2HMOB

Crystal structure of naphthalene 1,2-dioxygenase bound to 3-nitrotoluene.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmoB00
4XB5A 1JB4A 1SJWA 3B7CA 1QMAA 3OWUA 3HZPA 1DMMA 2Z76A 4L7KA 3LYGA 4J9AA 2INXA 4U13A 4FCJA 3G16A 3EHCA 4XDVA 4R9KA 2PZVA 2UX0A 1OHPA 3BB9A 6STDA 1JB5A 1OGZA 3ER7A 3FZWA 5DRVA 3JUMA 3MG1A 2RCDA 5CF2A 3MKIA 3EX9A 1O7NB 2I9WA 3NV0B 5AIFA 2Z77A 1C7HA 5STDA 3D9RA 3K0ZA 3CPOA 4WYKB 1O7GB 4I4KA 3GZRA 1TUHA 1JB2A 1ASKA 2F99A 3VGNA 4RZMA 2RFRA 1O7PB 3H51A 4L8PA 1OH0A 5IERA 3HX8A 1ULJB 4XBTA 4LEHA 1BUQA 4HJLB 3KKGA 5JPUA 4L8OA 3F8HA 2HMKB 1OUNA 3RGRA 4K1UA 2GBXB 2BMQB 2F98A 3OXAA 1O7HB 4J8TA 3EJVA 2GBWB 4HZ9B 3EC9A 3EBTA 1IDPA 2QIYA 1NDOB 2XSHB 2GEXA 1OF5B 3E99A 4XDWA 4WWUC 1K41A 2YFLB 4HM1B 4HM5B 1GS3A 1U5OA 3I0YA 5AIIA 4K1VA 1ISKA 3JUPA 4HM2B 3BLZA 3B4PA 4ORLA 3GWRA 4MJDA 5CK6A 3FKAA 3GZBA 2K54A 4HM6B 4GB5A 5D82A 3FF0A 1EG9B 1S5AA 4CDLA 4HM0B 3FH1A 1UUVB 1NU3A 1TP6A 2BMRB 3NV0A 4X2OA 4WYKA 4HM3B 3FSDA 4OVMA 5D83A 3KE7A 1E97A 3DM8A 4KVHA 3KSPA 3T8NA 2RGQA 3F9SA 4HVNA 5JPPA 4FCMA 3ROBA 2OWPA 1E3VA 1NWWA 3SEDA 2GEYA 2F86B 3MYTA 1O7WB 3F8XA 4HM7B 3OWSA 2STDA 5IF6A 4XBYA 3MG3A 4R1KA 3HK4A 1A2KA 1CQSA 3OX9A 5CLKA 1Q42A 4PEJA 1OHSA 3VSYA 3NBRA 1E3RA 2BNGA 3UJMA 3WMDA 2QGUA 1ULIB 4STDA 5DREA 2W2CA 2Z7AA 3FLJA 5D81A 5KP3A 2HMLB 1GYBA 1ZX2A 1Q40A 1ZO2A 1OF5A 5IG5A 5TGNA 1JN5A 4LGQA 5CXOA 3JUOA 4HM8B 3UNLA 1W6YA 2A15A 2IMJA 4H3UA 2CKFB 5IEPA 3CU3A 1W01A 1JKGB 5IEOA 1W00A 7STDA 3SOYA 1UUWB 5IG4A 3FGYA 3ECFA 3MHEA 3EQQB 3T8UA 3RGAA 3EBYA 5IG3A 3STDA 1OGXA 2B1XB 2R4IA 3Q90A 5AI1A 1OPYA 4OUQA 3EN8A 3S5CA 4HKVB 3GZXB 3IPTA 4N3VA 2XRXB 4LMIA 5AIGA 2B24B 5BVBA 3NXJA 5HGRA 3MG2A 3GZYB 1Z1SA 2HMMB 3DXOA 3DMCA 4XBXA 2YFJB 3B8LA 3F40A 4HM4B 3G8ZA 2HMJB 5EVHA 1AR0A 5IENA 2XSOB 3LZAA 3MSOA 3SOAA 3GRDA 3KZTA 4XM4A 3A76A 5IG0A 1WQLB 3M8CA 1W02A 3EF8A 3H3HA 3OV4A 2CHCA 1GY6A 1OHOA 2BMOB 5AIHA 2HMOB 5AEUB 8CHOA 2XR8B 3OWYA 2JQ5A 1O7MB 1JKGA 5G2GA 5BXQA 3F7XA 3B4OA 3EN1B 1STDA 1DMNA 1GY7A 3G0KA 1HKXA 1EA2A 5KP4A 1GY5A 3CNMA 5CF1A 2HMNB 4IIAA 3F14A 3K7CA 1DMQA 4Q53A 1Q40B 4WP5A 5FW5A 2GXFA 1VZZA 1JN5B 1OCVA 5AEWB 3NHXA 3F7SA 3FF2A 4R9LA 2YFIB 3CNXA 3DZLA 3JUNA 3NUVA 4HZBB 3NM2A 5KP1A 4X2HA 3DUKA 3JUQA 1QJGA
chains in the Genus database with same CATH superfamily
4XB5A 1JB4A 2CFGA 4KFEA 4MMYB 4EV5A 1RKYA 1SJWA 3B7CA 1QMAA 1AQZA 4KFFA 1FUTA 1RLSA 3OWUA 3GSPA 2RSXA 3HZPA 1DMMA 2H0IA 2Z76A 2KF5A 2W0QA 3QK9A 1BNFA 4L7KA 3L0RA 2WOFA 3LYGA 4J9AA 2OQEA 2INXA 1RTUA 1GOUA 4U13A 4FCJA 1YGEA 3G16A 3EHCA 1TFKA 1BNJA 1G02A 4XDVA 3NBJA 1JJ22 2IYJA 4R9KA 1YJW3 2PZVA 4MEIA 3PCSA 2UX0A 1LQGC 1OHPA 3BB9A 3LTBA 1B27A 3KN4A 6STDA 1IV7A 1JB5A 1BRSA 3LOYA 1RNBA 1BSBA 2CC3A 1OGZA 3ER7A 5LC6A 1VQN3 3FZWA 5DRVA 3JUMA 3MG1A 6GSPA 1QVF2 2CWTA 1UI8A 3DH2A 2RCDA 1KSIA 4FMCA 3PGBA 2WO0A 1LRAA 1RGHA 3NM7A 1BNIA 3K5TA 1TIJA 4EV2A 1UI7A 5CF2A 1G96A 3MKIA 1YHQ3 1RN7A 3EB8A 3LT8A 1RGKA 2KF6A 1HU9A 3O8YA 2YX9A 1W6CA 5RNTA 3EX9A 4FMAA 1O7NB 2I9WA 1PY3A 1B20A 2KCDA 3NV0B 4IPBA 3AHSA 3D3LA 5AIFA 2Z77A 1C7HA 1FZUA 5STDA 5A0OB 1PFPA 3D9RA 3K0ZA 3CPOA 3D79A 3K63A 4WYKB 4BL3A 1O7GB 2F56A 1BNRA 1RSNA 4I4KA 1VQ63 1UGIA 3GZRA 2BU4A 1I0XA 4FCZA 1TUHA 1VQ73 1BSEA 3AMOA 1JB2A 1ASKA 2F99A 3LMLA 4FMBA 3VGNA 2LYXA 1V74A 4EBGA 5JBSA 4RZMA 2RFRA 1YJ93 1O7PB 2CIUA 3DGMA 1K9M4 2CFLA 4RBNA 2P05A 1VQK3 3H51A 1KC84 4L8PA 2KF3A 3N54B 3X3XA 1JZDA 1OH0A 5IERA 1JNQA 2RBIA 3HX8A 1M1K4 1ULJB 4XBTA 4LEHA 4N6MA 1BUQA 4HJLB 3KKGA 1RGLA 5JPUA 4L8OA 3F8HA 2BO9B 2HMKB 1FW7A 1OUNA 3IJEB 1DVCA 2OOVA 1BRHA 3SLUA 3RGRA 4K1UA 3V98A 1Q7HA 1YVBI 3JVCA 2GBXB 2BMQB 1N8R4 2F98A 3OXAA 2KAAA 1O7HB 4K61A 5EQLA 5LC7A 4J8TA 3EJVA 2GBWB 4HZ9B 2LQVA 1BSDA 3G6E3 1D6UA 3EC9A 3EBTA 3ZG5A 1WMPA 2Z6BA 3MWZA 1MWUA 1YVSA 1IVUA 1W5ZA 1IDPA 3HI7A 1BOXA 2QIYA 9RNTA 1IVVA 1NDOB 2GU1A 2P0MA 1RNTA 2MC8A 3CCM3 2XSHB 5EEOA 1SQWA 1ROAA 2CW9A 1OF5B 2CWVA 2GEXA 3E99A 4KFDA 1UGHI 4XDWA 1C54A 2R41A 4WWUC 1K41A 3LTDA 1LOVA 4R4KA 1K8A4 1RMSA 1Y4KA 2YFLB 4HM1B 2XF3A 4HM5B 1GS3A 1IQ8A 1LQMB 1U5OA 1GOVA 1FGMA 2QEX3 3I0YA 2XGNA 2Y73A 1A67A 3LXUX 5AIIA 1CEWI 4GHOA 4K1VA 1ISKA 3RNTA 1HYFA 1RRLA 1QAKA 3JUPA 1AVKA 4HM2B 1NB3I 1BRGA 1CH0A 1F8NA 3BLZA 2HOHA 4DKIA 1IVWA 3B4PA 2FGTA 