4HM1B

Naphthalene 1,2-dioxygenase bound to 1-indanone
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to 1-indanone
rcsb
source organism Pseudomonas sp. c18
total genus 55
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm1B00
3JUQA 1O7PB 3CNMA 3FLJA 3D9RA 4Q53A 1OGZA 3T8NA 5IG3A 4L8OA 5STDA 4XB5A 4HM4B 3BLZA 1E3RA 3CU3A 3G16A 1O7MB 3EN1B 3F14A 3M8CA 4XDWA 1OF5B 5AI1A 1HKXA 3I0YA 3F7SA 5IEOA 3OV4A 3EF8A 2CHCA 1JKGA 3F9SA 4J8TA 1DMMA 3HK4A 5D83A 3OWSA 3ECFA 3F8XA 4KVHA 3JUOA 5D82A 2F99A 2YFLB 3VSYA 2STDA 4X2OA 3F7XA 1EG9B 3EBYA 2CKFB 3K7CA 1W6YA 2K54A 1OHSA 3NV0A 5D81A 1NDOB 2IMJA 1ZX2A 2XRXB 3RGRA 2XSHB 3B7CA 1BUQA 4CDLA 1OGXA 3OWYA 5KP3A 3JUNA 5JPUA 5AIGA 5CF1A 1E3VA 1K41A 4N3VA 3DM8A 4LEHA 3LYGA 1JB2A 3EBTA 1ISKA 3S5CA 4WWUC 5IG0A 5IG4A 3SOAA 1TUHA 1TP6A 2QIYA 4FCJA 1IDPA 3HZPA 3KKGA 1O7NB 8CHOA 4PEJA 4L8PA 4HM8B 2F86B 5AEWB 1GY7A 3STDA 4XM4A 3UNLA 4HM7B 4K1VA 1EA2A 2QGUA 4HZ9B 3DXOA 1UUVB 3GZBA 3E99A 1AR0A 2XR8B 4STDA 2YFJB 3MYTA 2B1XB 5AIFA 4HM5B 1QMAA 3NV0B 1JB4A 2Z76A 2Z7AA 1JB5A 2HMMB 1Q42A 3FF2A 3FGYA 4U13A 3DMCA 1W02A 3EC9A 3F40A 2HMNB 4R9LA 1ASKA 3VGNA 5IENA 1SJWA 4L7KA 3KZTA 4HVNA 3FKAA 1WQLB 2UX0A 1O7GB 4HM6B 2F98A 3GZYB 2RFRA 1GS3A 1NWWA 2A15A 5FW5A 4XBYA 3SOYA 3BB9A 4HM1B 3SEDA 3B4PA 3MG2A 4R1KA 3A76A 4R9KA 3UJMA 3F8HA 5CK6A 4OUQA 3OX9A 2Z77A 1Q40A 5IERA 2YFIB 2OWPA 3NXJA 1S5AA 4HJLB 4OVMA 4WP5A 3K0ZA 2BMQB 3RGAA 4FCMA 2BNGA 3JUMA 1VZZA 3EN8A 4HM0B 3T8UA 3NM2A 3OXAA 3FSDA 3EJVA 3LZAA 5IEPA 5EVHA 3B4OA 3GZRA 1ULIB 3MG1A 5AIHA 5BXQA 2R4IA 5AIIA 1OH0A 1E97A 2XSOB 4LMIA 4XBXA 1JN5A 4I4KA 3MHEA 4RZMA 4ORLA 5BVBA 2GBWB 3GZXB 2GEXA 3KSPA 2B24B 4XBTA 4X2HA 3G0KA 4K1UA 3NHXA 3H51A 3B8LA 3EQQB 5IF6A 2I9WA 1DMNA 3FZWA 1GY5A 3FH1A 2RGQA 3MG3A 3GRDA 4MJDA 4GB5A 3G8ZA 4HM2B 5G2GA 4WYKA 1Q40B 1W01A 5KP1A 1ULJB 1GYBA 2GBXB 2HMKB 1OCVA 2INXA 3ER7A 3ROBA 2JQ5A 3FF0A 3CPOA 3KE7A 2BMRB 2GEYA 1DMQA 5AEUB 3NBRA 2HMOB 5DREA 3MKIA 2HMLB 1CQSA 1OF5A 4H3UA 3GWRA 3DZLA 1NU3A 4HKVB 1OHOA 5KP4A 1U5OA 1W00A 2PZVA 6STDA 1JN5B 2BMOB 4XDVA 5CF2A 5CLKA 1QJGA 1OUNA 1A2KA 1GY6A 4HM3B 3WMDA 3EHCA 5CXOA 3Q90A 3OWUA 2GXFA 3HX8A 1O7WB 5HGRA 1Z1SA 1ZO2A 3JUPA 1OPYA 1UUWB 3CNXA 4HZBB 3H3HA 1C7HA 2HMJB 7STDA 3MSOA 5JPPA 2W2CA 5TGNA 3NUVA 3EX9A 5DRVA 1O7HB 4IIAA 2RCDA 3IPTA 1STDA 1JKGB 5IG5A 4WYKB 1OHPA 3DUKA 4LGQA 4J9AA
chains in the Genus database with same CATH superfamily
1UCJA 1I70A 3NM7A 3JUQA 1IV7A 1O7PB 3CNMA 3FLJA 3CMA3 2WOFA 1GOVA 1DYUA 3D9RA 3HIIA 2QA43 2OOVA 4Q53A 1OGZA 2RSXA 3T8NA 1D6UA 5IG3A 4L8OA 2CWTA 1PYLA 5AYSC 4BL3A 1BNSA 5STDA 2CFDA 2Y73A 1YGEA 2KXGA 2W6JH 1IYYA 4FMBA 4XB5A 1RKYA 4HM4B 3HI7A 3BLZA 1E3RA 6GSPA 3CU3A 1S723 1BNFA 1KSIA 1O7MB 3EN1B 3F14A 3G16A 3M8CA 3NQZA 4XDWA 4EV2A 1OF5B 5AI1A 1HKXA 1DETA 3I0YA 3F7SA 5IEOA 3OV4A 3EF8A 3N8BA 4NREA 3I553 2CHCA 4LZIA 3HIGA 1RGKA 1QAKA 3X3ZA 2OTJ3 1JKGA 3F9SA 1GMPA 1RGAA 5G1KA 4J8TA 3NQYA 2H0IA 4EYCA 1JV2B 4NPBA 1DMMA 2CX1A 4GSPA 1Q824 1M9GA 1HYFA 3HK4A 3RNTA 5D83A 1HU9A 1NJI4 4EV5A 3Q2PA 3CCL3 1RSNA 3A5EA 3Q1CA 3WOEB 1D6ZA 4KZ1A 3G6E3 3X42A 3OWSA 4BIRA 1K734 3ECFA 2F56A 3FG4A 1VQ93 2ZA4A 1VQP3 1LRAA 3F8XA 1IQXA 4IPBA 4KVHA 3JUOA 3GSPA 5D82A 2F99A 1YIJ3 2YFLB 3VSYA 3CCQ3 1RGEA 3PGBA 1TTOA 2STDA 4X2OA 3X41A 1VQO3 3N9HA 1YIT3 3F7XA 2ZDJA 1EG9B 3EBYA 1IVWA 2CKFB 1YNVX 2GSPA 1BSCA 3K7CA 2ZHXB 1MWSA 1W6YA 3N54B 1I8VA 1SIHA 1N9JA 1M1XB 2K54A 3LXUX 5FGOA 1OHSA 3NV0A 3PZWA 4MMYB 3CCU3 5D81A 1STFI 3LTBA 1NDOB 1X1YA 4H61A 2IMJA 1SQWA 3CC23 3G713 1C54A 1MWRA 1ZX2A 2E2UA 1IVVA 2Q07A 3LT9A 5GSPA 2XRXB 3L0RA 2CWVA 4WFOA 3RGRA 1I0VA 1YVBI 2WGQA 3K9MC 1FA3A 3BNEA 1RCKA 2SARA 1AVKA 4ILFA 3FCSB 1YI23 4EXRA 4N6NB 2XSHB 4FMAA 3B7CA 4CJNA 1BANA 1MOLA 1NO3A 1OGXA 4CDLA 1BUQA 3DGLA 3OWYA 3KIIA 5KP3A 3JUNA 3AMOA 3V99A 2P38A 3CC43 1TFOA 1UDII 4LSOA 5JPUA 2CWUA 2JDIH 1KD14 5AIGA 1RNTA 1QVF2 3LH4A 1N9EA 1JZDA 5CF1A 1E3VA 1FGOA 1K41A 4BTWA 4N3VA 3DM8A 3PS8A 5M1AA 1RMSA 1TRQA 1WMNA 3ALAA 4LEHA 1CH0A 3LYGA 1FGQA 3D4AA 2W04A 2RNTA 3SX1A 1JB2A 2BU4A 2OQEC 3EBTA 3KCHA 1ISKA 3S5CA 1V57A 4WWUC 5IG0A 2P05A 5IG4A 3SOAA 1TUHA 1B20A 5BU4A 1TP6A 2IYJA 3S27A 3U1WA 5HOHA 2QIYA 1GD4A 1YHQ3 1IVUA 4FCJA 1BSDA 4GHOA 2P09A 1FUWA 1IDPA 1ZGXA 2CFGA 1K8A4 3HZPA 3KKGA 1O7NB 8CHOA 