4HM1B

Naphthalene 1,2-dioxygenase bound to 1-indanone
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to 1-indanone
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 55
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm1B00
1UUWB 3MSOA 3EN1B 1AR0A 2GEXA 3ER7A 1JB5A 3H3HA 2CKFB 5JPUA 3OXAA 3B8LA 5TGNA 2F86B 2JQ5A 3MG2A 1W00A 5CXOA 5AIFA 1DMNA 1OGXA 3CU3A 4HM7B 5G2GA 4HM5B 3JUQA 5IERA 4X2OA 3JUMA 1NU3A 2XRXB 3T8NA 4LEHA 2B24B 1VZZA 1E97A 4OUQA 3SOYA 1EG9B 2QGUA 3MG3A 3SEDA 1JB4A 3ROBA 1Q42A 1OPYA 3CNXA 1O7PB 3F7XA 5IG0A 6STDA 2Z77A 1OGZA 5BVBA 2YFLB 3RGRA 3VSYA 3EQQB 3NBRA 3NV0B 4XDWA 4FCJA 5KP3A 3K7CA 3EBTA 8CHOA 1E3VA 5IEOA 3WMDA 3LYGA 4HM4B 1BUQA 1O7MB 1W6YA 1WQLB 2F99A 5AEUB 4STDA 2RGQA 5DREA 1STDA 2OWPA 3IPTA 2INXA 3I0YA 2HMNB 3FH1A 2PZVA 3KSPA 3DXOA 3FSDA 4HM8B 1C7HA 3GZXB 1OCVA 4FCMA 4HM2B 1O7NB 3OX9A 4H3UA 3LZAA 1OH0A 5IG3A 2BMOB 3EF8A 1JN5A 1OHOA 5AIGA 2Z7AA 2BNGA 3RGAA 1GS3A 2QIYA 1U5OA 5IG4A 4OVMA 1SJWA 1NDOB 5FW5A 3F14A 3B4PA 5AIHA 1GY6A 1W01A 3H51A 4WWUC 5CLKA 1S5AA 1OF5B 4U13A 5CF1A 2UX0A 1ASKA 4R9LA 5BXQA 1ULJB 4J8TA 3OWSA 5KP4A 5DRVA 3BB9A 3F8HA 2GBXB 3A76A 4L8OA 5JPPA 3F7SA 3MYTA 1NWWA 2W2CA 5EVHA 2GXFA 3MHEA 3NHXA 1JKGB 3CPOA 1GY7A 4L7KA 1TUHA 4WYKB 2GBWB 5D83A 2HMLB 3EC9A 3EJVA 2Z76A 1OHPA 5D81A 2RFRA 5IENA 1Q40A 1UUVB 2B1XB 4ORLA 4LMIA 3SOAA 5STDA 2GEYA 4CDLA 3HK4A 3JUOA 4L8PA 3GZYB 4R1KA 2R4IA 2HMMB 3MG1A 4R9KA 3KKGA 1OHSA 1HKXA 3K0ZA 5CF2A 4HZBB 1CQSA 3FZWA 4GB5A 2IMJA 2YFJB 7STDA 4LGQA 4XBTA 4XDVA 3G8ZA 3EHCA 4XM4A 2YFIB 3DUKA 3CNMA 3FF0A 4HJLB 4HM6B 1E3RA 4MJDA 3D9RA 1A2KA 4I4KA 3EBYA 1GYBA 2XSOB 4WP5A 4XBXA 3NV0A 3VGNA 4X2HA 3KE7A 3UJMA 3DMCA 1EA2A 4HM3B 1K41A 2HMKB 5AIIA 1TP6A 2K54A 3FGYA 3MKIA 3DM8A 3UNLA 3NUVA 2XSHB 4Q53A 3NM2A 1QMAA 4HZ9B 3B7CA 1GY5A 3E99A 3BLZA 4XBYA 3S5CA 1O7WB 3JUPA 1JN5B 5CK6A 2HMOB 5D82A 2F98A 3GWRA 4HM1B 3ECFA 1JB2A 2BMQB 3G16A 1IDPA 3FLJA 4HKVB 3M8CA 4J9AA 3F9SA 3EX9A 3G0KA 4N3VA 4HVNA 1ZX2A 4IIAA 2BMRB 1O7HB 4KVHA 3HZPA 1DMQA 2RCDA 3OWUA 3DZLA 3FF2A 2I9WA 1OF5A 3JUNA 4K1VA 3GRDA 1ZO2A 3KZTA 1OUNA 3T8UA 3EN8A 4K1UA 5KP1A 3B4OA 1O7GB 3F40A 5IF6A 5IG5A 1ISKA 2HMJB 3NXJA 2CHCA 5IEPA 5AI1A 4XB5A 4HM0B 1DMMA 3F8XA 5AEWB 1JKGA 2XR8B 3Q90A 4PEJA 3GZBA 3GZRA 2A15A 4RZMA 4WYKA 5HGRA 3STDA 1W02A 1QJGA 3OV4A 1Q40B 3FKAA 1ULIB 1Z1SA 2STDA 3HX8A 3OWYA
