4HM1B

Naphthalene 1,2-dioxygenase bound to 1-indanone
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Naphthalene 1,2-Dioxygenase bound to 1-indanone
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
total genus 55
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm1B00
3DM8A 2A15A 4WYKA 3F9SA 5IERA 2GBWB 1OPYA 5IG4A 3GZRA 2HMKB 4U13A 3MG2A 1IDPA 5IF6A 2QGUA 3G16A 1O7WB 3GZXB 5CK6A 7STDA 5JPPA 4LEHA 1TP6A 2HMMB 1GYBA 2BMOB 3EBYA 4N3VA 4PEJA 4WYKB 2HMOB 1OCVA 2B1XB 3F8XA 4FCJA 3VGNA 1HKXA 5JPUA 1O7MB 3F14A 1E97A 1W02A 3STDA 4XBXA 2B24B 1WQLB 3CNXA 4FCMA 3KSPA 3EQQB 3FSDA 3GWRA 4K1UA 1GY5A 2PZVA 1O7HB 2XR8B 4K1VA 4L8OA 4LGQA 4MJDA 2XRXB 5IG0A 4LMIA 3IPTA 2YFJB 1JN5B 3DUKA 4HM0B 3FF2A 4HM1B 1JN5A 3SOAA 4HM2B 3EJVA 4WWUC 5G2GA 3OWUA 3FLJA 3HX8A 5DREA 3G0KA 4HM8B 5IENA 4XBYA 2QIYA 3EN8A 3UNLA 3EHCA 3JUQA 1DMQA 4RZMA 4H3UA 5CLKA 3DXOA 1JB4A 4R1KA 1ULJB 3OWSA 5AIHA 1SJWA 3RGAA 3EC9A 5AIFA 3Q90A 4OVMA 6STDA 1VZZA 1DMNA 1JKGA 1GY6A 1O7PB 4XB5A 2K54A 5FW5A 3BB9A 3S5CA 5CF1A 3A76A 3LZAA 3FZWA 3E99A 3F40A 4L8PA 2Z76A 3CU3A 5TGNA 3UJMA 1JB2A 3ER7A 3NUVA 2GEYA 3FH1A 3ECFA 5EVHA 4R9LA 4HKVB 1EA2A 2INXA 3EN1B 3LYGA 3MG3A 1JKGB 4R9KA 1ISKA 3KZTA 4HM6B 3DMCA 1CQSA 3B8LA 1QMAA 3KE7A 3FKAA 3NV0B 3M8CA 3OV4A 4HM4B 3H3HA 1OF5B 1ZX2A 1GS3A 4WP5A 1STDA 3NXJA 3NHXA 5DRVA 3MG1A 1S5AA 1Z1SA 8CHOA 3CNMA 5KP3A 1OGZA 3K7CA 2HMJB 1UUVB 3GZYB 1OHOA 4HM3B 5CF2A 3HK4A 5AIGA 1NDOB 3F8HA 3ROBA 2XSOB 1E3RA 3EBTA 4HZ9B 2GXFA 4J8TA 3SOYA 1QJGA 2W2CA 3H51A 2F99A 2RGQA 5BXQA 2R4IA 3NBRA 2RFRA 3NV0A 4XDVA 2XSHB 4GB5A 3JUPA 4HM7B 3B7CA 3OX9A 3VSYA 5CXOA 1BUQA 3BLZA 1U5OA 1Q40B 2IMJA 5AI1A 1NU3A 1Q40A 5AEWB 2RCDA 2YFIB 5D83A 1UUWB 1C7HA 2BMRB 2HMNB 3MSOA 4HVNA 1O7NB 1AR0A 2I9WA 3I0YA 1OUNA 4XDWA 2GEXA 1O7GB 3DZLA 3WMDA 1OGXA 2BNGA 5KP4A 1A2KA 1OF5A 3MKIA 5AEUB 3KKGA 3G8ZA 5KP1A 3MYTA 3SEDA 5IEOA 2CHCA 3MHEA 2F86B 3JUOA 4HM5B 4IIAA 4J9AA 2YFLB 1OH0A 4ORLA 4CDLA 5IG5A 3EX9A 3FGYA 5IEPA 3FF0A 2GBXB 3B4PA 3T8UA 4L7KA 5IG3A 2BMQB 2Z7AA 3OXAA 5AIIA 1EG9B 2OWPA 4XBTA 1E3VA 1NWWA 3CPOA 5STDA 3F7XA 3K0ZA 2F98A 3D9RA 3JUMA 4I4KA 1TUHA 1Q42A 3B4OA 1ASKA 1K41A 4STDA 5D81A 2HMLB 2STDA 3F7SA 1W6YA 5D82A 1OHSA 4X2HA 3NM2A 5HGRA 4XM4A 1W01A 4X2OA 1W00A 1OHPA 2CKFB 3HZPA 4OUQA 5BVBA 1ULIB 3RGRA 4HJLB 1GY7A 1ZO2A 2JQ5A 3EF8A 3GRDA 4HZBB 3T8NA 2UX0A 1JB5A 2Z77A 3JUNA 4Q53A 3OWYA 3GZBA 4KVHA 1DMMA
chains in the Genus database with same CATH superfamily
2Q07A 2F56A 5IERA 2RSXA 1VQN3 1OPYA 3LTBA 4RNYA 5IG4A 4U13A 3URPA 1BNEA 1I70A 1O7WB 5CK6A 1TP6A 2BMOB 1TIJA 1JZDA 3O8YA 1YJN3 3STDA 4XBXA 1QVG2 1BNJA 1JBRA 3HOHA 4R4KA 3GWRA 3FSDA 1TU5A 4K1VA 1O7HB 3LMLA 1GD4A 1VQQA 1I2FA 1ZGXA 2D42A 2J8XB 2XRXB 1Q7Y4 1JN5B 1B3SA 3SOAA 1RGHA 5G2GA 3FLJA 3HX8A 4QWTA 1WMNA 1BNFA 4XBYA 2QIYA 1I0VA 3UNLA 1SIIA 4EYCA 5A0OB 3WA3A 1MNLA 2L4VA 4JRFA 3LTDA 4H3UA 2BIRA 3DXOA 1RGCA 3HIGA 3D5GA 1SJWA 2PNCA 3EC9A 1VZZA 1DVCA 3S5CA 2AADA 2K54A 2CWTA 5FW5A 1IK3A 3A76A 5TGNA 3E99A 1UI8A 3CU3A 1RMSA 1FUSA 2KF6A 4BU4A 7RNTA 3ECFA 3G4S3 1RN7A 3CCE3 1MOLA 2BHMA 3LYGA 3S27A 3VF1A 1BNGA 1JKGB 3WR2A 2OQEA 1RGLA 3LT9A 2P38A 3CCM3 4HM6B 1RCLA 4HM4B 3B8LA 3NV0B 1LXEA 4HBRA 1ROVA 1W2ZA 4EW5A 4MMXB 1Q864 2P09A 4FMDA 4TX4A 5BU4A 1R4YA 3H3HA 1OF5B 1ZX2A 3PZWA 4WP5A 3NHXA 1CEWI 2P0XA 1W5ZA 1AQZA 2CH9A 4R80A 1A67A 3K7CA 1RCKA 3K9MC 1UUVB 2AAEA 2IYJA 4HM3B 1LOYA 2H0IA 1VQ53 1QJGA 3H51A 4BL3A 2H0HA 3GAXA 1YIT3 5BXQA 3NBRA 1AV4A 2RFRA 3JUPA 3B7CA 1A90A 5CXOA 4LYLB 2BU4A 3IMAB 1U8CB 1WMOA 2L1SA 2YFIB 1FGRA 4I5QA 1BSEA 1UUWB 2HMNB 2QA43 4XDWA 1CYVA 4HVNA 1B2UA 1O7NB 1B2XA 1MGRA 1OUNA 3I0YA 1UGHI 3DZLA 5KP4A 3X40A 2BNGA 1BSCA 3MKIA 3EB8A 1BRKA 3NX0A 3G8ZA 2O3OA 2XFTA 3SEDA 1D6ZA 4EV2A 1VQ93 5G1LA 2F86B 3JUOA 4KFDA 4IIAA 3T0UA 4CDLA 2KF5A 1QVF2 2GSPA 2RBIA 3FF0A 3RNTA 1DVDA 4MMZB 5ELJA 1FZUA 1IT7A 1NO3A 1ROAA 2WOHA 4DKIA 1LNIA 5STDA 3WDGB 1UUGB 3F7XA 2F98A 3JUMA 1WNHA 1Q42A 1BOXA 1ASKA 1RTUA 1ZS7A 3KIIA 4STDA 2W04A 3SYUA 1SPUA 2STDA 3Q3FA 4LSOA 1NNVA 4X2HA 1W2B2 1W01A 1RJOA 4G1MB 2CKFB 4O8SA 2UGIA 3ZG5A 1RRHA 1I2GA 3DGOA 3X3XA 2K3DA 2OOVA 1JB5A 4Q53A 2CIUA 5EQLA 4KVHA 4AKZA 2HMJB 1M9GA 1LVNA 2P0MA 4K1UA 1VQM3 4KFEA 1QAKA 1YGEA 1TRQA 1MWSA 1W7CA 1RRLA 3MWZA 2HMKB 5IF6A 1UDII 1EEJA 1T2HA 