1I3FA 4PEJA 1N5HA 2ML5A 4L8PA 4O2HA 4HM8B 3RDEA 1A2PA 2IA7A 1Q7HA 2PNCA 2F86B 5AEWB 3ZFZA 2CG1A 1PFPA 1GY7A 3STDA 2O3OA 1VQ53 2XF3A 3PXMA 1UCLA 4XM4A 3UNLA 3U97A 3CME3 4HM7B 1QVG2 2XGLA 1EA2A 2QGUA 4K1VA 2IUJA 2OQEA 4R80A 4HZ9B 4BL2A 3DXOA 4I5QA 1LNHA 1UUVB 2R41A 3GZBA 1VQM3 1BNJA 3DH2A 3E99A 5ELJA 3TDGA 1MWTA 1AR0A 1DE3A 1RGCA 2XR8B 1JJ22 1EQKA 3DY5A 1LXEA 5M19A 4STDA 4G1MB 2KAAA 2YFJB 1BAOA 2CH9A 1TRPA 1A67A 3MYTA 2B1XB 2C10A 5AIFA 4HM5B 1T2HA 1QMAA 1LNIA 3NV0B 1JB4A 1A90A 2Z76A 3QK9A 2Z7AA 1AY7A 1JB5A 1RGFA 2HMMB 3V92A 1Q42A 3CXC2 3FF2A 3FGYA 4U13A 3CCM3 3DMCA 3LT8A 1UI8A 2WGOA 3G4S3 2KRTA 3MPHA 4O8SA 1W02A 1BVIA 3EC9A 4FMDA 1JBSA 3F40A 3NX0A 2HMNB 4N6V0 1I2FA 1VQQA 4KT3B 2CK3H 4R9LA 1US1A 1N5PA 4LYLB 4MEIA 1ASKA 2E2TA 3MWZA 3VGNA 5IENA 1SJWA 1BSBA 1KWIA 2LQVA 4L7KA 3AMOB 1N8R4 1MWUA 1CYVA 1TJDA 3URPA 2FNQA 1FYSA 3KZTA 1UUGB 3UL5A 1UCIA 1IVXA 1LVNA 1RRHA 1TIJA 2W0QA 3D5GA 1BRJA 3PYJA 3CD63 4HVNA 2Y74A 3KN4A 3FKAA 1W6CA 1WQLB 2UX0A 1Q7Y4 1B21A 2F5WA 1O7GB 2K3DA 4HM6B 2F98A 1Y4KA 2LYXA 2V1LA 3GZYB 2RFRA 3HOHA 4FMCA 1VQ63 1G02A 3T0UA 1BNGA 2BIRA 1BRHA 3BNDA 2W03A 1GS3A 1VQ83 3J7Yd 1B2XA 1BRKA 1V74A 2ZL8A 1FGMA 4QWTA 1NWWA 3LTAA 1M904 4CPKA 1JBTA 2K0MA 1LQMB 1R4CA 2A15A 1GD3A 5FW5A 3K5TA 1T3BA 1IT8A 3SVAA 4XBYA 4HOHA 2BT3A 3SOYA 3BB9A 4HM1B 3SEDA 1WTHA 3CCE3 3EE1A 2XH9A 3B4PA 4BTXA 3MG2A 5EQLA 1MNLA 3IJEB 4R1KA 4AEQA 5A0OB 5I97A 4FR9A 4NHFA 3A76A 4R9KA 3UJMA 1OACA 3F8HA 5CK6A 1B3SA 3CCR3 4J5GA 9RNTA 4OUQA 3OX9A 1R4YA 2Z77A 1Q40A 2W9QA 1NB3I 2FGTA 4RBNA 2RBIA 1RJOA 2YFIB 2OWPA 3GAXA 2UGIA 1S5AA 3KSED 1IV9A 1W7CA 3NXJA 4HJLB 4OVMA 1GMRA 4WP5A 3OW22 1UGHI 2BO9B 2YX9A 3NBBA 1BRIA 3K0ZA 1RCLA 2UUGC 2BMQB 1FUTA 3RGAA 1RGLA 4FCMA 1BOXA 4EC6A 1ROAA 2CFKA 3Q3FA 1ZS7A 4HAAA 2Z6BA 1N8QA 2BNGA 1RGGA 3DGOA 2L1SA 3JUMA 2CIUA 3X40A 1WNHA 1RN4A 3VF1A 3K63A 3ZG5A 3JVCA 1VZZA 4RNYA 3EN8A 2KF3A 1AV4A 3S67A 1D6YA 4HM0B 3T8UA 3NM2A 1YJW3 5M18A 1IQ8A 2MF7A 4HYZA 1I3IA 3OXAA 1W2ZA 3FSDA 3NBJA 3UL6A 4O02B 3EJVA 3LZAA 5IEPA 5EVHA 1JRQA 3B4OA 3GZRA 1GSPA 1ULIB 4IT7A 4AKZA 3MG1A 4AKYA 5EEOA 1IQYA 1VQ73 5AIHA 5BXQA 2R4IA 2HOHA 3QRDA 3BU4A 5AIIA 1OH0A 1YVSA 1E97A 2XSOB 4LMIA 2AAEA 3PCSA 4EW5A 3LMLA 4XBXA 1B27A 4N6TA 1JN5A 1RN1A 1WMPA 2GU3A 3KFQC 4I4KA 5IERA 1VQK3 1FW7A 2WOHA 1PY3A 3X3YA 3MHEA 1KC84 1RLSA 4RZMA 4ORLA 5IW9A 5BVBA 2OCTA 1G96A 4R4KA 2GBWB 1BRGA 3PCRA 3GZXB 2GEXA 1HZ1A 1BRNL 3KSPA 2B24B 4XBTA 3ZG0A 4X2HA 7GSPA 1Q864 1V58A 4RNZA 2H0HA 3G0KA 1RTUA 1UCKA 1SARA 1QALA 4WHAA 4K1UA 1EEJA 2D1WA 3AHSA 3NHXA 4N6UA 1B2MA 3WDGB 3H51A 3B8LA 1UGIA 3EQQB 4BTYA 1K9M4 5IF6A 1BIRA 2I9WA 1TU5A 2XGNA 1DMNA 1B2UA 1FZUA 3BIRA 3FZWA 5G1LA 2SBLA 2H0GA 1GY5A 1X1XA 2W9PA 3FH1A 1BU4A 1BUJA 1CEWI 2KF4A 4GL6A 1LOXA 1BRSA 2RGQA 3MG3A 1B2ZA 1X1UA 3GRDA 4MJDA 3D79A 1I0XA 3EB8A 4GB5A 4DKIA 4N6OB 2CW9A 3G8ZA 4HM2B 1NB5I 1Q814 3CPW2 1RGHA 4K90B 5G2GA 4K61A 4WYKA 1Q40B 4KFFA 1T5YA 1DVCA 1W01A 5KP1A 1AVLA 1FUSA 1SPUA 1NNVA 3CC73 1ULJB 3LTDA 3UB1A 5JBSA 1MGWA 3WA3A 1LQGC 1GYBA 1LOYA 2KF5A 3CCJ3 2OTL3 2GBXB 2HMKB 1OCVA 1W6GA 2J8XB 2INXA 1YGWA 2XEPA 3ER7A 3ROBA 1BSEA 1X1WA 2F4YA 6RNTA 2C4BA 5LC6A 3CCV3 1CYUA 3WOFB 3WODG 1B2SA 4RNTA 3S28A 1JNQA 3BNBA 2JQ5A 1RN7A 2CC3A 1RRLA 3FF0A 3SYUA 1BNIA 4CCVA 3CPOA 3KE7A 1BSAA 2BMRB 2GEYA 5BIRA 2P0MA 1DMQA 5AEUB 2CFLA 1F8NA 3NBRA 3O8YA 2MC8A 2L4VA 2HMOB 5DREA 3MKIA 4N6LA 1RDSA 2IUKA 2HMLB 2XFTA 1CQSA 3FG1A 3AHWA 4TX4A 1OF5A 4ZM8A 1JBRA 1W4NA 4H3UA 3GWRA 2GU1A 4MMXB 2M7OA 1IK3A 1DVDA 3DZLA 3IMAB 1NU3A 4HKVB 1OHOA 2BHMA 4HBRA 5KP4A 1U5OA 1MGRA 3CCS3 2AADA 1W00A 2CX0A 3DGYA 3WHOA 1Q9EA 2P0XA 3S29A 1EKMA 4FCZA 1I2GA 3I563 1KQS2 1IT7A 2PZVA 1VQN3 5RNTA 6STDA 1JN5B 1K28A 2BMOB 2F5MA 1JZOA 3D5IA 4XDVA 5CLKA 5CF2A 1J2BA 2W56B 1QJGA 1OUNA 2C11A 4MMZB 1A2KA 1GY6A 1AQZA 2IY2A 2FXTA 4HM3B 3SXXA 1W2B2 3WMDA 1UI7A 3AGOA 3EHCA 5CXOA 8RNTA 3SLUA 3Q90A 4JF8A 1YJ93 1IU7A 1I2EA 3OWUA 2ML6A 1TFKA 1U8CB 1A2VA 1FGTA 2GXFA 3HX8A 3LOYA 4KFEA 1PU4A 1O7WB 1EUIC 1GMQA 2WO0A 1LOWA 5HGRA 1ROVA 1G0TA 1Z1SA 1ZO2A 1BNRA 5AYRB 3JUPA 4BU4A 1VQL3 1OPYA 1UUWB 3CNXA 4HZBB 3DGNA 5ELUA 3LTCA 1VQ43 4OK0A 1L5GB 3H3HA 1C7HA 2HMJB 7STDA 5LC7A 3V98A 2OOVC 1BNEA 1RNBA 3MSOA 5JPPA 2CG0A 1FGRA 2W2CA 1T2IA 5TGNA 4EBGA 1YJN3 3WR2A 4JRFA 2E2VA 4KFDA 4J5KA 3BNCA 3NUVA 1LOVA 3EX9A 1WMOA 2QEX3 1RHLA 5DRVA 3X3XA 1O7HB 1GOUA 1UW1A 7RNTA 2KF6A 1GOYA 1W5ZA 2XFSA 2KCDA 4IIAA 2RCDA 2CFWA 3IPTA 3DGMA 3FG3A 1STDA 2W56A 1JKGB 3AGNA 2D42A 3D3LA 1M1K4 4N6MA 5IG5A 1SIIA 4WYKB 1OHPA 3WA2X 2O9UX 3DUKA 1BGSA 4LGQA 4J9AA 1QAFA 4O3VA