4ORLA 3GWRA 3U97A 4MJDA 1K734 3S28A 2OQEC 5CK6A 1SPUA 1DYUA 4N6TA 3FKAA 1QALA 3GZBA 2K54A 2IY2A 3DGNA 1W6GA 3WOFB 2H0GA 1I8VA 2QA43 3MPHA 3NX0A 3DY5A 3X41A 3G713 1LOWA 2AAEA 2O9UX 4HM6B 4GB5A 3D5IA 3CXC2 2CX0A 5M1AA 3X3YA 2XGLA 1TFOA 5D82A 1WMNA 3FF0A 5BIRA 1KD14 3SYUA 3S27A 1IQYA 1EG9B 1S5AA 2BHMA 3V99A 1JRQA 3AHWA 1BU4A 2ZDJA 2BT3A 3NQYA 4CDLA 1BAOA 2W56A 4J5GA 1JBRA 4HM0B 3FH1A 2WGOA 2OCTA 2CWUA 1UUVB 1NU3A 1TP6A 2BMRB 3NV0A 1X1YA 5GSPA 1YIJ3 1LXEA 1GMRA 4X2OA 4N6LA 1WNHA 1W2ZA 4WYKA 3AGNA 1A90A 1JBSA 4HM3B 3FSDA 4QWTA 3DGYA 4OVMA 3KE7A 5D83A 3CCE3 1NB5I 1N8QA 1E97A 1DVDA 3DM8A 4KVHA 1TTOA 3KSPA 3SX1A 1YI23 3I553 1I2FA 3FG1A 1BGSA 3T8NA 4O2HA 2RGQA 3U1WA 3F9SA 4HVNA 3UL5A 3TDGA 2Y74A 5JPPA 4FCMA 4NPBA 3ROBA 1ROVA 3WHOA 2OWPA 1E3VA 1NWWA 4R80A 3SEDA 2GEYA 4J5KA 2F86B 2GU3A 3ZG0A 5FGOA 3MYTA 1IU7A 1O7WB 4AKZA 4G1MB 2CG0A 1L5GB 3F8XA 4HM7B 1B21A 2E2TA 3OWSA 2STDA 5IF6A 2O3OA 5HOHA 3CCL3 3WA2X 1M1XB 1EEJA 3MG3A 4XBYA 4WHAA 1YGWA 2XEPA 1I2GA 2L1SA 1S723 1A2VA 1ZGXA 4R1KA 3HK4A 2OTJ3 1SARA 4OK0A 1NJI4 2FNQA 4HAAA 1A2KA 1ZS7A 2XFSA 1BNGA 1MWRA 2H0HA 2F5MA 1HZ1A 2W6JH 3K9MC 4I5QA 1CQSA 3OX9A 1YNVX 5CLKA 1Q42A 2GSPA 4PEJA 2IUJA 1OHSA 1Q824 1RN4A 3PXMA 4ILFA 2OOVC 3DGLA 4N6OB 3N9HA 3VSYA 2ZA4A 3NBRA 1RJOA 3KFQC 1BNEA 8RNTA 1E3RA 1B2MA 2BNGA 3UJMA 1GMPA 3WMDA 2QGUA 1ULIB 2KXGA 4FMDA 4JF8A 4N6NB 4STDA 5DREA 2W2CA 2Z7AA 3FLJA 2JDIH 3NBBA 5ELJA 1B2ZA 3BNEA 3WDGB 5M18A 1VQ53 1IYYA 7GSPA 5D81A 5KP3A 2HMLB 4K90B 1GYBA 2UUGC 3PS8A 1ZX2A 3WODG 4N6UA 1FUWA 1Q40A 1ZO2A 3T0UA 1GMQA 3AMOB 1OF5A 5IG5A 3PCRA 3X42A 5TGNA 1JN5A 1UCLA 2IA7A 3S67A 4LGQA 3VF1A 5CXOA 3JUOA 1B3SA 4HM8B 3EE1A 3UNLA 1FYSA 1W6YA 2P38A 3D5GA 5AYRB 2CG1A 2A15A 4CCVA 1SIHA 3HIIA 3CD63 1VQQA 1V57A 1LVNA 2IMJA 4EYCA 1RGFA 2UGIA 3CCR3 4H3UA 1T2HA 2KRTA 4EC6A 1VQ93 2CKFB 1UW1A 5G1KA 1A2PA 5IEPA 3CU3A 1EKMA 1W01A 2PNCA 1JKGB 3LTCA 5IEOA 4BIRA 4AKYA 2M7OA 1W00A 7STDA 1FGTA 3PYJA 4RNTA 3SOYA 3URPA 1IQXA 3OW22 1B2SA 1UUWB 3CPW2 4TX4A 1R4CA 5IG4A 3FGYA 1GOYA 3ECFA 3QRDA 4AEQA 1VQP3 1BUJA 3X3ZA 4GL6A 3MHEA 1UUGB 3EQQB 3T8UA 3CCS3 1LOXA 3RGAA 3EBYA 5IG3A 3X40A 3STDA 3G4S3 1GSPA 1J2BA 1OGXA 1UDII 2B1XB 2R4IA 3Q90A 5AI1A 5M19A 1OPYA 4OUQA 3EN8A 1GD3A 4WFOA 3FG4A 1MNLA 1I3IA 3S5CA 1FGRA 4HKVB 3GZXB 1LNIA 4LSOA 1X1XA 1I0VA 2ML6A 3BNDA 3IPTA 3D4AA 4FR9A 1PYLA 1FUSA 1JZOA 2E2VA 7RNTA 1DETA 4N3VA 2XRXB 2FXTA 4EXRA 4LMIA 1BRJA 1R4YA 2Q07A 3S29A 5AIGA 3CCQ3 2B24B 5BVBA 3UL6A 1I3FA 3WA3A 3NXJA 5HGRA 3MG2A 3GZYB 3CCJ3 1BNSA 1EUIC 1Z1SA 2HMMB 1T3BA 3UB1A 1TRQA 3SXXA 3DXOA 2D42A 3DMCA 4XBXA 5IW9A 1IVXA 2P09A 2YFJB 3KIIA 3B8LA 2CFKA 1RCLA 4BTYA 3F40A 3PZWA 1I2EA 4HM4B 3WR2A 3G8ZA 1N9EA 1BVIA 2HMJB 4IT7A 1UCKA 1UCIA 1US1A 5EVHA 1AR0A 2CK3H 1I70A 2RNTA 3CCU3 2J8XB 5IENA 1IK3A 1CYVA 1DE3A 1W4NA 1Q864 4O02B 2XSOB 1B2XA 3LZAA 3MSOA 4LYLB 3V92A 5I97A 1PU4A 4NREA 5ELUA 1KQS2 3SOAA 3GRDA 3KZTA 1X1WA 1CYUA 1VQM3 4XM4A 1T2IA 3DGOA 2WGQA 2AADA 4EW5A 1N9JA 1BRIA 1STFI 3A76A 2E2UA 5IG0A 1WQLB 1YJN3 2CFDA 1YIT3 1JBTA 3M8CA 4BL2A 1BSAA 2W56B 3SVAA 3KSED 4GSPA 1RCKA 4HOHA 1RGCA 1W02A 1Q7Y4 1RGAA 4NHFA 3EF8A 4H61A 2CFWA 3FCSB 2L4VA 3H3HA 4N6V0 2SARA 3IMAB 3OV4A 1MOLA 1RGGA 1U8CB 2CHCA 1FGQA 2W03A 4LZIA 1GY6A 2W9PA 1G0TA 3Q1CA 3LH4A 1OHOA 2CH9A 2BMOB 3HIGA 1VQO3 5AIHA 1N5PA 4BTWA 1W2B2 3HOHA 1AV4A 1IT7A 3Q3FA 2HMOB 2ML5A 1TU5A 5AEUB 3ZFZA 4MMZB 8CHOA 3CME3 1OACA 2XR8B 2KF4A 1T5YA 4KZ1A 5BU4A 3OWYA 1LNHA 1W7CA 2CX1A 3A5EA 3BIRA 4RNYA 1BRKA 1K28A 2V1LA 3AGOA 1QAFA 3I563 1KWIA 2JQ5A 1D6ZA 4KT3B 6RNTA 1O7MB 1IV9A 4ZM8A 1JKGA 1BSCA 5G2GA 5BXQA 2XH9A 1GD4A 3RDEA 2C11A 1BIRA 1MGWA 3F7XA 3GAXA 3J7Yd 1B2UA 1M9GA 2D1WA 3BU4A 3Q2PA 3B4OA 3LT9A 3EN1B 1WTHA 1NNVA 1RN1A 1STDA 1DMNA 1SIIA 4O8SA 1AVLA 1GY7A 3BNCA 1D6YA 3G0KA 1QVG2 1HKXA 1EA2A 1V58A 3CCV3 1RRHA 1MGRA 1FA3A 3FG3A 1MWTA 1RGEA 1IT8A 5KP4A 1GY5A 3CNMA 4JRFA 5CF1A 1FGOA 2IUKA 4BU4A 1NO3A 1BANA 2HMNB 2XFTA 3ALAA 4IIAA 5G1LA 3WOEB 3F14A 1VQ83 1N5HA 2K3DA 3K7CA 1TRPA 1AY7A 1DMQA 2SBLA 3NQZA 4HBRA 4CJNA 1VQL3 1BRNL 1M904 4Q53A 3BNBA 4RNZA 4CPKA 2W9QA 3CMA3 1Q40B 4WP5A 1RDSA 2F4YA 1X1UA 3CC23 5FW5A 2GXFA 1VZZA 1JN5B 5AYSC 1Q814 1UCJA 2ZHXB 1OCVA 2OTL3 3LTAA 4MMXB 3NHXA 5AEWB 2MF7A 1TJDA 3F7SA 2ZL8A 2C10A 3CC43 3N8BA 2F5WA 3FF2A 1Q9EA 1EQKA 2P0XA 4R9LA 1VQ43 2YFIB 1MWSA 3CNXA 3DZLA 3JUNA 3KCHA 1LOYA 3NUVA 4HZBB 4O3VA 3NM2A 4BTXA 3CC73 5KP1A 1JV2B 2BIRA 4HYZA 4X2HA 3DUKA 3JUQA 2C4BA 2WOHA 2W04A 1QJGA 1WMOA 1RHLA 2K0MA