1X1UA 4EC6A 1VQP3 5JPPA 3CCR3 1RNTA 1C54A 2XF3A 3S28A 1FGOA 3EBYA 3D3LA 4PEJA 4WYKB 4FCJA 1OCVA 2CFDA 3F8XA 2BO9B 2W9PA 3NQZA 3VGNA 2MC8A 1Q9EA 1W02A 3FG1A 4FCZA 1IT8A 4N6MA 3AGNA 5EEOA 3I563 3KCHA 2QEX3 1CYUA 4FR9A 4L8OA 2WGOA 1M904 1TFOA 3LTCA 3QRDA 1PFPA 2ZDJA 1RN4A 3DUKA 4N6LA 1PYLA 3DGLA 2LQVA 3WA2X 3OWUA 4N6V0 3CPW2 3G0KA 5IENA 4H61A 1KQS2 3EN8A 1BRNL 4ZM8A 1JB4A 1ULJB 2O9UX 1UCKA 3RGAA 3SVAA 2CW9A 2W6JH 1GSPA 4N6NB 3BB9A 4O02B 3X3ZA 3UJMA 1IVVA 2ML5A 3NUVA 3FH1A 1N8R4 2KAAA 1KSIA 1BIRA 1YVSA 3MG3A 1MWUA 2FNQA 1HYFA 3AHWA 1D6UA 1NB5I 2ZHXB 2IUKA 1IVWA 1CQSA 3D4AA 1BVIA 5M19A 3CC43 3BIRA 3M8CA 3NBJA 1YIJ3 1FGTA 1W4NA 4J5GA 4J5KA 1GS3A 2CC3A 3NXJA 5HOHA 1LRAA 1S5AA 3CC23 3PCSA 4JF8A 1D6YA 1DETA 3GZYB 1OHOA 5CF2A 3UL5A 3NQYA 3SOYA 1BRJA 4J8TA 4HZ9B 4WHAA 2ZL8A 4AKYA 2W9QA 2F99A 2RGQA 3HI7A 4EXRA 2MF7A 4XDVA 2XSHB 4GB5A 1QAFA 1GOYA 3VSYA 3CME3 2KRTA 4K90B 1RGKA 1OACA 1Q40B 4HOHA 3X3YA 1Q40A 1K734 1TTOA 2RCDA 2BMRB 3NBBA 1EQKA 1LOXA 2FXTA 1AR0A 1VQ43 3WMDA 1OGXA 3PCRA 1TRPA 4BTYA 5IEOA 2W56B 4K61A 5IG5A 1UW1A 3NM7A 1SIHA 1GOUA 1YHQ3 5IEPA 1DE3A 2R41A 3LXUX 3BNDA 5IG3A 1GMRA 2BMQB 3OXAA 3LTAA 3S29A 1LQGC 1IV7A 1UCJA 3AGOA 3L0RA 1I8VA 2WOFA 1PY3A 1N8QA 3WODG 2H0GA 3CPOA 1IYYA 3D9RA 2CG0A 3CD63 1K41A 3PS8A 1FUTA 1AVKA 5D82A 1OHSA 3NM2A 4IT7A 4XM4A 5HGRA 2CFGA 1BU4A 2E2VA 1KWIA 1HU9A 1RGEA 4HJLB 2JQ5A 4HZBB 3GRDA 3T8NA 2CFWA 4NHFA 4BL2A 1T2IA 1YJW3 3OWYA 2WO0A 1BNIA 1CH0A 1DMMA 3DM8A 4WYKA 3F9SA 1F8NA 1K9M4 1GMPA 2GBWB 2ML6A 3UL6A 1JV2B 3GZRA 3MG2A 1I0XA 1IDPA 3GZXB 3G16A 4BTWA 7STDA 3ZG0A 3BNEA 3V99A 3Q1CA 2B1XB 1N9JA 2LYXA 1J2BA 1O7MB 1JJ22 1E97A 3CCJ3 4OK0A 1KD14 1B20A 1NJI4 4FCMA 1VQ63 3CMA3 1GY5A 3WHOA 1BRSA 1I3IA 4LGQA 3N9HA 4LMIA 1IVXA 3BU4A 2XH9A 3RDEA 4EV5A 1JBTA 1T3BA 1JN5A 1B2MA 2IA7A 4WWUC 2E2UA 4HM8B 3CXC2 1JNQA 1Y4KA 1DMQA 4N6OB 4RZMA 5M1AA 5CLKA 3CCV3 4R1KA 1G96A 1AY7A 3DGMA 3N8BA 4OVMA 1FGQA 1GY6A 3DY5A 1EUIC 2W0QA 4KFFA 1N5PA 1UCLA 3LZAA 5CF1A 2K0MA 1IV9A 2M7OA 2V1LA 2Z76A 3F40A 3ER7A 4L8PA 2GEYA 2CX0A 4R9LA 4HKVB 1EA2A 2INXA 4N6TA 7GSPA 3X41A 1UCIA 4FMCA 1GD3A 5IW9A 1SQWA 1BANA 3SX1A 6GSPA 1LNHA 3OV4A 1QMAA 4CCVA 2BT3A 1PU4A 1RKYA 1UI7A 1B27A 3WOFB 1STDA 5DRVA 3ZFZA 3U97A 2W03A 3U1WA 8CHOA 3CNMA 1MWRA 5KP3A 4CPKA 1B2SA 1RSNA 2Y73A 5AIGA 3F8HA 5FGOA 3ROBA 1E3RA 2CX1A 1EKMA 2GXFA 3DGYA 3BNBA 1Q7HA 2KF3A 3LT8A 1YJ93 2OQEC 3UB1A 2R4IA 2JDIH 1VQ83 3NV0A 2CFKA 4RNZA 1KC84 2OTL3 1SARA 1RGFA 1HZ1A 1U5OA 1RN1A 5AI1A 3CCQ3 1X1XA 1FW7A 4MMYB 3D79A 3I553 1C7HA 1WTHA 1TFKA 2XFSA 3MSOA 2I9WA 5AYSC 3WOEB 1V58A 2GEXA 2GU3A 3ALAA 5I97A 1WMPA 5AEUB 1RNBA 1RLSA 3PGBA 3HIIA 1A2VA 2CHCA 4ORLA 1L5GB 2YFLB 4HAAA 2ZA4A 4O3VA 3FGYA 2FGTA 2GBXB 3B4PA 3T8UA 4L7KA 1RHLA 2Z7AA 3X42A 1IQ8A 6RNTA 3FG4A 5RNTA 1V74A 3FCSB 4I4KA 1TUHA 1BUJA 5D81A 2HMLB 3F7SA 2CFLA 1W6YA 4LZIA 1IVUA 1LOWA 1Q814 1QALA 4GL6A 4X2OA 4OUQA 4EBGA 3G6E3 5BVBA 1S723 1FGMA 3RGRA 1UGIA 2CK3H 4GSPA 1BGSA 1GY7A 3EF8A 1GOVA 2UX0A 2Z77A 3GZBA 3LOYA 3JVCA 2A15A 3DH2A 3BNCA 2C10A 1W6GA 3AMOB 1MGWA 1RDSA 2XEPA 2F4YA 3OW22 4AEQA 2W56A 2QGUA 1RGAA 1TJDA 3G713 1IQXA 4LEHA 2HMMB 2D1WA 5G1KA 2CG1A 1GYBA 4FMBA 4N3VA 1VQK3 8RNTA 2HMOB 1HKXA 1MWTA 5JPUA 3F14A 2KF4A 1VQL3 2B24B 2XGNA 1WQLB 3CNXA 4NREA 1VQ73 3KSPA 3PXMA 1W6CA 3EQQB 5DREA 4NPBA 2SBLA 2PZVA 1STFI 2OOVC 2XR8B 3N54B 1BAOA 4MJDA 5LC6A 5IG0A 2GU1A 3V98A 3IPTA 2YFJB 4HM0B 3FF2A 1DYUA 4HM1B 4HM2B 3EJVA 2Y74A 4HYZA 3KN4A 1G02A 3EHCA 3JUQA 3KSED 1I3FA 1X1YA 2C11A 1BRIA 3K63A 3OWSA 5AIHA 6STDA 2C4BA 3Q90A 5AIFA 2OTJ3 2IY2A 1DMNA 1BNSA 1JKGA 1O7PB 1T5YA 4XB5A 1AVLA 3FZWA 5KP1A 1JB2A 2YX9A 2UUGC 3DGNA 3A5EA 5EVHA 3EN1B 2CWUA 5GSPA 3PYJA 4R9KA 3MPHA 3TDGA 1ISKA 2KCDA 3GSPA 4N6UA 3KZTA 1JBSA 3DMCA 3KE7A 2SARA 3FKAA 4KT3B 3CC73 5BIRA 3D5IA 2CWVA 3LH4A 3MG1A 3V92A 1Z1SA 4BTXA 2KXGA 2F5MA 1BSAA 1OGZA 2XGLA 2IUJA 1IQYA 2Z6BA 5ELUA 3S67A 1YI23 1K8A4 1JRQA 1BNRA 4FMAA 3HK4A 5LC7A 3SLUA 1M1XB 1NDOB 2XSOB 3EBTA 1IU7A 2W2CA 3Q2PA 3SXXA 4IPBA 4HM7B 4ILFA 4GHOA 3OX9A 1JZOA 1BUQA 1K28A 3BLZA 1BRGA 1I2EA 3KFQC 2IMJA 5JBSA 2E2TA 1NU3A 1GMQA 5AEWB 4CJNA 2F5WA 5D83A 4MEIA 1O7GB 1LOVA 1A2KA 1OF5A 3IJEB 4RBNA 3KKGA 2WGQA 1BSBA 1Q824 3AMOA 3J7Yd 1VQO3 3CCU3 3EE1A 3MYTA 1FYSA 3MHEA 4HM5B 1RGGA 1YNVX 2P05A 1BSDA 1OH0A 4J9AA 1FUWA 3EX9A 5AYRB 3FG3A 5AIIA 3CCL3 1EG9B 2OWPA 4XBTA 2RNTA 2OCTA 1E3VA 3QK9A 1NWWA 4KZ1A 1FA3A 3K0ZA 1V57A 1US1A 1R4CA 3B4OA 1N9EA 3K5TA 9RNTA 1G0TA 1NB3I 1B2ZA 4RNTA 3CCS3 4O2HA 1W00A 1OHPA 3HZPA 4BIRA 1N5HA 1ULIB 5M18A 1BRHA 1X1WA 1M1K4 1A2PA 1LQMB 1ZO2A 3AHSA 1YVBI 4WFOA 3JUNA 2HOHA 1B21A 1YGWA
