSC 1JNQA 4FMDA 3UNLA 1VQN3 1JB2A 1NWWA 2PZVA 1DMMA 2WGOA 3PZWA 3FG1A 4R80A 1W5ZA 1JJ22 1J2BA 3JUNA 2V1LA 5AEWB 3S27A 4HM6B 1UGHI 4XB5A 3GZBA 3V92A 1X1YA 1WTHA 2O9UX 1QAFA 1ROVA 5FW5A 4N3VA 3OW22 2FNQA 5G1LA 4O8SA 1UW1A 3S5CA 1YHQ3 1TP6A 1VQ63 2RSXA 2XSOB 2C11A 3BIRA 3K5TA 1BVIA 2CG0A 4R1KA 2H0HA 5CXOA 3NHXA 1TFOA 5DRVA 3CCE3 3NX0A 2W6JH 2GBXB 4PEJA 1ROAA 3OX9A 1EUIC 4TX4A 1I3IA 2P0MA 3PYJA 7GSPA 5RNTA 4X2HA 3H3HA 2F5MA 3KSPA 2BO9B 3N9HA 4STDA 1O7WB 4XBYA 1FUSA 4K1UA 6RNTA 1A90A 1ULJB 8CHOA 3HX8A 1PYLA 1FGRA 1B2UA 1NB5I 1A67A 5JBSA 3UB1A 3MHEA 1IYYA 3J7Yd 3AGNA 1O7MB 2OQEA 3LT8A 3Q2PA 3V98A 1VQ53 1GS3A 4KVHA 4L8PA
chains in the Genus database with same CATH topology
2XF3A 5IG3A 2ML6A 2HMMB 1JRQA 2KXGA 3LTBA 3NQZA 1U5OA 1STFI 5D82A 4FCJA 3WA2X 3CU3A 4N6TA 2Z77A 4EBGA 1LXEA 5EVHA 1WNHA 4MJDA 1GD4A 3AMOB 2HMNB 1VQK3 4FCZA 2Z76A 3RDEA 3FG4A 5IG4A 4IT7A 1RKYA 1Q864 3D9RA 1F8NA 4HVNA 3MG3A 1C7HA 4EV5A 1BUQA 3H51A 1NDOB 1GD3A 4IIAA 4FMBA 1FUWA 3EQQB 2FGTA 5D83A 4EC6A 2CFDA 1QVF2 3G713 5FGOA 1VQM3 2OOVA 4WHAA 1TU5A 1FGTA 5LC7A 3UJMA 3JUOA 3NM7A 1V74A 6STDA 4NREA 5CF2A 3VSYA 3I553 2UX0A 1T5YA 1OCVA 2WGQA 4K61A 4GB5A 4KFEA 2CH9A 5HGRA 3CCL3 4XDWA 1A90A 3RGRA 1OF5A 3LXUX 1Q824 1W4NA 1QJGA 2P09A 1KC84 4WYKA 1YJ93 1K8A4 4N6LA 2K0MA 4O02B 2HMKB 3KE7A 3MWZA 4RNYA 4X2OA 2JQ5A 1WMOA 4ORLA 3X3YA 4CCVA 1IV7A 1UUWB 1KWIA 1L5GB 1O7PB 1YIT3 1NB3I 2CW9A 5JPPA 5IERA 1G96A 3ECFA 1OUNA 1Q814 1OHOA 3FLJA 2CC3A 3I0YA 3G6E3 3UL5A 3CME3 2STDA 1MNLA 2O3OA 1JKGA 3F7XA 3N8BA 3X3XA 2OCTA 3DMCA 3CNXA 3KIIA 3BNEA 1IVWA 3RGAA 3G8ZA 3U1WA 3CPW2 3IMAB 3DXOA 1SPUA 1IVXA 3NBRA 1EG9B 3JVCA 3U97A 5KP4A 3LTCA 3S67A 2HMOB 3DGOA 4BTXA 3B4PA 2GEXA 2P38A 2SBLA 2F98A 1Q40B 2R4IA 3F8XA 4IPBA 1JB5A 3KKGA 4KZ1A 1RN7A 2I9WA 1DVDA 3IPTA 3T8UA 1LOXA 3FF0A 2IMJA 2CFKA 3A76A 4R9LA 1Y4KA 1IT7A 5IG0A 1W6GA 4XBXA 1LVNA 4ZM8A 1ZO2A 4WWUC 2B24B 4N6MA 1W7CA 1IV9A 3EF8A 2W0QA 5IEOA 5BXQA 3S28A 1SIHA 3LZAA 3WOFB 5KP3A 4U13A 3LT9A 3LYGA 3G16A 3WA3A 3BNDA 3LMLA 3DGLA 5CK6A 2HMJB 4HJLB 4MMZB 3AMOA 2GU3A 1YJW3 3OWUA 3CCQ3 4HZBB 2RFRA 1VQ43 3GZRA 1UUVB 2BMRB 1E97A 2A15A 3EE1A 3F9SA 4HYZA 5D81A 3CCM3 2W56A 3ROBA 1K41A 1CEWI 3FZWA 1PU4A 1VQ93 2OTL3 2F99A 4L8OA 1DYUA 4JF8A 1U8CB 2YFLB 3EJVA 4LGQA 1SJWA 2Q07A 1HKXA 5IF6A 1YI23 3PS8A 1EQKA 2W9PA 1W6YA 1R4CA 2E2VA 1IQ8A 3T0UA 1N8R4 4J9AA 1DMNA 2ZL8A 3MKIA 4LSOA 5AIHA 2CG1A 1QAKA 1KSIA 3NV0B 3CCU3 2INXA 5EQLA 3HZPA 4O3VA 2P0XA 3GWRA 3SLUA 3CD63 2XGLA 3FF2A 4O2HA 2BMQB 4N6OB 3PXMA 5ELUA 3Q1CA 5LC6A 1UI7A 1IVVA 1TUHA 5IEPA 1VQ83 3NM2A 4N6NB 3DY5A 3EC9A 4AKYA 7STDA 3I563 1ISKA 3K7CA 3KFQC 1QVG2 3CCV3 1OACA 1OH0A 4LEHA 3SOYA 1Q7Y4 2OQEC 2ZDJA 2JDIH 5I97A 1ASKA 2RGQA 2Y73A 2LYXA 4HM2B 4R4KA 2CFWA 3ALAA 2BT3A 3K9MC 2E2TA 1K28A 3FSDA 4J8TA 4NHFA 4HM3B 2Z7AA 1IVUA 4OVMA 3B8LA 3ER7A 1N5HA 3CC43 3BNCA 1OPYA 5AIIA 3F8HA 4BTWA 4LMIA 1AR0A 1NO3A 4OK0A 1GY5A 2GXFA 3X42A 3OXAA 4MEIA 1QMAA 2WO0A 1Q40A 1S5AA 1VQP3 3MSOA 1O7HB 3NQYA 3QK9A 1FA3A 1IQXA 5G2GA 3OWSA 3CXC2 2XEPA 3HIGA 4H3UA 1W2ZA 4OUQA 2XGNA 3KSED 3X3ZA 1QALA 3NUVA 3OV4A 2CWTA 4L7KA 2XR8B 1DVCA 3EN1B 1STDA 2XFSA 2CWVA 3T8NA 1W6CA 2YX9A 3CCS3 1YIJ3 1D6YA 2GEYA 2YFIB 4HM0B 1M1XB 2KRTA 5JPUA 4G1MB 3JUQA 3EX9A 