chains in the Genus database with same CATH topology
4XB5A 1JB4A 2CFGA 4KFEA 4MMYB 4EV5A 1RKYA 1SJWA 3B7CA 1QMAA 4KFFA 3OWUA 3HZPA 2RSXA 1DMMA 2Z76A 2W0QA 3QK9A 4L7KA 3L0RA 2WOFA 3LYGA 4J9AA 2OQEA 2INXA 4U13A 4FCJA 1YGEA 3G16A 3EHCA 1TFKA 4XDVA 3NBJA 1JJ22 1YJW3 4R9KA 2PZVA 4MEIA 3PCSA 2UX0A 1OHPA 3BB9A 3LTBA 3KN4A 6STDA 1IV7A 1JB5A 3LOYA 2CC3A 1OGZA 3ER7A 5LC6A 1VQN3 3FZWA 5DRVA 3JUMA 3MG1A 1QVF2 2CWTA 1UI8A 2RCDA 1KSIA 4FMCA 3PGBA 2WO0A 3NM7A 3K5TA 1TIJA 4EV2A 1UI7A 5CF2A 1G96A 3MKIA 1YHQ3 1RN7A 3EB8A 3LT8A 1HU9A 3O8YA 2YX9A 1W6CA 3EX9A 4FMAA 1O7NB 2I9WA 3NV0B 4IPBA 2KCDA 3D3LA 5AIFA 2Z77A 1C7HA 5STDA 5A0OB 1PFPA 3D9RA 3K0ZA 3CPOA 3K63A 4WYKB 1O7GB 4I4KA 1VQ63 3GZRA 4FCZA 1TUHA 1VQ73 3AMOA 1JB2A 1ASKA 2F99A 3LMLA 4FMBA 3VGNA 2LYXA 1V74A 4EBGA 5JBSA 4RZMA 2RFRA 1YJ93 1O7PB 2CIUA 3DGMA 1K9M4 2CFLA 4RBNA 2P05A 1VQK3 3H51A 1KC84 4L8PA 3N54B 3X3XA 1OH0A 5IERA 1JNQA 3HX8A 1M1K4 1ULJB 4XBTA 4LEHA 1BUQA 4HJLB 3KKGA 5JPUA 4L8OA 3F8HA 2BO9B 2HMKB 1OUNA 3IJEB 1DVCA 2OOVA 3SLUA 3RGRA 4K1UA 3V98A 1YVBI 3JVCA 2GBXB 2BMQB 1N8R4 2F98A 3OXAA 1O7HB 4K61A 5EQLA 5LC7A 4J8TA 3EJVA 2GBWB 4HZ9B 2LQVA 3G6E3 1D6UA 3EC9A 3EBTA 1WMPA 2Z6BA 3MWZA 4N6MA 1IVUA 1W5ZA 1IDPA 3HI7A 2QIYA 1IVVA 1NDOB 2GU1A 2P0MA 2MC8A 3CCM3 2XSHB 5EEOA 1SQWA 1ROAA 2CW9A 1OF5B 2CWVA 2GEXA 3E99A 4KFDA 4XDWA 4WWUC 1K41A 3LTDA 4R4KA 1K8A4 1Y4KA 2YFLB 4HM1B 2XF3A 4HM5B 1GS3A 1IQ8A 1U5OA 1FGMA 2QEX3 3I0YA 2XGNA 2Y73A 1A67A 3LXUX 5AIIA 1CEWI 4K1VA 1ISKA 1RRLA 1QAKA 3JUPA 1AVKA 4HM2B 1NB3I 3BLZA 1F8NA 1IVWA 3B4PA 2FGTA 4ORLA 3GWRA 3U97A 4MJDA 1K734 3S28A 2OQEC 5CK6A 1SPUA 1DYUA 4N6TA 3FKAA 1QALA 3GZBA 2K54A 3DGNA 1W6GA 3WOFB 2QA43 3MPHA 3NX0A 3DY5A 3X41A 3G713 2O9UX 4HM6B 4GB5A 3CXC2 3X3YA 2XGLA 1TFOA 5D82A 1WMNA 3FF0A 1KD14 3S27A 1IQYA 1EG9B 1S5AA 2BHMA 3V99A 1JRQA 2ZDJA 2BT3A 3NQYA 4CDLA 2W56A 4HM0B 3FH1A 2WGOA 2OCTA 2CWUA 1UUVB 1NU3A 1TP6A 2BMRB 3NV0A 1YIJ3 1LXEA 4X2OA 4N6LA 1WNHA 1W2ZA 4WYKA 1A90A 4HM3B 3FSDA 4QWTA 4OVMA 5D83A 3KE7A 3CCE3 1NB5I 1N8QA 1E97A 1DVDA 3DM8A 4KVHA 1YI23 3KSPA 3SX1A 3I553 3T8NA 3FG1A 4O2HA 2RGQA 3U1WA 3F9SA 4HVNA 3UL5A 3TDGA 2Y74A 5JPPA 4FCMA 3ROBA 1ROVA 2OWPA 1E3VA 1NWWA 4R80A 3SEDA 2GEYA 2F86B 2GU3A 5FGOA 3MYTA 1IU7A 1O7WB 4AKZA 4G1MB 2CG0A 1L5GB 3F8XA 4HM7B 2E2TA 3OWSA 2STDA 5IF6A 2O3OA 3CCL3 3WA2X 1M1XB 4XBYA 3MG3A 4WHAA 2XEPA 1S723 1A2VA 4R1KA 3HK4A 2OTJ3 4OK0A 1NJI4 2FNQA 1A2KA 2XFSA 2W6JH 3K9MC 1CQSA 3OX9A 5CLKA 1Q42A 4PEJA 2IUJA 1Q824 1OHSA 3PXMA 4N6OB 2OOVC 3DGLA 3N9HA 3VSYA 3NBRA 1RJOA 3KFQC 1E3RA 2BNGA 3UJMA 3WMDA 1VQ83 2QGUA 1ULIB 2KXGA 4FMDA 4JF8A 4N6NB 4STDA 5DREA 2W2CA 2Z7AA 3FLJA 2JDIH 3NBBA 5ELJA 3BNEA 3WDGB 1VQ53 5D81A 5KP3A 2HMLB 4K90B 1GYBA 3PS8A 1ZX2A 3WODG 4N6UA 1FUWA 1Q40A 1ZO2A 3T0UA 3AMOB 1OF5A 5IG5A 3PCRA 3X42A 5TGNA 1JN5A 2IA7A 3S67A 4LGQA 3VF1A 5CXOA 3JUOA 4HM8B 3EE1A 3UNLA 1W6YA 2P38A 2CG1A 5AYRB 4CCVA 2A15A 1SIHA 3HIIA 3CD63 1LVNA 2IMJA 4EYCA 3CCR3 4H3UA 2KRTA 4EC6A 1VQ93 2CKFB 1UW1A 5IEPA 3CU3A 1EKMA 1W01A 2PNCA 1JKGB 3LTCA 5IEOA 4AKYA 2M7OA 1W00A 7STDA 1FGTA 3PYJA 3SOYA 1IQXA 3OW22 1UUWB 3CPW2 4TX4A 1R4CA 5IG4A 3FGYA 3ECFA 3QRDA 4AEQA 1VQP3 3X3ZA 4GL6A 3MHEA 3EQQB 3T8UA 3CCS3 1LOXA 3RGAA 3EBYA 5IG3A 3X40A 3STDA 3G4S3 1J2BA 1OGXA 2B1XB 2R4IA 3Q90A 5AI1A 1OPYA 4OUQA 3EN8A 1GD3A 4WFOA 3FG4A 1MNLA 3S5CA 1FGRA 4HKVB 3GZXB 4LSOA 2ML6A 3BNDA 3IPTA 4FR9A 2E2VA 4N3VA 2XRXB 2FXTA 4EXRA 4LMIA 2Q07A 3S29A 5AIGA 3CCQ3 2B24B 5BVBA 3UL6A 3WA3A 3NXJA 5HGRA 3MG2A 3GZYB 3CCJ3 1Z1SA 2HMMB 3UB1A 3SXXA 3DXOA 2D42A 3DMCA 4XBXA 5IW9A 1IVXA 2P09A 2YFJB 3KIIA 3B8LA 2CFKA 4BTYA 3F40A 3PZWA 4HM4B 3G8ZA 1N9EA 2HMJB 4IT7A 1US1A 5EVHA 1AR0A 2CK3H 3CCU3 5IENA 1IK3A 1CYVA 1W4NA 1Q864 4O02B 2XSOB 3LZAA 3MSOA 3V92A 5I97A 1PU4A 4NREA 5ELUA 1KQS2 3SOAA 3GRDA 3KZTA 1CYUA 1VQM3 4XM4A 3DGOA 2WGQA 1N9JA 1STFI 3A76A 2E2UA 5IG0A 1WQLB 1YJN3 2CFDA 1YIT3 3M8CA 2W56B 3SVAA 3KSED 1Q7Y4 1W02A 4NHFA 3EF8A 4H61A 2CFWA 3FCSB 2L4VA 3H3HA 4N6V0 3OV4A 3IMAB 1MOLA 2CHCA 1U8CB 1FGQA 2W03A 4LZIA 1GY6A 2W9PA 3Q1CA 