chains in the Genus database with same CATH topology
3NM7A 3JUQA 1IV7A 1O7PB 3CNMA 3FLJA 3CMA3 2WOFA 3D9RA 1DYUA 3HIIA 2QA43 2OOVA 4Q53A 1OGZA 2RSXA 3T8NA 1D6UA 5IG3A 4L8OA 2CWTA 5AYSC 5STDA 2CFDA 2Y73A 1YGEA 2KXGA 2W6JH 4FMBA 4XB5A 1RKYA 4HM4B 3HI7A 3BLZA 1E3RA 1S723 3CU3A 1KSIA 1O7MB 3EN1B 3F14A 3G16A 3M8CA 3NQZA 4XDWA 4EV2A 1OF5B 5AI1A 1HKXA 3I0YA 3F7SA 5IEOA 3OV4A 3EF8A 3N8BA 4NREA 2OTJ3 2CHCA 4LZIA 3HIGA 3X3ZA 1QAKA 1JKGA 3F9SA 4J8TA 3NQYA 4EYCA 1JV2B 1DMMA 1Q824 1M9GA 3HK4A 5D83A 1HU9A 1NJI4 4EV5A 3Q2PA 3CCL3 3Q1CA 3WOEB 1D6ZA 4KZ1A 3G6E3 3X42A 3OWSA 1K734 3ECFA 3FG4A 1VQ93 1VQP3 3F8XA 1IQXA 4IPBA 4KVHA 3JUOA 5D82A 2F99A 1YIJ3 2YFLB 3VSYA 3CCQ3 3PGBA 2STDA 4X2OA 3X41A 1VQO3 3N9HA 1YIT3 3F7XA 2ZDJA 1EG9B 3EBYA 1IVWA 2CKFB 3K7CA 3N54B 4BTYA 1W6YA 3LXUX 1SIHA 1N9JA 1M1XB 2K54A 5FGOA 1OHSA 3NV0A 3PZWA 4MMYB 3CCU3 5D81A 1STFI 3LTBA 1NDOB 4H61A 2IMJA 1SQWA 3CC23 3G713 1ZX2A 2E2UA 1IVVA 2Q07A 3LT9A 2XRXB 3L0RA 2CWVA 4WFOA 3RGRA 2WGQA 1YVBI 3K9MC 1FA3A 3BNEA 1AVKA 3FCSB 1YI23 4EXRA 4N6NB 2XSHB 4FMAA 3B7CA 1MOLA 1NO3A 1OGXA 4CDLA 1BUQA 3DGLA 3OWYA 3KIIA 5KP3A 3JUNA 3AMOA 3V99A 2P38A 3CC43 1TFOA 4LSOA 5JPUA 2CWUA 2JDIH 1KD14 5AIGA 1QVF2 3LH4A 1N9EA 5CF1A 1E3VA 1FGOA 1K41A 4BTWA 4N3VA 3DM8A 3PS8A 3ALAA 1WMNA 4LEHA 3LYGA 1FGQA 2W04A 3SX1A 1JB2A 2OQEC 3EBTA 1ISKA 3S5CA 4WWUC 5IG0A 2P05A 5IG4A 3SOAA 1TUHA 1TP6A 3S27A 1YHQ3 3U1WA 2QIYA 1GD4A 1IVUA 4FCJA 2P09A 1FUWA 1IDPA 2CFGA 1K8A4 3HZPA 3KKGA 1O7NB 8CHOA 4PEJA 1N5HA 2ML5A 4L8PA 4O2HA 4HM8B 3RDEA 2IA7A 2PNCA 2F86B 5AEWB 2CG1A 1PFPA 1GY7A 3STDA 2O3OA 1VQ53 2XF3A 3PXMA 4XM4A 3UNLA 3U97A 3CME3 4HM7B 1QVG2 2XGLA 1EA2A 2QGUA 4K1VA 2IUJA 2OQEA 4R80A 4HZ9B 3DXOA 1LNHA 1UUVB 3GZBA 1VQM3 3E99A 5ELJA 3TDGA 1AR0A 2XR8B 1JJ22 1EQKA 3DY5A 1LXEA 4STDA 4G1MB 2YFJB 2CH9A 1A67A 3MYTA 2B1XB 2C10A 5AIFA 4HM5B 1QMAA 3NV0B 1JB4A 1A90A 2Z76A 3QK9A 2Z7AA 1JB5A 2HMMB 3V92A 1Q42A 3CXC2 3FF2A 3FGYA 4U13A 3CCM3 3DMCA 3LT8A 1UI8A 2WGOA 3G4S3 2KRTA 3MPHA 4O8SA 1W02A 3EC9A 4FMDA 3F40A 3NX0A 2HMNB 4N6V0 2CK3H 4R9LA 1US1A 1N5PA 4MEIA 1ASKA 2E2TA 3MWZA 3VGNA 5IENA 1SJWA 1KWIA 2LQVA 4L7KA 3AMOB 1N8R4 1CYVA 2FNQA 3KZTA 3UL5A 1IVXA 1LVNA 1RRHA 1TIJA 2W0QA 3PYJA 3CD63 4HVNA 2Y74A 3KN4A 3FKAA 1W6CA 1WQLB 2UX0A 1Q7Y4 1O7GB 4HM6B 2F98A 1Y4KA 2LYXA 2V1LA 3GZYB 2RFRA 4FMCA 1VQ63 3T0UA 3BNDA 2W03A 1GS3A 1VQ83 3J7Yd 1V74A 2ZL8A 1FGMA 4QWTA 1NWWA 3LTAA 1M904 2K0MA 1R4CA 2A15A 1GD3A 5FW5A 3K5TA 1IT8A 3SVAA 4XBYA 2BT3A 3SOYA 3BB9A 4HM1B 3SEDA 1WTHA 3CCE3 3EE1A 2XH9A 3B4PA 4BTXA 3MG2A 5EQLA 1MNLA 3IJEB 4R1KA 4AEQA 5A0OB 5I97A 4FR9A 4NHFA 3A76A 4R9KA 3UJMA 1OACA 3F8HA 5CK6A 3CCR3 4OUQA 3OX9A 2Z77A 1Q40A 2W9QA 1NB3I 2FGTA 4RBNA 3GAXA 1RJOA 2YFIB 2OWPA 3KSED 3NXJA 1S5AA 4HJLB 1IV9A 1W7CA 5IERA 4OVMA 3I553 4WP5A 3OW22 2BO9B 2YX9A 3NBBA 3K0ZA 2BMQB 3RGAA 4FCMA 4EC6A 1ROAA 2CFKA 2Z6BA 1N8QA 2BNGA 3DGOA 3JUMA 2CIUA 3X40A 1WNHA 3VF1A 3K63A 3JVCA 1VZZA 4RNYA 3EN8A 1AV4A 3S67A 1D6YA 4HM0B 3T8UA 3NM2A 1YJW3 1IQ8A 2MF7A 4HYZA 3UL6A 3OXAA 1W2ZA 3FSDA 3NBJA 4O02B 3EJVA 3LZAA 5IEPA 5EVHA 1JRQA 3B4OA 3GZRA 4IT7A 1ULIB 4AKYA 4AKZA 3MG1A 1VQ73 5EEOA 1IQYA 5AIHA 5BXQA 2R4IA 3QRDA 5AIIA 1OH0A 1E97A 2XSOB 4LMIA 3PCSA 3LMLA 4XBXA 4N6TA 1JN5A 1WMPA 2GU3A 4I4KA 3KFQC 1VQK3 2WOHA 3X3YA 1KC84 3MHEA 4RZMA 4ORLA 5IW9A 5BVBA 2OCTA 1G96A 4R4KA 2GBWB 3PCRA 3GZXB 2GEXA 3KSPA 2B24B 4XBTA 4X2HA 1Q864 4RNZA 3G0KA 1QALA 4WHAA 4K1UA 2D1WA 3NHXA 4N6UA 3WDGB 3H51A 3B8LA 3EQQB 1K9M4 5IF6A 2I9WA 1TU5A 2XGNA 1DMNA 3FZWA 2SBLA 1GY5A 2W9PA 3FH1A 1CEWI 4GL6A 1LOXA 2RGQA 3MG3A 3GRDA 4MJDA 3EB8A 4GB5A 4N6OB 2CW9A 3G8ZA 4HM2B 1NB5I 1Q814 3CPW2 4K90B 5G2GA 4K61A 4WYKA 1Q40B 4KFFA 1T5YA 1DVCA 1W01A 5KP1A 1AVLA 1SPUA 3CC73 1ULJB 3LTDA 3UB1A 5JBSA 3WA3A 1GYBA 3CCJ3 2OTL3 2GBXB 2HMKB 1OCVA 1W6GA 2XEPA 2INXA 3ER7A 3ROBA 5LC6A 3CCV3 1CYUA 3WOFB 3WODG 3S28A 1JNQA 3BNBA 2JQ5A 1RN7A 2CC3A 1RRLA 3FF0A 4CCVA 3CPOA 3KE7A 2BMRB 2GEYA 2P0MA 1DMQA 5AEUB 2CFLA 1F8NA 