3SX1A 2XRXB 3UL6A 4HM4B 3V99A 1US1A 4HM1B 3KZTA 4XDVA 1A2KA 2QGUA 3JUMA 5AI1A 1JN5B 3VGNA 4RZMA 1EA2A 5IG5A 1HU9A 3VF1A 1YVBI 3S29A 1SQWA 3F14A 2IUKA 1NU3A 2BHMA 2GU1A 4K90B 3OWYA 1W02A 3FH1A 2XH9A 4R9KA 5IENA 3K63A 2KCDA 1NJI4 1Q42A 5AIGA 1ULIB 1YGEA 3MYTA 4H61A 3HI7A 3LOYA 1KQS2 3BLZA 1E3RA 3KN4A 1VZZA 4QWTA 3GRDA 1OGZA 1OGXA 2K54A 3NV0A 3QRDA 5AIFA 4HM5B 1PFPA 3PCRA 3WOEB 2Y74A 2IUJA 2QA43 1K9M4 3MPHA 3WMDA 4I4KA 2C10A 2W03A 3G4S3 3JUPA 1DMQA 3G0KA 2XSHB 2CKFB 1N5PA 5CLKA 1JKGB 3SXXA 3LTAA 1AVKA 2B1XB 3HK4A 4JRFA 2RCDA 2CWUA 1IU7A 1VQL3 1IDPA 2WOFA 2PNCA 4WFOA 3N54B 2CFGA 3M8CA 2GBWB 3SEDA 4EXRA 1N9EA 1VQO3 1A2VA 2F86B 4FCMA 5CF1A 2MF7A 4HZ9B 1LNHA 1WMPA 4HBRA 1TIJA 5TGNA 2Z6BA 5STDA 4FMAA 4RNZA 1RRLA 4AEQA 1VQ73 2HMLB 3O8YA 1E3VA 3DGNA 3EB8A 4N6V0 3MG2A 2WOHA 3NBBA 3IJEB 1RJOA 4BTYA 3X41A 3DZLA 3X40A 4FMCA 1ZX2A 5IW9A 1M904 1CYUA 4AKZA 1N9JA 4K1VA 4Q53A 3FKAA 4RBNA 3EHCA 1GYBA 3B7CA 2E2UA 4N6UA 2CK3H 1WQLB 2CHCA 1IK3A 1CQSA 3B4OA 3K0ZA 3DUKA 3FGYA 3LTDA 4EYCA 3CC73 3GZXB 5KP1A 3SOAA 2L4VA 2D1WA 3TDGA 3CMA3 4LZIA 1GY6A 2IA7A 3SVAA 2LQVA 3CC23 2W9QA 1S723 1D6UA 2W04A 3DGMA 3Q90A 4MMXB 1O7NB 3PGBA 1YJN3 1JV2B 3CPOA 2BNGA 4HM8B 2BMOB 2W56B 2QIYA 4HKVB 5DREA 3D3LA 3NXJA 1OHSA 4FR9A 5AEUB 1JN5A 3F40A 4MMYB 3WODG 3EBTA 2ML5A 1W01A 4XBTA 2P05A 1N8QA 2W2CA 3STDA 1AVLA 4WP5A 2OWPA 1OHPA 2OOVC 2YFJB 2D42A 1O7GB 1GY7A 3CCR3 5AYRB 3WDGB 2FXTA 5ELJA 2QEX3 2MC8A 3EBYA 3FCSB 1SIIA 1FGQA 1RRHA 1D6ZA 1MOLA 1FGMA 1JB4A 1W00A 2XFTA 3BB9A 3CNMA 2M7OA 3DM8A 1M1K4 5EEOA 3MG1A 4KFFA 1AV4A 3NBJA 3L0RA 4CDLA 1FGOA 4XM4A 1IQYA 4GL6A 1UI8A 3BNBA 4HM7B 3LH4A 3GZYB 3GAXA 1WMNA 2OTJ3 3E99A 3FG3A 1EKMA 1OF5B 1M9GA 1W2B2 1KD14 5BVBA 3PCSA 1TFKA 1Z1SA 4WYKB 3EN8A 4KFDA 2CIUA 2CFLA 5A0OB 1CYVA 4EV2A 3CCJ3 3HIIA 1K734 1IT8A 3F7SA 5AYSC 1JNQA 4FMDA 3UNLA 1VQN3 1JB2A 1NWWA 2PZVA 1DMMA 2WGOA 3PZWA 3FG1A 4R80A 1W5ZA 1JJ22 1J2BA 3JUNA 2V1LA 5AEWB 3S27A 4HM6B 4XB5A 3GZBA 3V92A 1WTHA 2O9UX 1QAFA 1ROVA 5FW5A 4N3VA 3OW22 2FNQA 4O8SA 1UW1A 3S5CA 1YHQ3 1TP6A 1VQ63 2RSXA 2XSOB 2C11A 4R1KA 3K5TA 2CG0A 5CXOA 3NHXA 1TFOA 5DRVA 3CCE3 3NX0A 2W6JH 2GBXB 4PEJA 1ROAA 3OX9A 4TX4A 2P0MA 3PYJA 4X2HA 3H3HA 3KSPA 3N9HA 2BO9B 4STDA 4XBYA 1O7WB 4K1UA 1ULJB 8CHOA 3HX8A 1FGRA 1A67A 1NB5I 5JBSA 3UB1A 3MHEA 3J7Yd 1VQ53 1O7MB 2OQEA 3LT8A 3Q2PA 3V98A 1GS3A 4KVHA 4L8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IG3 A;  2HMM B;  1U5O A;  5D82 A;  4FCJ A;  3CU3 A;  2Z77 A;  5EVH A;  4MJD A;  2HMN B;  2Z76 A;  5IG4 A;  3D9R A;  4HVN A;  1BUQ A;  3MG3 A;  1C7H A;  3H51 A;  1NDO B;  4IIA A;  3EQQ B;  5D83 A;  3UJM A;  3JUO A;  6STD A;  5CF2 A;  3VSY A;  2UX0 A;  1OCV A;  5HGR A;  4GB5 A;  4XDW A;  3RGR A;  1OF5 A;  1QJG A;  4WYK A;  2HMK B;  3KE7 A;  4X2O A;  2JQ5 A;  4ORL A;  1UUW B;  1O7P B;  5JPP A;  5IER A;  3ECF A;  1OUN A;  1OHO A;  3FLJ A;  3I0Y A;  2STD A;  1JKG A;  3F7X A;  3DMC A;  3CNX A;  3RGA A;  3G8Z A;  3DXO A;  3NBR A;  1EG9 B;  5KP4 A;  2HMO B;  3B4P A;  2GEX A;  2F98 A;  1Q40 B;  2R4I A;  3F8X A;  1JB5 A;  3KKG A;  2I9W A;  3IPT A;  3T8U A;  3FF0 A;  2IMJ A;  3A76 A;  4R9L A;  5IG0 A;  4XBX A;  1ZO2 A;  4WWU C;  2B24 B;  3EF8 A;  5IEO A;  5BXQ A;  3LZA A;  5KP3 A;  