3LH4A 1OHOA 2CH9A 2BMOB 3HIGA 1VQO3 5AIHA 1N5PA 4BTWA 1W2B2 1AV4A 1IT7A 3CME3 2HMOB 2ML5A 1TU5A 5AEUB 4MMZB 8CHOA 1OACA 2XR8B 1T5YA 4KZ1A 3OWYA 1LNHA 1W7CA 4RNYA 1K28A 2V1LA 1QAFA 3I563 1KWIA 2JQ5A 1D6ZA 1O7MB 1IV9A 4ZM8A 1JKGA 5G2GA 5BXQA 2XH9A 1GD4A 3RDEA 2C11A 3F7XA 3GAXA 3J7Yd 1M9GA 2D1WA 3Q2PA 3B4OA 3LT9A 3EN1B 1WTHA 1STDA 1DMNA 1SIIA 4O8SA 1AVLA 1GY7A 3BNCA 1D6YA 3G0KA 1QVG2 1HKXA 1EA2A 3CCV3 1FA3A 1RRHA 3FG3A 1IT8A 5KP4A 1GY5A 3CNMA 4JRFA 5CF1A 1FGOA 2IUKA 1NO3A 2HMNB 2XFTA 4IIAA 3ALAA 3WOEB 3F14A 1N5HA 3K7CA 1DMQA 2SBLA 3NQZA 4HBRA 1VQL3 1M904 4Q53A 3BNBA 4RNZA 2W9QA 3CMA3 1Q40B 4WP5A 3CC23 5FW5A 2GXFA 1VZZA 1JN5B 5AYSC 1Q814 1OCVA 2OTL3 3LTAA 4MMXB 3NHXA 5AEWB 2MF7A 3F7SA 2ZL8A 2C10A 3CC43 3N8BA 1EQKA 3FF2A 2P0XA 4R9LA 1VQ43 2YFIB 3CNXA 3DZLA 3JUNA 3NUVA 4HZBB 4O3VA 4BTXA 3NM2A 3CC73 5KP1A 1JV2B 4HYZA 4X2HA 3DUKA 3JUQA 2WOHA 2W04A 1QJGA 1WMOA 2K0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XB5 A;  1JB4 A;  1SJW A;  3B7C A;  1QMA A;  3OWU A;  3HZP A;  1DMM A;  2Z76 A;  4L7K A;  3LYG A;  4J9A A;  2INX A;  4U13 A;  4FCJ A;  3G16 A;  3EHC A;  4XDV A;  4R9K A;  2PZV A;  2UX0 A;  1OHP A;  3BB9 A;  6STD A;  1JB5 A;  1OGZ A;  3ER7 A;  3FZW A;  5DRV A;  3JUM A;  3MG1 A;  2RCD A;  5CF2 A;  3MKI A;  3EX9 A;  1O7N B;  2I9W A;  3NV0 B;  5AIF A;  2Z77 A;  1C7H A;  5STD A;  3D9R A;  3K0Z A;  3CPO A;  4WYK B;  1O7G B;  4I4K A;  3GZR A;  1TUH A;  1JB2 A;  1ASK A;  2F99 A;  3VGN A;  4RZM A;  2RFR A;  1O7P B;  3H51 A;  4L8P A;  1OH0 A;  5IER A;  3HX8 A;  1ULJ B;  4XBT A;  4LEH A;  1BUQ A;  4HJL B;  3KKG A;  5JPU A;  4L8O A;  3F8H A;  2HMK B;  1OUN A;  3RGR A;  4K1U A;  2GBX B;  2BMQ B;  2F98 A;  3OXA A;  1O7H B;  4J8T A;  3EJV A;  2GBW B;  4HZ9 B;  3EC9 A;  3EBT A;  1IDP A;  2QIY A;  1NDO B;  2XSH B;  2GEX A;  1OF5 B;  3E99 A;  4XDW A;  4WWU C;  1K41 A;  2YFL B;  4HM1 B;  4HM5 B;  1GS3 A;  1U5O A;  3I0Y A;  5AII A;  4K1V A;  1ISK A;  3JUP A;  4HM2 B;  3BLZ A;  3B4P A;  4ORL A;  3GWR A;  4MJD A;  5CK6 A;  3FKA A;  3GZB A;  2K54 A;  4HM6 B;  4GB5 A;  5D82 A;  3FF0 A;  1EG9 B;  1S5A A;  4CDL A;  4HM0 B;  3FH1 A;  1UUV B;  1NU3 A;  1TP6 A;  2BMR B;  3NV0 A;  4X2O A;  4WYK A;  4HM3 B;  3FSD A;  4OVM A;  5D83 A;  3KE7 A;  1E97 A;  3DM8 A;  4KVH A;  3KSP A;  3T8N A;  2RGQ A;  3F9S A;  4HVN A;  5JPP A;  4FCM A;  3ROB A;  2OWP A;  1E3V A;  1NWW A;  3SED A;  2GEY A;  2F86 B;  3MYT A;  1O7W B;  3F8X A;  4HM7 B;  3OWS A;  2STD A;  5IF6 A;  4XBY A;  3MG3 A;  4R1K A;  3HK4 A;  1A2K A;  1CQS A;  3OX9 A;  5CLK A;  1Q42 A;  4PEJ A;  1OHS A;  3VSY A;  3NBR A;  1E3R A;  2BNG A;  3UJM A;  3WMD A;  2QGU A;  1ULI B;  4STD A;  5DRE A;  2W2C A;  2Z7A A;  3FLJ A;  5D81 A;  5KP3 A;  2HML B;  1GYB A;  1ZX2 A;  1Q40 A;  1ZO2 A;  1OF5 A;  5IG5 A;  5TGN A;  1JN5 A;  4LGQ A;  5CXO A;  3JUO A;  4HM8 B;  3UNL A;  1W6Y A;  2A15 A;  2IMJ A;  4H3U A;  2CKF B;  5IEP A;  3CU3 A;  1W01 A;  1JKG B;  5IEO A;  1W00 A;  7STD A;  3SOY A;  1UUW B;  5IG4 A;  3FGY A;  3ECF A;  3MHE A;  3EQQ B;  3T8U A;  3RGA A;  3EBY A;  5IG3 A;  3STD A;  1OGX A;  2B1X B;  2R4I A;  3Q90 A;  5AI1 A;  1OPY A;  4OUQ A;  3EN8 A;  3S5C A;  4HKV B;  3GZX B;  3IPT A;  4N3V A;  2XRX B;  4LMI A;  5AIG A;  2B24 B;  5BVB A;  3NXJ A;  5HGR A;  3MG2 A;  3GZY B;  1Z1S A;  2HMM B;  3DXO A;  3DMC A;  4XBX A;  2YFJ B;  3B8L A;  3F40 A;  4HM4 B;  3G8Z A;  2HMJ B;  5EVH A;  1AR0 A;  5IEN A;  2XSO B;  3LZA A;  3MSO A;  3SOA A;  3GRD A;  3KZT A;  4XM4 A;  3A76 A;  5IG0 A;  1WQL B;  3M8C A;  1W02 A;  3EF8 A;  3H3H A;  3OV4 A;  2CHC A;  1GY6 A;  1OHO A;  2BMO B;  5AIH A;  2HMO B;  5AEU B;  8CHO A;  2XR8 B;  3OWY A;  2JQ5 A;  1O7M B;  1JKG A;  5G2G A;  5BXQ A;  3F7X A;  3B4O A;  3EN1 B;  1STD A;  1DMN A;  1GY7 A;  3G0K A;  1HKX A;  1EA2 A;  5KP4 A;  1GY5 A;  3CNM A;  5CF1 A;  2HMN B;  4IIA A;  3F14 A;  3K7C A;  1DMQ A;  4Q53 A;  1Q40 B;  4WP5 A;  5FW5 A;  2GXF A;  1VZZ A;  1JN5 B;  1OCV A;  5AEW B;  3NHX A;  3F7S A;  3FF2 A;  4R9L A;  2YFI B;  3CNX A;  3DZL A;  3JUN A;  3NUV A;  4HZB B;  3NM2 A;  5KP1 A;  4X2H A;  3DUK A;  3JUQ A;  1QJG A; 
#chains in the Genus database with same CATH topology
