4HM1B

Naphthalene 1,2-dioxygenase bound to 1-indanone
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
192
structure length
192
Chain Sequence
b'INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to 1-indanone
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 55
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm1B00
3F14A 3CNMA 5DRVA 3SOAA 3FF2A 2XRXB 4PEJA 4CDLA 5BXQA 3GWRA 2RGQA 1DMQA 4HZBB 2GBWB 4XBYA 1CQSA 3E99A 3GZBA 4R1KA 4N3VA 1OHSA 3F7SA 2RFRA 4HM5B 4WWUC 1Q42A 4HKVB 5G2GA 1GY7A 1OGXA 3FKAA 3EBTA 1QJGA 3VSYA 3G16A 1DMMA 1TP6A 1OUNA 1ZO2A 2BMQB 2YFLB 3H3HA 3I0YA 3SOYA 5HGRA 1NU3A 1Q40B 3RGAA 3FLJA 1W01A 3HK4A 1ISKA 2B24B 3K0ZA 2STDA 4ORLA 5IENA 4XDVA 3OXAA 3FH1A 4L8PA 2B1XB 1S5AA 4XBTA 1OCVA 4FCJA 1OF5A 4LMIA 5KP4A 3CPOA 2K54A 3MYTA 1NWWA 3DZLA 4XB5A 1E97A 2QGUA 1JKGA 4L7KA 1OH0A 3LZAA 4HM6B 3DMCA 3IPTA 5TGNA 1QMAA 3MG2A 3OV4A 4RZMA 5FW5A 1O7GB 2XSHB 1UUWB 1EG9B 1VZZA 3EN8A 1E3VA 1TUHA 3MHEA 2HMMB 3S5CA 3D9RA 1DMNA 1A2KA 4WYKB 3EC9A 3T8UA 3NXJA 3GRDA 1WQLB 7STDA 4HM4B 2HMJB 2CHCA 5CXOA 1IDPA 8CHOA 1OF5B 1W02A 3F7XA 2GEXA 3CU3A 4Q53A 4X2OA 4K1VA 4LEHA 3G8ZA 1O7MB 4R9LA 2Z76A 1JKGB 3JUNA 1JN5B 5AIHA 2OWPA 3B8LA 1OGZA 2YFJB 2INXA 4GB5A 2HMKB 4MJDA 3MG1A 2GXFA 4HM3B 5D82A 2HMNB 1JB4A 3DUKA 4LGQA 3GZYB 4KVHA 4IIAA 2QIYA 5IG4A 1OHPA 4U13A 6STDA 2XR8B 1W6YA 5STDA 2F99A 5AI1A 3NM2A 1C7HA 3NHXA 2I9WA 2R4IA 5AIGA 3B4OA 1E3RA 4J8TA 5CK6A 5KP3A 5AEWB 5IEOA 2HMOB 4FCMA 3MKIA 3F40A 5IG5A 3KZTA 3OWSA 5AEUB 1GS3A 3KKGA 1Z1SA 2XSOB 1STDA 3OX9A 1NDOB 2F98A 2IMJA 1ZX2A 1ULJB 3B4PA 1OHOA 3EJVA 4WP5A 1JB2A 4STDA 5EVHA 3JUOA 1W00A 3NV0A 3HX8A 2GEYA 4X2HA 3KE7A 3F8XA 3JUQA 3JUMA 3MSOA 4XM4A 1O7HB 3EN1B 4L8OA 3ECFA 4HM8B 5IG3A 5AIFA 3ER7A 1GYBA 1Q40A 1O7WB 3FSDA 3T8NA 1GY5A 1OPYA 3M8CA 3JUPA 2CKFB 5IF6A 1O7NB 4J9AA 1GY6A 1SJWA 2BNGA 3ROBA 5KP1A 5JPPA 1UUVB 4HJLB 1O7PB 3NBRA 2HMLB 2GBXB 4XBXA 2Z77A 3B7CA 3GZRA 3RGRA 4HM1B 3EHCA 2W2CA 1EA2A 3DXOA 5BVBA 3GZXB 3CNXA 3NV0B 4OUQA 3G0KA 5CF2A 3MG3A 2PZVA 3WMDA 2JQ5A 3FF0A 1JB5A 5AIIA 1ASKA 5IEPA 3F8HA 3OWUA 4I4KA 3FGYA 3BB9A 3UJMA 4HM7B 4XDWA 5D83A 4HZ9B 5DREA 2BMOB 3SEDA 4WYKA 4HM0B 3VGNA 3DM8A 2BMRB 4OVMA 3F9SA 3H51A 3EQQB 4HVNA 3HZPA 2YFIB 1K41A 3FZWA 3K7CA 2Z7AA 1HKXA 5JPUA 2RCDA 1ULIB 1BUQA 3EF8A 5IG0A 1JN5A 2UX0A 4R9KA 5CF1A 3BLZA 3NUVA 1U5OA 4HM2B 3KSPA 3STDA 3EX9A 2A15A 3UNLA 1AR0A 2F86B 5D81A 5CLKA 5IERA 3EBYA 3OWYA 3A76A 4H3UA 3LYGA 4K1UA 3Q90A
chains in the Genus database with same CATH superfamily
3F14A 2E2TA 5M1AA 2OQEA 3WOEB 1RNBA 1RGHA 3ALAA 3CNMA 2CC3A 3D5GA 3HI7A 5DRVA 3X42A 3SOAA 2BIRA 2CH9A 1W6GA 3FF2A 2XRXB 3Q2PA 4PEJA 5LC7A 3WODG 1CYVA 1MGRA 1TFKA 1I0VA 3LH4A 2OOVC 2H0HA 4CDLA 1BNRA 3K5TA 5BXQA 3GWRA 1ROVA 1MNLA 2LQVA 1ROAA 2RBIA 2E2VA 3NBJA 2RGQA 3L0RA 3S67A 1DMQA 4HZBB 2GBWB 4AKZA 1RDSA 1AVKA 4XBYA 4LYLB 1CQSA 3BU4A 2L4VA 1QVG2 3E99A 3GZBA 1I8VA 4R1KA 3GSPA 4N3VA 1OHSA 4QWTA 3F7SA 5ELJA 1UGIA 2CFKA 2RFRA 1I2EA 1GOYA 3AMOB 4HM5B 4WWUC 1UUGB 5LC6A 1YGEA 3BNEA 1NO3A 1NB5I 1Q42A 1K8A4 4HKVB 5G2GA 2XF3A 1GY7A 3QRDA 2ZDJA 2K3DA 3KIIA 1JBSA 1OGXA 3SVAA 1VQK3 1PY3A 3FKAA 1YI23 3EBTA 1QJGA 3VSYA 1B2UA 1DMMA 3G16A 1IQXA 1TP6A 3D5IA 3JVCA 1RSNA 1OUNA 1ZO2A 1I3IA 2BMQB 1AQZA 2CK3H 4LZIA 2XGNA 2KF6A 2YFLB 3LTCA 3CCJ3 1JV2B 3H3HA 1S723 4EYCA 3ZG5A 1B27A 2Q07A 3DGOA 3I0YA 2D42A 4FMDA 2ZA4A 3SOYA 4KFFA 4R4KA 3PCRA 2RSXA 1BRHA 1KSIA 1JNQA 1TTOA 3CCS3 1RMSA 3N8BA 3WOFB 1BNEA 1FZUA 1D6UA 3J7Yd 1BSCA 2CFGA 3BNDA 2XFSA 2OQEC 2BU4A 2CWTA 5HGRA 1NU3A 4TX4A 1Q40B 3BIRA 1TRQA 3RGAA 3FLJA 1AV4A 3BNBA 1GSPA 1YJ93 1W01A 4R80A 1N8QA 3GAXA 2GU3A 3LTBA 3HK4A 1ISKA 2B24B 5M19A 1BNJA 3Q1CA 4BTXA 3K0ZA 3KFQC 1RRLA 1T5YA 2P0XA 5I97A 1STFI 2STDA 4ORLA 3V92A 5IENA 4XDVA 1K734 3OXAA 3FH1A 1RJOA 4L8PA 1B3SA 3KN4A 4EV5A 2B1XB 1TJDA 1X1WA 1LOWA 2OCTA 1FYSA 1T3BA 1S5AA 4XBTA 3ZFZA 1OCVA 4FCJA 5BIRA 2CG1A 3TDGA 2OOVA 1OF5A 1VQ83 4EXRA 4LMIA 5KP4A 1LVNA 3CPOA 3WDGB 4NPBA 1I2GA 4RNYA 2K54A 1J2BA 3N9HA 1IQ8A 1FUSA 3MYTA 2FNQA 1NWWA 3DZLA 1HZ1A 3LTAA 4XB5A 1YJW3 1E97A 1KC84 2QGUA 4ZM8A 1JKGA 4L7KA 1W2ZA 1BANA 1UCLA 1DVCA 3FG4A 5EQLA 4J5GA 4N6UA 1VQ43 1OH0A 2W56A 1GD4A 2IA7A 2ML5A 2CW9A 3LZAA 4HM6B 3DMCA 3IPTA 1LOYA 2BT3A 2F5MA 5TGNA 1T2IA 1CEWI 1UW1A 1QMAA 1KD14 