chains in the Genus database with same CATH topology
2Q07A 5IERA 2RSXA 1VQN3 1OPYA 3LTBA 4RNYA 5IG4A 4U13A 1O7WB 5CK6A 1TP6A 2BMOB 1TIJA 3O8YA 1YJN3 3STDA 4XBXA 1QVG2 4R4KA 3GWRA 3FSDA 1TU5A 4K1VA 1O7HB 3LMLA 1GD4A 2D42A 2XRXB 1Q7Y4 1JN5B 3SOAA 5G2GA 3FLJA 3HX8A 4QWTA 1WMNA 4XBYA 2QIYA 4EYCA 3UNLA 1SIIA 5A0OB 3WA3A 1MNLA 2L4VA 4JRFA 3LTDA 4H3UA 3DXOA 3HIGA 1SJWA 2PNCA 3EC9A 1VZZA 1DVCA 3S5CA 2K54A 2CWTA 5FW5A 1IK3A 3A76A 5TGNA 3E99A 1UI8A 3CU3A 3ECFA 3G4S3 1RN7A 3CCE3 1MOLA 2BHMA 3LYGA 3S27A 3VF1A 1JKGB 2OQEA 3LT9A 2P38A 3CCM3 4HM6B 4HM4B 3B8LA 3NV0B 1LXEA 4HBRA 1ROVA 1W2ZA 1Q864 4MMXB 2P09A 4FMDA 4TX4A 3H3HA 1OF5B 1ZX2A 3PZWA 4WP5A 3NHXA 1CEWI 2P0XA 1W5ZA 4R80A 2CH9A 1A67A 3K7CA 3K9MC 1UUVB 4HM3B 1VQ53 1QJGA 3H51A 3GAXA 1YIT3 5BXQA 3NBRA 1AV4A 2RFRA 3JUPA 3B7CA 1A90A 5CXOA 3IMAB 1U8CB 1WMOA 2YFIB 1FGRA 1UUWB 2HMNB 2QA43 4XDWA 1CYVA 4HVNA 1O7NB 3I0YA 1OUNA 5KP4A 3DZLA 3X40A 2BNGA 3MKIA 3EB8A 3NX0A 3G8ZA 2O3OA 2XFTA 3SEDA 1D6ZA 4EV2A 1VQ93 2F86B 3JUOA 4KFDA 4IIAA 3T0UA 4CDLA 1QVF2 3FF0A 1DVDA 4MMZB 5ELJA 1IT7A 1NO3A 1ROAA 2WOHA 5STDA 3WDGB 3F7XA 2F98A 3JUMA 1WNHA 1Q42A 3KIIA 1ASKA 4STDA 2W04A 1SPUA 2STDA 4LSOA 4X2HA 1W2B2 1W01A 1RJOA 4G1MB 2CKFB 4O8SA 1RRHA 3X3XA 3DGOA 2OOVA 1JB5A 4Q53A 2CIUA 5EQLA 4KVHA 4AKZA 2HMJB 1M9GA 1LVNA 2P0MA 4K1UA 1VQM3 4KFEA 1QAKA 1YGEA 1W7CA 1RRLA 3MWZA 2HMKB 5IF6A 4EC6A 1VQP3 5JPPA 3CCR3 2XF3A 3S28A 1FGOA 3EBYA 3D3LA 4PEJA 4WYKB 4FCJA 1OCVA 2CFDA 3F8XA 2BO9B 2W9PA 3NQZA 3VGNA 2MC8A 1W02A 4FCZA 3FG1A 1IT8A 4N6MA 5EEOA 3I563 2QEX3 1CYUA 4FR9A 4L8OA 2WGOA 1M904 1TFOA 3LTCA 3QRDA 1PFPA 2ZDJA 3DUKA 4N6LA 3DGLA 2LQVA 3WA2X 3OWUA 4N6V0 3CPW2 3G0KA 5IENA 4H61A 1KQS2 3EN8A 4ZM8A 1JB4A 1ULJB 2O9UX 3RGAA 3SVAA 2CW9A 2W6JH 4N6NB 3BB9A 4O02B 3X3ZA 3UJMA 1IVVA 2ML5A 3NUVA 3FH1A 1N8R4 1KSIA 3MG3A 2FNQA 1D6UA 1NB5I 2IUKA 1IVWA 1CQSA 3CC43 3M8CA 3NBJA 1YIJ3 1FGTA 1W4NA 1GS3A 2CC3A 3NXJA 3CC23 1S5AA 3PCSA 4JF8A 1D6YA 3GZYB 1OHOA 5CF2A 3UL5A 3NQYA 3SOYA 4J8TA 4HZ9B 4WHAA 2ZL8A 4AKYA 2W9QA 2F99A 2RGQA 3HI7A 4EXRA 2MF7A 4XDVA 2XSHB 4GB5A 1QAFA 3VSYA 3CME3 2KRTA 4K90B 1OACA 1Q40B 3X3YA 1Q40A 1K734 2RCDA 2BMRB 3NBBA 1EQKA 1LOXA 2FXTA 1AR0A 1VQ43 3WMDA 1OGXA 3PCRA 4BTYA 5IEOA 2W56B 4K61A 5IG5A 1UW1A 3NM7A 1SIHA 1YHQ3 5IEPA 3LXUX 5IG3A 3BNDA 2BMQB 3OXAA 3S29A 3LTAA 1IV7A 3L0RA 2WOFA 1N8QA 3WODG 3CPOA 3D9RA 2CG0A 3CD63 1K41A 3PS8A 1AVKA 5D82A 1OHSA 3NM2A 4IT7A 4XM4A 5HGRA 2CFGA 2E2VA 1KWIA 1HU9A 4HJLB 2JQ5A 4HZBB 3GRDA 3T8NA 2CFWA 4NHFA 1YJW3 3OWYA 2WO0A 1DMMA 3DM8A 4WYKA 3F9SA 1F8NA 1K9M4 2GBWB 2ML6A 3UL6A 1JV2B 3GZRA 3MG2A 1IDPA 3GZXB 3G16A 4BTWA 7STDA 3BNEA 3V99A 3Q1CA 2B1XB 1N9JA 2LYXA 1J2BA 1O7MB 1JJ22 1E97A 3CCJ3 4OK0A 1KD14 1NJI4 4FCMA 1VQ63 3CMA3 1GY5A 4LGQA 3N9HA 4LMIA 1IVXA 2XH9A 3RDEA 4EV5A 1JN5A 2IA7A 4WWUC 2E2UA 4HM8B 3CXC2 1JNQA 1Y4KA 1DMQA 4N6OB 4RZMA 5CLKA 3CCV3 4R1KA 1G96A 3DGMA 3N8BA 4OVMA 1FGQA 1GY6A 3DY5A 2W0QA 4KFFA 1N5PA 3LZAA 5CF1A 2K0MA 1IV9A 2M7OA 2V1LA 2Z76A 3F40A 3ER7A 4L8PA 2GEYA 4R9LA 4HKVB 1EA2A 2INXA 4N6TA 3X41A 4FMCA 1GD3A 5IW9A 1SQWA 3SX1A 1LNHA 3OV4A 1QMAA 4CCVA 2BT3A 1PU4A 1RKYA 1UI7A 3WOFB 1STDA 5DRVA 3U97A 2W03A 3U1WA 8CHOA 3CNMA 5KP3A 2Y73A 5AIGA 3F8HA 5FGOA 3ROBA 1E3RA 1EKMA 2GXFA 3BNBA 3LT8A 1YJ93 2OQEC 3UB1A 2R4IA 2JDIH 1VQ83 3NV0A 2CFKA 4RNZA 1KC84 2OTL3 1U5OA 5AI1A 3CCQ3 4MMYB 3I553 2XFSA 1C7HA 1WTHA 1TFKA 3MSOA 2I9WA 5AYSC 3WOEB 2GEXA 2GU3A 3ALAA 5I97A 1WMPA 5AEUB 3PGBA 3HIIA 1A2VA 2CHCA 4ORLA 1L5GB 2YFLB 4O3VA 3FGYA 2FGTA 2GBXB 3B4PA 3T8UA 4L7KA 2Z7AA 3X42A 1IQ8A 3FG4A 1V74A 3FCSB 4I4KA 1TUHA 5D81A 2HMLB 3F7SA 2CFLA 1W6YA 4LZIA 1IVUA 1Q814 1QALA 4GL6A 4X2OA 4OUQA 4EBGA 3G6E3 5BVBA 1S723 1FGMA 3RGRA 2CK3H 1GY7A 3EF8A 2UX0A 2Z77A 3GZBA 3LOYA 3JVCA 2A15A 3BNCA 2C10A 1W6GA 3AMOB 2XEPA 3OW22 4AEQA 2W56A 2QGUA 3G713 1IQXA 4LEHA 2HMMB 2D1WA 2CG1A 1VQK3 1GYBA 4FMBA 4N3VA 2HMOB 1HKXA 5JPUA 3F14A 1VQL3 2B24B 2XGNA 1WQLB 3CNXA 4NREA 