chains in the Genus database with same CATH superfamily
1UUWB 3PCSA 3MSOA 3EN1B 1AR0A 1GOYA 2GEXA 3G4S3 4CCVA 2P38A 1LNIA 4RBNA 1YIJ3 3ER7A 2XF3A 4GHOA 1JB5A 2CFLA 4EXRA 3G713 1YNVX 3AGOA 1A67A 3H3HA 1IVWA 2CKFB 3T0UA 1ROAA 1W6CA 1K8A4 3ZFZA 5JPUA 3OXAA 3B8LA 2GSPA 5TGNA 1PYLA 2F86B 3LTAA 2JQ5A 3D4AA 5ELUA 3MG2A 3WOEB 1W00A 3WHOA 2AAEA 1SIIA 2SBLA 5CXOA 5AIFA 3CC73 1DMNA 3CCS3 2CW9A 4N6V0 1BSDA 3SXXA 2C10A 5A0OB 2OCTA 3DGOA 1BNSA 2CWUA 4HBRA 3S5CA 3CCM3 1BVIA 1OGXA 4RNZA 2KAAA 3CU3A 4HM7B 5G2GA 1I3IA 4HM5B 3JUQA 5IERA 4KFDA 4X2OA 2BHMA 2E2TA 3JUMA 4RNTA 1X1XA 1JZOA 4EW5A 1UW1A 1NB5I 1NB3I 4FR9A 1NNVA 1NU3A 1FUWA 1WMPA 3TDGA 3ZG0A 2XRXB 3N54B 4LYLB 3T8NA 1TTOA 1IQ8A 4LEHA 2B24B 1S723 1VZZA 1RN7A 2E2VA 1E97A 3QK9A 4OUQA 1UDII 2W9QA 1JV2B 4BTXA 3Q2PA 1KD14 3SOYA 1CYUA 1EG9B 2QGUA 3MG3A 3K63A 3SEDA 1VQK3 1BNRA 1JB4A 1SIHA 1N8QA 2BU4A 4TX4A 3X3ZA 1BNIA 3ROBA 1ZS7A 1JNQA 1OPYA 1Q42A 1BU4A 5LC7A 4N6OB 4ILFA 3CNXA 3X3YA 2CFGA 1ROVA 1CEWI 1TFKA 1O7PB 2FXTA 2H0GA 1YVBI 1D6UA 3F7XA 5IG0A 6STDA 2Z77A 1OGZA 5BVBA 3A5EA 4MMYB 5RNTA 1M904 3X3XA 2YFLB 1RJOA 1HZ1A 3NBJA 3RGRA 1WTHA 2CC3A 2PNCA 3VSYA 4AEQA 3SLUA 5AYRB 1W6GA 1FGTA 3EQQB 2OTJ3 1MWSA 4AKZA 1I0XA 2IUJA 2KF5A 2CWVA 1IV7A 1B27A 3NBRA 3NV0B 3RDEA 1I2EA 7GSPA 1VQP3 1HYFA 3VF1A 1X1UA 1M1XB 4XDWA 5HOHA 3G6E3 1LVNA 3V99A 4FCJA 3K7CA 1UGHI 2CFWA 5GSPA 5KP3A 2H0HA 3D5GA 2KXGA 3EBTA 3KFQC 1MWTA 2XGNA 4JRFA 1MNLA 8CHOA 1E3VA 1BRKA 1LNHA 3AMOB 3DGMA 3LTCA 5IEOA 3N8BA 1TIJA 3WMDA 1VQ83 2GU3A 3BU4A 3LYGA 4HM4B 1LOVA 1YI23 1BUQA 3BNCA 2ML6A 1V57A 1GMQA 1O7MB 1W6YA 2W6JH 3PYJA 1RGGA 1WQLB 1BRIA 1VQO3 2F99A 1W7CA 2V1LA 3HIIA 5AEUB 2BT3A 3BIRA 4FCZA 4EV5A 4STDA 2RGQA 4N6TA 5M19A 5DREA 3WR2A 1STDA 3IMAB 2OWPA 2ZHXB 1B2SA 2INXA 3HOHA 2HMNB 3I0YA 3IPTA 1RDSA 3NM7A 1RHLA 3FH1A 2PZVA 2UUGC 1FZUA 1TU5A 3KSPA 3LH4A 1RN1A 2CH9A 1RCLA 2K3DA 3DGLA 3DXOA 3FSDA 3X40A 4HM8B 1C7HA 3GZXB 3CMA3 1TRQA 1OCVA 1OACA 2F4YA 4FCMA 1DVCA 