3MG2A 3WA3A 1DE3A 3OV4A 1RLSA 4RZMA 2W04A 2GSPA 3CCR3 1EKMA 4NREA 1A2PA 1B20A 5FW5A 1O7GB 1UDII 2XSHB 4FMCA 4IT7A 2H0IA 1FA3A 1RTUA 1UUWB 3CC73 2CWVA 1RGKA 1EG9B 3AGNA 2CIUA 1GD3A 1W2B2 4MEIA 1VZZA 2OTL3 3O8YA 1RN7A 2IYJA 2J8XB 3G6E3 3CCU3 3SXXA 1UGHI 3EN8A 1E3VA 3LT8A 1DETA 1RGGA 3OW22 4KZ1A 1TUHA 3LMLA 2HMMB 3MHEA 3S5CA 1JBTA 1V57A 3D9RA 1BOXA 4N6MA 1FUWA 4AKYA 1DMNA 1A2KA 4WYKB 1VQM3 3EC9A 3T8UA 2C4BA 3NXJA 3GRDA 1I3FA 1U8CB 1M1XB 2E2UA 3DGLA 3LT9A 1WQLB 1PYLA 3SYUA 1VQL3 4BU4A 1VQ73 7STDA 4HM4B 1G96A 4BL2A 1BSAA 1YHQ3 1BUJA 3UL6A 4GL6A 2HMJB 2CHCA 3DY5A 1IDPA 1MWUA 5CXOA 8CHOA 1OF5B 1F8NA 4GHOA 1DYUA 1W02A 1MWSA 3F7XA 1X1XA 1TU5A 2GEXA 3CU3A 1UI8A 3CXC2 3U97A 1WMPA 4Q53A 2H0GA 1RKYA 1VQ63 3NQZA 4X2OA 3I553 4K1VA 1BIRA 3FG1A 4LEHA 3CCE3 3G8ZA 1NNVA 1VQP3 2MF7A 1O7MB 4R9LA 2Z76A 1JKGB 1MGWA 3PS8A 4HYZA 3JUNA 1JN5B 5AIHA 1NJI4 2OWPA 3B8LA 1KQS2 1OGZA 1B2ZA 1RN4A 2INXA 2YFJB 3K9MC 4GB5A 5AYSC 1VQ93 3LXUX 2HMKB 5A0OB 1FGOA 4MJDA 3RNTA 3IMAB 3MG1A 2GXFA 4HM3B 1I0XA 1IT7A 1N9EA 1RGFA 1B21A 1CH0A 1X1UA 6RNTA 5D82A 1BAOA 2QEX3 1DVDA 4JF8A 3SX1A 1BNFA 2HMNB 3CD63 1JB4A 3DUKA 2WGQA 1V58A 1BRIA 1L5GB 1V74A 4LGQA 1NB3I 2KF3A 3GZYB 4FCZA 1HU9A 4KVHA 2KRTA 4IIAA 2QIYA 4BL3A 1LRAA 3RDEA 5IG4A 3PGBA 4N6OB 1EEJA 1BSBA 1OHPA 2W9PA 2KAAA 5G1KA 4U13A 6STDA 1SPUA 2XR8B 1QAKA 2WOFA 2BHMA 1W6YA 2KCDA 5STDA 4EBGA 1D6ZA 4N6V0 2F99A 1R4CA 5AI1A 3G4S3 1QALA 3K63A 3NM2A 1C7HA 3NHXA 4HOHA 4RNZA 2I9WA 2RNTA 2R4IA 1VQN3 5AIGA 3B4OA 4MMYB 1UCIA 1JZDA 1E3RA 1AVLA 4J8TA 1G02A 2M7OA 5CK6A 1US1A 2Y73A 5KP3A 4LSOA 2O9UX 5AEWB 3NQYA 1YJN3 1B2SA 5IEOA 4O3VA 2GU1A 2HMOB 3D79A 3HIIA 1RGCA 4FCMA 1TIJA 1W5ZA 3MKIA 4K90B 3V98A 2MC8A 4DKIA 1PU4A 1M9GA 1EUIC 4FMBA 5M18A 3CPW2 3F40A 2F5WA 5IG5A 1KWIA 3HIGA 2KF5A 3KZTA 1GMQA 2P38A 2W0QA 4HAAA 2CX0A 1VQO3 1RCLA 3OWSA 3AHSA 5AEUB 5JBSA 3ZG0A 3DH2A 1GS3A 1VQ53 2D1WA 2HOHA 4O02B 2C11A 2ZL8A 3KKGA 1LQGC 4FR9A 4KT3B 4N6NB 1R4YA 1Z1SA 2XSOB 1PFPA 1STDA 3OX9A 1IK3A 1NDOB 2F98A 2IMJA 4K61A 2IUKA 2F56A 4H61A 4EW5A 1ZX2A 1VQQA 5RNTA 1M1K4 1ULJB 3B4PA 1OHOA 1WNHA 1YNVX 2ZHXB 3AMOA 3AGOA 3EJVA 4WP5A 1T2HA 1JB2A 4N6LA 1IVVA 2SBLA 4O8SA 1ZS7A 5EEOA 4KFEA 4STDA 5EVHA 3D3LA 4OK0A 3JUOA 1UCKA 1W00A 1OACA 3NM7A 3NV0A 2CWUA 1IYYA 2CG0A 2Y74A 1G0TA 3HX8A 3QK9A 1MWTA 2GEYA 5HOHA 1Q824 2WO0A 4CPKA 2KXGA 4X2HA 3URPA 1WMNA 1FGMA 2V1LA 5ELUA 2AADA 3DGYA 3FCSB 3KE7A 4RNTA 3F8XA 3JUQA 3JUMA 3S29A 1BRKA 3CC23 3X3YA 4FMAA 3MSOA 1BNIA 4XM4A 5FGOA 1JJ22 3X41A 1O7HB 7RNTA 4MMXB 1QAFA 3EN1B 3PCSA 2XH9A 4L8OA 1C54A 3I563 3ECFA 4HM8B 2CFLA 1A90A 7GSPA 5AIFA 5IG3A 3NX0A 3ER7A 1GYBA 1Q40A 1O7WB 2W03A 3CCL3 3FSDA 2F4YA 3T8NA 3CCV3 2OTJ3 1UI7A 4HBRA 2Z6BA 1JRQA 1GY5A 1Y4KA 4BTYA 5G1LA 1OPYA 1B2MA 1FGTA 1I70A 3M8CA 3JUPA 3KCHA 4J5KA 6GSPA 2P0MA 3EE1A 2LYXA 1JZOA 2CKFB 5IF6A 3MPHA 1O7NB 3X40A 1GMRA 3CCM3 1W7CA 4J9AA 4WFOA 1BU4A 1YGWA 1GY6A 2YX9A 1EQKA 1RGLA 1SJWA 2BNGA 1A67A 1LOVA 3V99A 3ROBA 5KP1A 1IV7A 5JPPA 3A5EA 3WA2X 1UUVB 3HOHA 4HJLB 1IVXA 1WMOA 2W56B 1O7PB 3NBRA 2HMLB 2GBXB 4XBXA 4WHAA 1M904 2Z77A 4EV2A 3BNCA 1SIIA 1W6CA 4CCVA 1IT8A 3Q3FA 1N5HA 1BSEA 1BRGA 3B7CA 1IVUA 3GZRA 1W4NA 3RGRA 4HM1B 3EHCA 3LTDA 2W2CA 3CMA3 2R41A 1EA2A 3PYJA 1FW7A 3G713 3AHWA 2IUJA 3DXOA 5BVBA 1CYUA 3GZXB 3CNXA 1BNSA 1YVBI 3NV0B 4OUQA 1TRPA 3G0KA 3MG3A 2PZVA 1BNGA 4MMZB 3WMDA 3D4AA 5CF2A 3S27A 1JBRA 2XEPA 1MOLA 1BRNL 3X3ZA 2JQ5A 3FF0A 2QA43 2FXTA 1AY7A 1JB5A 4KFDA 5AIIA 3WHOA 2K0MA 4GSPA 2BO9B 1ASKA 5IW9A 5IEPA 1N5PA 3F8HA 1IVWA 1GOVA 5AYRB 1RGEA 3OWUA 1SIHA 1I2FA 4I4KA 3N54B 3UL5A 3FGYA 3IJEB 3BB9A 3UJMA 3UB1A 2WOHA 1Q864 4HM7B 4XDWA 5D83A 1RRHA 2UGIA 4HZ9B 1X1YA 1BGSA 9RNTA 2XFTA 1BRSA 2BMOB 4G1MB 4WYKA 5DREA 3SEDA 1IU7A 2JDIH 3KSED 3S28A 3CCQ3 2CFDA 4HM0B 3VGNA 4CJNA 2AAEA 2BMRB 3DM8A 1FGQA 1FGRA 1GMPA 3SLUA 1YIJ3 4OVMA 3F9SA 3H51A 3CME3 4BIRA 3EB8A 1A2VA 4JRFA 3NBBA 4EC6A 5GSPA 3LOYA 4ILFA 3WR2A 1RHLA 3EQQB 4HVNA 1HYFA 3HZPA 2YFIB 2P09A 3CC43 1RNTA 1K41A 2CX1A 3FZWA 3K7CA 4O2HA 3VF1A 1Q7Y4 4NHFA 2IY2A 1HKXA 2Z7AA 5JPUA 1WTHA 1LXEA 4RBNA 1N8R4 1LQMB 1ULIB 2RCDA 4BTWA 1BUQA 3EF8A 1IQYA 1YIT3 1MWRA 1IV9A 1ZGXA 5IG0A 2L1SA 1Q814 1BSDA 1JN5A 2WGOA 2UX0A 2C10A 4AEQA 2FGTA 1GOUA 4R9KA 5CF1A 3BLZA 5BU4A 1LNHA 4N6TA 3NUVA 3U1WA 1U5OA 1B2XA 1Q9EA 3KSPA 1FUTA 3FG3A 4HM2B 2W9QA 3DGNA 1BVIA 1SQWA 4I5QA 3PXMA 4IPBA 3STDA 1RGAA 3PZWA 1LNIA 3EX9A 1RCKA 2A15A 2XGLA 3UNLA 2CFWA 1AR0A 3DGMA 1BRJA 1QVF2 3MWZA 1D6YA 1Q7HA 1UCJA 2F86B 2ML6A 5CLKA 2P05A 5D81A 5IERA 3T0UA 1K9M4 1K28A 3EBYA 1N9JA 3OWYA 2UUGC 1RN1A 2O3OA 2SARA 3A76A 4H3UA 3LYGA 2PNCA 3X3XA 2W6JH 1YVSA 2KF4A 1LOXA 1TFOA 8RNTA 4K1UA 3Q90A 1SARA