1VQ73 3KSPA 3PXMA 1W6CA 3EQQB 5DREA 2SBLA 2PZVA 1STFI 2OOVC 2XR8B 3N54B 4MJDA 5LC6A 3V98A 5IG0A 2GU1A 3IPTA 2YFJB 4HM0B 3FF2A 1DYUA 4HM1B 4HM2B 3EJVA 2Y74A 4HYZA 3KN4A 3EHCA 3JUQA 3KSED 2C11A 3K63A 3OWSA 5AIHA 6STDA 5AIFA 3Q90A 2OTJ3 1DMNA 1JKGA 1O7PB 1T5YA 4XB5A 1AVLA 3FZWA 5KP1A 1JB2A 2YX9A 3DGNA 5EVHA 3EN1B 2CWUA 3PYJA 4R9KA 3MPHA 3TDGA 1ISKA 2KCDA 4N6UA 3KZTA 3DMCA 3KE7A 3FKAA 3CC73 2CWVA 3LH4A 3MG1A 3V92A 1Z1SA 4BTXA 2KXGA 2XGLA 1OGZA 2IUJA 1YI23 1IQYA 2Z6BA 5ELUA 3S67A 1K8A4 1JRQA 4FMAA 3HK4A 5LC7A 3SLUA 1M1XB 1NDOB 2XSOB 3EBTA 1IU7A 2W2CA 3Q2PA 3SXXA 4IPBA 4HM7B 3OX9A 1BUQA 1K28A 3BLZA 3KFQC 2IMJA 5JBSA 2E2TA 1NU3A 5AEWB 5D83A 4MEIA 1O7GB 1A2KA 1OF5A 3IJEB 4RBNA 3KKGA 2WGQA 1Q824 3AMOA 3J7Yd 1VQO3 3CCU3 3EE1A 3MYTA 3MHEA 4HM5B 2P05A 4J9AA 1OH0A 1FUWA 3EX9A 5AYRB 3FG3A 5AIIA 3CCL3 1EG9B 2OWPA 4XBTA 2OCTA 1E3VA 3QK9A 1NWWA 4KZ1A 1FA3A 3K0ZA 1US1A 1R4CA 3B4OA 1N9EA 3K5TA 1NB3I 3CCS3 4O2HA 1W00A 1OHPA 3HZPA 1N5HA 1ULIB 1M1K4 1ZO2A 1YVBI 4WFOA 3JUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DM8 A;  2A15 A;  4WYK A;  3F9S A;  5IER A;  2GBW B;  1OPY A;  5IG4 A;  3GZR A;  2HMK B;  4U13 A;  3MG2 A;  1IDP A;  5IF6 A;  2QGU A;  3G16 A;  1O7W B;  3GZX B;  5CK6 A;  7STD A;  5JPP A;  4LEH A;  1TP6 A;  2HMM B;  1GYB A;  2BMO B;  3EBY A;  4N3V A;  4PEJ A;  4WYK B;  2HMO B;  1OCV A;  2B1X B;  3F8X A;  4FCJ A;  3VGN A;  1HKX A;  5JPU A;  1O7M B;  3F14 A;  1E97 A;  1W02 A;  3STD A;  4XBX A;  2B24 B;  1WQL B;  3CNX A;  4FCM A;  3KSP A;  3EQQ B;  3FSD A;  3GWR A;  4K1U A;  1GY5 A;  2PZV A;  1O7H B;  2XR8 B;  4K1V A;  4L8O A;  4LGQ A;  4MJD A;  2XRX B;  5IG0 A;  4LMI A;  3IPT A;  2YFJ B;  1JN5 B;  3DUK A;  4HM0 B;  3FF2 A;  4HM1 B;  1JN5 A;  3SOA A;  4HM2 B;  3EJV A;  4WWU C;  5G2G A;  3OWU A;  3FLJ A;  3HX8 A;  5DRE A;  3G0K A;  4HM8 B;  5IEN A;  4XBY A;  2QIY A;  3EN8 A;  3UNL A;  3EHC A;  3JUQ A;  1DMQ A;  4RZM A;  4H3U A;  5CLK A;  3DXO A;  1JB4 A;  4R1K A;  1ULJ B;  3OWS A;  5AIH A;  1SJW A;  3RGA A;  3EC9 A;  5AIF A;  3Q90 A;  4OVM A;  6STD A;  1VZZ A;  1DMN A;  1JKG A;  1GY6 A;  1O7P B;  4XB5 A;  2K54 A;  5FW5 A;  3BB9 A;  3S5C A;  5CF1 A;  3A76 A;  3LZA A;  3FZW A;  3E99 A;  3F40 A;  4L8P A;  2Z76 A;  3CU3 A;  5TGN A;  3UJM A;  1JB2 A;  3ER7 A;  3NUV A;  2GEY A;  3FH1 A;  3ECF A;  5EVH A;  4R9L A;  4HKV B;  1EA2 A;  2INX A;  3EN1 B;  3LYG A;  3MG3 A;  1JKG B;  4R9K A;  1ISK A;  3KZT A;  4HM6 B;  3DMC A;  1CQS A;  3B8L A;  1QMA A;  3KE7 A;  3FKA A;  3NV0 B;  3M8C A;  3OV4 A;  4HM4 B;  3H3H A;  1OF5 B;  1ZX2 A;  1GS3 A;  4WP5 A;  1STD A;  3NXJ A;  3NHX A;  5DRV A;  3MG1 A;  1S5A A;  1Z1S A;  8CHO A;  3CNM A;  5KP3 A;  1OGZ A;  3K7C A;  2HMJ B;  1UUV B;  3GZY B;  1OHO A;  4HM3 B;  5CF2 A;  3HK4 A;  5AIG A;  1NDO B;  3F8H A;  3ROB A;  2XSO B;  1E3R A;  3EBT A;  4HZ9 B;  2GXF A;  4J8T A;  3SOY A;  1QJG A;  2W2C A;  3H51 A;  2F99 A;  2RGQ A;  5BXQ A;  2R4I A;  3NBR A;  2RFR A;  3NV0 A;  4XDV A;  2XSH B;  4GB5 A;  3JUP A;  4HM7 B;  3B7C A;  3OX9 A;  3VSY A;  5CXO A;  1BUQ A;  3BLZ A;  1U5O A;  1Q40 B;  2IMJ A;  5AI1 A;  1NU3 A;  1Q40 A;  5AEW B;  2RCD A;  2YFI B;  5D83 A;  1UUW B;  1C7H A;  2BMR B;  2HMN B;  3MSO A;  4HVN A;  1O7N B;  1AR0 A;  2I9W A;  3I0Y A;  1OUN A;  4XDW A;  2GEX A;  1O7G B;  3DZL A;  3WMD A;  1OGX A;  2BNG A;  5KP4 A;  1A2K A;  1OF5 A;  3MKI A;  5AEU B;  3KKG A;  3G8Z A;  5KP1 A;  3MYT A;  3SED A;  5IEO A;  2CHC A;  3MHE A;  2F86 B;  3JUO A;  4HM5 B;  4IIA A;  4J9A A;  2YFL B;  1OH0 A;  4ORL A;  4CDL A;  5IG5 A;  3EX9 A;  3FGY A;  5IEP A;  3FF0 A;  2GBX B;  3B4P A;  3T8U A;  4L7K A;  5IG3 A;  2BMQ B;  2Z7A A;  3OXA A;  5AII A;  1EG9 B;  2OWP A;  4XBT A;  1E3V A;  1NWW A;  3CPO A;  5STD A;  3F7X A;  3K0Z A;  2F98 A;  3D9R A;  3JUM A;  4I4K A;  1TUH A;  1Q42 A;  3B4O A;  1ASK A;  1K41 A;  4STD A;  5D81 A;  2HML B;  2STD A;  3F7S A;  1W6Y A;  5D82 A;  1OHS A;  4X2H A;  3NM2 A;  5HGR A;  4XM4 A;  1W01 A;  4X2O A;  1W00 A;  1OHP A;  2CKF B;  3HZP A;  4OUQ A;  5BVB A;  1ULI B;  3RGR A;  4HJL B;  1GY7 A;  1ZO2 A;  2JQ5 A;  3EF8 A;  3GRD A;  4HZB B;  3T8N A;  2UX0 A;  1JB5 A;  2Z77 A;  3JUN A;  4Q53 A;  3OWY A;  3GZB A;  4KVH A;  1DMM A; 
#chains in the Genus database with same CATH topology