 4XB5 A;  1JB4 A;  2CFG A;  4KFE A;  4MMY B;  4EV5 A;  1RKY A;  1SJW A;  3B7C A;  1QMA A;  1AQZ A;  4KFF A;  1FUT A;  1RLS A;  3OWU A;  3GSP A;  2RSX A;  3HZP A;  1DMM A;  2H0I A;  2Z76 A;  2KF5 A;  2W0Q A;  3QK9 A;  1BNF A;  4L7K A;  3L0R A;  2WOF A;  3LYG A;  4J9A A;  2OQE A;  2INX A;  1RTU A;  1GOU A;  4U13 A;  4FCJ A;  1YGE A;  3G16 A;  3EHC A;  1TFK A;  1BNJ A;  1G02 A;  4XDV A;  3NBJ A;  1JJ2 2;  2IYJ A;  4R9K A;  1YJW 3;  2PZV A;  4MEI A;  3PCS A;  2UX0 A;  1LQG C;  1OHP A;  3BB9 A;  3LTB A;  1B27 A;  3KN4 A;  6STD A;  1IV7 A;  1JB5 A;  1BRS A;  3LOY A;  1RNB A;  1BSB A;  2CC3 A;  1OGZ A;  3ER7 A;  5LC6 A;  1VQN 3;  3FZW A;  5DRV A;  3JUM A;  3MG1 A;  6GSP A;  1QVF 2;  2CWT A;  1UI8 A;  3DH2 A;  2RCD A;  1KSI A;  4FMC A;  3PGB A;  2WO0 A;  1LRA A;  1RGH A;  3NM7 A;  1BNI A;  3K5T A;  1TIJ A;  4EV2 A;  1UI7 A;  5CF2 A;  1G96 A;  3MKI A;  1YHQ 3;  1RN7 A;  3EB8 A;  3LT8 A;  1RGK A;  2KF6 A;  1HU9 A;  3O8Y A;  2YX9 A;  1W6C A;  5RNT A;  3EX9 A;  4FMA A;  1O7N B;  2I9W A;  1PY3 A;  1B20 A;  2KCD A;  3NV0 B;  4IPB A;  3AHS A;  3D3L A;  5AIF A;  2Z77 A;  1C7H A;  1FZU A;  5STD A;  5A0O B;  1PFP A;  3D9R A;  3K0Z A;  3CPO A;  3D79 A;  3K63 A;  4WYK B;  4BL3 A;  1O7G B;  2F56 A;  1BNR A;  1RSN A;  4I4K A;  1VQ6 3;  1UGI A;  3GZR A;  2BU4 A;  1I0X A;  4FCZ A;  1TUH A;  1VQ7 3;  1BSE A;  3AMO A;  1JB2 A;  1ASK A;  2F99 A;  3LML A;  4FMB A;  3VGN A;  2LYX A;  1V74 A;  4EBG A;  5JBS A;  4RZM A;  2RFR A;  1YJ9 3;  1O7P B;  2CIU A;  3DGM A;  1K9M 4;  2CFL A;  4RBN A;  2P05 A;  1VQK 3;  3H51 A;  1KC8 4;  4L8P A;  2KF3 A;  3N54 B;  3X3X A;  1JZD A;  1OH0 A;  5IER A;  1JNQ A;  2RBI A;  3HX8 A;  1M1K 4;  1ULJ B;  4XBT A;  4LEH A;  4N6M A;  1BUQ A;  4HJL B;  3KKG A;  1RGL A;  5JPU A;  4L8O A;  3F8H A;  2BO9 B;  2HMK B;  1FW7 A;  1OUN A;  3IJE B;  1DVC A;  2OOV A;  1BRH A;  3SLU A;  3RGR A;  4K1U A;  3V98 A;  1Q7H A;  1YVB I;  3JVC A;  2GBX B;  2BMQ B;  1N8R 4;  2F98 A;  3OXA A;  2KAA A;  1O7H B;  4K61 A;  5EQL A;  5LC7 A;  4J8T A;  3EJV A;  2GBW B;  4HZ9 B;  2LQV A;  1BSD A;  3G6E 3;  1D6U A;  3EC9 A;  3EBT A;  3ZG5 A;  1WMP A;  2Z6B A;  3MWZ A;  1MWU A;  1YVS A;  1IVU A;  1W5Z A;  1IDP A;  3HI7 A;  1BOX A;  2QIY A;  9RNT A;  1IVV A;  1NDO B;  2GU1 A;  2P0M A;  1RNT A;  2MC8 A;  3CCM 3;  2XSH B;  5EEO A;  1SQW A;  1ROA A;  2CW9 A;  1OF5 B;  2CWV A;  2GEX A;  3E99 A;  4KFD A;  1UGH I;  4XDW A;  1C54 A;  2R41 A;  4WWU C;  1K41 A;  3LTD A;  1LOV A;  4R4K A;  1K8A 4;  1RMS A;  1Y4K A;  2YFL B;  4HM1 B;  2XF3 A;  4HM5 B;  1GS3 A;  1IQ8 A;  1LQM B;  1U5O A;  1GOV A;  1FGM A;  2QEX 3;  3I0Y A;  2XGN A;  2Y73 A;  1A67 A;  3LXU X;  5AII A;  1CEW I;  4GHO A;  4K1V A;  1ISK A;  3RNT A;  1HYF A;  1RRL A;  1QAK A;  3JUP A;  1AVK A;  4HM2 B;  1NB3 I;  1BRG A;  1CH0 A;  1F8N A;  3BLZ A;  2HOH A;  4DKI A;  1IVW A;  3B4P A;  2FGT A;  4ORL A;  3GWR A;  3U97 A;  4MJD A;  1K73 4;  3S28 A;  2OQE C;  5CK6 A;  1SPU A;  1DYU A;  4N6T A;  3FKA A;  1QAL A;  3GZB A;  2K54 A;  2IY2 A;  3DGN A;  1W6G A;  3WOF B;  2H0G A;  1I8V A;  2QA4 3;  3MPH A;  3NX0 A;  3DY5 A;  3X41 A;  3G71 3;  1LOW A;  2AAE A;  2O9U X;  4HM6 B;  4GB5 A;  3D5I A;  3CXC 2;  2CX0 A;  5M1A A;  3X3Y A;  2XGL A;  1TFO A;  5D82 A;  1WMN A;  3FF0 A;  5BIR A;  1KD1 4;  3SYU A;  3S27 A;  1IQY A;  1EG9 B;  1S5A A;  2BHM A;  3V99 A;  1JRQ A;  3AHW A;  1BU4 A;  2ZDJ A;  2BT3 A;  3NQY A;  4CDL A;  1BAO A;  2W56 A;  4J5G A;  1JBR A;  4HM0 B;  3FH1 A;  2WGO A;  2OCT A;  2CWU A;  1UUV B;  1NU3 A;  1TP6 A;  2BMR B;  3NV0 A;  1X1Y A;  5GSP A;  1YIJ 3;  1LXE A;  1GMR A;  4X2O A;  4N6L A;  1WNH A;  1W2Z A;  4WYK A;  3AGN A;  1A90 A;  1JBS A;  4HM3 B;  3FSD A;  4QWT A;  3DGY A;  4OVM A;  3KE7 A;  5D83 A;  3CCE 3;  1NB5 I;  1N8Q A;  1E97 A;  1DVD A;  3DM8 A;  4KVH A;  1TTO A;  3KSP A;  3SX1 A;  1YI2 3;  3I55 3;  1I2F A;  3FG1 A;  1BGS A;  3T8N A;  4O2H A;  2RGQ A;  3U1W A;  3F9S A;  4HVN A;  3UL5 A;  3TDG A;  2Y74 A;  5JPP A;  4FCM A;  4NPB A;  3ROB A;  1ROV A;  3WHO A;  2OWP A;  1E3V A;  1NWW A;  4R80 A;  3SED A;  2GEY A;  4J5K A;  2F86 B;  2GU3 A;  3ZG0 A;  5FGO A;  3MYT A;  1IU7 A;  1O7W B;  4AKZ A;  4G1M B;  2CG0 A;  1L5G B;  3F8X A;  4HM7 B;  1B21 A;  2E2T A;  3OWS A;  2STD A;  5IF6 A;  2O3O A;  5HOH