3NBRA 3O8YA 2MC8A 2L4VA 2HMOB 5DREA 3MKIA 4N6LA 4TX4A 2IUKA 2HMLB 2XFTA 1CQSA 3FG1A 4ZM8A 1OF5A 1W4NA 4H3UA 3GWRA 2GU1A 4MMXB 2M7OA 1IK3A 1DVDA 3DZLA 3IMAB 1NU3A 4HKVB 1OHOA 2BHMA 4HBRA 5KP4A 1U5OA 3CCS3 1W00A 2P0XA 3S29A 1EKMA 4FCZA 1KQS2 3I563 1IT7A 2PZVA 1VQN3 6STDA 1JN5B 1K28A 2BMOB 4XDVA 5CLKA 5CF2A 1J2BA 2W56B 1QJGA 1OUNA 2C11A 4MMZB 1A2KA 1GY6A 4HM3B 2FXTA 3SXXA 1W2B2 3WMDA 1UI7A 3EHCA 5CXOA 3SLUA 3Q90A 4JF8A 1YJ93 1IU7A 3OWUA 2ML6A 1TFKA 1U8CB 1A2VA 1FGTA 2GXFA 3HX8A 3LOYA 4KFEA 1PU4A 1O7WB 2WO0A 5HGRA 1ROVA 1Z1SA 1ZO2A 5AYRB 3JUPA 1VQL3 1OPYA 1UUWB 3CNXA 4HZBB 3DGNA 5ELUA 3LTCA 1VQ43 4OK0A 1L5GB 3H3HA 1C7HA 2HMJB 7STDA 5LC7A 3V98A 2OOVC 3MSOA 5JPPA 2CG0A 1FGRA 2W2CA 5TGNA 4EBGA 1YJN3 4JRFA 2E2VA 4KFDA 3BNCA 3NUVA 3EX9A 1WMOA 2QEX3 5DRVA 3X3XA 1O7HB 1UW1A 1W5ZA 2XFSA 2KCDA 4IIAA 2RCDA 2CFWA 3IPTA 3DGMA 3FG3A 1STDA 2W56A 1JKGB 2D42A 3D3LA 1M1K4 4N6MA 5IG5A 1SIIA 4WYKB 1OHPA 3WA2X 2O9UX 3DUKA 4LGQA 4J9AA 1QAFA 4O3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUQ A;  1O7P B;  3CNM A;  3FLJ A;  3D9R A;  4Q53 A;  1OGZ A;  3T8N A;  5IG3 A;  4L8O A;  5STD A;  4XB5 A;  4HM4 B;  3BLZ A;  1E3R A;  3CU3 A;  3G16 A;  1O7M B;  3EN1 B;  3F14 A;  3M8C A;  4XDW A;  1OF5 B;  5AI1 A;  1HKX A;  3I0Y A;  3F7S A;  5IEO A;  3OV4 A;  3EF8 A;  2CHC A;  1JKG A;  3F9S A;  4J8T A;  1DMM A;  3HK4 A;  5D83 A;  3OWS A;  3ECF A;  3F8X A;  4KVH A;  3JUO A;  5D82 A;  2F99 A;  2YFL B;  3VSY A;  2STD A;  4X2O A;  3F7X A;  1EG9 B;  3EBY A;  2CKF B;  3K7C A;  1W6Y A;  2K54 A;  1OHS A;  3NV0 A;  5D81 A;  1NDO B;  2IMJ A;  1ZX2 A;  2XRX B;  3RGR A;  2XSH B;  3B7C A;  1BUQ A;  4CDL A;  1OGX A;  3OWY A;  5KP3 A;  3JUN A;  5JPU A;  5AIG A;  5CF1 A;  1E3V A;  1K41 A;  4N3V A;  3DM8 A;  4LEH A;  3LYG A;  1JB2 A;  3EBT A;  1ISK A;  3S5C A;  4WWU C;  5IG0 A;  5IG4 A;  3SOA A;  1TUH A;  1TP6 A;  2QIY A;  4FCJ A;  1IDP A;  3HZP A;  3KKG A;  1O7N B;  8CHO A;  4PEJ A;  4L8P A;  4HM8 B;  2F86 B;  5AEW B;  1GY7 A;  3STD A;  4XM4 A;  3UNL A;  4HM7 B;  4K1V A;  1EA2 A;  2QGU A;  4HZ9 B;  3DXO A;  1UUV B;  3GZB A;  3E99 A;  1AR0 A;  2XR8 B;  4STD A;  2YFJ B;  3MYT A;  2B1X B;  5AIF A;  4HM5 B;  1QMA A;  3NV0 B;  1JB4 A;  2Z76 A;  2Z7A A;  1JB5 A;  2HMM B;  1Q42 A;  3FF2 A;  3FGY A;  4U13 A;  3DMC A;  1W02 A;  3EC9 A;  3F40 A;  2HMN B;  4R9L A;  1ASK A;  3VGN A;  5IEN A;  1SJW A;  4L7K A;  3KZT A;  4HVN A;  3FKA A;  1WQL B;  2UX0 A;  1O7G B;  4HM6 B;  2F98 A;  3GZY B;  2RFR A;  1GS3 A;  1NWW A;  2A15 A;  5FW5 A;  4XBY A;  3SOY A;  3BB9 A;  4HM1 B;  3SED A;  3B4P A;  3MG2 A;  4R1K A;  3A76 A;  4R9K A;  3UJM A;  3F8H A;  5CK6 A;  4OUQ A;  3OX9 A;  2Z77 A;  1Q40 A;  5IER A;  2YFI B;  2OWP A;  3NXJ A;  1S5A A;  4HJL B;  4OVM A;  4WP5 A;  3K0Z A;  2BMQ B;  3RGA A;  4FCM A;  2BNG A;  3JUM A;  1VZZ A;  3EN8 A;  4HM0 B;  3T8U A;  3NM2 A;  3OXA A;  3FSD A;  3EJV A;  3LZA A;  5IEP A;  5EVH A;  3B4O A;  3GZR A;  1ULI B;  3MG1 A;  5AIH A;  5BXQ A;  2R4I A;  5AII A;  1OH0 A;  1E97 A;  2XSO B;  4LMI A;  4XBX A;  1JN5 A;  4I4K A;  3MHE A;  4RZM A;  4ORL A;  5BVB A;  2GBW B;  3GZX B;  2GEX A;  3KSP A;  2B24 B;  4XBT A;  4X2H A;  3G0K A;  4K1U A;  3NHX A;  3H51 A;  3B8L A;  3EQQ B;  5IF6 A;  2I9W A;  1DMN A;  3FZW A;  1GY5 A;  3FH1 A;  2RGQ A;  3MG3 A;  3GRD A;  4MJD A;  4GB5 A;  3G8Z A;  4HM2 B;  5G2G A;  4WYK A;  1Q40 B;  1W01 A;  5KP1 A;  1ULJ B;  1GYB A;  2GBX B;  2HMK B;  1OCV A;  2INX A;  3ER7 A;  3ROB A;  2JQ5 A;  3FF0 A;  3CPO A;  3KE7 A;  2BMR B;  2GEY A;  1DMQ A;  5AEU B;  3NBR A;  2HMO B;  5DRE A;  3MKI A;  2HML B;  1CQS A;  1OF5 A;  4H3U A;  3GWR A;  3DZL A;  1NU3 A;  4HKV B;  1OHO A;  5KP4 A;  1U5O A;  1W00 A;  2PZV A;  6STD A;  1JN5 B;  2BMO B;  4XDV A;  5CF2 A;  5CLK A;  1QJG A;  1OUN A;  1A2K A;  1GY6 A;  4HM3 B;  3WMD A;  3EHC A;  5CXO A;  3Q90 A;  3OWU A;  2GXF A;  3HX8 A;  1O7W B;  5HGR A;  1Z1S A;  1ZO2 A;  3JUP A;  1OPY A;  1UUW B;  3CNX A;  4HZB B;  3H3H A;  1C7H A;  2HMJ B;  7STD A;  3MSO A;  5JPP A;  2W2C A;  5TGN A;  3NUV A;  3EX9 A;  5DRV A;  1O7H B;  4IIA A;  2RCD A;  3IPT A;  1STD A;  1JKG B;  5IG5 A;  4WYK B;  1OHP A;  3DUK A;  4LGQ A;  4J9A A; 
#chains in the Genus database with same CATH topology