 2Q07 A;  2F56 A;  5IER A;  2RSX A;  1VQN 3;  1OPY A;  3LTB A;  4RNY A;  5IG4 A;  4U13 A;  3URP A;  1BNE A;  1I70 A;  1O7W B;  5CK6 A;  1TP6 A;  2BMO B;  1TIJ A;  1JZD A;  3O8Y A;  1YJN 3;  3STD A;  4XBX A;  1QVG 2;  1BNJ A;  1JBR A;  3HOH A;  4R4K A;  3GWR A;  3FSD A;  1TU5 A;  4K1V A;  1O7H B;  3LML A;  1GD4 A;  1VQQ A;  1I2F A;  1ZGX A;  2D42 A;  2J8X B;  2XRX B;  1Q7Y 4;  1JN5 B;  1B3S A;  3SOA A;  1RGH A;  5G2G A;  3FLJ A;  3HX8 A;  4QWT A;  1WMN A;  1BNF A;  4XBY A;  2QIY A;  1I0V A;  3UNL A;  1SII A;  4EYC A;  5A0O B;  3WA3 A;  1MNL A;  2L4V A;  4JRF A;  3LTD A;  4H3U A;  2BIR A;  3DXO A;  1RGC A;  3HIG A;  3D5G A;  1SJW A;  2PNC A;  3EC9 A;  1VZZ A;  1DVC A;  3S5C A;  2AAD A;  2K54 A;  2CWT A;  5FW5 A;  1IK3 A;  3A76 A;  5TGN A;  3E99 A;  1UI8 A;  3CU3 A;  1RMS A;  1FUS A;  2KF6 A;  4BU4 A;  7RNT A;  3ECF A;  3G4S 3;  1RN7 A;  3CCE 3;  1MOL A;  2BHM A;  3LYG A;  3S27 A;  3VF1 A;  1BNG A;  1JKG B;  3WR2 A;  2OQE A;  1RGL A;  3LT9 A;  2P38 A;  3CCM 3;  4HM6 B;  1RCL A;  4HM4 B;  3B8L A;  3NV0 B;  1LXE A;  4HBR A;  1ROV A;  1W2Z A;  4EW5 A;  4MMX B;  1Q86 4;  2P09 A;  4FMD A;  4TX4 A;  5BU4 A;  1R4Y A;  3H3H A;  1OF5 B;  1ZX2 A;  3PZW A;  4WP5 A;  3NHX A;  1CEW I;  2P0X A;  1W5Z A;  1AQZ A;  2CH9 A;  4R80 A;  1A67 A;  3K7C A;  1RCK A;  3K9M C;  1UUV B;  2AAE A;  2IYJ A;  4HM3 B;  1LOY A;  2H0I A;  1VQ5 3;  1QJG A;  3H51 A;  4BL3 A;  2H0H A;  3GAX A;  1YIT 3;  5BXQ A;  3NBR A;  1AV4 A;  2RFR A;  3JUP A;  3B7C A;  1A90 A;  5CXO A;  4LYL B;  2BU4 A;  3IMA B;  1U8C B;  1WMO A;  2L1S A;  2YFI B;  1FGR A;  4I5Q A;  1BSE A;  1UUW B;  2HMN B;  2QA4 3;  4XDW A;  1CYV A;  4HVN A;  1B2U A;  1O7N B;  1B2X A;  1MGR A;  1OUN A;  3I0Y A;  1UGH I;  3DZL A;  5KP4 A;  3X40 A;  2BNG A;  1BSC A;  3MKI A;  3EB8 A;  1BRK A;  3NX0 A;  3G8Z A;  2O3O A;  2XFT A;  3SED A;  1D6Z A;  4EV2 A;  1VQ9 3;  5G1L A;  2F86 B;  3JUO A;  4KFD A;  4IIA A;  3T0U A;  4CDL A;  2KF5 A;  1QVF 2;  2GSP A;  2RBI A;  3FF0 A;  3RNT A;  1DVD A;  4MMZ B;  5ELJ A;  1FZU A;  1IT7 A;  1NO3 A;  1ROA A;  2WOH A;  4DKI A;  1LNI A;  5STD A;  3WDG B;  1UUG B;  3F7X A;  2F98 A;  3JUM A;  1WNH A;  1Q42 A;  1BOX A;  1ASK A;  1RTU A;  1ZS7 A;  3KII A;  4STD A;  2W04 A;  3SYU A;  1SPU A;  2STD A;  3Q3F A;  4LSO A;  1NNV A;  4X2H A;  1W2B 2;  1W01 A;  1RJO A;  4G1M B;  2CKF B;  4O8S A;  2UGI A;  3ZG5 A;  1RRH A;  1I2G A;  3DGO A;  3X3X A;  2K3D A;  2OOV A;  1JB5 A;  4Q53 A;  2CIU A;  5EQL A;  4KVH A;  4AKZ A;  2HMJ B;  1M9G A;  1LVN A;  2P0M A;  4K1U A;  1VQM 3;  4KFE A;  1QAK A;  1YGE A;  1TRQ A;  1MWS A;  1W7C A;  1RRL A;  3MWZ A;  2HMK B;  5IF6 A;  1UDI I;  1EEJ A;  1T2H A;  1X1U A;  4EC6 A;  1VQP 3;  5JPP A;  3CCR 3;  1RNT A;  1C54 A;  2XF3 A;  3S28 A;  1FGO A;  3EBY A;  3D3L A;  4PEJ A;  4WYK B;  4FCJ A;  1OCV A;  2CFD A;  3F8X A;  2BO9 B;  2W9P A;  3NQZ A;  3VGN A;  2MC8 A;  1Q9E A;  1W02 A;  3FG1 A;  4FCZ A;  1IT8 A;  4N6M A;  3AGN A;  5EEO A;  3I56 3;  3KCH A;  2QEX 3;  1CYU A;  4FR9 A;  4L8O A;  2WGO A;  1M90 4;  1TFO A;  3LTC A;  3QRD A;  1PFP A;  2ZDJ A;  1RN4 A;  3DUK A;  4N6L A;  1PYL A;  3DGL A;  2LQV A;  3WA2 X;  3OWU A;  4N6V 0;  3CPW 2;  3G0K A;  5IEN A;  4H61 A;  1KQS 2;  3EN8 A;  1BRN L;  4ZM8 A;  1JB4 A;  1ULJ B;  2O9U X;  1UCK A;  3RGA A;  3SVA A;  2CW9 A;  2W6J H;  1GSP A;  4N6N B;  3BB9 A;  4O02 B;  3X3Z A;  3UJM A;  1IVV A;  2ML5 A;  3NUV A;  3FH1 A;  1N8R 4;  2KAA A;  1KSI A;  1BIR A;  1YVS A;  3MG3 A;  1MWU A;  2FNQ A;  1HYF A;  3AHW A;  1D6U A;  1NB5 I;  2ZHX B;  2IUK A;  1IVW A;  1CQS A;  3D4A A;  1BVI A;  5M19 A;  3CC4 3;  3BIR A;  3M8C A;  3NBJ A;  1YIJ 3;  1FGT A;  1W4N A;  4J5G A;  4J5K A;  1GS3 A;  2CC3 A;  3NXJ A;  5HOH A;  1LRA A;  1S5A A;  3CC2 3;  3PCS A;  4JF8 A;  1D6Y A;  1DET A;  3GZY B;  1OHO A;  5CF2 A;  3UL5 A;  3NQY A;  3SOY A;  1BRJ A;  4J8T A;  4HZ9 B;  4WHA A;  2ZL8 A;  4AKY A;  2W9Q A;  2F99 A;  2RGQ A;  3HI7 A;  4EXR A;  2MF7 A;  4XDV A;  2XSH B;  4GB5 A;  1QAF A;  1GOY A;  3VSY A;  3CME 3;  2KRT A;  4K90 B;  1RGK A;  1OAC A;  1Q40 B;  4HOH A;  3X3Y A;  1Q40 A;  1K73 4;  1TTO A;  2RCD A;  2BMR B;  3NBB A;  1EQK A;  1LOX A;  2FXT A;  1AR0 A;  1VQ4 3;  3WMD A;  1OGX A;  3PCR