A;  3CCL 3;  3WA2 X;  1M1X B;  1EEJ A;  3MG3 A;  4XBY A;  4WHA A;  1YGW A;  2XEP A;  1I2G A;  2L1S A;  1S72 3;  1A2V A;  1ZGX A;  4R1K A;  3HK4 A;  2OTJ 3;  1SAR A;  4OK0 A;  1NJI 4;  2FNQ A;  4HAA A;  1A2K A;  1ZS7 A;  2XFS A;  1BNG A;  1MWR A;  2H0H A;  2F5M A;  1HZ1 A;  2W6J H;  3K9M C;  4I5Q A;  1CQS A;  3OX9 A;  1YNV X;  5CLK A;  1Q42 A;  2GSP A;  4PEJ A;  2IUJ A;  1OHS A;  1Q82 4;  1RN4 A;  3PXM A;  4ILF A;  2OOV C;  3DGL A;  4N6O B;  3N9H A;  3VSY A;  2ZA4 A;  3NBR A;  1RJO A;  3KFQ C;  1BNE A;  8RNT A;  1E3R A;  1B2M A;  2BNG A;  3UJM A;  1GMP A;  3WMD A;  2QGU A;  1ULI B;  2KXG A;  4FMD A;  4JF8 A;  4N6N B;  4STD A;  5DRE A;  2W2C A;  2Z7A A;  3FLJ A;  2JDI H;  3NBB A;  5ELJ A;  1B2Z A;  3BNE A;  3WDG B;  5M18 A;  1VQ5 3;  1IYY A;  7GSP A;  5D81 A;  5KP3 A;  2HML B;  4K90 B;  1GYB A;  2UUG C;  3PS8 A;  1ZX2 A;  3WOD G;  4N6U A;  1FUW A;  1Q40 A;  1ZO2 A;  3T0U A;  1GMQ A;  3AMO B;  1OF5 A;  5IG5 A;  3PCR A;  3X42 A;  5TGN A;  1JN5 A;  1UCL A;  2IA7 A;  3S67 A;  4LGQ A;  3VF1 A;  5CXO A;  3JUO A;  1B3S A;  4HM8 B;  3EE1 A;  3UNL A;  1FYS A;  1W6Y A;  2P38 A;  3D5G A;  5AYR B;  2CG1 A;  2A15 A;  4CCV A;  1SIH A;  3HII A;  3CD6 3;  1VQQ A;  1V57 A;  1LVN A;  2IMJ A;  4EYC A;  1RGF A;  2UGI A;  3CCR 3;  4H3U A;  1T2H A;  2KRT A;  4EC6 A;  1VQ9 3;  2CKF B;  1UW1 A;  5G1K A;  1A2P A;  5IEP A;  3CU3 A;  1EKM A;  1W01 A;  2PNC A;  1JKG B;  3LTC A;  5IEO A;  4BIR A;  4AKY A;  2M7O A;  1W00 A;  7STD A;  1FGT A;  3PYJ A;  4RNT A;  3SOY A;  3URP A;  1IQX A;  3OW2 2;  1B2S A;  1UUW B;  3CPW 2;  4TX4 A;  1R4C A;  5IG4 A;  3FGY A;  1GOY A;  3ECF A;  3QRD A;  4AEQ A;  1VQP 3;  1BUJ A;  3X3Z A;  4GL6 A;  3MHE A;  1UUG B;  3EQQ B;  3T8U A;  3CCS 3;  1LOX A;  3RGA A;  3EBY A;  5IG3 A;  3X40 A;  3STD A;  3G4S 3;  1GSP A;  1J2B A;  1OGX A;  1UDI I;  2B1X B;  2R4I A;  3Q90 A;  5AI1 A;  5M19 A;  1OPY A;  4OUQ A;  3EN8 A;  1GD3 A;  4WFO A;  3FG4 A;  1MNL A;  1I3I A;  3S5C A;  1FGR A;  4HKV B;  3GZX B;  1LNI A;  4LSO A;  1X1X A;  1I0V A;  2ML6 A;  3BND A;  3IPT A;  3D4A A;  4FR9 A;  1PYL A;  1FUS A;  1JZO A;  2E2V A;  7RNT A;  1DET A;  4N3V A;  2XRX B;  2FXT A;  4EXR A;  4LMI A;  1BRJ A;  1R4Y A;  2Q07 A;  3S29 A;  5AIG A;  3CCQ 3;  2B24 B;  5BVB A;  3UL6 A;  1I3F A;  3WA3 A;  3NXJ A;  5HGR A;  3MG2 A;  3GZY B;  3CCJ 3;  1BNS A;  1EUI C;  1Z1S A;  2HMM B;  1T3B A;  3UB1 A;  1TRQ A;  3SXX A;  3DXO A;  2D42 A;  3DMC A;  4XBX A;  5IW9 A;  1IVX A;  2P09 A;  2YFJ B;  3KII A;  3B8L A;  2CFK A;  1RCL A;  4BTY A;  3F40 A;  3PZW A;  1I2E A;  4HM4 B;  3WR2 A;  3G8Z A;  1N9E A;  1BVI A;  2HMJ B;  4IT7 A;  1UCK A;  1UCI A;  1US1 A;  5EVH A;  1AR0 A;  2CK3 H;  1I70 A;  2RNT A;  3CCU 3;  2J8X B;  5IEN A;  1IK3 A;  1CYV A;  1DE3 A;  1W4N A;  1Q86 4;  4O02 B;  2XSO B;  1B2X A;  3LZA A;  3MSO A;  4LYL B;  3V92 A;  5I97 A;  1PU4 A;  4NRE A;  5ELU A;  1KQS 2;  3SOA A;  3GRD A;  3KZT A;  1X1W A;  1CYU A;  1VQM 3;  4XM4 A;  1T2I A;  3DGO A;  2WGQ A;  2AAD A;  4EW5 A;  1N9J A;  1BRI A;  1STF I;  3A76 A;  2E2U A;  5IG0 A;  1WQL B;  1YJN 3;  2CFD A;  1YIT 3;  1JBT A;  3M8C A;  4BL2 A;  1BSA A;  2W56 B;  3SVA A;  3KSE D;  4GSP A;  1RCK A;  4HOH A;  1RGC A;  1W02 A;  1Q7Y 4;  1RGA A;  4NHF A;  3EF8 A;  4H61 A;  2CFW A;  3FCS B;  2L4V A;  3H3H A;  4N6V 0;  2SAR A;  3IMA B;  3OV4 A;  1MOL A;  1RGG A;  1U8C B;  2CHC A;  1FGQ A;  2W03 A;  4LZI A;  1GY6 A;  2W9P A;  1G0T A;  3Q1C A;  3LH4 A;  1OHO A;  2CH9 A;  2BMO B;  3HIG A;  1VQO 3;  5AIH A;  1N5P A;  4BTW A;  1W2B 2;  3HOH A;  1AV4 A;  1IT7 A;  3Q3F A;  2HMO B;  2ML5 A;  1TU5 A;  5AEU B;  3ZFZ A;  4MMZ B;  8CHO A;  3CME 3;  1OAC A;  2XR8 B;  2KF4 A;  1T5Y A;  4KZ1 A;  5BU4 A;  3OWY A;  1LNH A;  1W7C A;  2CX1 A;  3A5E A;  3BIR A;  4RNY A;  1BRK A;  1K28 A;  2V1L A;  3AGO A;  1QAF A;  3I56 3;  1KWI A;  2JQ5 A;  1D6Z A;  4KT3 B;  6RNT A;  1O7M B;  1IV9 A;  4ZM8 A;  1JKG A;  1BSC A;  5G2G A;  5BXQ A;  2XH9 A;  1GD4 A;  3RDE A;  2C11 A;  1BIR A;  1MGW A;  3F7X A;  3GAX A;  3J7Y d;  1B2U A;  1M9G A;  2D1W A;  3BU4 A;  3Q2P A;  3B4O A;  3LT9 A;  3EN1 B;  1WTH A;  1NNV A;  1RN1 A;  1STD A;  1DMN A;  1SII A;  4O8S A;  1AVL A;  1GY7 A;  3BNC A;  1D6Y A;  3G0K A;  