4U13 A;  3LYG A;  3G16 A;  5CK6 A;  2HMJ B;  4HJL B;  3OWU A;  4HZB B;  2RFR A;  3GZR A;  1UUV B;  2BMR B;  1E97 A;  2A15 A;  3F9S A;  5D81 A;  3ROB A;  1K41 A;  3FZW A;  2F99 A;  4L8O A;  3EJV A;  2YFL B;  4LGQ A;  1SJW A;  1HKX A;  5IF6 A;  1W6Y A;  4J9A A;  1DMN A;  3MKI A;  5AIH A;  3NV0 B;  2INX A;  3HZP A;  3GWR A;  3FF2 A;  2BMQ B;  1TUH A;  5IEP A;  3NM2 A;  3EC9 A;  1ISK A;  7STD A;  3K7C A;  1OH0 A;  4LEH A;  3SOY A;  1ASK A;  2RGQ A;  4HM2 B;  3FSD A;  4J8T A;  4HM3 B;  2Z7A A;  4OVM A;  3B8L A;  3ER7 A;  1OPY A;  5AII A;  3F8H A;  4LMI A;  1AR0 A;  1GY5 A;  2GXF A;  3OXA A;  1QMA A;  1Q40 A;  1S5A A;  3MSO A;  1O7H B;  5G2G A;  3OWS A;  4H3U A;  4OUQ A;  3NUV A;  3OV4 A;  4L7K A;  2XR8 B;  3EN1 B;  1STD A;  3T8N A;  2YFI B;  2GEY A;  4HM0 B;  5JPU A;  3JUQ A;  3EX9 A;  2XRX B;  4HM4 B;  4HM1 B;  4XDV A;  3KZT A;  1A2K A;  2QGU A;  3JUM A;  5AI1 A;  1JN5 B;  3VGN A;  4RZM A;  1EA2 A;  5IG5 A;  3F14 A;  1NU3 A;  3OWY A;  1W02 A;  3FH1 A;  4R9K A;  5IEN A;  1Q42 A;  5AIG A;  1ULI B;  3MYT A;  3BLZ A;  1E3R A;  1VZZ A;  3GRD A;  1OGZ A;  1OGX A;  2K54 A;  3NV0 A;  5AIF A;  4HM5 B;  3WMD A;  4I4K A;  3JUP A;  1DMQ A;  3G0K A;  2XSH B;  2CKF B;  5CLK A;  1JKG B;  2B1X B;  3HK4 A;  2RCD A;  1IDP A;  3M8C A;  2GBW B;  3SED A;  2F86 B;  4FCM A;  5CF1 A;  4HZ9 B;  5TGN A;  5STD A;  2HML B;  1E3V A;  3MG2 A;  3DZL A;  1ZX2 A;  4K1V A;  4Q53 A;  3FKA A;  3EHC A;  1GYB A;  3B7C A;  1WQL B;  2CHC A;  1CQS A;  3B4O A;  3K0Z A;  3DUK A;  3FGY A;  3GZX B;  5KP1 A;  3SOA A;  1GY6 A;  3Q90 A;  1O7N B;  3CPO A;  2BNG A;  4HM8 B;  2BMO B;  2QIY A;  4HKV B;  5DRE A;  5AEU B;  3NXJ A;  1OHS A;  1JN5 A;  3F40 A;  3EBT A;  1W01 A;  4XBT A;  2W2C A;  3STD A;  4WP5 A;  2OWP A;  1OHP A;  2YFJ B;  1O7G B;  1GY7 A;  3EBY A;  1JB4 A;  1W00 A;  3BB9 A;  3CNM A;  3DM8 A;  3MG1 A;  4CDL A;  4XM4 A;  4HM7 B;  3GZY B;  3E99 A;  1OF5 B;  5BVB A;  1Z1S A;  4WYK B;  3EN8 A;  3F7S A;  3UNL A;  1JB2 A;  1NWW A;  2PZV A;  1DMM A;  3JUN A;  5AEW B;  4HM6 B;  4XB5 A;  3GZB A;  5FW5 A;  4N3V A;  3S5C A;  1TP6 A;  2XSO B;  4R1K A;  5CXO A;  3NHX A;  5DRV A;  2GBX B;  4PEJ A;  3OX9 A;  4X2H A;  3H3H A;  3KSP A;  4STD A;  4XBY A;  1O7W B;  4K1U A;  1ULJ B;  8CHO A;  3HX8 A;  3MHE A;  1O7M B;  1GS3 A;  4KVH A;  4L8P A; 
#chains in the Genus database with same CATH topology
 2XF3 A;  5IG3 A;  2ML6 A;  2HMM B;  1BRH A;  1JRQ A;  2KXG A;  1MWT A;  1GOV A;  5BU4 A;  3LTB A;  3NQZ A;  1U5O A;  1STF I;  5D82 A;  1BSB A;  4FCJ A;  3WA2 X;  3CU3 A;  2BU4 A;  1BNS A;  4N6T A;  2Z77 A;  4EBG A;  1LXE A;  5EVH A;  1WNH A;  4MJD A;  1GD4 A;  3AMO B;  2HMN B;  1VQK 3;  4FCZ A;  2Z76 A;  1G02 A;  3RDE A;  3FG4 A;  5IG4 A;  4IT7 A;  1B20 A;  1RKY A;  1Q86 4;  3D9R A;  5M18 A;  1F8N A;  4HVN A;  3MG3 A;  1C7H A;  1RGE A;  4EV5 A;  9RNT A;  1BUQ A;  1RN4 A;  3H51 A;  1NDO B;  1GD3 A;  4IIA A;  4FMB A;  1FUW A;  3EQQ B;  2FGT A;  5D83 A;  4EC6 A;  2CFD A;  1QVF 2;  1X1W A;  3G71 3;  5FGO A;  1VQM 3;  2OOV A;  4WHA A;  1TU5 A;  1FGT A;  1I70 A;  5LC7 A;  3UJM A;  3JUO A;  3NM7 A;  1V74 A;  6STD A;  3CCL 3;  3Q3F A;  4NRE A;  3HOH A;  5CF2 A;  1BU4 A;  3VSY A;  3I55 3;  2UX0 A;  