chains in the Genus database with same CATH topology
3F14A 2E2TA 2OQEA 3WOEB 3ALAA 3CNMA 2CC3A 5DRVA 3HI7A 3X42A 3SOAA 2CH9A 1W6GA 3FF2A 2XRXB 3Q2PA 4PEJA 5LC7A 3WODG 1CYVA 1TFKA 3LH4A 2OOVC 4CDLA 3K5TA 5BXQA 3GWRA 1ROVA 1MNLA 2LQVA 1ROAA 2E2VA 3NBJA 2RGQA 3L0RA 3S67A 1DMQA 4HZBB 2GBWB 4AKZA 1AVKA 4XBYA 1CQSA 2L4VA 1QVG2 3E99A 3GZBA 4R1KA 4N3VA 1OHSA 4QWTA 3F7SA 5ELJA 2CFKA 2RFRA 3AMOB 4HM5B 4WWUC 5LC6A 1YGEA 3BNEA 1NO3A 1NB5I 1Q42A 1K8A4 4HKVB 5G2GA 2XF3A 1GY7A 3QRDA 2ZDJA 3KIIA 1OGXA 3SVAA 1VQK3 3FKAA 3EBTA 1QJGA 3VSYA 3G16A 1DMMA 1IQXA 1TP6A 3JVCA 1OUNA 1ZO2A 2BMQB 2CK3H 4LZIA 2XGNA 2YFLB 3CCJ3 3LTCA 1S723 1JV2B 3H3HA 4EYCA 2Q07A 3I0YA 3DGOA 2D42A 4FMDA 3SOYA 4KFFA 4R4KA 3PCRA 2RSXA 1KSIA 1JNQA 3CCS3 3N8BA 3WOFB 1D6UA 3J7Yd 2CFGA 3BNDA 2XFSA 2OQEC 2CWTA 5HGRA 1NU3A 4TX4A 1Q40B 3RGAA 3FLJA 1AV4A 3BNBA 1YJ93 1W01A 4R80A 1N8QA 3GAXA 2GU3A 3LTBA 3HK4A 1ISKA 2B24B 3Q1CA 4BTXA 3K0ZA 3KFQC 1RRLA 1T5YA 2P0XA 5I97A 1STFI 2STDA 4ORLA 3V92A 5IENA 4XDVA 1K734 3OXAA 3FH1A 1RJOA 4L8PA 4EV5A 3KN4A 2B1XB 2OCTA 1S5AA 4XBTA 1OCVA 4FCJA 2CG1A 3TDGA 2OOVA 1OF5A 1VQ83 4EXRA 4LMIA 5KP4A 1LVNA 3CPOA 3WDGB 4RNYA 2K54A 1J2BA 3N9HA 1IQ8A 3MYTA 2FNQA 1NWWA 3DZLA 1YJW3 3LTAA 4XB5A 1E97A 1KC84 2QGUA 4ZM8A 1JKGA 4L7KA 1W2ZA 1DVCA 3FG4A 5EQLA 4N6UA 1VQ43 1OH0A 2W56A 1GD4A 2IA7A 2ML5A 2CW9A 3LZAA 4HM6B 3DMCA 3IPTA 2BT3A 5TGNA 1CEWI 1UW1A 1QMAA 1KD14 3MG2A 3WA3A 3OV4A 4RZMA 2W04A 3CCR3 1EKMA 4NREA 5FW5A 1O7GB 2XSHB 4FMCA 4IT7A 1FA3A 1UUWB 3CC73 2CWVA 1EG9B 1W2B2 2CIUA 1GD3A 4MEIA 1VZZA 2OTL3 3O8YA 1RN7A 3G6E3 3CCU3 3SXXA 3EN8A 1E3VA 3LT8A 3OW22 4KZ1A 1TUHA 3LMLA 2HMMB 3MHEA 3S5CA 3D9RA 4N6MA 1FUWA 4AKYA 1DMNA 1A2KA 4WYKB 1VQM3 3EC9A 3T8UA 3NXJA 3GRDA 1U8CB 1M1XB 2E2UA 3DGLA 3LT9A 1WQLB 1VQL3 1VQ73 7STDA 4HM4B 1G96A 1YHQ3 3UL6A 4GL6A 2HMJB 2CHCA 3DY5A 1IDPA 5CXOA 8CHOA 1OF5B 1F8NA 1DYUA 1W02A 3F7XA 1TU5A 2GEXA 3CU3A 1UI8A 3CXC2 3U97A 1WMPA 4Q53A 1VQ63 1RKYA 3NQZA 4X2OA 3I553 4K1VA 3FG1A 4LEHA 3CCE3 3G8ZA 1VQP3 2MF7A 1O7MB 4R9LA 2Z76A 1JKGB 3PS8A 4HYZA 3JUNA 1JN5B 5AIHA 1NJI4 2OWPA 3B8LA 1KQS2 1OGZA 2YFJB 2INXA 3K9MC 4GB5A 5AYSC 1VQ93 3LXUX 2HMKB 5A0OB 1FGOA 4MJDA 3IMAB 3MG1A 2GXFA 4HM3B 1IT7A 1N9EA 2QEX3 1DVDA 5D82A 4JF8A 3SX1A 2HMNB 3CD63 1JB4A 3DUKA 2WGQA 1L5GB 1V74A 4LGQA 1NB3I 3GZYB 4FCZA 1HU9A 4KVHA 2KRTA 4IIAA 2QIYA 3RDEA 5IG4A 3PGBA 4N6OB 1OHPA 2W9PA 4U13A 6STDA 1SPUA 2XR8B 1QAKA 2WOFA 2BHMA 1W6YA 2KCDA 5STDA 4EBGA 1D6ZA 4N6V0 2F99A 1R4CA 5AI1A 3G4S3 1QALA 3K63A 3NM2A 1C7HA 3NHXA 4RNZA 2I9WA 2R4IA 1VQN3 5AIGA 3B4OA 4MMYB 1E3RA 1AVLA 4J8TA 2M7OA 5CK6A 1US1A 2Y73A 5KP3A 4LSOA 2O9UX 5AEWB 3NQYA 1YJN3 5IEOA 4O3VA 2GU1A 2HMOB 3HIIA 4FCMA 1YI23 4K90B 1TIJA 1W5ZA 3MKIA 3V98A 1PU4A 2MC8A 1M9GA 4FMBA 3CPW2 3F40A 5IG5A 1KWIA 3HIGA 3KZTA 2W0QA 2P38A 1VQO3 3OWSA 5AEUB 5JBSA 1GS3A 1VQ53 2D1WA 4O02B 2C11A 2ZL8A 3KKGA 4FR9A 4N6NB 1Z1SA 2XSOB 1PFPA 1STDA 3OX9A 1IK3A 1NDOB 2F98A 2IMJA 4K61A 2IUKA 4H61A 1ZX2A 1M1K4 1ULJB 3B4PA 1OHOA 1WNHA 3AMOA 3EJVA 4WP5A 1JB2A 4N6LA 1IVVA 2SBLA 4O8SA 5EEOA 4KFEA 4STDA 5EVHA 3D3LA 4OK0A 3JUOA 1W00A 1OACA 3NM7A 3NV0A 2CWUA 2CG0A 2Y74A 3HX8A 3QK9A 2GEYA 1Q824 2WO0A 2KXGA 4X2HA 1WMNA 1FGMA 2V1LA 5ELUA 3FCSB 3KE7A 3F8XA 3JUQA 3JUMA 3S29A 3CC23 3X3YA 4FMAA 3MSOA 4XM4A 5FGOA 1JJ22 3X41A 1O7HB 4MMXB 1QAFA 3EN1B 3PCSA 2XH9A 4L8OA 3I563 3ECFA 4HM8B 2CFLA 1A90A 5IG3A 5AIFA 3NX0A 3ER7A 1GYBA 1Q40A 1O7WB 2W03A 3CCL3 3FSDA 3T8NA 3CCV3 2OTJ3 1UI7A 4HBRA 2Z6BA 1JRQA 1GY5A 1Y4KA 4BTYA 1OPYA 1FGTA 3M8CA 3JUPA 2P0MA 3EE1A 2LYXA 2CKFB 5IF6A 3MPHA 1O7NB 3X40A 3CCM3 1W7CA 4J9AA 4WFOA 1GY6A 2YX9A 1EQKA 1SJWA 2BNGA 1A67A 3V99A 3ROBA 5KP1A 1IV7A 5JPPA 3WA2X 1UUVB 4HJLB 1IVXA 1WMOA 2W56B 1O7PB 3NBRA 2HMLB 2GBXB 4XBXA 4WHAA 1M904 2Z77A 4EV2A 3BNCA 1SIIA 1W6CA 4CCVA 1IT8A 1N5HA 3B7CA 1IVUA 3GZRA 1W4NA 3RGRA 4HM1B 3EHCA 3LTDA 2W2CA 3CMA3 1EA2A 3PYJA 3G713 2IUJA 3DXOA 5BVBA 