 1UCJ A;  1I70 A;  3NM7 A;  3JUQ A;  1IV7 A;  1O7P B;  3CNM A;  3FLJ A;  3CMA 3;  2WOF A;  1GOV A;  1DYU A;  3D9R A;  3HII A;  2QA4 3;  2OOV A;  4Q53 A;  1OGZ A;  2RSX A;  3T8N A;  1D6U A;  5IG3 A;  4L8O A;  2CWT A;  1PYL A;  5AYS C;  4BL3 A;  1BNS A;  5STD A;  2CFD A;  2Y73 A;  1YGE A;  2KXG A;  2W6J H;  1IYY A;  4FMB A;  4XB5 A;  1RKY A;  4HM4 B;  3HI7 A;  3BLZ A;  1E3R A;  6GSP A;  3CU3 A;  1S72 3;  1BNF A;  1KSI A;  1O7M B;  3EN1 B;  3F14 A;  3G16 A;  3M8C A;  3NQZ A;  4XDW A;  4EV2 A;  1OF5 B;  5AI1 A;  1HKX A;  1DET A;  3I0Y A;  3F7S A;  5IEO A;  3OV4 A;  3EF8 A;  3N8B A;  4NRE A;  3I55 3;  2CHC A;  4LZI A;  3HIG A;  1RGK A;  1QAK A;  3X3Z A;  2OTJ 3;  1JKG A;  3F9S A;  1GMP A;  1RGA A;  5G1K A;  4J8T A;  3NQY A;  2H0I A;  4EYC A;  1JV2 B;  4NPB A;  1DMM A;  2CX1 A;  4GSP A;  1Q82 4;  1M9G A;  1HYF A;  3HK4 A;  3RNT A;  5D83 A;  1HU9 A;  1NJI 4;  4EV5 A;  3Q2P A;  3CCL 3;  1RSN A;  3A5E A;  3Q1C A;  3WOE B;  1D6Z A;  4KZ1 A;  3G6E 3;  3X42 A;  3OWS A;  4BIR A;  1K73 4;  3ECF A;  2F56 A;  3FG4 A;  1VQ9 3;  2ZA4 A;  1VQP 3;  1LRA A;  3F8X A;  1IQX A;  4IPB A;  4KVH A;  3JUO A;  3GSP A;  5D82 A;  2F99 A;  1YIJ 3;  2YFL B;  3VSY A;  3CCQ 3;  1RGE A;  3PGB A;  1TTO A;  2STD A;  4X2O A;  3X41 A;  1VQO 3;  3N9H A;  1YIT 3;  3F7X A;  2ZDJ A;  1EG9 B;  3EBY A;  1IVW A;  2CKF B;  1YNV X;  2GSP A;  1BSC A;  3K7C A;  2ZHX B;  1MWS A;  1W6Y A;  3N54 B;  1I8V A;  1SIH A;  1N9J A;  1M1X B;  2K54 A;  3LXU X;  5FGO A;  1OHS A;  3NV0 A;  3PZW A;  4MMY B;  3CCU 3;  5D81 A;  1STF I;  3LTB A;  1NDO B;  1X1Y A;  4H61 A;  2IMJ A;  1SQW A;  3CC2 3;  3G71 3;  1C54 A;  1MWR A;  1ZX2 A;  2E2U A;  1IVV A;  2Q07 A;  3LT9 A;  5GSP A;  2XRX B;  3L0R A;  2CWV A;  4WFO A;  3RGR A;  1I0V A;  1YVB I;  2WGQ A;  3K9M C;  1FA3 A;  3BNE A;  1RCK A;  2SAR A;  1AVK A;  4ILF A;  3FCS B;  1YI2 3;  4EXR A;  4N6N B;  2XSH B;  4FMA A;  3B7C A;  4CJN A;  1BAN A;  1MOL A;  1NO3 A;  1OGX A;  4CDL A;  1BUQ A;  3DGL A;  3OWY A;  3KII A;  5KP3 A;  3JUN A;  3AMO A;  3V99 A;  2P38 A;  3CC4 3;  1TFO A;  1UDI I;  4LSO A;  5JPU A;  2CWU A;  2JDI H;  1KD1 4;  5AIG A;  1RNT A;  1QVF 2;  3LH4 A;  1N9E A;  1JZD A;  5CF1 A;  1E3V A;  1FGO A;  1K41 A;  4BTW A;  4N3V A;  3DM8 A;  3PS8 A;  5M1A A;  1RMS A;  1TRQ A;  1WMN A;  3ALA A;  4LEH A;  1CH0 A;  3LYG A;  1FGQ A;  3D4A A;  2W04 A;  2RNT A;  3SX1 A;  1JB2 A;  2BU4 A;  2OQE C;  3EBT A;  3KCH A;  1ISK A;  3S5C A;  1V57 A;  4WWU C;  5IG0 A;  2P05 A;  5IG4 A;  3SOA A;  1TUH A;  1B20 A;  5BU4 A;  1TP6 A;  2IYJ A;  3S27 A;  3U1W A;  5HOH A;  2QIY A;  1GD4 A;  1YHQ 3;  1IVU A;  4FCJ A;  1BSD A;  4GHO A;  2P09 A;  1FUW A;  1IDP A;  1ZGX A;  2CFG A;  1K8A 4;  3HZP A;  3KKG A;  1O7N B;  8CHO A;  1I3F A;  4PEJ A;  1N5H A;  2ML5 A;  4L8P A;  4O2H A;  4HM8 B;  3RDE A;  1A2P A;  2IA7 A;  1Q7H A;  2PNC A;  2F86 B;  5AEW B;  3ZFZ A;  2CG1 A;  1PFP A;  1GY7 A;  3STD A;  2O3O A;  1VQ5 3;  2XF3 A;  3PXM A;  1UCL A;  4XM4 A;  3UNL A;  3U97 A;  3CME 3;  4HM7 B;  1QVG 2;  2XGL A;  1EA2 A;  2QGU A;  4K1V A;  2IUJ A;  2OQE A;  4R80 A;  4HZ9 B;  4BL2 A;  3DXO A;  4I5Q A;  1LNH A;  1UUV B;  2R41 A;  3GZB A;  1VQM 3;  1BNJ A;  3DH2 A;  3E99 A;  5ELJ A;  3TDG A;  1MWT A;  1AR0 A;  1DE3 A;  1RGC A;  2XR8 B;  1JJ2 2;  1EQK A;  3DY5 A;  1LXE A;  5M19 A;  4STD A;  4G1M B;  2KAA A;  2YFJ B;  1BAO A;  2CH9 A;  1TRP A;  1A67 A;  3MYT A;  2B1X B;  2C10 A;  5AIF A;  4HM5 B;  1T2H A;  1QMA A;  1LNI A;  3NV0 B;  1JB4 A;  1A90 A;  2Z76 A;  3QK9 A;  2Z7A A;  1AY7 A;  1JB5 A;  1RGF A;  2HMM B;  3V92 A;  1Q42 A;  3CXC 2;  3FF2 A;  3FGY A;  4U13 A;  3CCM 3;  3DMC A;  3LT8 A;  1UI8 A;  2WGO A;  3G4S 3;  2KRT A;  3MPH A;  4O8S A;  1W02 A;  1BVI A;  3EC9 A;  4FMD A;  1JBS A;  3F40 A;  3NX0 A;  2HMN B;  4N6V 0;  1I2F A;  1VQQ A;  4KT3 B;  2CK3 H;  4R9L A;  1US1 A;  1N5P A;  4LYL B;  4MEI A;  1ASK A;  2E2T A;  3MWZ A;  3VGN A;  5IEN A;  1SJW A;  1BSB A;  1KWI A;  2LQV A;  4L7K A;  3AMO B;  1N8R 4;  1MWU A;  1CYV A;  1TJD A;  3URP A;  2FNQ A;  1FYS A;  3KZT A;  1UUG B;  3UL5 A;  1UCI A;  1IVX A;  1LVN A;  1RRH A;  1TIJ A;  2W0Q A;  3D5G A;  1BRJ A;  3PYJ A;  3CD6 3;  4HVN A;  2Y74 A;  3KN4 A;  3FKA A;  1W6C A;  1WQL B;  2UX0 A;  1Q7Y 