1QVG 2;  1HKX A;  1EA2 A;  1V58 A;  3CCV 3;  1RRH A;  1MGR A;  1FA3 A;  3FG3 A;  1MWT A;  1RGE A;  1IT8 A;  5KP4 A;  1GY5 A;  3CNM A;  4JRF A;  5CF1 A;  1FGO A;  2IUK A;  4BU4 A;  1NO3 A;  1BAN A;  2HMN B;  2XFT A;  3ALA A;  4IIA A;  5G1L A;  3WOE B;  3F14 A;  1VQ8 3;  1N5H A;  2K3D A;  3K7C A;  1TRP A;  1AY7 A;  1DMQ A;  2SBL A;  3NQZ A;  4HBR A;  4CJN A;  1VQL 3;  1BRN L;  1M90 4;  4Q53 A;  3BNB A;  4RNZ A;  4CPK A;  2W9Q A;  3CMA 3;  1Q40 B;  4WP5 A;  1RDS A;  2F4Y A;  1X1U A;  3CC2 3;  5FW5 A;  2GXF A;  1VZZ A;  1JN5 B;  5AYS C;  1Q81 4;  1UCJ A;  2ZHX B;  1OCV A;  2OTL 3;  3LTA A;  4MMX B;  3NHX A;  5AEW B;  2MF7 A;  1TJD A;  3F7S A;  2ZL8 A;  2C10 A;  3CC4 3;  3N8B A;  2F5W A;  3FF2 A;  1Q9E A;  1EQK A;  2P0X A;  4R9L A;  1VQ4 3;  2YFI B;  1MWS A;  3CNX A;  3DZL A;  3JUN A;  3KCH A;  1LOY A;  3NUV A;  4HZB B;  4O3V A;  3NM2 A;  4BTX A;  3CC7 3;  5KP1 A;  1JV2 B;  2BIR A;  4HYZ A;  4X2H A;  3DUK A;  3JUQ A;  2C4B A;  2WOH A;  2W04 A;  1QJG A;  1WMO A;  1RHL A;  2K0M A; 
#chains in the Genus database with same CATH homology
 4XB5 A;  1JB4 A;  2CFG A;  4KFE A;  4MMY B;  4EV5 A;  1RKY A;  1SJW A;  3B7C A;  1QMA A;  4KFF A;  3OWU A;  3HZP A;  2RSX A;  1DMM A;  2Z76 A;  2W0Q A;  3QK9 A;  4L7K A;  3L0R A;  2WOF A;  3LYG A;  4J9A A;  2OQE A;  2INX A;  4U13 A;  4FCJ A;  1YGE A;  3G16 A;  3EHC A;  1TFK A;  4XDV A;  3NBJ A;  1JJ2 2;  1YJW 3;  4R9K A;  2PZV A;  4MEI A;  3PCS A;  2UX0 A;  1OHP A;  3BB9 A;  3LTB A;  3KN4 A;  6STD A;  1IV7 A;  1JB5 A;  3LOY A;  2CC3 A;  1OGZ A;  3ER7 A;  5LC6 A;  1VQN 3;  3FZW A;  5DRV A;  3JUM A;  3MG1 A;  1QVF 2;  2CWT A;  1UI8 A;  2RCD A;  1KSI A;  4FMC A;  3PGB A;  2WO0 A;  3NM7 A;  3K5T A;  1TIJ A;  4EV2 A;  1UI7 A;  5CF2 A;  1G96 A;  3MKI A;  1YHQ 3;  1RN7 A;  3EB8 A;  3LT8 A;  1HU9 A;  3O8Y A;  2YX9 A;  1W6C A;  3EX9 A;  4FMA A;  1O7N B;  2I9W A;  3NV0 B;  4IPB A;  2KCD A;  3D3L A;  5AIF A;  2Z77 A;  1C7H A;  5STD A;  5A0O B;  1PFP A;  3D9R A;  3K0Z A;  3CPO A;  3K63 A;  4WYK B;  1O7G B;  4I4K A;  1VQ6 3;  3GZR A;  4FCZ A;  1TUH A;  1VQ7 3;  3AMO A;  1JB2 A;  1ASK A;  2F99 A;  3LML A;  4FMB A;  3VGN A;  2LYX A;  1V74 A;  4EBG A;  5JBS A;  4RZM A;  2RFR A;  1YJ9 3;  1O7P B;  2CIU A;  3DGM A;  1K9M 4;  2CFL A;  4RBN A;  2P05 A;  1VQK 3;  3H51 A;  1KC8 4;  4L8P A;  3N54 B;  3X3X A;  1OH0 A;  5IER A;  1JNQ A;  3HX8 A;  1M1K 4;  1ULJ B;  4XBT A;  4LEH A;  1BUQ A;  4HJL B;  3KKG A;  5JPU A;  4L8O A;  3F8H A;  2BO9 B;  2HMK B;  1OUN A;  3IJE B;  1DVC A;  2OOV A;  3SLU A;  3RGR A;  4K1U A;  3V98 A;  1YVB I;  3JVC A;  2GBX B;  2BMQ B;  1N8R 4;  2F98 A;  3OXA A;  1O7H B;  4K61 A;  5EQL A;  5LC7 A;  4J8T A;  3EJV A;  2GBW B;  4HZ9 B;  2LQV A;  3G6E 3;  1D6U A;  3EC9 A;  3EBT A;  1WMP A;  2Z6B A;  3MWZ A;  4N6M A;  1IVU A;  1W5Z A;  1IDP A;  3HI7 A;  2QIY A;  1IVV A;  1NDO B;  2GU1 A;  2P0M A;  2MC8 A;  3CCM 3;  2XSH B;  5EEO A;  1SQW A;  1ROA A;  2CW9 A;  1OF5 B;  2CWV A;  2GEX A;  3E99 A;  4KFD A;  4XDW A;  4WWU C;  1K41 A;  3LTD A;  4R4K A;  1K8A 4;  1Y4K A;  2YFL B;  4HM1 B;  2XF3 A;  4HM5 B;  1GS3 A;  1IQ8 A;  1U5O A;  1FGM A;  2QEX 3;  3I0Y A;  2XGN A;  2Y73 A;  1A67 A;  3LXU X;  5AII A;  1CEW I;  4K1V A;  1ISK A;  1RRL A;  1QAK A;  3JUP A;  1AVK A;  4HM2 B;  1NB3 I;  3BLZ A;  1F8N A;  1IVW A;  3B4P A;  2FGT A;  4ORL A;  3GWR A;  3U97 A;  4MJD A;  1K73 4;  3S28 A;  2OQE C;  5CK6 A;  1SPU A;  1DYU A;  4N6T A;  3FKA A;  1QAL A;  3GZB A;  2K54 A;  3DGN A;  1W6G A;  3WOF B;  2QA4 3;  3MPH A;  3NX0 A;  3DY5 A;  3X41 A;  3G71 3;  2O9U X;  4HM6 B;  4GB5 A;  3CXC 2;  3X3Y A;  2XGL A;  1TFO A;  5D82 A;  1WMN A;  3FF0 A;  1KD1 4;  3S27 A;  1IQY A;  1EG9 B;  1S5A A;  2BHM A;  3V99 A;  1JRQ A;  2ZDJ A;  2BT3 A;  3NQY A;  4CDL A;  2W56 A;  4HM0 B;  3FH1 A;  2WGO A;  2OCT A;  2CWU A;  1UUV B;  1NU3 A;  1TP6 A;  2BMR B;  3NV0 A;  1YIJ 3;  1LXE A;  4X2O A;  4N6L A;  1WNH A;  1W2Z A;  4WYK A;  1A90 A;  4HM3 B;  3FSD A;  4QWT A;  4OVM A;  5D83 A;  3KE7 A;  3CCE 3;  1NB5 I;  1N8Q A;  1E97 A;  1DVD A;  3DM8 A;  4KVH A;  1YI2 3;  3KSP A;  3SX1 A;  3I55 3;  3T8N A;  3FG1 A;  4O2H A;  2RGQ A;  3U1W A;  3F9S A;  4HVN A;  3UL5 A;  3TDG A;  2Y74 A;  5JPP A;  