1R4YA 1RGEA 2KF3A 4FMDA 4N6LA 4NHFA 5IW9A 1B2MA 4FMBA 4AKYA 1Q824 1LQMB 4RNYA 1W2ZA 4HM2B 3SYUA 5M18A 1X1YA 1O7NB 4O2HA 5EQLA 3OX9A 4BU4A 4CJNA 1G0TA 4N6MA 1N9JA 2CK3H 4H3UA 1LOYA 2BIRA 3HI7A 3LZAA 3WA2X 3CCL3 1JZDA 1OH0A 3U1WA 1VQ53 2K0MA 2MC8A 5IG3A 2W04A 2CX1A 2BMOB 3EF8A 1RRLA 1JN5A 1OHOA 5AIGA 3FCSB 2Z7AA 1UI8A 2BNGA 3RGAA 1GS3A 2D42A 3L0RA 2CG1A 2QIYA 1B20A 1UCIA 1U5OA 1RN4A 2YX9A 1M9GA 5JBSA 3PCRA 5IG4A 4OVMA 3UL6A 1SJWA 1FUTA 1IT7A 1NDOB 1AV4A 5FW5A 3F14A 3B4PA 3BNEA 3FG3A 1YJW3 3K5TA 1CYVA 1QAFA 5AIHA 1PY3A 1RNBA 1GY6A 3MPHA 1W01A 1MWUA 1UCKA 2WGQA 2QA43 1AVKA 4MMXB 3H51A 3PZWA 1BANA 2OOVC 4WWUC 1RGCA 1UCLA 5CLKA 5BU4A 1S5AA 1OF5B 4U13A 1RGLA 5CF1A 2LQVA 3PGBA 2UX0A 2ZL8A 1BGSA 1ASKA 1BRSA 4R9LA 5BXQA 1VQQA 3U97A 4BIRA 1ULJB 2IY2A 3WOFB 4J8TA 3OWSA 2L4VA 5KP4A 5DRVA 1IV9A 3GAXA 3BB9A 3F8HA 2GBXB 2OTL3 2Y73A 1JBSA 1KQS2 1B21A 3A76A 2OOVA 1T5YA 4L8OA 5JPPA 1IVVA 3F7SA 3MYTA 1NWWA 2W2CA 1EEJA 1BRNL 3KSED 1GMRA 1RGFA 5EVHA 1LOXA 9RNTA 1I0VA 1VQ43 2GXFA 1GD4A 1NJI4 3MHEA 1M1K4 3NHXA 1JKGB 3CPOA 1N5HA 3S67A 1GY7A 2FNQA 1K28A 2ZDJA 4IT7A 3LXUX 4KZ1A 4L7KA 1L5GB 1TUHA 2UGIA 4WYKB 3UB1A 2GBWB 1A2VA 4K90B 1IQYA 5D83A 3LTDA 3JVCA 2HMLB 4NREA 4EBGA 4FMCA 4NPBA 2IYJA 3EC9A 2F56A 3LTBA 2IA7A 3EJVA 2Z6BA 3V92A 4JF8A 2Z76A 5M1AA 3CCJ3 3DGNA 3LOYA 1BRHA 1OHPA 4OK0A 1BSAA 5D81A 2RFRA 5IENA 1Q40A 1LOWA 1MOLA 3CCE3 1JJ22 3CC43 1T3BA 1UUVB 1F8NA 3CC23 2RBIA 1QALA 4O02B 2B1XB 2W56A 4ORLA 4LMIA 2MF7A 1Q9EA 4EYCA 1YGEA 3KN4A 2XGLA 1US1A 3BNBA 3SOAA 3X41A 2JDIH 3HIGA 1BAOA 2GEYA 5STDA 3X42A 4CDLA 1UUGB 1CH0A 3HK4A 3JUOA 4L8PA 3S27A 3URPA 1GOVA 3GZYB 4R1KA 3ALAA 2R4IA 3GSPA 1PU4A 1QAKA 3CCU3 2E2UA 2C4BA 2FGTA 2HMMB 1IQXA 4R80A 4GL6A 3MG1A 4R9KA 1N5PA 1SARA 1BSBA 3KKGA 1OHSA 1UI7A 1HKXA 3K0ZA 2LYXA 1BUJA 4I5QA 2WGOA 1FA3A 5CF2A 1GD3A 1BRGA 2W9PA 4HOHA 4HZBB 2WOFA 3FG4A 4KFEA 1SQWA 1QVF2 1CQSA 3FZWA 4GB5A 1B2ZA 1I2GA 2IMJA 1Q864 1BNGA 2YFJB 6GSPA 7STDA 4LGQA 1BNEA 3CCQ3 2XEPA 1JBRA 4QWTA 1U8CB 3PXMA 4XBTA 4XDVA 1VQL3 3G8ZA 3DH2A 1D6YA 1W5ZA 3EHCA 1PFPA 4XM4A 1BNFA 2YFIB 5ELJA 2IUKA 3MWZA 4EV2A 1A2PA 1VQN3 2H0IA 1I2FA 1VQ93 2F5MA 2W03A 