A;  1TRP A;  4BTY A;  5IEO A;  2W56 B;  4K61 A;  5IG5 A;  1UW1 A;  3NM7 A;  1SIH A;  1GOU A;  1YHQ 3;  5IEP A;  1DE3 A;  2R41 A;  3LXU X;  3BND A;  5IG3 A;  1GMR A;  2BMQ B;  3OXA A;  3LTA A;  3S29 A;  1LQG C;  1IV7 A;  1UCJ A;  3AGO A;  3L0R A;  1I8V A;  2WOF A;  1PY3 A;  1N8Q A;  3WOD G;  2H0G A;  3CPO A;  1IYY A;  3D9R A;  2CG0 A;  3CD6 3;  1K41 A;  3PS8 A;  1FUT A;  1AVK A;  5D82 A;  1OHS A;  3NM2 A;  4IT7 A;  4XM4 A;  5HGR A;  2CFG A;  1BU4 A;  2E2V A;  1KWI A;  1HU9 A;  1RGE A;  4HJL B;  2JQ5 A;  4HZB B;  3GRD A;  3T8N A;  2CFW A;  4NHF A;  4BL2 A;  1T2I A;  1YJW 3;  3OWY A;  2WO0 A;  1BNI A;  1CH0 A;  1DMM A;  3DM8 A;  4WYK A;  3F9S A;  1F8N A;  1K9M 4;  1GMP A;  2GBW B;  2ML6 A;  3UL6 A;  1JV2 B;  3GZR A;  3MG2 A;  1I0X A;  1IDP A;  3GZX B;  3G16 A;  4BTW A;  7STD A;  3ZG0 A;  3BNE A;  3V99 A;  3Q1C A;  2B1X B;  1N9J A;  2LYX A;  1J2B A;  1O7M B;  1JJ2 2;  1E97 A;  3CCJ 3;  4OK0 A;  1KD1 4;  1B20 A;  1NJI 4;  4FCM A;  1VQ6 3;  3CMA 3;  1GY5 A;  3WHO A;  1BRS A;  1I3I A;  4LGQ A;  3N9H A;  4LMI A;  1IVX A;  3BU4 A;  2XH9 A;  3RDE A;  4EV5 A;  1JBT A;  1T3B A;  1JN5 A;  1B2M A;  2IA7 A;  4WWU C;  2E2U A;  4HM8 B;  3CXC 2;  1JNQ A;  1Y4K A;  1DMQ A;  4N6O B;  4RZM A;  5M1A A;  5CLK A;  3CCV 3;  4R1K A;  1G96 A;  1AY7 A;  3DGM A;  3N8B A;  4OVM A;  1FGQ A;  1GY6 A;  3DY5 A;  1EUI C;  2W0Q A;  4KFF A;  1N5P A;  1UCL A;  3LZA A;  5CF1 A;  2K0M A;  1IV9 A;  2M7O A;  2V1L A;  2Z76 A;  3F40 A;  3ER7 A;  4L8P A;  2GEY A;  2CX0 A;  4R9L A;  4HKV B;  1EA2 A;  2INX A;  4N6T A;  7GSP A;  3X41 A;  1UCI A;  4FMC A;  1GD3 A;  5IW9 A;  1SQW A;  1BAN A;  3SX1 A;  6GSP A;  1LNH A;  3OV4 A;  1QMA A;  4CCV A;  2BT3 A;  1PU4 A;  1RKY A;  1UI7 A;  1B27 A;  3WOF B;  1STD A;  5DRV A;  3ZFZ A;  3U97 A;  2W03 A;  3U1W A;  8CHO A;  3CNM A;  1MWR A;  5KP3 A;  4CPK A;  1B2S A;  1RSN A;  2Y73 A;  5AIG A;  3F8H A;  5FGO A;  3ROB A;  1E3R A;  2CX1 A;  1EKM A;  2GXF A;  3DGY A;  3BNB A;  1Q7H A;  2KF3 A;  3LT8 A;  1YJ9 3;  2OQE C;  3UB1 A;  2R4I A;  2JDI H;  1VQ8 3;  3NV0 A;  2CFK A;  4RNZ A;  1KC8 4;  2OTL 3;  1SAR A;  1RGF A;  1HZ1 A;  1U5O A;  1RN1 A;  5AI1 A;  3CCQ 3;  1X1X A;  1FW7 A;  4MMY B;  3D79 A;  3I55 3;  1C7H A;  1WTH A;  1TFK A;  2XFS A;  3MSO A;  2I9W A;  5AYS C;  3WOE B;  1V58 A;  2GEX A;  2GU3 A;  3ALA A;  5I97 A;  1WMP A;  5AEU B;  1RNB A;  1RLS A;  3PGB A;  3HII A;  1A2V A;  2CHC A;  4ORL A;  1L5G B;  2YFL B;  4HAA A;  2ZA4 A;  4O3V A;  3FGY A;  2FGT A;  2GBX B;  3B4P A;  3T8U A;  4L7K A;  1RHL A;  2Z7A A;  3X42 A;  1IQ8 A;  6RNT A;  3FG4 A;  5RNT A;  1V74 A;  3FCS B;  4I4K A;  1TUH A;  1BUJ A;  5D81 A;  2HML B;  3F7S A;  2CFL A;  1W6Y A;  4LZI A;  1IVU A;  1LOW A;  1Q81 4;  1QAL A;  4GL6 A;  4X2O A;  4OUQ A;  4EBG A;  3G6E 3;  5BVB A;  1S72 3;  1FGM A;  3RGR A;  1UGI A;  2CK3 H;  4GSP A;  1BGS A;  1GY7 A;  3EF8 A;  1GOV A;  2UX0 A;  2Z77 A;  3GZB A;  3LOY A;  3JVC A;  2A15 A;  3DH2 A;  3BNC A;  2C10 A;  1W6G A;  3AMO B;  1MGW A;  1RDS A;  2XEP A;  2F4Y A;  3OW2 2;  4AEQ A;  2W56 A;  2QGU A;  1RGA A;  1TJD A;  3G71 3;  1IQX A;  4LEH A;  2HMM B;  2D1W A;  5G1K A;  2CG1 A;  1GYB A;  4FMB A;  4N3V A;  1VQK 3;  8RNT A;  2HMO B;  1HKX A;  1MWT A;  5JPU A;  3F14 A;  2KF4 A;  1VQL 3;  2B24 B;  2XGN A;  1WQL B;  3CNX A;  4NRE A;  1VQ7 3;  3KSP A;  3PXM A;  1W6C A;  3EQQ B;  5DRE A;  4NPB A;  2SBL A;  2PZV A;  1STF I;  2OOV C;  2XR8 B;  3N54 B;  1BAO A;  4MJD A;  5LC6 A;  5IG0 A;  2GU1 A;  3V98 A;  3IPT A;  2YFJ B;  4HM0 B;  3FF2 A;  1DYU A;  4HM1 B;  4HM2 B;  3EJV A;  2Y74 A;  4HYZ A;  3KN4 A;  1G02 A;  3EHC A;  3JUQ A;  3KSE D;  1I3F A;  1X1Y A;  2C11 A;  1BRI A;  3K63 A;  3OWS A;  5AIH A;  6STD A;  2C4B A;  3Q90 A;  5AIF A;  2OTJ 3;  2IY2 A;  1DMN A;  1BNS A;  1JKG A;  1O7P B;  1T5Y A;  4XB5 A;  1AVL A;  3FZW A;  5KP1 A;  1JB2 A;  2YX9 A;  2UUG C;  3DGN A;  3A5E A;  5EVH A;  3EN1 B;  2CWU A;  5GSP A;  3PYJ A;  4R9K A;  3MPH A;  3TDG A;  1ISK A;  2KCD A;  3GSP A;  4N6U A;  3KZT A;  1JBS A;  3DMC A;  3KE7 A;  2SAR A;  3FKA A;  4KT3 B;  3CC7 3;  5BIR A;  3D5I A;  2CWV A;  3LH4 A;  3MG1 A;  3V92 A;  1Z1S A;  4BTX A;  2KXG A;  2F5M A;  1BSA A;  1OGZ A;  2XGL A;  2IUJ A;  1IQY A;  2Z6B A;  5ELU