1CYUA 3GZXB 3CNXA 1YVBI 3NV0B 4OUQA 3G0KA 5CF2A 3MG3A 2PZVA 3WMDA 4MMZB 3S27A 2XEPA 1MOLA 3X3ZA 2JQ5A 3FF0A 2QA43 2FXTA 1JB5A 4KFDA 5AIIA 2K0MA 2BO9B 1ASKA 5IW9A 5IEPA 1N5PA 3F8HA 1IVWA 5AYRB 3OWUA 1SIHA 4I4KA 3N54B 3UL5A 3FGYA 3IJEB 3BB9A 3UJMA 3UB1A 2WOHA 1Q864 4HM7B 4XDWA 5D83A 1RRHA 4HZ9B 2XFTA 5DREA 2BMOB 4G1MB 4WYKA 3SEDA 1IU7A 2JDIH 3KSED 3S28A 3CCQ3 2CFDA 4HM0B 3VGNA 3DM8A 2BMRB 1FGQA 1FGRA 3SLUA 1YIJ3 4OVMA 3F9SA 3H51A 3CME3 3EB8A 1A2VA 4JRFA 3NBBA 4EC6A 3LOYA 3EQQB 4HVNA 3HZPA 2YFIB 2P09A 3CC43 1K41A 3FZWA 3K7CA 4O2HA 3VF1A 1Q7Y4 4NHFA 2Z7AA 1HKXA 5JPUA 1WTHA 1LXEA 4RBNA 1N8R4 2RCDA 1ULIB 4BTWA 1BUQA 3EF8A 1IQYA 1YIT3 1IV9A 5IG0A 1Q814 2WGOA 1JN5A 4AEQA 2UX0A 2C10A 2FGTA 4R9KA 5CF1A 3BLZA 1LNHA 4N6TA 3NUVA 3U1WA 1U5OA 4HM2B 3KSPA 3FG3A 2W9QA 3DGNA 3STDA 1SQWA 3PXMA 4IPBA 3PZWA 3EX9A 2A15A 2XGLA 3UNLA 2CFWA 1AR0A 3DGMA 1QVF2 3MWZA 1D6YA 2F86B 2ML6A 5D81A 5CLKA 2P05A 5IERA 1K9M4 3T0UA 1K28A 3EBYA 1N9JA 3OWYA 2O3OA 3A76A 4H3UA 3LYGA 2PNCA 3X3XA 2W6JH 1LOXA 1TFOA 4K1UA 3Q90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F14 A;  3CNM A;  5DRV A;  3SOA A;  3FF2 A;  2XRX B;  4PEJ A;  4CDL A;  5BXQ A;  3GWR A;  2RGQ A;  1DMQ A;  4HZB B;  2GBW B;  4XBY A;  1CQS A;  3E99 A;  3GZB A;  4R1K A;  4N3V A;  1OHS A;  3F7S A;  2RFR A;  4HM5 B;  4WWU C;  1Q42 A;  4HKV B;  5G2G A;  1GY7 A;  1OGX A;  3FKA A;  3EBT A;  1QJG A;  3VSY A;  3G16 A;  1DMM A;  1TP6 A;  1OUN A;  1ZO2 A;  2BMQ B;  2YFL B;  3H3H A;  3I0Y A;  3SOY A;  5HGR A;  1NU3 A;  1Q40 B;  3RGA A;  3FLJ A;  1W01 A;  3HK4 A;  1ISK A;  2B24 B;  3K0Z A;  2STD A;  4ORL A;  5IEN A;  4XDV A;  3OXA A;  3FH1 A;  4L8P A;  2B1X B;  1S5A A;  4XBT A;  1OCV A;  4FCJ A;  1OF5 A;  4LMI A;  5KP4 A;  3CPO A;  2K54 A;  3MYT A;  1NWW A;  3DZL A;  4XB5 A;  1E97 A;  2QGU A;  1JKG A;  4L7K A;  1OH0 A;  3LZA A;  4HM6 B;  3DMC A;  3IPT A;  5TGN A;  1QMA A;  3MG2 A;  3OV4 A;  4RZM A;  5FW5 A;  1O7G B;  2XSH B;  1UUW B;  1EG9 B;  1VZZ A;  3EN8 A;  1E3V A;  1TUH A;  3MHE A;  2HMM B;  3S5C A;  3D9R A;  1DMN A;  1A2K A;  4WYK B;  3EC9 A;  3T8U A;  3NXJ A;  3GRD A;  1WQL B;  7STD A;  4HM4 B;  2HMJ B;  2CHC A;  5CXO A;  1IDP A;  8CHO A;  1OF5 B;  1W02 A;  3F7X A;  2GEX A;  3CU3 A;  4Q53 A;  4X2O A;  4K1V A;  4LEH A;  3G8Z A;  1O7M B;  4R9L A;  2Z76 A;  1JKG B;  3JUN A;  1JN5 B;  5AIH A;  2OWP A;  3B8L A;  1OGZ A;  2YFJ B;  2INX A;  4GB5 A;  2HMK B;  4MJD A;  3MG1 A;  2GXF A;  4HM3 B;  5D82 A;  2HMN B;  1JB4 A;  3DUK A;  4LGQ A;  3GZY B;  4KVH A;  4IIA A;  2QIY A;  5IG4 A;  1OHP A;  4U13 A;  6STD A;  2XR8 B;  1W6Y A;  5STD A;  2F99 A;  5AI1 A;  3NM2 A;  1C7H A;  3NHX A;  2I9W A;  2R4I A;  5AIG A;  3B4O A;  1E3R A;  4J8T A;  5CK6 A;  5KP3 A;  5AEW B;  5IEO A;  2HMO B;  4FCM A;  3MKI A;  3F40 A;  5IG5 A;  3KZT A;  3OWS A;  5AEU B;  1GS3 A;  3KKG A;  1Z1S A;  2XSO B;  1STD A;  3OX9 A;  1NDO B;  2F98 A;  2IMJ A;  1ZX2 A;  1ULJ B;  3B4P A;  1OHO A;  3EJV A;  4WP5 A;  1JB2 A;  4STD A;  5EVH A;  3JUO A;  1W00 A;  3NV0 A;  3HX8 A;  2GEY A;  4X2H A;  3KE7 A;  3F8X A;  3JUQ A;  3JUM A;  3MSO A;  4XM4 A;  1O7H B;  3EN1 B;  4L8O A;  3ECF A;  4HM8 B;  5IG3 A;  5AIF A;  3ER7 A;  1GYB A;  1Q40 A;  1O7W B;  3FSD A;  3T8N A;  1GY5 A;  1OPY A;  3M8C A;  3JUP A;  2CKF B;  5IF6 A;  1O7N B;  4J9A A;  1GY6 A;  1SJW A;  2BNG A;  3ROB A;  5KP1 A;  5JPP A;  1UUV B;  4HJL B;  1O7P B;  3NBR A;  2HML B;  2GBX B;  4XBX A;  2Z77 A;  3B7C A;  3GZR A;  3RGR A;  4HM1 B;  3EHC A;  2W2C A;  1EA2 A;  3DXO A;  5BVB A;  3GZX B;  3CNX A;  3NV0 B;  4OUQ A;  3G0K A;  5CF2 A;  3MG3 A;  2PZV A;  3WMD A;  2JQ5 A;  3FF0 A;  1JB5 A;  5AII A;  1ASK A;  5IEP A;  3F8H A;  3OWU A;  4I4K A;  3FGY A;  3BB9 A;  3UJM A;  4HM7 B;  4XDW A;  5D83 A;  4HZ9 B;  5DRE A;  2BMO B;  3SED A;  4WYK A;  4HM0 B;  3VGN A;  3DM8 A;  2BMR B;  4OVM A;  3F9S A;  3H51 A;  3EQQ B;  4HVN A;  3HZP A;  2YFI B;  1K41 A;  3FZW A;  3K7C A;  2Z7A A;  1HKX A;  5JPU A;  2RCD A;  1ULI B;  1BUQ A;  3EF8 A;  5IG0 A;  1JN5 A;  2UX0 A;  4R9K A;  5CF1 A;  3BLZ A;  3NUV A;  1U5O A;  4HM2 B;  3KSP A;  3STD A;  3EX9 A;  2A15 A;  3UNL A;  1AR0 A;  2F86 B;  5D81 A;  5CLK A;  5IER A;  3EBY A;  3OWY A;  3A76 A;  4H3U A;  3LYG A;  4K1U A;  3Q90 A; 