3DUKA 3WODG 1UGIA 2D1WA 1V58A 2GU1A 3CNMA 4R4KA 1Q814 3FF0A 3SVAA 2KCDA 2CG0A 1IT8A 2W0QA 1LQGC 4HJLB 1E3RA 4HM6B 4J5KA 5LC6A 3D79A 4MJDA 4ZM8A 1FGOA 5BIRA 1BOXA 2KF6A 4BL3A 3QRDA 4K61A 1R4CA 3D9RA 4H61A 1A2KA 2O3OA 3EB8A 1IK3A 4I4KA 1DE3A 5G1LA 2CIUA 1BRJA 1VQM3 1IVXA 4J5GA 3EBYA 4HAAA 1VQ73 1GYBA 1RLSA 3I563 2XSOB 1EKMA 1G96A 1EUIC 3D3LA 3KCHA 4DKIA 4WP5A 4XBXA 4BL2A 5I97A 1Y4KA 3NV0A 1QVG2 1G02A 1X1WA 1KWIA 8RNTA 3VGNA 1HU9A 5AYSC 4X2HA 3CCV3 3KE7A 2HOHA 1FYSA 3UJMA 3WDGB 3NQYA 1EQKA 3DMCA 3AMOA 1EA2A 1RTUA 1B2UA 4HM3B 1YJN3 1K41A 3KIIA 3S29A 1MGRA 2ML5A 3DY5A 2HMKB 2AADA 5AIIA 2BO9B 4O3VA 1TP6A 2K54A 2WOHA 3FGYA 1W4NA 3D5IA 4KT3B 1MGWA 2CFKA 3MKIA 1FGRA 3DM8A 4BTYA 3UNLA 3CME3 1MWRA 3NUVA 1WMNA 2XSHB 3DGYA 2CWTA 3CD63 4Q53A 3IJEB 3NM2A 1RSNA 1QMAA 4HZ9B 3SX1A 1BSCA 4BTWA 3B7CA 1B3SA 2P09A 1RRHA 3NX0A 4FMAA 5FGOA 4MEIA 1GY5A 1YVSA 1UCJA 3E99A 3Q3FA 3O8YA 1N9EA 3NQZA 3BLZA 1I3FA 2CFDA 4GSPA 4N6UA 4XBYA 4WFOA 1I8VA 1O7WB 3JUPA 1BNJA 1JN5B 1RGKA 5CK6A 2CX0A 2HMOB 5D82A 3CXC2 2F98A 1I70A 3GWRA 1LRAA 1IU7A 2R41A 4HM1B 3ECFA 1YIT3 3PS8A 1K9M4 1JB2A 1KC84 1YGWA 1RMSA 2BMQB 1NO3A 3G16A 2ZA4A 1IDPA 3AHWA 3FLJA 4HKVB 3N9HA 3M8CA 4J9AA 3F9SA 3WA3A 3EX9A 1DETA 1A90A 3G0KA 4N3VA 3LT8A 4HVNA 2QEX3 2C11A 1ZX2A 3UL5A 4IIAA 3K9MC 1DYUA 1VQ63 1WMOA 2BMRB 2Y74A 1FW7A 4HYZA 5G1KA 1O7HB 4LSOA 2XFTA 1JRQA 1Q7Y4 3OW22 4IPBA 1IYYA 4KVHA 3HZPA 1T2HA 4EC6A 3I553 1RKYA 2J8XB 1DMQA 2OQEC 2F5WA 2SARA 4LZIA 2L1SA 3V98A 2RCDA 2WO0A 1STFI 3OWUA 3ZG5A 1AY7A 1GOUA 3DZLA 3CPW2 1BIRA 1D6ZA 2XH9A 3FF2A 2I9WA 7RNTA 1DVDA 1OF5A 3JUNA 4K1VA 3LMLA 3AGNA 3GRDA 1IVUA 2P0XA 1ZO2A 1KSIA 1Q7HA 3KZTA 4G1MB 1OUNA 2P05A 1GMPA 1TJDA 1FGMA 3T8UA 3EN8A 4K1UA 5KP1A 2RSXA 2XFSA 3J7Yd 1JBTA 4O8SA 3B4OA 4N6NB 1YJ93 2OQEA 1B2XA 1ZGXA 2KRTA 1O7GB 3S28A 3CCR3 3F40A 5IF6A 5IG5A 1ISKA 2HMJB 3AHSA 4CPKA 1BSEA 1FUSA 2KF4A 2P0MA 3NXJA 2CHCA 5IEPA 1K734 5AI1A 2M7OA 4XB5A 1W2B2 1AVLA 1C54A 4MMZB 4HM0B 1DMMA 3BNDA 3F8XA 5AEWB 1JKGA 4WHAA 2XR8B 1FGQA 2RNTA 3NBBA 3Q90A 3EE1A 4PEJA 1TRPA 3GZBA 3GZRA 5EEOA 1YHQ3 2Q07A 2A15A 1J2BA 4KFFA 4RZMA 1TFOA 1N8R4 4WYKA 5HGRA 1GSPA 3STDA 1W02A 1RCKA 1RGHA 3RNTA 3Q1CA 3FG1A 1WNHA 1QJGA 6RNTA 3OV4A 1Q40B 3FKAA 1ULIB 1Z1SA 1V74A 2O9UX 2STDA 1AQZA 1RGAA 1SPUA 1RNTA 1T2IA 3HX8A 3OWYA 2W56B 3LT9A 1LXEA