4;  1B21 A;  2F5W A;  1O7G B;  2K3D A;  4HM6 B;  2F98 A;  1Y4K A;  2LYX A;  2V1L A;  3GZY B;  2RFR A;  3HOH A;  4FMC A;  1VQ6 3;  1G02 A;  3T0U A;  1BNG A;  2BIR A;  1BRH A;  3BND A;  2W03 A;  1GS3 A;  1VQ8 3;  3J7Y d;  1B2X A;  1BRK A;  1V74 A;  2ZL8 A;  1FGM A;  4QWT A;  1NWW A;  3LTA A;  1M90 4;  4CPK A;  1JBT A;  2K0M A;  1LQM B;  1R4C A;  2A15 A;  1GD3 A;  5FW5 A;  3K5T A;  1T3B A;  1IT8 A;  3SVA A;  4XBY A;  4HOH A;  2BT3 A;  3SOY A;  3BB9 A;  4HM1 B;  3SED A;  1WTH A;  3CCE 3;  3EE1 A;  2XH9 A;  3B4P A;  4BTX A;  3MG2 A;  5EQL A;  1MNL A;  3IJE B;  4R1K A;  4AEQ A;  5A0O B;  5I97 A;  4FR9 A;  4NHF A;  3A76 A;  4R9K A;  3UJM A;  1OAC A;  3F8H A;  5CK6 A;  1B3S A;  3CCR 3;  4J5G A;  9RNT A;  4OUQ A;  3OX9 A;  1R4Y A;  2Z77 A;  1Q40 A;  2W9Q A;  1NB3 I;  2FGT A;  4RBN A;  2RBI A;  1RJO A;  2YFI B;  2OWP A;  3GAX A;  2UGI A;  1S5A A;  3KSE D;  1IV9 A;  1W7C A;  3NXJ A;  4HJL B;  4OVM A;  1GMR A;  4WP5 A;  3OW2 2;  1UGH I;  2BO9 B;  2YX9 A;  3NBB A;  1BRI A;  3K0Z A;  1RCL A;  2UUG C;  2BMQ B;  1FUT A;  3RGA A;  1RGL A;  4FCM A;  1BOX A;  4EC6 A;  1ROA A;  2CFK A;  3Q3F A;  1ZS7 A;  4HAA A;  2Z6B A;  1N8Q A;  2BNG A;  1RGG A;  3DGO A;  2L1S A;  3JUM A;  2CIU A;  3X40 A;  1WNH A;  1RN4 A;  3VF1 A;  3K63 A;  3ZG5 A;  3JVC A;  1VZZ A;  4RNY A;  3EN8 A;  2KF3 A;  1AV4 A;  3S67 A;  1D6Y A;  4HM0 B;  3T8U A;  3NM2 A;  1YJW 3;  5M18 A;  1IQ8 A;  2MF7 A;  4HYZ A;  1I3I A;  3OXA A;  1W2Z A;  3FSD A;  3NBJ A;  3UL6 A;  4O02 B;  3EJV A;  3LZA A;  5IEP A;  5EVH A;  1JRQ A;  3B4O A;  3GZR A;  1GSP A;  1ULI B;  4IT7 A;  4AKZ A;  3MG1 A;  4AKY A;  5EEO A;  1IQY A;  1VQ7 3;  5AIH A;  5BXQ A;  2R4I A;  2HOH A;  3QRD A;  3BU4 A;  5AII A;  1OH0 A;  1YVS A;  1E97 A;  2XSO B;  4LMI A;  2AAE A;  3PCS A;  4EW5 A;  3LML A;  4XBX A;  1B27 A;  4N6T A;  1JN5 A;  1RN1 A;  1WMP A;  2GU3 A;  3KFQ C;  4I4K A;  5IER A;  1VQK 3;  1FW7 A;  2WOH A;  1PY3 A;  3X3Y A;  3MHE A;  1KC8 4;  1RLS A;  4RZM A;  4ORL A;  5IW9 A;  5BVB A;  2OCT A;  1G96 A;  4R4K A;  2GBW B;  1BRG A;  3PCR A;  3GZX B;  2GEX A;  1HZ1 A;  1BRN L;  3KSP A;  2B24 B;  4XBT A;  3ZG0 A;  4X2H A;  7GSP A;  1Q86 4;  1V58 A;  4RNZ A;  2H0H A;  3G0K A;  1RTU A;  1UCK A;  1SAR A;  1QAL A;  4WHA A;  4K1U A;  1EEJ A;  2D1W A;  3AHS A;  3NHX A;  4N6U A;  1B2M A;  3WDG B;  3H51 A;  3B8L A;  1UGI A;  3EQQ B;  4BTY A;  1K9M 4;  5IF6 A;  1BIR A;  2I9W A;  1TU5 A;  2XGN A;  1DMN A;  1B2U A;  1FZU A;  3BIR A;  3FZW A;  5G1L A;  2SBL A;  2H0G A;  1GY5 A;  1X1X A;  2W9P A;  3FH1 A;  1BU4 A;  1BUJ A;  1CEW I;  2KF4 A;  4GL6 A;  1LOX A;  1BRS A;  2RGQ A;  3MG3 A;  1B2Z A;  1X1U A;  3GRD A;  4MJD A;  3D79 A;  1I0X A;  3EB8 A;  4GB5 A;  4DKI A;  4N6O B;  2CW9 A;  3G8Z A;  4HM2 B;  1NB5 I;  1Q81 4;  3CPW 2;  1RGH A;  4K90 B;  5G2G A;  4K61 A;  4WYK A;  1Q40 B;  4KFF A;  1T5Y A;  1DVC A;  1W01 A;  5KP1 A;  1AVL A;  1FUS A;  1SPU A;  1NNV A;  3CC7 3;  1ULJ B;  3LTD A;  3UB1 A;  5JBS A;  1MGW A;  3WA3 A;  1LQG C;  1GYB A;  1LOY A;  2KF5 A;  3CCJ 3;  2OTL 3;  2GBX B;  2HMK B;  1OCV A;  1W6G A;  2J8X B;  2INX A;  1YGW A;  2XEP A;  3ER7 A;  3ROB A;  1BSE A;  1X1W A;  2F4Y A;  6RNT A;  2C4B A;  5LC6 A;  3CCV 3;  1CYU A;  3WOF B;  3WOD G;  1B2S A;  4RNT A;  3S28 A;  1JNQ A;  3BNB A;  2JQ5 A;  1RN7 A;  2CC3 A;  1RRL A;  3FF0 A;  3SYU A;  1BNI A;  4CCV A;  3CPO A;  3KE7 A;  1BSA A;  2BMR B;  2GEY A;  5BIR A;  2P0M A;  1DMQ A;  5AEU B;  2CFL A;  1F8N A;  3NBR A;  3O8Y A;  2MC8 A;  2L4V A;  2HMO B;  5DRE A;  3MKI A;  4N6L A;  1RDS A;  2IUK A;  2HML B;  2XFT A;  1CQS A;  3FG1 A;  3AHW A;  4TX4 A;  1OF5 A;  4ZM8 A;  1JBR A;  1W4N A;  4H3U A;  3GWR A;  2GU1 A;  4MMX B;  2M7O A;  1IK3 A;  1DVD A;  3DZL A;  3IMA B;  1NU3 A;  4HKV B;  1OHO A;  2BHM A;  4HBR A;  5KP4 A;  1U5O A;  1MGR A;  3CCS 3;  2AAD A;  1W00 A;  2CX0 A;  3DGY A;  3WHO A;  1Q9E A;  2P0X A;  3S29 A;  1EKM A;  4FCZ A;  1I2G A;  3I56 3;  1KQS 2;  1IT7 A;  2PZV A;  1VQN 3;  5RNT A;  6STD A;  1JN5 B;  1K28 A;  2BMO B;  2F5M A;  1JZO A;  3D5I A;  4XDV A;  5CLK A;  5CF2 A;  1J2B A;  2W56 B;  1QJG A;  1OUN A;  2C11 A;  4MMZ B;  1A2K A;  1GY6 A;  1AQZ A;  2IY2 A;  2FXT A;  4HM3 B;  3SXX A;  1W2B 2;  3WMD A;  1UI7 A;  