#chains in the Genus database with same CATH topology
 3F14 A;  2E2T A;  5M1A A;  2OQE A;  3WOE B;  1RNB A;  1RGH A;  3ALA A;  3CNM A;  2CC3 A;  3D5G A;  3HI7 A;  5DRV A;  3X42 A;  3SOA A;  2BIR A;  2CH9 A;  1W6G A;  3FF2 A;  2XRX B;  3Q2P A;  4PEJ A;  5LC7 A;  3WOD G;  1CYV A;  1MGR A;  1TFK A;  1I0V A;  3LH4 A;  2OOV C;  2H0H A;  4CDL A;  1BNR A;  3K5T A;  5BXQ A;  3GWR A;  1ROV A;  1MNL A;  2LQV A;  1ROA A;  2RBI A;  2E2V A;  3NBJ A;  2RGQ A;  3L0R A;  3S67 A;  1DMQ A;  4HZB B;  2GBW B;  4AKZ A;  1RDS A;  1AVK A;  4XBY A;  4LYL B;  1CQS A;  3BU4 A;  2L4V A;  1QVG 2;  3E99 A;  3GZB A;  1I8V A;  4R1K A;  3GSP A;  4N3V A;  1OHS A;  4QWT A;  3F7S A;  5ELJ A;  1UGI A;  2CFK A;  2RFR A;  1I2E A;  1GOY A;  3AMO B;  4HM5 B;  4WWU C;  1UUG B;  5LC6 A;  1YGE A;  3BNE A;  1NO3 A;  1NB5 I;  1Q42 A;  1K8A 4;  4HKV B;  5G2G A;  2XF3 A;  1GY7 A;  3QRD A;  2ZDJ A;  2K3D A;  3KII A;  1JBS A;  1OGX A;  3SVA A;  1VQK 3;  1PY3 A;  3FKA A;  1YI2 3;  3EBT A;  1QJG A;  3VSY A;  1B2U A;  1DMM A;  3G16 A;  1IQX A;  1TP6 A;  3D5I A;  3JVC A;  1RSN A;  1OUN A;  1ZO2 A;  1I3I A;  2BMQ B;  1AQZ A;  2CK3 H;  4LZI A;  2XGN A;  2KF6 A;  2YFL B;  3LTC A;  3CCJ 3;  1JV2 B;  3H3H A;  1S72 3;  4EYC A;  3ZG5 A;  1B27 A;  2Q07 A;  3DGO A;  3I0Y A;  2D42 A;  4FMD A;  2ZA4 A;  3SOY A;  4KFF A;  4R4K A;  3PCR A;  2RSX A;  1BRH A;  1KSI A;  1JNQ A;  1TTO A;  3CCS 3;  1RMS A;  3N8B A;  3WOF B;  1BNE A;  1FZU A;  1D6U A;  3J7Y d;  1BSC A;  2CFG A;  3BND A;  2XFS A;  2OQE C;  2BU4 A;  2CWT A;  5HGR A;  1NU3 A;  4TX4 A;  1Q40 B;  3BIR A;  1TRQ A;  3RGA A;  3FLJ A;  1AV4 A;  3BNB A;  1GSP A;  1YJ9 3;  1W01 A;  4R80 A;  1N8Q A;  3GAX A;  2GU3 A;  3LTB A;  3HK4 A;  1ISK A;  2B24 B;  5M19 A;  1BNJ A;  3Q1C A;  4BTX A;  3K0Z A;  3KFQ C;  1RRL A;  1T5Y A;  2P0X A;  5I97 A;  1STF I;  2STD A;  4ORL A;  3V92 A;  5IEN A;  4XDV A;  1K73 4;  3OXA A;  3FH1 A;  1RJO A;  4L8P A;  1B3S A;  3KN4 A;  4EV5 A;  2B1X B;  1TJD A;  1X1W A;  1LOW A;  2OCT A;  1FYS A;  1T3B A;  1S5A A;  4XBT A;  3ZFZ A;  1OCV A;  4FCJ A;  5BIR A;  2CG1 A;  3TDG A;  2OOV A;  1OF5 A;  1VQ8 3;  4EXR A;  4LMI A;  5KP4 A;  1LVN A;  3CPO A;  3WDG B;  4NPB A;  1I2G A;  4RNY A;  2K54 A;  1J2B A;  3N9H A;  1IQ8 A;  1FUS A;  3MYT A;  2FNQ A;  1NWW A;  3DZL A;  1HZ1 A;  3LTA A;  4XB5 A;  1YJW 3;  1E97 A;  1KC8 4;  2QGU A;  4ZM8 A;  1JKG A;  4L7K A;  1W2Z A;  1BAN A;  1UCL A;  1DVC A;  3FG4 A;  5EQL A;  4J5G A;  4N6U A;  1VQ4 3;  1OH0 A;  2W56 A;  1GD4 A;  2IA7 A;  2ML5 A;  2CW9 A;  3LZA A;  4HM6 B;  3DMC A;  3IPT A;  1LOY A;  2BT3 A;  2F5M A;  5TGN A;  1T2I A;  1CEW I;  1UW1 A;  1QMA A;  1KD1 4;  3MG2 A;  3WA3 A;  1DE3 A;  3OV4 A;  1RLS A;  4RZM A;  2W04 A;  2GSP A;  3CCR 3;  1EKM A;  4NRE A;  1A2P A;  1B20 A;  5FW5 A;  1O7G B;  1UDI I;  2XSH B;  4FMC A;  4IT7 A;  2H0I A;  1FA3 A;  1RTU A;  1UUW B;  3CC7 3;  2CWV A;  1RGK A;  1EG9 B;  3AGN A;  2CIU A;  1GD3 A;  1W2B 2;  4MEI A;  1VZZ A;  2OTL 3;  3O8Y A;  1RN7 A;  2IYJ A;  2J8X B;  3G6E 3;  3CCU 3;  3SXX A;  1UGH I;  3EN8 A;  1E3V A;  3LT8 A;  1DET A;  1RGG A;  3OW2 2;  4KZ1 A;  1TUH A;  3LML A;  2HMM B;  3MHE A;  3S5C A;  1JBT A;  1V57 A;  3D9R A;  1BOX A;  4N6M A;  1FUW A;  4AKY A;  1DMN A;  1A2K A;  4WYK B;  1VQM 3;  3EC9 A;  3T8U A;  2C4B A;  3NXJ A;  3GRD A;  1I3F A;  1U8C B;  1M1X B;  2E2U A;  3DGL A;  3LT9 A;  1WQL B;  1PYL A;  3SYU A;  1VQL 3;  4BU4 A;  1VQ7 3;  7STD A;  4HM4 B;  1G96 A;  4BL2 A;  1BSA A;  1YHQ 3;  1BUJ A;  3UL6 A;  4GL6 A;  2HMJ B;  2CHC A;  3DY5 A;  1IDP A;  1MWU A;  5CXO A;  8CHO A;  1OF5 B;  1F8N A;  4GHO A;  1DYU A;  1W02 A;  1MWS A;  3F7X A;  1X1X A;  1TU5 A;  2GEX A;  3CU3 A;  1UI8 A;  3CXC 2;  3U97 A;  1WMP A;  4Q53 A;  2H0G A;  1RKY A;  1VQ6 3;  3NQZ A;  4X2O A;  3I55 3;  4K1V A;  1BIR A;  3FG1 A;  4LEH A;  3CCE 3;  3G8Z A;  1NNV A;  1VQP 3;  2MF7 A;  1O7M B;  4R9L A;  2Z76 A;  1JKG B;  1MGW A;  3PS8 A;  4HYZ A;  3JUN A;  1JN5 B;  5AIH A;  1NJI 4;  2OWP A;  3B8L A;  1KQS 2;  1OGZ A;  1B2Z A;  1RN4 A;  2INX A;  2YFJ B;  3K9M C;  4GB5 A;  5AYS C;  1VQ9 3;  3LXU X;  2HMK B;  5A0O B;  1FGO A;  4MJD A;  3RNT A;  3IMA B;  3MG1 A;  2GXF A;  4HM3 B;  1I0X A;  1IT7 A;  1N9E A;  1RGF A;  1B21 A;  1CH0 A;  1X1U A;  