chains in the Genus database with same CATH topology
1UUWB 3PCSA 3MSOA 3EN1B 1AR0A 2GEXA 3G4S3 4CCVA 2P38A 4RBNA 1YIJ3 3ER7A 2XF3A 1JB5A 2CFLA 4EXRA 3G713 1A67A 3H3HA 1IVWA 2CKFB 3T0UA 1ROAA 1W6CA 1K8A4 5JPUA 3OXAA 3B8LA 5TGNA 2F86B 3LTAA 2JQ5A 5ELUA 3MG2A 3WOEB 1W00A 1SIIA 2SBLA 5CXOA 5AIFA 3CC73 1DMNA 3CCS3 2CW9A 4N6V0 3SXXA 2C10A 5A0OB 2OCTA 3DGOA 2CWUA 4HBRA 3CCM3 1OGXA 4RNZA 3CU3A 4HM7B 5G2GA 4HM5B 3JUQA 5IERA 4KFDA 4X2OA 2BHMA 2E2TA 3JUMA 1UW1A 1NB5I 1NB3I 4FR9A 1NU3A 1FUWA 1WMPA 3TDGA 2XRXB 3N54B 3T8NA 4LEHA 1IQ8A 2B24B 1S723 1VZZA 1RN7A 2E2VA 1E97A 3QK9A 4OUQA 2W9QA 1JV2B 4BTXA 3Q2PA 1KD14 3SOYA 1CYUA 1EG9B 2QGUA 3MG3A 3K63A 3SEDA 1VQK3 1JB4A 1SIHA 1N8QA 4TX4A 3X3ZA 3ROBA 1JNQA 1OPYA 1Q42A 5LC7A 4N6OB 3CNXA 3X3YA 2CFGA 1ROVA 1CEWI 1TFKA 1O7PB 2FXTA 3F7XA 1YVBI 1D6UA 5IG0A 6STDA 3OW22 2Z77A 1OGZA 5BVBA 4MMYB 1M904 3X3XA 2YFLB 1RJOA 3RGRA 3NBJA 1WTHA 2CC3A 2PNCA 3VSYA 4AEQA 3SLUA 5AYRB 1W6GA 1FGTA 3EQQB 2OTJ3 4AKZA 2IUJA 2CWVA 1IV7A 3NBRA 3NV0B 3RDEA 1VQP3 3VF1A 1M1XB 4XDWA 3G6E3 1LVNA 3V99A 4FCJA 3K7CA 2CFWA 5KP3A 2KXGA 3EBTA 3KFQC 2XGNA 4JRFA 1MNLA 8CHOA 1E3VA 1LNHA 3AMOB 5IEOA 3DGMA 3LTCA 3N8BA 1TIJA 3WMDA 1VQ83 2GU3A 3LYGA 4HM4B 1YI23 1BUQA 3BNCA 2ML6A 3PYJA 1O7MB 2W6JH 1W6YA 1WQLB 1VQO3 2F99A 1W7CA 2V1LA 3HIIA 5AEUB 2BT3A 4FCZA 4EV5A 4STDA 2RGQA 4N6TA 5DREA 3I563 1STDA 3IMAB 2OWPA 3IPTA 2INXA 3I0YA 3NM7A 2HMNB 3FH1A 2PZVA 1TU5A 3KSPA 3LH4A 2CH9A 3DGLA 3DXOA 3FSDA 3X40A 4HM8B 1C7HA 3GZXB 3CMA3 1OCVA 1OACA 4FMDA 4FCMA 1DVCA 4N6LA 4NHFA 5IW9A 4FMBA 4AKYA 1Q824 4RNYA 1W2ZA 4HM2B 4O2HA 1O7NB 5EQLA 3OX9A 4N6MA 1N9JA 2CK3H 4H3UA 3HI7A 3LZAA 3CCL3 3WA2X 1OH0A 3U1WA 1VQ53 2K0MA 2MC8A 5IG3A 2W04A 2BMOB 3EF8A 1RRLA 1JN5A 1OHOA 5AIGA 3FCSB 2Z7AA 1UI8A 2BNGA 3RGAA 1GS3A 2D42A 3L0RA 2CG1A 2QIYA 1U5OA 2YX9A 1M9GA 5JBSA 3PCRA 5IG4A 4OVMA 3UL6A 1SJWA 1IT7A 1NDOB 1AV4A 5FW5A 3F14A 3B4PA 3BNEA 3FG3A 1YJW3 3K5TA 1CYVA 1QAFA 5AIHA 1GY6A 3MPHA 1W01A 2WGQA 2QA43 1AVKA 4MMXB 3H51A 3PZWA 2OOVC 4WWUC 5CLKA 1S5AA 1OF5B 4U13A 5CF1A 2LQVA 3PGBA 2UX0A 2ZL8A 1ASKA 4R9LA 5BXQA 3U97A 1ULJB 3WOFB 4J8TA 3OWSA 2L4VA 5KP4A 5DRVA 1IV9A 3GAXA 3BB9A 3F8HA 2GBXB 2OTL3 2Y73A 1KQS2 3A76A 2OOVA 1T5YA 4L8OA 5JPPA 1IVVA 3F7SA 3MYTA 1NWWA 2W2CA 3KSED 5EVHA 1LOXA 1VQ43 2GXFA 1GD4A 1NJI4 3MHEA 1M1K4 3NHXA 1JKGB 3CPOA 1N5HA 3S67A 1GY7A 2FNQA 1K28A 2ZDJA 4IT7A 3LXUX 4KZ1A 4L7KA 1L5GB 1TUHA 4WYKB 3UB1A 2GBWB 1A2VA 4K90B 1IQYA 5D83A 3LTDA 3JVCA 2HMLB 4NREA 4EBGA 4FMCA 3EC9A 3LTBA 2IA7A 3EJVA 2Z6BA 3V92A 4JF8A 2Z76A 3CCJ3 3DGNA 3LOYA 1OHPA 4OK0A 5D81A 2RFRA 5IENA 1Q40A 3CCE3 1MOLA 1JJ22 3CC43 1UUVB 1F8NA 3CC23 1QALA 4O02B 2B1XB 2W56A 4ORLA 4LMIA 2MF7A 4EYCA 1YGEA 3KN4A 2XGLA 1US1A 3BNBA 3SOAA 3X41A 2JDIH 3HIGA 5STDA 2GEYA 3X42A 4CDLA 3HK4A 3JUOA 4L8PA 3S27A 3GZYB 4R1KA 3ALAA 2R4IA 1PU4A 1QAKA 3CCU3 2E2UA 2FGTA 2HMMB 1IQXA 4R80A 4GL6A 3MG1A 4R9KA 1N5PA 3KKGA 1OHSA 1UI7A 1HKXA 3K0ZA 2LYXA 2WGOA 1FA3A 5CF2A 1GD3A 2W9PA 4HZBB 2WOFA 3FG4A 4KFEA 1SQWA 1QVF2 1CQSA 3FZWA 4GB5A 2IMJA 1Q864 2YFJB 7STDA 4LGQA 3CCQ3 2XEPA 4QWTA 1U8CB 3PXMA 4XBTA 4XDVA 1VQL3 3G8ZA 1D6YA 1W5ZA 3EHCA 1PFPA 4XM4A 5ELJA 2YFIB 2IUKA 3MWZA 4EV2A 1VQN3 1VQ93 2W03A 3DUKA 3WODG 2D1WA 2GU1A 3CNMA 4R4KA 1Q814 3FF0A 3SVAA 2KCDA 2CG0A 1IT8A 2W0QA 4HJLB 4HM6B 1E3RA 5LC6A 4MJDA 4ZM8A 1FGOA 3QRDA 4K61A 1R4CA 3D9RA 4H61A 1A2KA 2O3OA 3EB8A 1IK3A 4I4KA 2CIUA 1VQM3 1IVXA 3EBYA 1VQ73 1GYBA 2XSOB 1EKMA 1G96A 3D3LA 1QVG2 5I97A 4WP5A 4XBXA 1Y4KA 3NV0A 1KWIA 3VGNA 1HU9A 5AYSC 4X2HA 3CCV3 3KE7A 3UJMA 3WDGB 3NQYA 1EQKA 3DMCA 3AMOA 1EA2A 4HM3B 1YJN3 1K41A 3KIIA 3S29A 2ML5A 3DY5A 2HMKB 5AIIA 2BO9B 4O3VA 1TP6A 2K54A 2WOHA 3FGYA 1W4NA 3MKIA 2CFKA 4BTYA 1FGRA 3DM8A 3CME3 3UNLA 3NUVA 1WMNA 2XSHB 2CWTA 3CD63 4Q53A 3IJEB 3NM2A 1QMAA 4HZ9B 3SX1A 4BTWA 3B7CA 2P09A 1RRHA 3NX0A 4FMAA 5FGOA 4MEIA 1GY5A 3E99A 3O8YA 1N9EA 3NQZA 3BLZA 2CFDA 4N6UA 4XBYA 4WFOA 3S5CA 1O7WB 3JUPA 1JN5B 5CK6A 3CXC2 2HMOB 5D82A 2F98A 3GWRA 1IU7A 4HM1B 3ECFA 1YIT3 3PS8A 1K9M4 1JB2A 1KC84 2BMQB 1NO3A 3G16A 1IDPA 3FLJA 4HKVB 3N9HA 3M8CA 4J9AA 3F9SA 3WA3A 3EX9A 1A90A 3G0KA 4N3VA 3LT8A 4HVNA 2QEX3 2C11A 1ZX2A 3UL5A 4IIAA 3K9MC 1DYUA 