A;  3S67 A;  1YI2 3;  1K8A 4;  1JRQ A;  1BNR A;  4FMA A;  3HK4 A;  5LC7 A;  3SLU A;  1M1X B;  1NDO B;  2XSO B;  3EBT A;  1IU7 A;  2W2C A;  3Q2P A;  3SXX A;  4IPB A;  4HM7 B;  4ILF A;  4GHO A;  3OX9 A;  1JZO A;  1BUQ A;  1K28 A;  3BLZ A;  1BRG A;  1I2E A;  3KFQ C;  2IMJ A;  5JBS A;  2E2T A;  1NU3 A;  1GMQ A;  5AEW B;  4CJN A;  2F5W A;  5D83 A;  4MEI A;  1O7G B;  1LOV A;  1A2K A;  1OF5 A;  3IJE B;  4RBN A;  3KKG A;  2WGQ A;  1BSB A;  1Q82 4;  3AMO A;  3J7Y d;  1VQO 3;  3CCU 3;  3EE1 A;  3MYT A;  1FYS A;  3MHE A;  4HM5 B;  1RGG A;  1YNV X;  2P05 A;  1BSD A;  1OH0 A;  4J9A A;  1FUW A;  3EX9 A;  5AYR B;  3FG3 A;  5AII A;  3CCL 3;  1EG9 B;  2OWP A;  4XBT A;  2RNT A;  2OCT A;  1E3V A;  3QK9 A;  1NWW A;  4KZ1 A;  1FA3 A;  3K0Z A;  1V57 A;  1US1 A;  1R4C A;  3B4O A;  1N9E A;  3K5T A;  9RNT A;  1G0T A;  1NB3 I;  1B2Z A;  4RNT A;  3CCS 3;  4O2H A;  1W00 A;  1OHP A;  3HZP A;  4BIR A;  1N5H A;  1ULI B;  5M18 A;  1BRH A;  1X1W A;  1M1K 4;  1A2P A;  1LQM B;  1ZO2 A;  3AHS A;  1YVB I;  4WFO A;  3JUN A;  2HOH A;  1B21 A;  1YGW A; 
#chains in the Genus database with same CATH homology
 2Q07 A;  5IER A;  2RSX A;  1VQN 3;  1OPY A;  3LTB A;  4RNY A;  5IG4 A;  4U13 A;  1O7W B;  5CK6 A;  1TP6 A;  2BMO B;  1TIJ A;  3O8Y A;  1YJN 3;  3STD A;  4XBX A;  1QVG 2;  4R4K A;  3GWR A;  3FSD A;  1TU5 A;  4K1V A;  1O7H B;  3LML A;  1GD4 A;  2D42 A;  2XRX B;  1Q7Y 4;  1JN5 B;  3SOA A;  5G2G A;  3FLJ A;  3HX8 A;  4QWT A;  1WMN A;  4XBY A;  2QIY A;  4EYC A;  3UNL A;  1SII A;  5A0O B;  3WA3 A;  1MNL A;  2L4V A;  4JRF A;  3LTD A;  4H3U A;  3DXO A;  3HIG A;  1SJW A;  2PNC A;  3EC9 A;  1VZZ A;  1DVC A;  3S5C A;  2K54 A;  2CWT A;  5FW5 A;  1IK3 A;  3A76 A;  5TGN A;  3E99 A;  1UI8 A;  3CU3 A;  3ECF A;  3G4S 3;  1RN7 A;  3CCE 3;  1MOL A;  2BHM A;  3LYG A;  3S27 A;  3VF1 A;  1JKG B;  2OQE A;  3LT9 A;  2P38 A;  3CCM 3;  4HM6 B;  4HM4 B;  3B8L A;  3NV0 B;  1LXE A;  4HBR A;  1ROV A;  1W2Z A;  1Q86 4;  4MMX B;  2P09 A;  4FMD A;  4TX4 A;  3H3H A;  1OF5 B;  1ZX2 A;  3PZW A;  4WP5 A;  3NHX A;  1CEW I;  2P0X A;  1W5Z A;  4R80 A;  2CH9 A;  1A67 A;  3K7C A;  3K9M C;  1UUV B;  4HM3 B;  1VQ5 3;  1QJG A;  3H51 A;  3GAX A;  1YIT 3;  5BXQ A;  3NBR A;  1AV4 A;  2RFR A;  3JUP A;  3B7C A;  1A90 A;  5CXO A;  3IMA B;  1U8C B;  1WMO A;  2YFI B;  1FGR A;  1UUW B;  2HMN B;  2QA4 3;  4XDW A;  1CYV A;  4HVN A;  1O7N B;  3I0Y A;  1OUN A;  5KP4 A;  3DZL A;  3X40 A;  2BNG A;  3MKI A;  3EB8 A;  3NX0 A;  3G8Z A;  2O3O A;  2XFT A;  3SED A;  1D6Z A;  4EV2 A;  1VQ9 3;  2F86 B;  3JUO A;  4KFD A;  4IIA A;  3T0U A;  4CDL A;  1QVF 2;  3FF0 A;  1DVD A;  4MMZ B;  5ELJ A;  1IT7 A;  1NO3 A;  1ROA A;  2WOH A;  5STD A;  3WDG B;  3F7X A;  2F98 A;  3JUM A;  1WNH A;  1Q42 A;  3KII A;  1ASK A;  4STD A;  2W04 A;  1SPU A;  2STD A;  4LSO A;  4X2H A;  1W2B 2;  1W01 A;  1RJO A;  4G1M B;  2CKF B;  4O8S A;  1RRH A;  3X3X A;  3DGO A;  2OOV A;  1JB5 A;  4Q53 A;  2CIU A;  5EQL A;  4KVH A;  4AKZ A;  2HMJ B;  1M9G A;  1LVN A;  2P0M A;  4K1U A;  1VQM 3;  4KFE A;  1QAK A;  1YGE A;  1W7C A;  1RRL A;  3MWZ A;  2HMK B;  5IF6 A;  4EC6 A;  1VQP 3;  5JPP A;  3CCR 3;  2XF3 A;  3S28 A;  1FGO A;  3EBY A;  3D3L A;  4PEJ A;  4WYK B;  4FCJ A;  1OCV A;  2CFD A;  3F8X A;  2BO9 B;  2W9P A;  3NQZ A;  3VGN A;  2MC8 A;  1W02 A;  4FCZ A;  3FG1 A;  1IT8 A;  4N6M A;  5EEO A;  3I56 3;  2QEX 3;  1CYU A;  4FR9 A;  4L8O A;  2WGO A;  1M90 4;  1TFO A;  3LTC A;  3QRD A;  1PFP A;  2ZDJ A;  3DUK A;  4N6L A;  3DGL A;  2LQV A;  3WA2 X;  3OWU A;  4N6V 0;  3CPW 2;  3G0K A;  5IEN A;  4H61 A;  1KQS 2;  3EN8 A;  4ZM8 A;  1JB4 A;  1ULJ B;  2O9U X;  3RGA A;  3SVA A;  2CW9 A;  2W6J H;  4N6N B;  3BB9 A;  4O02 B;  3X3Z A;  3UJM A;  1IVV A;  2ML5 A;  3NUV A;  3FH1 A;  1N8R 4;  1KSI A;  3MG3 A;  2FNQ A;  1D6U A;  1NB5 I;  2IUK A;  1IVW A;  1CQS A;  3CC4 3;  3M8C A;  3NBJ A;  1YIJ 3;  1FGT A;  1W4N A;  1GS3 A;  2CC3 A;  3NXJ A;  3CC2 3;  1S5A A;  3PCS A;  4JF8 A;  1D6Y A;  3GZY B;  1OHO A;  5CF2 A;  3UL5 A;  3NQY A;  3SOY A;  4J8T A;  4HZ9 B;  4WHA A;  2ZL8 A;  4AKY A;  2W9Q A;  2F99 A;  2RGQ A;  3HI7 A;  4EXR A;  2MF7 A;  4XDV A;  2XSH B;  4GB5 A;  1QAF A;  3VSY A;  3CME 3;  2KRT A;  4K90 B;  1OAC A;  1Q40 B;  3X3Y A;  1Q40 A;  