6RNT A;  5D82 A;  1BAO A;  2QEX 3;  1DVD A;  4JF8 A;  3SX1 A;  1BNF A;  2HMN B;  3CD6 3;  1JB4 A;  3DUK A;  2WGQ A;  1V58 A;  1BRI A;  1L5G B;  1V74 A;  4LGQ A;  1NB3 I;  2KF3 A;  3GZY B;  4FCZ A;  1HU9 A;  4KVH A;  2KRT A;  4IIA A;  2QIY A;  4BL3 A;  1LRA A;  3RDE A;  5IG4 A;  3PGB A;  4N6O B;  1EEJ A;  1BSB A;  1OHP A;  2W9P A;  2KAA A;  5G1K A;  4U13 A;  6STD A;  1SPU A;  2XR8 B;  1QAK A;  2WOF A;  2BHM A;  1W6Y A;  2KCD A;  5STD A;  4EBG A;  1D6Z A;  4N6V 0;  2F99 A;  1R4C A;  5AI1 A;  3G4S 3;  1QAL A;  3K63 A;  3NM2 A;  1C7H A;  3NHX A;  4HOH A;  4RNZ A;  2I9W A;  2RNT A;  2R4I A;  1VQN 3;  5AIG A;  3B4O A;  4MMY B;  1UCI A;  1JZD A;  1E3R A;  1AVL A;  4J8T A;  1G02 A;  2M7O A;  5CK6 A;  1US1 A;  2Y73 A;  5KP3 A;  4LSO A;  2O9U X;  5AEW B;  3NQY A;  1YJN 3;  1B2S A;  5IEO A;  4O3V A;  2GU1 A;  2HMO B;  3D79 A;  3HII A;  1RGC A;  4FCM A;  1TIJ A;  1W5Z A;  3MKI A;  4K90 B;  3V98 A;  2MC8 A;  4DKI A;  1PU4 A;  1M9G A;  1EUI C;  4FMB A;  5M18 A;  3CPW 2;  3F40 A;  2F5W A;  5IG5 A;  1KWI A;  3HIG A;  2KF5 A;  3KZT A;  1GMQ A;  2P38 A;  2W0Q A;  4HAA A;  2CX0 A;  1VQO 3;  1RCL A;  3OWS A;  3AHS A;  5AEU B;  5JBS A;  3ZG0 A;  3DH2 A;  1GS3 A;  1VQ5 3;  2D1W A;  2HOH A;  4O02 B;  2C11 A;  2ZL8 A;  3KKG A;  1LQG C;  4FR9 A;  4KT3 B;  4N6N B;  1R4Y A;  1Z1S A;  2XSO B;  1PFP A;  1STD A;  3OX9 A;  1IK3 A;  1NDO B;  2F98 A;  2IMJ A;  4K61 A;  2IUK A;  2F56 A;  4H61 A;  4EW5 A;  1ZX2 A;  1VQQ A;  5RNT A;  1M1K 4;  1ULJ B;  3B4P A;  1OHO A;  1WNH A;  1YNV X;  2ZHX B;  3AMO A;  3AGO A;  3EJV A;  4WP5 A;  1T2H A;  1JB2 A;  4N6L A;  1IVV A;  2SBL A;  4O8S A;  1ZS7 A;  5EEO A;  4KFE A;  4STD A;  5EVH A;  3D3L A;  4OK0 A;  3JUO A;  1UCK A;  1W00 A;  1OAC A;  3NM7 A;  3NV0 A;  2CWU A;  1IYY A;  2CG0 A;  2Y74 A;  1G0T A;  3HX8 A;  3QK9 A;  1MWT A;  2GEY A;  5HOH A;  1Q82 4;  2WO0 A;  4CPK A;  2KXG A;  4X2H A;  3URP A;  1WMN A;  1FGM A;  2V1L A;  5ELU A;  2AAD A;  3DGY A;  3FCS B;  3KE7 A;  4RNT A;  3F8X A;  3JUQ A;  3JUM A;  3S29 A;  1BRK A;  3CC2 3;  3X3Y A;  4FMA A;  3MSO A;  1BNI A;  4XM4 A;  5FGO A;  1JJ2 2;  3X41 A;  1O7H B;  7RNT A;  4MMX B;  1QAF A;  3EN1 B;  3PCS A;  2XH9 A;  4L8O A;  1C54 A;  3I56 3;  3ECF A;  4HM8 B;  2CFL A;  1A90 A;  7GSP A;  5AIF A;  5IG3 A;  3NX0 A;  3ER7 A;  1GYB A;  1Q40 A;  1O7W B;  2W03 A;  3CCL 3;  3FSD A;  2F4Y A;  3T8N A;  3CCV 3;  2OTJ 3;  1UI7 A;  4HBR A;  2Z6B A;  1JRQ A;  1GY5 A;  1Y4K A;  4BTY A;  5G1L A;  1OPY A;  1B2M A;  1FGT A;  1I70 A;  3M8C A;  3JUP A;  3KCH A;  4J5K A;  6GSP A;  2P0M A;  3EE1 A;  2LYX A;  1JZO A;  2CKF B;  5IF6 A;  3MPH A;  1O7N B;  3X40 A;  1GMR A;  3CCM 3;  1W7C A;  4J9A A;  4WFO A;  1BU4 A;  1YGW A;  1GY6 A;  2YX9 A;  1EQK A;  1RGL A;  1SJW A;  2BNG A;  1A67 A;  1LOV A;  3V99 A;  3ROB A;  5KP1 A;  1IV7 A;  5JPP A;  3A5E A;  3WA2 X;  1UUV B;  3HOH A;  4HJL B;  1IVX A;  1WMO A;  2W56 B;  1O7P B;  3NBR A;  2HML B;  2GBX B;  4XBX A;  4WHA A;  1M90 4;  2Z77 A;  4EV2 A;  3BNC A;  1SII A;  1W6C A;  4CCV A;  1IT8 A;  3Q3F A;  1N5H A;  1BSE A;  1BRG A;  3B7C A;  1IVU A;  3GZR A;  1W4N A;  3RGR A;  4HM1 B;  3EHC A;  3LTD A;  2W2C A;  3CMA 3;  2R41 A;  1EA2 A;  3PYJ A;  1FW7 A;  3G71 3;  3AHW A;  2IUJ A;  3DXO A;  5BVB A;  1CYU A;  3GZX B;  3CNX A;  1BNS A;  1YVB I;  3NV0 B;  4OUQ A;  1TRP A;  3G0K A;  3MG3 A;  2PZV A;  1BNG A;  4MMZ B;  3WMD A;  3D4A A;  5CF2 A;  3S27 A;  1JBR A;  2XEP A;  1MOL A;  1BRN L;  3X3Z A;  2JQ5 A;  3FF0 A;  2QA4 3;  2FXT A;  1AY7 A;  1JB5 A;  4KFD A;  5AII A;  3WHO A;  2K0M A;  4GSP A;  2BO9 B;  1ASK A;  5IW9 A;  5IEP A;  1N5P A;  3F8H A;  1IVW A;  1GOV A;  5AYR B;  1RGE A;  3OWU A;  1SIH A;  1I2F A;  4I4K A;  3N54 B;  3UL5 A;  3FGY A;  3IJE B;  3BB9 A;  3UJM A;  3UB1 A;  2WOH A;  1Q86 4;  4HM7 B;  4XDW A;  5D83 A;  1RRH A;  2UGI A;  4HZ9 B;  1X1Y A;  1BGS A;  9RNT A;  2XFT A;  1BRS A;  2BMO B;  4G1M B;  4WYK A;  5DRE A;  3SED A;  1IU7 A;  2JDI H;  3KSE D;  3S28 A;  3CCQ 3;  2CFD A;  4HM0 B;  3VGN A;  4CJN A;  2AAE A;  2BMR B;  3DM8 A;  1FGQ A;  1FGR A;  1GMP A;  3SLU A;  1YIJ 3;  4OVM A;  3F9S A;  3H51 A;  3CME 3;  4BIR A;  3EB8 A;  1A2V A;  4JRF A;  3NBB A;  4EC6 A;  5GSP A;  3LOY A;  4ILF A;  3WR2 A;  1RHL A;  3EQQ B;  4HVN A;  1HYF A;  3HZP A;  2YFI B;  2P09 A;  3CC4 3;  1RNT A;  1K41 A;  2CX1 A;  3FZW A;  3K7C A;  4O2H A;  3VF1 A;  1Q7Y 4;  4NHF A;  2IY2 A;  1HKX A;  2Z7A A;  5JPU A;  1WTH A;  1LXE A;  4RBN A;  1N8R 4;  1LQM B;  1ULI B;  2RCD A;  4BTW A;  1BUQ A;  3EF8 A;  1IQY A;  1YIT 3;  1MWR A;  1IV9 A;  1ZGX A;  5IG0 A;  2L1S A;  1Q81 4;  1BSD A;  1JN5 A;  2WGO A;  2UX0 A;  2C10 A;  4AEQ A;  2FGT A;  1GOU A;  4R9K A;  5CF1 A;  3BLZ A;  5BU4 A;  1LNH A;  4N6T A;  3NUV A;  3U1W A;  1U5O A;  1B2X A;  1Q9E A;  3KSP A;  1FUT A;  3FG3 A;  4HM2 B;  2W9Q A;  3DGN A;  1BVI A;  1SQW A;  4I5Q A;  3PXM A;  4IPB A;  3STD A;  1RGA A;  3PZW A;  1LNI A;  3EX9 A;  1RCK A;  2A15 A;  2XGL A;  3UNL A;  2CFW A;  1AR0 A;  3DGM A;  1BRJ A;  1QVF 2;  3MWZ A;  1D6Y A;  1Q7H A;  1UCJ A;  2F86 B;  2ML6 A;  5CLK A;  2P05 A;  5D81 A;  5IER A;  3T0U A;  1K9M 4;  1K28 A;  3EBY A;  1N9J A;  3OWY A;  2UUG C;  1RN1 A;  2O3O A;  2SAR A;  3A76 A;  4H3U A;  3LYG A;  2PNC A;  3X3X A;  2W6J H;  1YVS A;  2KF4 A;  1LOX A;  1TFO A;  8RNT A;  4K1U A;  3Q90 A;  1SAR A; 
#chains in the Genus database with same CATH homology
 3F14 A;  2E2T A;  2OQE A;  3WOE B;  3ALA A;  3CNM A;  2CC3 A;  5DRV A;  3HI7 A;  3X42 A;  3SOA A;  2CH9 A;  1W6G A;  3FF2 A;  2XRX B;  3Q2P A;  4PEJ A;  5LC7 A;  3WOD G;  1CYV A;  1TFK A;  3LH4 A;  2OOV C;  4CDL A;  3K5T A;  5BXQ A;  3GWR A;  1ROV A;  1MNL A;  2LQV A;  1ROA A;  2E2V A;  3NBJ A;  2RGQ A;  3L0R A;  3S67 A;  1DMQ A;  4HZB B;  2GBW B;  4AKZ A;  1AVK A;  4XBY A;  1CQS A;  2L4V A;  1QVG 2;  3E99 A;  3GZB A;  4R1K A;  4N3V A;  1OHS A;  4QWT A;  3F7S A;  5ELJ A;  2CFK A;  2RFR A;  3AMO B;  4HM5 B;  4WWU C;  5LC6 A;  1YGE A;  3BNE A;  1NO3 A;  1NB5 I;  1Q42 A;  1K8A 4;  4HKV B;  5G2G A;  2XF3 A;  1GY7 A;  3QRD A;  2ZDJ A;  3KII A;  1OGX A;  3SVA A;  1VQK 3;  3FKA A;  3EBT A;  1QJG A;  3VSY A;  3G16 A;  1DMM A;  1IQX A;  1TP6 A;  3JVC A;  1OUN A;  1ZO2 A;  2BMQ B;  2CK3 H;  4LZI A;  2XGN A;  2YFL B;  3CCJ 3;  3LTC A;  1S72 3;  1JV2 B;  3H3H A;  4EYC A;  2Q07 A;  3I0Y A;  3DGO A;  2D42 A;  4FMD A;  3SOY A;  4KFF A;  4R4K A;  3PCR A;  2RSX A;  1KSI A;  1JNQ A;  3CCS 3;  3N8B A;  3WOF B;  1D6U A;  3J7Y d;  2CFG A;  3BND A;  2XFS A;  2OQE C;  2CWT A;  5HGR A;  1NU3 A;  4TX4 A;  1Q40 B;  3RGA A;  3FLJ A;  1AV4 A;  3BNB A;  1YJ9 3;  1W01 A;  4R80 A;  1N8Q A;  3GAX A;  2GU3 A;  3LTB A;  3HK4 A;  1ISK A;  2B24 B;  3Q1C A;  4BTX A;  3K0Z A;  3KFQ C;  1RRL A;  1T5Y A;  2P0X A;  5I97 A;  1STF I;  2STD A;  4ORL A;  3V92 A;  5IEN A;  4XDV A;  1K73 4;  3OXA A;  3FH1 A;  1RJO A;  4L8P A;  4EV5 A;  3KN4 A;  2B1X B;  2OCT A;  1S5A A;  4XBT A;  1OCV A;  4FCJ A;  2CG1 A;  3TDG A;  2OOV A;  1OF5 A;  1VQ8 3;  4EXR A;  4LMI A;  5KP4 A;  1LVN A;  3CPO A;  3WDG B;  4RNY A;  2K54 A;  1J2B A;  3N9H A;  1IQ8 A;  3MYT A;  2FNQ A;  1NWW A;  3DZL A;  1YJW 3;  3LTA A;  4XB5 A;  1E97 A;  1KC8 4;  2QGU A;  4ZM8 A;  1JKG A;  4L7K A;  1W2Z A;  1DVC A;  3FG4 A;  5EQL A;  4N6U A;  1VQ4 3;  1OH0 A;  2W56 A;  1GD4 A;  2IA7 A;  2ML5 A;  2CW9 A;  3LZA A;  4HM6 B;  3DMC A;  3IPT A;  2BT3 A;  5TGN A;  1CEW I;  1UW1 A;  1QMA A;  1KD1 4;  3MG2 A;  3WA3 A;  3OV4 A;  4RZM A;  2W04 A;  3CCR 3;  1EKM A;  4NRE A;  5FW5 A;  1O7G B;  2XSH B;  4FMC A;  4IT7 A;  1FA3 A;  1UUW B;  3CC7 3;  2CWV A;  1EG9 B;  1W2B 2;  2CIU A;  1GD3 A;  4MEI A;  1VZZ A;  2OTL 3;  3O8Y A;  1RN7 A;  3G6E 3;  3CCU 3;  3SXX A;  3EN8 A;  1E3V A;  3LT8 A;  3OW2 2;  4KZ1 A;  1TUH A;  3LML A;  2HMM B;  3MHE A;  3S5C A;  3D9R A;  4N6M A;  1FUW A;  4AKY A;  1DMN A;  1A2K A;  4WYK B;  1VQM 3;  3EC9 A;  3T8U A;  3NXJ A;  3GRD A;  1U8C B;  1M1X B;  2E2U A;  3DGL A;  3LT9 A;  1WQL B;  1VQL 3;  1VQ7 3;  7STD A;  4HM4 B;  1G96 A;  1YHQ 3;  3UL6 A;  4GL6 A;  2HMJ B;  2CHC A;  3DY5 A;  1IDP A;  5CXO A;  8CHO A;  1OF5 B;  1F8N A;  1DYU A;  1W02 A;  3F7X A;  1TU5 A;  2GEX A;  3CU3 A;  1UI8 A;  3CXC 2;  3U97 A;  1WMP A;  4Q53 A;  1VQ6 3;  1RKY A;  3NQZ A;  4X2O A;  3I55 3;  4K1V A;  3FG1 A;  4LEH A;  3CCE 3;  3G8Z A;  1VQP 3;  2MF7 A;  1O7M B;  4R9L A;  2Z76 A;  1JKG B;  3PS8 A;  4HYZ A;  3JUN A;  1JN5 B;  5AIH A;  1NJI 4;  2OWP A;  3B8L A;  1KQS 2;  1OGZ A;  2YFJ B;  2INX A;  3K9M C;  4GB5 A;  5AYS