1VQ63 1WMOA 2BMRB 2Y74A 4HYZA 1O7HB 4LSOA 2XFTA 1JRQA 1Q7Y4 4IPBA 4KVHA 3HZPA 4EC6A 3I553 1RKYA 1DMQA 2OQEC 4LZIA 3V98A 2RCDA 2WO0A 1STFI 3OWUA 3DZLA 3CPW2 1D6ZA 2XH9A 3FF2A 2I9WA 1DVDA 1OF5A 3JUNA 4K1VA 3LMLA 3GRDA 1IVUA 2P0XA 1ZO2A 1KSIA 3KZTA 4G1MB 1OUNA 2P05A 1FGMA 3T8UA 3EN8A 4K1UA 5KP1A 2RSXA 2XFSA 3J7Yd 4O8SA 3B4OA 4N6NB 1YJ93 2OQEA 2KRTA 1O7GB 3S28A 3CCR3 3F40A 5IF6A 5IG5A 1ISKA 2HMJB 2P0MA 3NXJA 2CHCA 5IEPA 1K734 5AI1A 2M7OA 4XB5A 1W2B2 1AVLA 4MMZB 4HM0B 1DMMA 3BNDA 3F8XA 5AEWB 1JKGA 4WHAA 2XR8B 1FGQA 3NBBA 3Q90A 3EE1A 4PEJA 3GZBA 3GZRA 5EEOA 1YHQ3 2Q07A 2A15A 1J2BA 4KFFA 4RZMA 1TFOA 1N8R4 4WYKA 5HGRA 3STDA 1W02A 3Q1CA 3FG1A 1WNHA 1QJGA 3OV4A 1Q40B 3FKAA 1ULIB 1Z1SA 1V74A 2O9UX 2STDA 3HX8A 1SPUA 3OWYA 2W56B 3LT9A 1LXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUW B;  3MSO A;  3EN1 B;  1AR0 A;  2GEX A;  3ER7 A;  1JB5 A;  3H3H A;  2CKF B;  5JPU A;  3OXA A;  3B8L A;  5TGN A;  2F86 B;  2JQ5 A;  3MG2 A;  1W00 A;  5CXO A;  5AIF A;  1DMN A;  1OGX A;  3CU3 A;  4HM7 B;  5G2G A;  4HM5 B;  3JUQ A;  5IER A;  4X2O A;  3JUM A;  1NU3 A;  2XRX B;  3T8N A;  4LEH A;  2B24 B;  1VZZ A;  1E97 A;  4OUQ A;  3SOY A;  1EG9 B;  2QGU A;  3MG3 A;  3SED A;  1JB4 A;  3ROB A;  1Q42 A;  1OPY A;  3CNX A;  1O7P B;  3F7X A;  5IG0 A;  6STD A;  2Z77 A;  1OGZ A;  5BVB A;  2YFL B;  3RGR A;  3VSY A;  3EQQ B;  3NBR A;  3NV0 B;  4XDW A;  4FCJ A;  5KP3 A;  3K7C A;  3EBT A;  8CHO A;  1E3V A;  5IEO A;  3WMD A;  3LYG A;  4HM4 B;  1BUQ A;  1O7M B;  1W6Y A;  1WQL B;  2F99 A;  5AEU B;  4STD A;  2RGQ A;  5DRE A;  1STD A;  2OWP A;  3IPT A;  2INX A;  3I0Y A;  2HMN B;  3FH1 A;  2PZV A;  3KSP A;  3DXO A;  3FSD A;  4HM8 B;  1C7H A;  3GZX B;  1OCV A;  4FCM A;  4HM2 B;  1O7N B;  3OX9 A;  4H3U A;  3LZA A;  1OH0 A;  5IG3 A;  2BMO B;  3EF8 A;  1JN5 A;  1OHO A;  5AIG A;  2Z7A A;  2BNG A;  3RGA A;  1GS3 A;  2QIY A;  1U5O A;  5IG4 A;  4OVM A;  1SJW A;  1NDO B;  5FW5 A;  3F14 A;  3B4P A;  5AIH A;  1GY6 A;  1W01 A;  3H51 A;  4WWU C;  5CLK A;  1S5A A;  1OF5 B;  4U13 A;  5CF1 A;  2UX0 A;  1ASK A;  4R9L A;  5BXQ A;  1ULJ B;  4J8T A;  3OWS A;  5KP4 A;  5DRV A;  3BB9 A;  