1T5Y A;  1B3S A;  1OCV A;  2WGQ A;  4GB5 A;  2AAE A;  2CH9 A;  4K61 A;  4KFE A;  1RCK A;  4XDW A;  5HGR A;  3RGR A;  1RNB A;  1OF5 A;  4NPB A;  1B27 A;  1Q7H A;  3LXU X;  1Q82 4;  1W4N A;  1B2M A;  1QJG A;  2P09 A;  1KC8 4;  4WYK A;  1YJ9 3;  1K8A 4;  4N6L A;  1BAO A;  2K0M A;  4O02 B;  2HMK B;  3KE7 A;  1A2P A;  3MWZ A;  4RNY A;  2HOH A;  4X2O A;  2JQ5 A;  1TTO A;  1WMO A;  4ORL A;  3X3Y A;  4BIR A;  4CCV A;  1BSD A;  1IV7 A;  1TRP A;  1UUW B;  1KWI A;  3D79 A;  1L5G B;  1O7P B;  1YIT 3;  1NB3 I;  2CW9 A;  1YVS A;  2KF5 A;  5JPP A;  5IER A;  3URP A;  1G96 A;  1B2S A;  1OUN A;  3ECF A;  1Q81 4;  1OHO A;  3FLJ A;  1MWS A;  2CC3 A;  3I0Y A;  3G6E 3;  3UL5 A;  3CME 3;  2STD A;  3ZFZ A;  1MNL A;  2O3O A;  1JKG A;  3F7X A;  3N8B A;  3X3X A;  1RGH A;  2K3D A;  2UUG C;  2OCT A;  3DMC A;  1Q9E A;  3CNX A;  3KII A;  1YNV X;  3BNE A;  1IVW A;  1UUG B;  3RGA A;  3G8Z A;  3U1W A;  1T2H A;  3CPW 2;  3IMA B;  3DXO A;  1SPU A;  4HAA A;  1IVX A;  3NBR A;  1DET A;  1EG9 B;  1UCI A;  3JVC A;  3U97 A;  5KP4 A;  3LTC A;  1I3F A;  3S67 A;  2HMO B;  2F5W A;  1BRG A;  3DGO A;  4BTX A;  3B4P A;  2GEX A;  2P38 A;  2SBL A;  2F98 A;  1Q40 B;  2R4I A;  3F8X A;  4IPB A;  1JB5 A;  2F4Y A;  3KKG A;  4KZ1 A;  1RN7 A;  2I9W A;  1DVD A;  3IPT A;  3T8U A;  2L1S A;  1LOX A;  2CX1 A;  3FF0 A;  2IMJ A;  2CFK A;  3A76 A;  2GSP A;  4R9L A;  4HOH A;  1Y4K A;  1IT7 A;  5IG0 A;  1W6G A;  4XBX A;  1VQQ A;  1LVN A;  4ZM8 A;  1ZO2 A;  4WWU C;  2B24 B;  4N6M A;  1W7C A;  1IV9 A;  3EF8 A;  2KF3 A;  2W0Q A;  5IEO A;  3S28 A;  3GSP A;  1SIH A;  3LZA A;  3WOF B;  5KP3 A;  5BXQ A;  4U13 A;  3LT9 A;  3LYG A;  3G16 A;  3WA3 A;  8RNT A;  3BND A;  3LML A;  1B2Z A;  3DGL A;  1JZD A;  5CK6 A;  2HMJ B;  4HJL B;  1JBT A;  4MMZ B;  3AMO A;  3RNT A;  2GU3 A;  5M1A A;  1YJW 3;  1RGL A;  3OWU A;  1LOW A;  4HZB B;  3CCQ 3;  2RFR A;  1VQ4 3;  3GZR A;  1UUV B;  2BIR A;  2BMR B;  1E97 A;  1FW7 A;  1FYS A;  1UCL A;  2A15 A;  3EE1 A;  3F9S A;  4HYZ A;  5D81 A;  1X1U A;  2W56 A;  3ROB A;  1K41 A;  1CEW I;  3FZW A;  1PU4 A;  3CCM 3;  1I2E A;  2ZA4 A;  1RGG A;  2F99 A;  4L8O A;  1DYU A;  2OTL 3;  4BL2 A;  3D5I A;  4JF8 A;  7RNT A;  1U8C B;  2YFL B;  3EJV A;  4LGQ A;  2H0I A;  1SJW A;  1V58 A;  2Q07 A;  6GSP A;  1HKX A;  5IF6 A;  1YI2 3;  1GMR A;  3PS8 A;  1EQK A;  2W9P A;  1CH0 A;  1R4C A;  1W6Y A;  2E2V A;  3ZG5 A;  1IQ8 A;  1JBR A;  3T0U A;  1N8R 4;  4J9A A;  1DMN A;  2ZL8 A;  3MKI A;  4LSO A;  5AIH A;  2CG1 A;  4BL3 A;  1QAK A;  1KSI A;  3NV0 B;  3CCU 3;  1BRI A;  2INX A;  5EQL A;  3HZP A;  4O3V A;  2P0X A;  3GWR A;  3SLU A;  3CD6 3;  2XGL A;  3FF2 A;  4O2H A;  2BMQ B;  1BSE A;  4N6O B;  3PXM A;  4ILF A;  3Q1C A;  5ELU A;  5LC6 A;  1UI7 A;  1IVV A;  1TUH A;  1I0V A;  5IEP A;  1VQ8 3;  2CX0 A;  3NM2 A;  1LQM B;  3AHS A;  3EC9 A;  3DY5 A;  4GSP A;  4N6N B;  4AKY A;  7STD A;  1YGW A;  3K7C A;  3KFQ C;  1BNG A;  3I56 3;  3CCV 3;  1OAC A;  1OH0 A;  4LEH A;  3SOY A;  1Q7Y 4;  1QVG 2;  2OQE C;  2ZDJ A;  2JDI H;  5I97 A;  1ASK A;  2RGQ A;  2Y73 A;  2LYX A;  4HM2 B;  1B2X A;  4R4K A;  2CFW A;  3ALA A;  1FUT A;  2BT3 A;  1RLS A;  3K9M C;  2E2T A;  1K28 A;  3FSD A;  4J8T A;  4NHF A;  4I5Q A;  4HM3 B;  