1K73 4;  2RCD A;  2BMR B;  3NBB A;  1EQK A;  1LOX A;  2FXT A;  1AR0 A;  1VQ4 3;  3WMD A;  1OGX A;  3PCR A;  4BTY A;  5IEO A;  2W56 B;  4K61 A;  5IG5 A;  1UW1 A;  3NM7 A;  1SIH A;  1YHQ 3;  5IEP A;  3LXU X;  5IG3 A;  3BND A;  2BMQ B;  3OXA A;  3S29 A;  3LTA A;  1IV7 A;  3L0R A;  2WOF A;  1N8Q A;  3WOD G;  3CPO A;  3D9R A;  2CG0 A;  3CD6 3;  1K41 A;  3PS8 A;  1AVK A;  5D82 A;  1OHS A;  3NM2 A;  4IT7 A;  4XM4 A;  5HGR A;  2CFG A;  2E2V A;  1KWI A;  1HU9 A;  4HJL B;  2JQ5 A;  4HZB B;  3GRD A;  3T8N A;  2CFW A;  4NHF A;  1YJW 3;  3OWY A;  2WO0 A;  1DMM A;  3DM8 A;  4WYK A;  3F9S A;  1F8N A;  1K9M 4;  2GBW B;  2ML6 A;  3UL6 A;  1JV2 B;  3GZR A;  3MG2 A;  1IDP A;  3GZX B;  3G16 A;  4BTW A;  7STD A;  3BNE A;  3V99 A;  3Q1C A;  2B1X B;  1N9J A;  2LYX A;  1J2B A;  1O7M B;  1JJ2 2;  1E97 A;  3CCJ 3;  4OK0 A;  1KD1 4;  1NJI 4;  4FCM A;  1VQ6 3;  3CMA 3;  1GY5 A;  4LGQ A;  3N9H A;  4LMI A;  1IVX A;  2XH9 A;  3RDE A;  4EV5 A;  1JN5 A;  2IA7 A;  4WWU C;  2E2U A;  4HM8 B;  3CXC 2;  1JNQ A;  1Y4K A;  1DMQ A;  4N6O B;  4RZM A;  5CLK A;  3CCV 3;  4R1K A;  1G96 A;  3DGM A;  3N8B A;  4OVM A;  1FGQ A;  1GY6 A;  3DY5 A;  2W0Q A;  4KFF A;  1N5P A;  3LZA A;  5CF1 A;  2K0M A;  1IV9 A;  2M7O A;  2V1L A;  2Z76 A;  3F40 A;  3ER7 A;  4L8P A;  2GEY A;  4R9L A;  4HKV B;  1EA2 A;  2INX A;  4N6T A;  3X41 A;  4FMC A;  1GD3 A;  5IW9 A;  1SQW A;  3SX1 A;  1LNH A;  3OV4 A;  1QMA A;  4CCV A;  2BT3 A;  1PU4 A;  1RKY A;  1UI7 A;  3WOF B;  1STD A;  5DRV A;  3U97 A;  2W03 A;  3U1W A;  8CHO A;  3CNM A;  5KP3 A;  2Y73 A;  5AIG A;  3F8H A;  5FGO A;  3ROB A;  1E3R A;  1EKM A;  2GXF A;  3BNB A;  3LT8 A;  1YJ9 3;  2OQE C;  3UB1 A;  2R4I A;  2JDI H;  1VQ8 3;  3NV0 A;  2CFK A;  4RNZ A;  1KC8 4;  2OTL 3;  1U5O A;  5AI1 A;  3CCQ 3;  4MMY B;  3I55 3;  2XFS A;  1C7H A;  1WTH A;  1TFK A;  3MSO A;  2I9W A;  5AYS C;  3WOE B;  2GEX A;  2GU3 A;  3ALA A;  5I97 A;  1WMP A;  5AEU B;  3PGB A;  3HII A;  1A2V A;  2CHC A;  4ORL A;  1L5G B;  2YFL B;  4O3V A;  3FGY A;  2FGT A;  2GBX B;  3B4P A;  3T8U A;  4L7K A;  2Z7A A;  3X42 A;  1IQ8 A;  3FG4 A;  1V74 A;  3FCS B;  4I4K A;  1TUH A;  5D81 A;  2HML B;  3F7S A;  2CFL A;  1W6Y A;  4LZI A;  1IVU A;  1Q81 4;  1QAL A;  4GL6 A;  4X2O A;  4OUQ A;  4EBG A;  3G6E 3;  5BVB A;  1S72 3;  1FGM A;  3RGR A;  2CK3 H;  1GY7 A;  3EF8 A;  2UX0 A;  2Z77 A;  3GZB A;  3LOY A;  3JVC A;  2A15 A;  3BNC A;  2C10 A;  1W6G A;  3AMO B;  2XEP A;  3OW2 2;  4AEQ A;  2W56 A;  2QGU A;  3G71 3;  1IQX A;  4LEH A;  2HMM B;  2D1W A;  2CG1 A;  1VQK 3;  1GYB A;  4FMB A;  4N3V A;  2HMO B;  1HKX A;  5JPU A;  3F14 A;  1VQL 3;  2B24 B;  2XGN A;  1WQL B;  3CNX A;  4NRE A;  1VQ7 3;  3KSP A;  3PXM A;  1W6C A;  3EQQ B;  5DRE A;  2SBL A;  2PZV A;  1STF I;  2OOV C;  2XR8 B;  3N54 B;  4MJD A;  5LC6 A;  3V98 A;  5IG0 A;  2GU1 A;  3IPT A;  2YFJ B;  4HM0 B;  3FF2 A;  1DYU A;  4HM1 B;  4HM2 B;  3EJV A;  2Y74 A;  4HYZ A;  3KN4 A;  3EHC A;  3JUQ A;  3KSE D;  2C11 A;  3K63 A;  3OWS A;  5AIH A;  6STD A;  5AIF A;  3Q90 A;  2OTJ 3;  1DMN A;  1JKG A;  1O7P B;  1T5Y A;  4XB5 A;  1AVL A;  3FZW A;  5KP1 A;  1JB2 A;  2YX9 A;  3DGN A;  5EVH A;  3EN1 B;  2CWU A;  3PYJ A;  4R9K A;  3MPH A;  3TDG A;  1ISK A;  2KCD A;  4N6U A;  3KZT A;  3DMC A;  3KE7 A;  3FKA A;  3CC7 3;  2CWV A;  3LH4 A;  3MG1 A;  3V92 A;  1Z1S A;  4BTX A;  2KXG A;  2XGL A;  1OGZ A;  2IUJ A;  1YI2 3;  1IQY A;  2Z6B A;  5ELU A;  3S67 A;  1K8A 4;  1JRQ A;  4FMA A;  3HK4 A;  5LC7 A;  3SLU A;  1M1X B;  1NDO B;  2XSO B;  3EBT A;  1IU7 A;  2W2C A;  3Q2P A;  3SXX A;  4IPB A;  4HM7 B;  3OX9 A;  1BUQ A;  1K28 A;  3BLZ A;  3KFQ C;  2IMJ A;  5JBS A;  2E2T A;  1NU3 A;  5AEW B;  5D83 A;  4MEI A;  1O7G B;  1A2K A;  1OF5 A;  3IJE B;  4RBN A;  3KKG A;  2WGQ A;  1Q82 4;  3AMO A;  3J7Y d;  1VQO 3;  3CCU 3;  3EE1 A;  3MYT A;  3MHE A;  4HM5 B;  2P05 A;  4J9A A;  1OH0 A;  1FUW A;  3EX9 A;  5AYR B;  3FG3 A;  5AII A;  3CCL 3;  1EG9 B;  2OWP A;  4XBT A;  2OCT A;  1E3V A;  3QK9 A;  1NWW A;  4KZ1 A;  1FA3 A;  3K0Z A;  1US1 A;  1R4C A;  3B4O A;  1N9E A;  3K5T A;  1NB3 I;  3CCS 3;  4O2H A;  1W00 A;  1OHP A;  3HZP A;  1N5H A;  1ULI B;  1M1K 4;  1ZO2 A;  1YVB I;  4WFO A;  3JUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...