C;  1VQ9 3;  3LXU X;  2HMK B;  5A0O B;  1FGO A;  4MJD A;  3IMA B;  3MG1 A;  2GXF A;  4HM3 B;  1IT7 A;  1N9E A;  2QEX 3;  1DVD A;  5D82 A;  4JF8 A;  3SX1 A;  2HMN B;  3CD6 3;  1JB4 A;  3DUK A;  2WGQ A;  1L5G B;  1V74 A;  4LGQ A;  1NB3 I;  3GZY B;  4FCZ A;  1HU9 A;  4KVH A;  2KRT A;  4IIA A;  2QIY A;  3RDE A;  5IG4 A;  3PGB A;  4N6O B;  1OHP A;  2W9P A;  4U13 A;  6STD A;  1SPU A;  2XR8 B;  1QAK A;  2WOF A;  2BHM A;  1W6Y A;  2KCD A;  5STD A;  4EBG A;  1D6Z A;  4N6V 0;  2F99 A;  1R4C A;  5AI1 A;  3G4S 3;  1QAL A;  3K63 A;  3NM2 A;  1C7H A;  3NHX A;  4RNZ A;  2I9W A;  2R4I A;  1VQN 3;  5AIG A;  3B4O A;  4MMY B;  1E3R A;  1AVL A;  4J8T A;  2M7O A;  5CK6 A;  1US1 A;  2Y73 A;  5KP3 A;  4LSO A;  2O9U X;  5AEW B;  3NQY A;  1YJN 3;  5IEO A;  4O3V A;  2GU1 A;  2HMO B;  3HII A;  4FCM A;  1YI2 3;  4K90 B;  1TIJ A;  1W5Z A;  3MKI A;  3V98 A;  1PU4 A;  2MC8 A;  1M9G A;  4FMB A;  3CPW 2;  3F40 A;  5IG5 A;  1KWI A;  3HIG A;  3KZT A;  2W0Q A;  2P38 A;  1VQO 3;  3OWS A;  5AEU B;  5JBS A;  1GS3 A;  1VQ5 3;  2D1W A;  4O02 B;  2C11 A;  2ZL8 A;  3KKG A;  4FR9 A;  4N6N B;  1Z1S A;  2XSO B;  1PFP A;  1STD A;  3OX9 A;  1IK3 A;  1NDO B;  2F98 A;  2IMJ A;  4K61 A;  2IUK A;  4H61 A;  1ZX2 A;  1M1K 4;  1ULJ B;  3B4P A;  1OHO A;  1WNH A;  3AMO A;  3EJV A;  4WP5 A;  1JB2 A;  4N6L A;  1IVV A;  2SBL A;  4O8S A;  5EEO A;  4KFE A;  4STD A;  5EVH A;  3D3L A;  4OK0 A;  3JUO A;  1W00 A;  1OAC A;  3NM7 A;  3NV0 A;  2CWU A;  2CG0 A;  2Y74 A;  3HX8 A;  3QK9 A;  2GEY A;  1Q82 4;  2WO0 A;  2KXG A;  4X2H A;  1WMN A;  1FGM A;  2V1L A;  5ELU A;  3FCS B;  3KE7 A;  3F8X A;  3JUQ A;  3JUM A;  3S29 A;  3CC2 3;  3X3Y A;  4FMA A;  3MSO A;  4XM4 A;  5FGO A;  1JJ2 2;  3X41 A;  1O7H B;  4MMX B;  1QAF A;  3EN1 B;  3PCS A;  2XH9 A;  4L8O A;  3I56 3;  3ECF A;  4HM8 B;  2CFL A;  1A90 A;  5IG3 A;  5AIF A;  3NX0 A;  3ER7 A;  1GYB A;  1Q40 A;  1O7W B;  2W03 A;  3CCL 3;  3FSD A;  3T8N A;  3CCV 3;  2OTJ 3;  1UI7 A;  4HBR A;  2Z6B A;  1JRQ A;  1GY5 A;  1Y4K A;  4BTY A;  1OPY A;  1FGT A;  3M8C A;  3JUP A;  2P0M A;  3EE1 A;  2LYX A;  2CKF B;  5IF6 A;  3MPH A;  1O7N B;  3X40 A;  3CCM 3;  1W7C A;  4J9A A;  4WFO A;  1GY6 A;  2YX9 A;  1EQK A;  1SJW A;  2BNG A;  1A67 A;  3V99 A;  3ROB A;  5KP1 A;  1IV7 A;  5JPP A;  3WA2 X;  1UUV B;  4HJL B;  1IVX A;  1WMO A;  2W56 B;  1O7P B;  3NBR A;  2HML B;  2GBX B;  4XBX A;  4WHA A;  1M90 4;  2Z77 A;  4EV2 A;  3BNC A;  1SII A;  1W6C A;  4CCV A;  1IT8 A;  1N5H A;  3B7C A;  1IVU A;  3GZR A;  1W4N A;  3RGR A;  4HM1 B;  3EHC A;  3LTD A;  2W2C A;  3CMA 3;  1EA2 A;  3PYJ A;  3G71 3;  2IUJ A;  3DXO A;  5BVB A;  1CYU A;  3GZX B;  3CNX A;  1YVB I;  3NV0 B;  4OUQ A;  3G0K A;  5CF2 A;  3MG3 A;  2PZV A;  3WMD A;  4MMZ B;  3S27 A;  2XEP A;  1MOL A;  3X3Z A;  2JQ5 A;  3FF0 A;  2QA4 3;  2FXT A;  1JB5 A;  4KFD A;  5AII A;  2K0M A;  2BO9 B;  1ASK A;  5IW9 A;  5IEP A;  1N5P A;  3F8H A;  1IVW A;  5AYR B;  3OWU A;  1SIH A;  4I4K A;  3N54 B;  3UL5 A;  3FGY A;  3IJE B;  3BB9 A;  3UJM A;  3UB1 A;  2WOH A;  1Q86 4;  4HM7 B;  4XDW A;  5D83 A;  1RRH A;  4HZ9 B;  2XFT A;  5DRE A;  2BMO B;  4G1M B;  4WYK A;  3SED A;  1IU7 A;  2JDI H;  3KSE D;  3S28 A;  3CCQ 3;  2CFD A;  4HM0 B;  3VGN A;  3DM8 A;  2BMR B;  1FGQ A;  1FGR A;  3SLU A;  1YIJ 3;  4OVM A;  3F9S A;  3H51 A;  3CME 3;  3EB8 A;  1A2V A;  4JRF A;  3NBB A;  4EC6 A;  3LOY A;  3EQQ B;  4HVN A;  3HZP A;  2YFI B;  2P09 A;  3CC4 3;  1K41 A;  3FZW A;  3K7C A;  4O2H A;  3VF1 A;  1Q7Y 4;  4NHF A;  2Z7A A;  1HKX A;  5JPU A;  1WTH A;  1LXE A;  4RBN A;  1N8R 4;  2RCD A;  1ULI B;  4BTW A;  1BUQ A;  3EF8 A;  1IQY A;  1YIT 3;  1IV9 A;  5IG0 A;  1Q81 4;  2WGO A;  1JN5 A;  4AEQ A;  2UX0 A;  2C10 A;  2FGT A;  4R9K A;  5CF1 A;  3BLZ A;  1LNH A;  4N6T A;  3NUV A;  3U1W A;  1U5O A;  4HM2 B;  3KSP A;  3FG3 A;  2W9Q A;  3DGN A;  3STD A;  1SQW A;  3PXM A;  4IPB A;  3PZW A;  3EX9 A;  2A15 A;  2XGL A;  3UNL A;  2CFW A;  1AR0 A;  3DGM A;  1QVF 2;  3MWZ A;  1D6Y A;  2F86 B;  2ML6 A;  5D81 A;  5CLK A;  2P05 A;  5IER A;  1K9M 4;  3T0U A;  1K28 A;  3EBY A;  1N9J A;  3OWY A;  2O3O A;  3A76 A;  4H3U A;  3LYG A;  2PNC A;  3X3X A;  2W6J H;  1LOX A;  1TFO A;  4K1U A;  3Q90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...