2Z7A A;  1IVU A;  2KF6 A;  1GOY A;  4OVM A;  3B8L A;  3ER7 A;  4BU4 A;  1N5H A;  3CC4 3;  3BNC A;  1OPY A;  5AII A;  3WR2 A;  3F8H A;  4BTW A;  1I0X A;  4LMI A;  1AR0 A;  1NO3 A;  4OK0 A;  1GMP A;  1GY5 A;  1RNT A;  2GXF A;  3X42 A;  1PY3 A;  3OXA A;  4MEI A;  1QMA A;  2WO0 A;  1Q40 A;  1S5A A;  1VQP 3;  1BNF A;  1R4Y A;  1O7H B;  3MSO A;  3NQY A;  3QK9 A;  1ZGX A;  1FA3 A;  1IQX A;  3D4A A;  5G2G A;  1EEJ A;  1BRK A;  3OWS A;  3DGY A;  3CXC 2;  2XEP A;  3HIG A;  4H3U A;  1T3B A;  1W2Z A;  4OUQ A;  2XGN A;  3KSE D;  3X3Z A;  1QAL A;  3NUV A;  3OV4 A;  2CWT A;  1LOY A;  4L7K A;  2XR8 B;  1DVC A;  3EN1 B;  1STD A;  2XFS A;  2CWV A;  3T8N A;  1W6C A;  2YX9 A;  3CCS 3;  1YIJ 3;  1D6Y A;  2GEY A;  2YFI B;  4HM0 B;  1M1X B;  1BAN A;  2KRT A;  5JPU A;  2C4B A;  4G1M B;  1LQG C;  1ISK A;  2IY2 A;  3JUQ A;  3EX9 A;  1JZO A;  3SX1 A;  1VQ9 3;  2XRX B;  1RMS A;  3UL6 A;  4HM4 B;  3V99 A;  1US1 A;  4HM1 B;  3KZT A;  4XDV A;  1A2K A;  2QGU A;  3JUM A;  1I2G A;  5AI1 A;  1JN5 B;  3VGN A;  3DH2 A;  1EA2 A;  4RZM A;  5IG5 A;  1HU9 A;  4LYL B;  4J5K A;  3VF1 A;  1YVB I;  3S29 A;  1SQW A;  3F14 A;  5GSP A;  2IUK A;  5G1K A;  1NU3 A;  1BGS A;  1RGK A;  2BHM A;  2GU1 A;  4K90 B;  2IYJ A;  3OWY A;  1BNI A;  1W02 A;  3FH1 A;  1BNE A;  3WHO A;  4GHO A;  2XH9 A;  4R9K A;  1HZ1 A;  5IEN A;  1HYF A;  1BSC A;  1BIR A;  1NNV A;  1Q42 A;  2KCD A;  3K63 A;  1ULI B;  1YGE A;  3MYT A;  5AIG A;  1NJI 4;  4H61 A;  1LNI A;  4RNT A;  3HI7 A;  1BRJ A;  3LOY A;  1KQS 2;  3BLZ A;  1E3R A;  2ZHX B;  3KCH A;  3KN4 A;  1VZZ A;  4CJN A;  1T2I A;  4QWT A;  3GRD A;  1OGZ A;  1ZS7 A;  1OGX A;  2K54 A;  3NV0 A;  3QRD A;  5AIF A;  4HM5 B;  1PFP A;  3PCR A;  3WOE B;  2Y74 A;  2IUJ A;  2QA4 3;  1K9M 4;  3MPH A;  3WMD A;  1GMQ A;  2C10 A;  4I4K A;  1G0T A;  2W03 A;  3G4S 3;  1LOV A;  1DMQ A;  3G0K A;  2XSH B;  3JUP A;  2CKF B;  1N5P A;  5CLK A;  1JKG B;  3SXX A;  3LTA A;  1FZU A;  1AVK A;  2B1X B;  3HK4 A;  4JRF A;  2RCD A;  2CWU A;  1IU7 A;  3AHW A;  1MGW A;  1VQL 3;  1IDP A;  2WOF A;  2PNC A;  4WFO A;  3N54 B;  2CFG A;  3M8C A;  2GBW B;  3SED A;  4EXR A;  1N9E A;  1VQO 3;  1A2V A;  2F86 B;  2J8X B;  4FCM A;  5CF1 A;  2MF7 A;  4HZ9 B;  2KF4 A;  1LNH A;  1WMP A;  2AAD A;  4HBR A;  1TIJ A;  5TGN A;  2Z6B A;  5STD A;  4FMA A;  4RNZ A;  1RRL A;  4AEQ A;  1VQ7 3;  2HML B;  3O8Y A;  1E3V A;  1TRQ A;  3DGN A;  3EB8 A;  4N6V 0;  2H0G A;  3MG2 A;  1SAR A;  2WOH A;  3NBB A;  3A5E A;  3AGO A;  1RJO A;  3IJE B;  4BTY A;  3X41 A;  1DE3 A;  3DZL A;  3X40 A;  4FMC A;  1ZX2 A;  1BUJ A;  5IW9 A;  4DKI A;  1M90 4;  1CYU A;  4AKZ A;  1N9J A;  4K1V A;  2R41 A;  3FKA A;  4Q53 A;  4RBN A;  3EHC A;  3SYU A;  1GYB A;  3B7C A;  2E2U A;  4N6U A;  2CK3 H;  1WQL B;  2CHC A;  1IK3 A;  1BRN L;  1CQS A;  3B4O A;  1RGA A;  1RHL A;  3DUK A;  3FGY A;  2UGI A;  3K0Z A;  3LTD A;  4EYC A;  3CC7 3;  3GZX B;  5KP1 A;  3SOA A;  2L4V A;  2D1W A;  3TDG A;  3CMA 3;  4LZI A;  1GY6 A;  1TJD A;  4EW5 A;  2IA7 A;  3SVA A;  2LQV A;  3CC2 3;  2W9Q A;  3ZG0 A;  1S72 3;  1D6U A;  2W04 A;  3DGM A;  3Q90 A;  4MMX B;  1MWR A;  1O7N B;  3PGB A;  1UCK A;  1JV2 B;  3CPO A;  1RDS A;  2BNG A;  1YJN 3;  4HM8 B;  1I8V A;  2BMO B;  1UGI