3AGO A;  3EHC A;  5CXO A;  8RNT A;  3SLU A;  3Q90 A;  4JF8 A;  1YJ9 3;  1IU7 A;  1I2E A;  3OWU A;  2ML6 A;  1TFK A;  1U8C B;  1A2V A;  1FGT A;  2GXF A;  3HX8 A;  3LOY A;  4KFE A;  1PU4 A;  1O7W B;  1EUI C;  1GMQ A;  2WO0 A;  1LOW A;  5HGR A;  1ROV A;  1G0T A;  1Z1S A;  1ZO2 A;  1BNR A;  5AYR B;  3JUP A;  4BU4 A;  1VQL 3;  1OPY A;  1UUW B;  3CNX A;  4HZB B;  3DGN A;  5ELU A;  3LTC A;  1VQ4 3;  4OK0 A;  1L5G B;  3H3H A;  1C7H A;  2HMJ B;  7STD A;  5LC7 A;  3V98 A;  2OOV C;  1BNE A;  1RNB A;  3MSO A;  5JPP A;  2CG0 A;  1FGR A;  2W2C A;  1T2I A;  5TGN A;  4EBG A;  1YJN 3;  3WR2 A;  4JRF A;  2E2V A;  4KFD A;  4J5K A;  3BNC A;  3NUV A;  1LOV A;  3EX9 A;  1WMO A;  2QEX 3;  1RHL A;  5DRV A;  3X3X A;  1O7H B;  1GOU A;  1UW1 A;  7RNT A;  2KF6 A;  1GOY A;  1W5Z A;  2XFS A;  2KCD A;  4IIA A;  2RCD A;  2CFW A;  3IPT A;  3DGM A;  3FG3 A;  1STD A;  2W56 A;  1JKG B;  3AGN A;  2D42 A;  3D3L A;  1M1K 4;  4N6M A;  5IG5 A;  1SII A;  4WYK B;  1OHP A;  3WA2 X;  2O9U X;  3DUK A;  1BGS A;  4LGQ A;  4J9A A;  1QAF A;  4O3V A; 
#chains in the Genus database with same CATH homology
 3NM7 A;  3JUQ A;  1IV7 A;  1O7P B;  3CNM A;  3FLJ A;  3CMA 3;  2WOF A;  3D9R A;  1DYU A;  3HII A;  2QA4 3;  2OOV A;  4Q53 A;  1OGZ A;  2RSX A;  3T8N A;  1D6U A;  5IG3 A;  4L8O A;  2CWT A;  5AYS C;  5STD A;  2CFD A;  2Y73 A;  1YGE A;  2KXG A;  2W6J H;  4FMB A;  4XB5 A;  1RKY A;  4HM4 B;  3HI7 A;  3BLZ A;  1E3R A;  1S72 3;  3CU3 A;  1KSI A;  1O7M B;  3EN1 B;  3F14 A;  3G16 A;  3M8C A;  3NQZ A;  4XDW A;  4EV2 A;  1OF5 B;  5AI1 A;  1HKX A;  3I0Y A;  3F7S A;  5IEO A;  3OV4 A;  3EF8 A;  3N8B A;  4NRE A;  2OTJ 3;  2CHC A;  4LZI A;  3HIG A;  3X3Z A;  1QAK A;  1JKG A;  3F9S A;  4J8T A;  3NQY A;  4EYC A;  1JV2 B;  1DMM A;  1Q82 4;  1M9G A;  3HK4 A;  5D83 A;  1HU9 A;  1NJI 4;  4EV5 A;  3Q2P A;  3CCL 3;  3Q1C A;  3WOE B;  1D6Z A;  4KZ1 A;  3G6E 3;  3X42 A;  3OWS A;  1K73 4;  3ECF A;  3FG4 A;  1VQ9 3;  1VQP 3;  3F8X A;  1IQX A;  4IPB A;  4KVH A;  3JUO A;  5D82 A;  2F99 A;  1YIJ 3;  2YFL B;  3VSY A;  3CCQ 3;  3PGB A;  2STD A;  4X2O A;  3X41 A;  1VQO 3;  3N9H A;  1YIT 3;  3F7X A;  2ZDJ A;  1EG9 B;  3EBY A;  1IVW A;  2CKF B;  3K7C A;  3N54 B;  4BTY A;  1W6Y A;  3LXU X;  1SIH A;  1N9J A;  1M1X B;  2K54 A;  5FGO A;  1OHS A;  3NV0 A;  3PZW A;  4MMY B;  3CCU 3;  5D81 A;  1STF I;  3LTB A;  1NDO B;  4H61 A;  2IMJ A;  1SQW A;  3CC2 3;  3G71 3;  1ZX2 A;  2E2U A;  1IVV A;  2Q07 A;  3LT9 A;  2XRX B;  3L0R A;  2CWV A;  4WFO A;  3RGR A;  2WGQ A;  1YVB I;  3K9M C;  1FA3 A;  3BNE A;  1AVK A;  3FCS B;  1YI2 3;  4EXR A;  4N6N B;  2XSH B;  4FMA A;  3B7C A;  1MOL A;  1NO3 A;  1OGX A;  4CDL A;  1BUQ A;  3DGL A;  3OWY A;  3KII A;  5KP3 A;  3JUN A;  3AMO A;  3V99 A;  2P38 A;  3CC4 3;  1TFO A;  4LSO A;  5JPU A;  2CWU A;  2JDI H;  1KD1 4;  5AIG A;  1QVF 2;  3LH4 A;  1N9E A;  5CF1 A;  1E3V A;  1FGO A;  1K41 A;  4BTW A;  4N3V A;  3DM8 A;  3PS8 A;  3ALA A;  1WMN A;  4LEH A;  3LYG A;  1FGQ A;  2W04 A;  3SX1 A;  1JB2 A;  2OQE C;  3EBT A;  1ISK A;  3S5C A;  4WWU C;  5IG0 A;  2P05 A;  5IG4 A;  3SOA A;  1TUH A;  1TP6 A;  3S27 A;  1YHQ 3;  3U1W A;  2QIY A;  1GD4 A;  1IVU A;  4FCJ A;  2P09 A;  1FUW A;  1IDP A;  2CFG A;  1K8A 4;  3HZP A;  3KKG A;  1O7N B;  8CHO A;  4PEJ A;  1N5H A;  2ML5 A;  4L8P A;  4O2H A;  4HM8 B;  3RDE A;  2IA7 A;  2PNC A;  2F86 B;  5AEW B;  2CG1 A;  1PFP A;  1GY7 A;  3STD A;  2O3O A;  1VQ5 3;  2XF3 A;  3PXM A;  4XM4 A;  3UNL A;  3U97 A;  3CME 3;  4HM7 B;  1QVG 2;  2XGL A;  1EA2 A;  2QGU A;  4K1V A;  2IUJ A;  2OQE A;  4R80 A;  4HZ9 B;  3DXO A;  1LNH A;  1UUV B;  3GZB A;  1VQM 3;  3E99 A;  5ELJ A;  3TDG A;  1AR0 A;  2XR8 B;  1JJ2 2;  1EQK A;  3DY5 A;  1LXE A;  4STD A;  4G1M B;  2YFJ B;  2CH9 A;  1A67 A;  3MYT A;  2B1X B;  2C10 A;  5AIF A;  4HM5 B;  1QMA A;  3NV0 B;  1JB4 A;  1A90 A;  2Z76 A;  3QK9 A;  2Z7A A;  1JB5 A;  2HMM B;  3V92 A;  1Q42 A;  3CXC 2;  3FF2 A;  3FGY A;  4U13 A;  3CCM 3;  3DMC A;  3LT8 A;  1UI8 A;  2WGO A;  3G4S 3;  2KRT A;  3MPH A;  4O8S A;  1W02 A;  3EC9 A;  4FMD A;  3F40 A;  3NX0 A;  2HMN B;  4N6V 0;  2CK3 H;  4R9L A;  1US1 A;  1N5P A;  4MEI A;  1ASK A;  2E2T A;  3MWZ A;  3VGN A;  5IEN A;  1SJW A;  1KWI A;  2LQV A;  4L7K A;  3AMO