4FCM A;  3ROB A;  1ROV A;  2OWP A;  1E3V A;  1NWW A;  4R80 A;  3SED A;  2GEY A;  2F86 B;  2GU3 A;  5FGO A;  3MYT A;  1IU7 A;  1O7W B;  4AKZ A;  4G1M B;  2CG0 A;  1L5G B;  3F8X A;  4HM7 B;  2E2T A;  3OWS A;  2STD A;  5IF6 A;  2O3O A;  3CCL 3;  3WA2 X;  1M1X B;  4XBY A;  3MG3 A;  4WHA A;  2XEP A;  1S72 3;  1A2V A;  4R1K A;  3HK4 A;  2OTJ 3;  4OK0 A;  1NJI 4;  2FNQ A;  1A2K A;  2XFS A;  2W6J H;  3K9M C;  1CQS A;  3OX9 A;  5CLK A;  1Q42 A;  4PEJ A;  2IUJ A;  1Q82 4;  1OHS A;  3PXM A;  4N6O B;  2OOV C;  3DGL A;  3N9H A;  3VSY A;  3NBR A;  1RJO A;  3KFQ C;  1E3R A;  2BNG A;  3UJM A;  3WMD A;  1VQ8 3;  2QGU A;  1ULI B;  2KXG A;  4FMD A;  4JF8 A;  4N6N B;  4STD A;  5DRE A;  2W2C A;  2Z7A A;  3FLJ A;  2JDI H;  3NBB A;  5ELJ A;  3BNE A;  3WDG B;  1VQ5 3;  5D81 A;  5KP3 A;  2HML B;  4K90 B;  1GYB A;  3PS8 A;  1ZX2 A;  3WOD G;  4N6U A;  1FUW A;  1Q40 A;  1ZO2 A;  3T0U A;  3AMO B;  1OF5 A;  5IG5 A;  3PCR A;  3X42 A;  5TGN A;  1JN5 A;  2IA7 A;  3S67 A;  4LGQ A;  3VF1 A;  5CXO A;  3JUO A;  4HM8 B;  3EE1 A;  3UNL A;  1W6Y A;  2P38 A;  2CG1 A;  5AYR B;  4CCV A;  2A15 A;  1SIH A;  3HII A;  3CD6 3;  1LVN A;  2IMJ A;  4EYC A;  3CCR 3;  4H3U A;  2KRT A;  4EC6 A;  1VQ9 3;  2CKF B;  1UW1 A;  5IEP A;  3CU3 A;  1EKM A;  1W01 A;  2PNC A;  1JKG B;  3LTC A;  5IEO A;  4AKY A;  2M7O A;  1W00 A;  7STD A;  1FGT A;  3PYJ A;  3SOY A;  1IQX A;  3OW2 2;  1UUW B;  3CPW 2;  4TX4 A;  1R4C A;  5IG4 A;  3FGY A;  3ECF A;  3QRD A;  4AEQ A;  1VQP 3;  3X3Z A;  4GL6 A;  3MHE A;  3EQQ B;  3T8U A;  3CCS 3;  1LOX A;  3RGA A;  3EBY A;  5IG3 A;  3X40 A;  3STD A;  3G4S 3;  1J2B A;  1OGX A;  2B1X B;  2R4I A;  3Q90 A;  5AI1 A;  1OPY A;  4OUQ A;  3EN8 A;  1GD3 A;  4WFO A;  3FG4 A;  1MNL A;  3S5C A;  1FGR A;  4HKV B;  3GZX B;  4LSO A;  2ML6 A;  3BND A;  3IPT A;  4FR9 A;  2E2V A;  4N3V A;  2XRX B;  2FXT A;  4EXR A;  4LMI A;  2Q07 A;  3S29 A;  5AIG A;  3CCQ 3;  2B24 B;  5BVB A;  3UL6 A;  3WA3 A;  3NXJ A;  5HGR A;  3MG2 A;  3GZY B;  3CCJ 3;  1Z1S A;  2HMM B;  3UB1 A;  3SXX A;  3DXO A;  2D42 A;  3DMC A;  4XBX A;  5IW9 A;  1IVX A;  2P09 A;  2YFJ B;  3KII A;  3B8L A;  2CFK A;  4BTY A;  3F40 A;  3PZW A;  4HM4 B;  3G8Z A;  1N9E A;  2HMJ B;  4IT7 A;  1US1 A;  5EVH A;  1AR0 A;  2CK3 H;  3CCU 3;  5IEN A;  1IK3 A;  1CYV A;  1W4N A;  1Q86 4;  4O02 B;  2XSO B;  3LZA A;  3MSO A;  3V92 A;  5I97 A;  1PU4 A;  4NRE A;  5ELU A;  1KQS 2;  3SOA A;  3GRD A;  3KZT A;  1CYU A;  1VQM 3;  4XM4 A;  3DGO A;  2WGQ A;  1N9J A;  1STF I;  3A76 A;  2E2U A;  5IG0 A;  1WQL B;  1YJN 3;  2CFD A;  1YIT 3;  3M8C A;  2W56 B;  3SVA A;  3KSE D;  1Q7Y 4;  1W02 A;  4NHF A;  3EF8 A;  4H61 A;  2CFW A;  3FCS B;  2L4V A;  3H3H A;  4N6V 0;  3OV4 A;  3IMA B;  1MOL A;  2CHC A;  1U8C B;  1FGQ A;  2W03 A;  4LZI A;  1GY6 A;  2W9P A;  3Q1C A;  3LH4 A;  1OHO A;  2CH9 A;  2BMO B;  3HIG A;  1VQO 3;  5AIH A;  1N5P A;  4BTW A;  1W2B 2;  1AV4 A;  1IT7 A;  3CME 3;  2HMO B;  2ML5 A;  1TU5 A;  5AEU B;  4MMZ B;  8CHO A;  1OAC A;  2XR8 B;  1T5Y A;  4KZ1 A;  3OWY A;  1LNH A;  1W7C A;  4RNY A;  1K28 A;  2V1L A;  1QAF A;  3I56 3;  1KWI A;  2JQ5 A;  1D6Z A;  1O7M B;  1IV9 A;  4ZM8 A;  1JKG A;  5G2G A;  5BXQ A;  2XH9 A;  1GD4 A;  3RDE A;  2C11 A;  3F7X A;  3GAX A;  3J7Y d;  1M9G A;  2D1W A;  3Q2P A;  3B4O A;  3LT9 A;  3EN1 B;  1WTH A;  1STD A;  1DMN A;  1SII A;  4O8S A;  1AVL A;  1GY7 A;  3BNC A;  1D6Y A;  3G0K A;  1QVG 2;  1HKX A;  1EA2 A;  3CCV 3;  1FA3 A;  1RRH A;  3FG3 A;  1IT8 A;  5KP4 A;  1GY5 A;  3CNM A;  4JRF A;  5CF1 A;  1FGO A;  2IUK A;  1NO3 A;  2HMN B;  2XFT A;  4IIA A;  3ALA A;  3WOE B;  3F14 A;  1N5H A;  3K7C A;  1DMQ A;  2SBL A;  3NQZ A;  4HBR A;  1VQL 3;  1M90 4;  4Q53 A;  3BNB A;  4RNZ A;  2W9Q A;  3CMA 3;  1Q40 B;  4WP5 A;  3CC2 3;  5FW5 A;  2GXF A;  1VZZ A;  1JN5 B;  5AYS C;  1Q81 4;  1OCV A;  2OTL 3;  3LTA A;  4MMX B;  3NHX A;  5AEW B;  2MF7 A;  3F7S A;  2ZL8 A;  2C10 A;  3CC4 3;  3N8B A;  1EQK A;  3FF2 A;  2P0X A;  4R9L A;  1VQ4 3;  2YFI B;  3CNX A;  3DZL A;  3JUN A;  3NUV A;  4HZB B;  4O3V A;  4BTX A;  3NM2 A;  3CC7 3;  5KP1 A;  1JV2 B;  4HYZ A;  4X2H A;  3DUK A;  3JUQ A;  2WOH A;  2W04 A;  1QJG A;  1WMO A;  2K0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...