A;  2W56 B;  2KAA A;  2QIY A;  4HKV B;  1I2F A;  1GSP A;  5DRE A;  3D3L A;  3NXJ A;  1OHS A;  1RGF A;  1UCJ A;  4FR9 A;  1JN5 A;  5AEU B;  1RGC A;  3F40 A;  4MMY B;  3WOD G;  5M19 A;  3EBT A;  2ML5 A;  1JBS A;  1W01 A;  4XBT A;  1B21 A;  2P05 A;  1N8Q A;  2W2C A;  3STD A;  1BNR A;  5HOH A;  1AVL A;  1LRA A;  4WP5 A;  2OWP A;  1MWU A;  1OHP A;  2OOV C;  2YFJ B;  2D42 A;  2RNT A;  1O7G B;  4KT3 B;  1GY7 A;  3CCR 3;  1RN1 A;  5AYR B;  3WDG B;  2FXT A;  5BIR A;  5ELJ A;  2QEX 3;  2MC8 A;  1X1X A;  3EBY A;  1V57 A;  1SII A;  3FCS B;  1C54 A;  1FGQ A;  1RRH A;  1D6Z A;  1JB4 A;  1AQZ A;  1FGM A;  1MOL A;  1W00 A;  2XFT A;  2F56 A;  2SAR A;  3BB9 A;  3CNM A;  2M7O A;  3DM8 A;  1M1K 4;  3D5G A;  5EEO A;  3MG1 A;  4KFF A;  4CPK A;  1AV4 A;  1RTU A;  3NBJ A;  3L0R A;  4CDL A;  1FGO A;  4XM4 A;  1AY7 A;  1IQY A;  4GL6 A;  1BRS A;  1UI8 A;  3BNB A;  1BOX A;  4HM7 B;  3LH4 A;  1BNJ A;  3GZY B;  3GAX A;  1WMN A;  4J5G A;  3E99 A;  1UDI I;  3FG3 A;  2OTJ 3;  1EKM A;  1OF5 B;  1M9G A;  1RCL A;  1W2B 2;  1KD1 4;  5BVB A;  3PCS A;  1RSN A;  1TFK A;  1Z1S A;  4WYK B;  3EN8 A;  4KFD A;  2CIU A;  2CFL A;  2RBI A;  5A0O B;  1GOU A;  1CYV A;  3BU4 A;  4EV2 A;  3CCJ 3;  1BSA A;  3HII A;  1K73 4;  1IT8 A;  3F7S A;  1MGR A;  5AYS C;  1JNQ A;  4FMD A;  3UNL A;  1VQN 3;  1JB2 A;  1NWW A;  2PZV A;  1DMM A;  2WGO A;  3PZW A;  3FG1 A;  4R80 A;  1W5Z A;  1JJ2 2;  1J2B A;  3JUN A;  2V1L A;  5AEW B;  3S27 A;  4HM6 B;  1UGH I;  4XB5 A;  3GZB A;  3V92 A;  1X1Y A;  1WTH A;  2O9U X;  1QAF A;  1ROV A;  5FW5 A;  4N3V A;  3OW2 2;  2FNQ A;  5G1L A;  4O8S A;  1UW1 A;  3S5C A;  1YHQ 3;  1TP6 A;  1VQ6 3;  2RSX A;  2XSO B;  2C11 A;  3BIR A;  3K5T A;  1BVI A;  2CG0 A;  4R1K A;  2H0H A;  5CXO A;  3NHX A;  1TFO A;  5DRV A;  3CCE 3;  3NX0 A;  2W6J H;  2GBX B;  4PEJ A;  1ROA A;  3OX9 A;  1EUI C;  4TX4 A;  1I3I A;  2P0M A;  3PYJ A;  7GSP A;  5RNT A;  4X2H A;  3H3H A;  2F5M A;  3KSP A;  2BO9 B;  3N9H A;  4STD A;  1O7W B;  4XBY A;  1FUS A;  4K1U A;  6RNT A;  1A90 A;  1ULJ B;  8CHO A;  3HX8 A;  1PYL A;  1FGR A;  1B2U A;  1NB5 I;  1A67 A;  5JBS A;  3UB1 A;  3MHE A;  1IYY A;  3J7Y d;  3AGN A;  1O7M B;  2OQE A;  3LT8 A;  3Q2P A;  3V98 A;  1VQ5 3;  1GS3 A;  4KVH A;  4L8P A; 
#chains in the Genus database with same CATH homology
 2XF3 A;  5IG3 A;  2ML6 A;  2HMM B;  1JRQ A;  2KXG A;  3LTB A;  3NQZ A;  1U5O A;  1STF I;  5D82 A;  4FCJ A;  3WA2 X;  3CU3 A;  4N6T A;  2Z77 A;  4EBG A;  1LXE A;  5EVH A;  1WNH A;  4MJD A;  1GD4 A;  3AMO B;  2HMN B;  1VQK 3;  4FCZ A;  2Z76 A;  3RDE A;  3FG4 A;  5IG4 A;  4IT7 A;  1RKY A;  1Q86 4;  3D9R A;  1F8N A;  4HVN A;  3MG3 A;  1C7H A;  4EV5 A;  1BUQ A;  3H51 A;  1NDO B;  1GD3 A;  4IIA A;  4FMB A;  1FUW A;  3EQQ B;  2FGT A;  5D83 A;  4EC6 A;  2CFD A;  1QVF 2;  3G71 3;  5FGO A;  1VQM 3;  2OOV A;  4WHA A;  1TU5 A;  1FGT A;  5LC7 A;  3UJM A;  3JUO A;  3NM7 A;  1V74 A;  6STD A;  4NRE A;  5CF2 A;  3VSY A;  3I55 3;  2UX0 A;  1T5Y A;  1OCV A;  2WGQ A;  4K61 A;  4GB5 A;  4KFE A;  2CH9 A;  5HGR A;  3CCL 3;  4XDW A;  1A90 A;  3RGR A;  1OF5 A;  3LXU X;  1Q82 4;  1W4N A;  1QJG A;  2P09 A;  1KC8 4;  4WYK A;  1YJ9 3;  1K8A 4;  4N6L A;  2K0M A;  4O02 B;  2HMK B;  3KE7 