B;  1N8R 4;  1CYV A;  2FNQ A;  3KZT A;  3UL5 A;  1IVX A;  1LVN A;  1RRH A;  1TIJ A;  2W0Q A;  3PYJ A;  3CD6 3;  4HVN A;  2Y74 A;  3KN4 A;  3FKA A;  1W6C A;  1WQL B;  2UX0 A;  1Q7Y 4;  1O7G B;  4HM6 B;  2F98 A;  1Y4K A;  2LYX A;  2V1L A;  3GZY B;  2RFR A;  4FMC A;  1VQ6 3;  3T0U A;  3BND A;  2W03 A;  1GS3 A;  1VQ8 3;  3J7Y d;  1V74 A;  2ZL8 A;  1FGM A;  4QWT A;  1NWW A;  3LTA A;  1M90 4;  2K0M A;  1R4C A;  2A15 A;  1GD3 A;  5FW5 A;  3K5T A;  1IT8 A;  3SVA A;  4XBY A;  2BT3 A;  3SOY A;  3BB9 A;  4HM1 B;  3SED A;  1WTH A;  3CCE 3;  3EE1 A;  2XH9 A;  3B4P A;  4BTX A;  3MG2 A;  5EQL A;  1MNL A;  3IJE B;  4R1K A;  4AEQ A;  5A0O B;  5I97 A;  4FR9 A;  4NHF A;  3A76 A;  4R9K A;  3UJM A;  1OAC A;  3F8H A;  5CK6 A;  3CCR 3;  4OUQ A;  3OX9 A;  2Z77 A;  1Q40 A;  2W9Q A;  1NB3 I;  2FGT A;  4RBN A;  3GAX A;  1RJO A;  2YFI B;  2OWP A;  3KSE D;  3NXJ A;  1S5A A;  4HJL B;  1IV9 A;  1W7C A;  5IER A;  4OVM A;  3I55 3;  4WP5 A;  3OW2 2;  2BO9 B;  2YX9 A;  3NBB A;  3K0Z A;  2BMQ B;  3RGA A;  4FCM A;  4EC6 A;  1ROA A;  2CFK A;  2Z6B A;  1N8Q A;  2BNG A;  3DGO A;  3JUM A;  2CIU A;  3X40 A;  1WNH A;  3VF1 A;  3K63 A;  3JVC A;  1VZZ A;  4RNY A;  3EN8 A;  1AV4 A;  3S67 A;  1D6Y A;  4HM0 B;  3T8U A;  3NM2 A;  1YJW 3;  1IQ8 A;  2MF7 A;  4HYZ A;  3UL6 A;  3OXA A;  1W2Z A;  3FSD A;  3NBJ A;  4O02 B;  3EJV A;  3LZA A;  5IEP A;  5EVH A;  1JRQ A;  3B4O A;  3GZR A;  4IT7 A;  1ULI B;  4AKY A;  4AKZ A;  3MG1 A;  1VQ7 3;  5EEO A;  1IQY A;  5AIH A;  5BXQ A;  2R4I A;  3QRD A;  5AII A;  1OH0 A;  1E97 A;  2XSO B;  4LMI A;  3PCS A;  3LML A;  4XBX A;  4N6T A;  1JN5 A;  1WMP A;  2GU3 A;  4I4K A;  3KFQ C;  1VQK 3;  2WOH A;  3X3Y A;  1KC8 4;  3MHE A;  4RZM A;  4ORL A;  5IW9 A;  5BVB A;  2OCT A;  1G96 A;  4R4K A;  2GBW B;  3PCR A;  3GZX B;  2GEX A;  3KSP A;  2B24 B;  4XBT A;  4X2H A;  1Q86 4;  4RNZ A;  3G0K A;  1QAL A;  4WHA A;  4K1U A;  2D1W A;  3NHX A;  4N6U A;  3WDG B;  3H51 A;  3B8L A;  3EQQ B;  1K9M 4;  5IF6 A;  2I9W A;  1TU5 A;  2XGN A;  1DMN A;  3FZW A;  2SBL A;  1GY5 A;  2W9P A;  3FH1 A;  1CEW I;  4GL6 A;  1LOX A;  2RGQ A;  3MG3 A;  3GRD A;  4MJD A;  3EB8 A;  4GB5 A;  4N6O B;  2CW9 A;  3G8Z A;  4HM2 B;  1NB5 I;  1Q81 4;  3CPW 2;  4K90 B;  5G2G A;  4K61 A;  4WYK A;  1Q40 B;  4KFF A;  1T5Y A;  1DVC A;  1W01 A;  5KP1 A;  1AVL A;  1SPU A;  3CC7 3;  1ULJ B;  3LTD A;  3UB1 A;  5JBS A;  3WA3 A;  1GYB A;  3CCJ 3;  2OTL 3;  2GBX B;  2HMK B;  1OCV A;  1W6G A;  2XEP A;  2INX A;  3ER7 A;  3ROB A;  5LC6 A;  3CCV 3;  1CYU A;  3WOF B;  3WOD G;  3S28 A;  1JNQ A;  3BNB A;  2JQ5 A;  1RN7 A;  2CC3 A;  1RRL A;  3FF0 A;  4CCV A;  3CPO A;  3KE7 A;  2BMR B;  2GEY A;  2P0M A;  1DMQ A;  5AEU B;  2CFL A;  1F8N A;  3NBR A;  3O8Y A;  2MC8 A;  2L4V A;  2HMO B;  5DRE A;  3MKI A;  4N6L A;  4TX4 A;  2IUK A;  2HML B;  2XFT A;  1CQS A;  3FG1 A;  4ZM8 A;  1OF5 A;  1W4N A;  4H3U A;  3GWR A;  2GU1 A;  4MMX B;  2M7O A;  1IK3 A;  1DVD A;  3DZL A;  3IMA B;  1NU3 A;  4HKV B;  1OHO A;  2BHM A;  4HBR A;  5KP4 A;  1U5O A;  3CCS 3;  1W00 A;  2P0X A;  3S29 A;  1EKM A;  4FCZ A;  1KQS 2;  3I56 3;  1IT7 A;  2PZV A;  1VQN 3;  6STD A;  1JN5 B;  1K28 A;  2BMO B;  4XDV A;  5CLK A;  5CF2 A;  1J2B A;  2W56 B;  1QJG A;  1OUN A;  2C11 A;  4MMZ B;  1A2K A;  1GY6 A;  4HM3 B;  2FXT A;  3SXX A;  1W2B 2;  3WMD A;  1UI7 A;  3EHC A;  5CXO A;  3SLU A;  3Q90 A;  4JF8 A;  1YJ9 3;  1IU7 A;  3OWU A;  2ML6 A;  1TFK A;  1U8C B;  1A2V A;  1FGT A;  2GXF A;  3HX8 A;  3LOY A;  4KFE A;  1PU4 A;  1O7W B;  2WO0 A;  5HGR A;  1ROV A;  1Z1S A;  1ZO2 A;  5AYR B;  3JUP A;  1VQL 3;  1OPY A;  1UUW B;  3CNX A;  4HZB B;  3DGN A;  5ELU A;  3LTC A;  1VQ4 3;  4OK0 A;  1L5G B;  3H3H A;  1C7H A;  2HMJ B;  7STD A;  5LC7 A;  3V98 A;  2OOV C;  3MSO A;  5JPP A;  2CG0 A;  1FGR A;  2W2C A;  5TGN A;  4EBG A;  1YJN 3;  4JRF A;  2E2V A;  4KFD A;  3BNC A;  3NUV A;  3EX9 A;  1WMO A;  2QEX 3;  5DRV A;  3X3X A;  1O7H B;  1UW1 A;  1W5Z A;  2XFS A;  2KCD A;  4IIA A;  2RCD A;  2CFW A;  3IPT A;  3DGM A;  3FG3 A;  1STD A;  2W56 A;  1JKG B;  2D42 A;  3D3L A;  1M1K 4;  4N6M A;  5IG5 A;  1SII A;  4WYK B;  1OHP A;  3WA2 X;  2O9U X;  3DUK A;  4LGQ A;  4J9A A;  1QAF A;  4O3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...