A;  3MWZ A;  4RNY A;  4X2O A;  2JQ5 A;  1WMO A;  4ORL A;  3X3Y A;  4CCV A;  1IV7 A;  1UUW B;  1KWI A;  1L5G B;  1O7P B;  1YIT 3;  1NB3 I;  2CW9 A;  5JPP A;  5IER A;  1G96 A;  3ECF A;  1OUN A;  1Q81 4;  1OHO A;  3FLJ A;  2CC3 A;  3I0Y A;  3G6E 3;  3UL5 A;  3CME 3;  2STD A;  1MNL A;  2O3O A;  1JKG A;  3F7X A;  3N8B A;  3X3X A;  2OCT A;  3DMC A;  3CNX A;  3KII A;  3BNE A;  1IVW A;  3RGA A;  3G8Z A;  3U1W A;  3CPW 2;  3IMA B;  3DXO A;  1SPU A;  1IVX A;  3NBR A;  1EG9 B;  3JVC A;  3U97 A;  5KP4 A;  3LTC A;  3S67 A;  2HMO B;  3DGO A;  4BTX A;  3B4P A;  2GEX A;  2P38 A;  2SBL A;  2F98 A;  1Q40 B;  2R4I A;  3F8X A;  4IPB A;  1JB5 A;  3KKG A;  4KZ1 A;  1RN7 A;  2I9W A;  1DVD A;  3IPT A;  3T8U A;  1LOX A;  3FF0 A;  2IMJ A;  2CFK A;  3A76 A;  4R9L A;  1Y4K A;  1IT7 A;  5IG0 A;  1W6G A;  4XBX A;  1LVN A;  4ZM8 A;  1ZO2 A;  4WWU C;  2B24 B;  4N6M A;  1W7C A;  1IV9 A;  3EF8 A;  2W0Q A;  5IEO A;  5BXQ A;  3S28 A;  1SIH A;  3LZA A;  3WOF B;  5KP3 A;  4U13 A;  3LT9 A;  3LYG A;  3G16 A;  3WA3 A;  3BND A;  3LML A;  3DGL A;  5CK6 A;  2HMJ B;  4HJL B;  4MMZ B;  3AMO A;  2GU3 A;  1YJW 3;  3OWU A;  3CCQ 3;  4HZB B;  2RFR A;  1VQ4 3;  3GZR A;  1UUV B;  2BMR B;  1E97 A;  2A15 A;  3EE1 A;  3F9S A;  4HYZ A;  5D81 A;  3CCM 3;  2W56 A;  3ROB A;  1K41 A;  1CEW I;  3FZW A;  1PU4 A;  1VQ9 3;  2OTL 3;  2F99 A;  4L8O A;  1DYU A;  4JF8 A;  1U8C B;  2YFL B;  3EJV A;  4LGQ A;  1SJW A;  2Q07 A;  1HKX A;  5IF6 A;  1YI2 3;  3PS8 A;  1EQK A;  2W9P A;  1W6Y A;  1R4C A;  2E2V A;  1IQ8 A;  3T0U A;  1N8R 4;  4J9A A;  1DMN A;  2ZL8 A;  3MKI A;  4LSO A;  5AIH A;  2CG1 A;  1QAK A;  1KSI A;  3NV0 B;  3CCU 3;  2INX A;  5EQL A;  3HZP A;  4O3V A;  2P0X A;  3GWR A;  3SLU A;  3CD6 3;  2XGL A;  3FF2 A;  4O2H A;  2BMQ B;  4N6O B;  3PXM A;  5ELU A;  3Q1C A;  5LC6 A;  1UI7 A;  1IVV A;  1TUH A;  5IEP A;  1VQ8 3;  3NM2 A;  4N6N B;  3DY5 A;  3EC9 A;  4AKY A;  7STD A;  3I56 3;  1ISK A;  3K7C A;  3KFQ C;  1QVG 2;  3CCV 3;  1OAC A;  1OH0 A;  4LEH A;  3SOY A;  1Q7Y 4;  2OQE C;  2ZDJ A;  2JDI H;  5I97 A;  1ASK A;  2RGQ A;  2Y73 A;  2LYX A;  4HM2 B;  4R4K A;  2CFW A;  3ALA A;  2BT3 A;  3K9M C;  2E2T A;  1K28 A;  3FSD A;  4J8T A;  4NHF A;  4HM3 B;  2Z7A A;  1IVU A;  4OVM A;  3B8L A;  3ER7 A;  1N5H A;  3CC4 3;  3BNC A;  1OPY A;  5AII A;  3F8H A;  4BTW A;  4LMI A;  1AR0 A;  1NO3 A;  4OK0 A;  1GY5 A;  2GXF A;  3X42 A;  3OXA A;  4MEI A;  1QMA A;  2WO0 A;  1Q40 A;  1S5A A;  1VQP 3;  3MSO A;  1O7H B;  3NQY A;  3QK9 A;  1FA3 A;  1IQX A;  5G2G A;  3OWS A;  3CXC 2;  2XEP A;  3HIG A;  4H3U A;  1W2Z A;  4OUQ A;  2XGN A;  3KSE D;  3X3Z A;  1QAL A;  3NUV A;  3OV4 A;  2CWT A;  4L7K A;  2XR8 B;  1DVC A;  3EN1 B;  1STD A;  2XFS A;  2CWV A;  3T8N A;  1W6C A;  2YX9 A;  3CCS 3;  1YIJ 3;  1D6Y A;  2GEY A;  2YFI B;  4HM0 B;  1M1X B;  2KRT A;  5JPU A;  4G1M B;  3JUQ A;  3EX9 A;  3SX1 A;  2XRX B;  3UL6 A;  4HM4 B;  3V99 A;  1US1 A;  4HM1 B;  3KZT A;  4XDV A;  1A2K A;  2QGU A;  3JUM A;  5AI1 A;  1JN5 B;  3VGN A;  4RZM A;  1EA2 A;  5IG5 A;  1HU9 A;  3VF1 A;  1YVB I;  3S29 A;  1SQW A;  3F14 A;  2IUK A;  1NU3 A;  2BHM A;  2GU1 A;  4K90 B;  3OWY A;  1W02 A;  3FH1 A;  2XH9 A;  4R9K A;  5IEN A;  3K63 A;  2KCD A;  1NJI 4;  1Q42 A;  5AIG A;  1ULI B;  1YGE A;  3MYT A;  4H61 A;  3HI7 A;  3LOY A;  1KQS 2;  3BLZ A;  1E3R A;  3KN4 A;  1VZZ A;  4QWT A;  3GRD A;  1OGZ A;  1OGX A;  2K54 A;  3NV0 A;  3QRD A;  5AIF A;  4HM5 B;  1PFP A;  3PCR A;  3WOE B;  2Y74 A;  2IUJ A;  2QA4 3;  1K9M 4;  3MPH A;  3WMD A;  4I4K A;  2C10 A;  2W03 A;  3G4S 3;  3JUP A;  1DMQ A;  3G0K A;  2XSH B;  2CKF B;  1N5P A;  5CLK A;  1JKG B;  3SXX A;  3LTA A;  1AVK A;  2B1X B;  3HK4 A;  4JRF A;  2RCD A;  2CWU A;  1IU7 A;  1VQL 3;  1IDP A;  2WOF A;  2PNC A;  4WFO A;  3N54 B;  2CFG A;  3M8C A;  2GBW B;  3SED A;  4EXR A;  1N9E A;  1VQO 3;  1A2V A;  2F86 B;  4FCM A;  5CF1 A;  2MF7 A;  4HZ9 B;  1LNH A;  1WMP A;  4HBR A;  1TIJ A;  5TGN A;  2Z6B A;  5STD A;  4FMA A;  4RNZ A;  1RRL A;  4AEQ A;  1VQ7 3;  2HML B;  3O8Y A;  1E3V A;  3DGN A;  3EB8 A;  4N6V 0;  3MG2 A;  2WOH A;  3NBB A;  3IJE B;  1RJO A;  4BTY A;  3X41 A;  3DZL A;  3X40 A;  4FMC A;  1ZX2 A;  5IW9 A;  1M90 4;  1CYU A;  4AKZ A;  1N9J A;  4K1V A;  4Q53 A;  3FKA A;  4RBN A;  3EHC A;  1GYB A;  3B7C A;  2E2U A;  4N6U A;  2CK3 H;  1WQL B;  2CHC A;  1IK3 A;  1CQS A;  3B4O A;  3K0Z A;  3DUK A;  3FGY A;  3LTD A;  4EYC A;  3CC7 3;  3GZX B;  5KP1 A;  3SOA A;  2L4V A;  2D1W A;  3TDG A;  3CMA 3;  4LZI A;  1GY6 A;  2IA7 A;  3SVA A;  2LQV A;  3CC2 3;  2W9Q A;  1S72 3;  1D6U A;  2W04 A;  3DGM A;  3Q90 A;  4MMX B;  1O7N B;  3PGB A;  1YJN 3;  1JV2 B;  3CPO A;  2BNG A;  4HM8 B;  2BMO B;  2W56 B;  2QIY A;  4HKV B;  5DRE A;  3D3L A;  3NXJ A;  1OHS A;  4FR9 A;  5AEU B;  1JN5 A;  3F40 A;  4MMY B;  3WOD G;  3EBT A;  2ML5 A;  1W01 A;  4XBT A;  2P05 A;  1N8Q A;  2W2C A;  3STD A;  1AVL A;  4WP5 A;  2OWP A;  1OHP A;  2OOV C;  2YFJ B;  2D42 A;  1O7G B;  1GY7 A;  3CCR 3;  5AYR B;  3WDG B;  2FXT A;  5ELJ A;  2QEX 3;  2MC8 A;  3EBY A;  3FCS B;  1SII A;  1FGQ A;  1RRH A;  1D6Z A;  1MOL A;  1FGM A;  1JB4 A;  1W00 A;  2XFT A;  3BB9 A;  3CNM A;  2M7O A;  3DM8 A;  1M1K 4;  5EEO A;  3MG1 A;  4KFF A;  1AV4 A;  3NBJ A;  3L0R A;  4CDL A;  1FGO A;  4XM4 A;  1IQY A;  4GL6 A;  1UI8 A;  3BNB A;  4HM7 B;  3LH4 A;  3GZY B;  3GAX A;  1WMN A;  2OTJ 3;  3E99 A;  3FG3 A;  1EKM A;  1OF5 B;  1M9G A;  1W2B 2;  1KD1 4;  5BVB A;  3PCS A;  1TFK A;  1Z1S A;  4WYK B;  3EN8 A;  4KFD A;  2CIU A;  2CFL A;  5A0O B;  1CYV A;  4EV2 A;  3CCJ 3;  3HII A;  1K73 4;  1IT8 A;  3F7S A;  5AYS C;  1JNQ A;  4FMD A;  3UNL A;  1VQN 3;  1JB2 A;  1NWW A;  2PZV A;  1DMM A;  2WGO A;  3PZW A;  3FG1 A;  4R80 A;  1W5Z A;  1JJ2 2;  1J2B A;  3JUN A;  2V1L A;  5AEW B;  3S27 A;  4HM6 B;  4XB5 A;  3GZB A;  3V92 A;  1WTH A;  2O9U X;  1QAF A;  1ROV A;  5FW5 A;  4N3V A;  3OW2 2;  2FNQ A;  4O8S A;  1UW1 A;  3S5C A;  1YHQ 3;  1TP6 A;  1VQ6 3;  2RSX A;  2XSO B;  2C11 A;  4R1K A;  3K5T A;  2CG0 A;  5CXO A;  3NHX A;  1TFO A;  5DRV A;  3CCE 3;  3NX0 A;  2W6J H;  2GBX B;  4PEJ A;  1ROA A;  3OX9 A;  4TX4 A;  2P0M A;  3PYJ A;  4X2H A;  3H3H A;  3KSP A;  3N9H A;  2BO9 B;  4STD A;  4XBY A;  1O7W B;  4K1U A;  1ULJ B;  8CHO A;  3HX8 A;  1FGR A;  1A67 A;  1NB5 I;  5JBS A;  3UB1 A;  3MHE A;  3J7Y d;  1VQ5 3;  1O7M B;  2OQE A;  3LT8 A;  3Q2P A;  3V98 A;  1GS3 A;  4KVH A;  4L8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...