3F8H A;  2GBX B;  3A76 A;  4L8O A;  5JPP A;  3F7S A;  3MYT A;  1NWW A;  2W2C A;  5EVH A;  2GXF A;  3MHE A;  3NHX A;  1JKG B;  3CPO A;  1GY7 A;  4L7K A;  1TUH A;  4WYK B;  2GBW B;  5D83 A;  2HML B;  3EC9 A;  3EJV A;  2Z76 A;  1OHP A;  5D81 A;  2RFR A;  5IEN A;  1Q40 A;  1UUV B;  2B1X B;  4ORL A;  4LMI A;  3SOA A;  5STD A;  2GEY A;  4CDL A;  3HK4 A;  3JUO A;  4L8P A;  3GZY B;  4R1K A;  2R4I A;  2HMM B;  3MG1 A;  4R9K A;  3KKG A;  1OHS A;  1HKX A;  3K0Z A;  5CF2 A;  4HZB B;  1CQS A;  3FZW A;  4GB5 A;  2IMJ A;  2YFJ B;  7STD A;  4LGQ A;  4XBT A;  4XDV A;  3G8Z A;  3EHC A;  4XM4 A;  2YFI B;  3DUK A;  3CNM A;  3FF0 A;  4HJL B;  4HM6 B;  1E3R A;  4MJD A;  3D9R A;  1A2K A;  4I4K A;  3EBY A;  1GYB A;  2XSO B;  4WP5 A;  4XBX A;  3NV0 A;  3VGN A;  4X2H A;  3KE7 A;  3UJM A;  3DMC A;  1EA2 A;  4HM3 B;  1K41 A;  2HMK B;  5AII A;  1TP6 A;  2K54 A;  3FGY A;  3MKI A;  3DM8 A;  3UNL A;  3NUV A;  2XSH B;  4Q53 A;  3NM2 A;  1QMA A;  4HZ9 B;  3B7C A;  1GY5 A;  3E99 A;  3BLZ A;  4XBY A;  3S5C A;  1O7W B;  3JUP A;  1JN5 B;  5CK6 A;  2HMO B;  5D82 A;  2F98 A;  3GWR A;  4HM1 B;  3ECF A;  1JB2 A;  2BMQ B;  3G16 A;  1IDP A;  3FLJ A;  4HKV B;  3M8C A;  4J9A A;  3F9S A;  3EX9 A;  3G0K A;  4N3V A;  4HVN A;  1ZX2 A;  4IIA A;  2BMR B;  1O7H B;  4KVH A;  3HZP A;  1DMQ A;  2RCD A;  3OWU A;  3DZL A;  3FF2 A;  2I9W A;  1OF5 A;  3JUN A;  4K1V A;  3GRD A;  1ZO2 A;  3KZT A;  1OUN A;  3T8U A;  3EN8 A;  4K1U A;  5KP1 A;  3B4O A;  1O7G B;  3F40 A;  5IF6 A;  5IG5 A;  1ISK A;  2HMJ B;  3NXJ A;  2CHC A;  5IEP A;  5AI1 A;  4XB5 A;  4HM0 B;  1DMM A;  3F8X A;  5AEW B;  1JKG A;  2XR8 B;  3Q90 A;  4PEJ A;  3GZB A;  3GZR A;  2A15 A;  4RZM A;  4WYK A;  5HGR A;  3STD A;  1W02 A;  1QJG A;  3OV4 A;  1Q40 B;  3FKA A;  1ULI B;  1Z1S A;  2STD A;  3HX8 A;  3OWY A; 
#chains in the Genus database with same CATH topology
 1UUW B;  3PCS A;  3MSO A;  3EN1 B;  1AR0 A;  1GOY A;  2GEX A;  3G4S 3;  4CCV A;  2P38 A;  1LNI A;  4RBN A;  1YIJ 3;  3ER7 A;  2XF3 A;  4GHO A;  1JB5 A;  2CFL A;  4EXR A;  3G71 3;  1YNV X;  3AGO A;  1A67 A;  3H3H A;  1IVW A;  2CKF B;  3T0U A;  1ROA A;  1W6C A;  1K8A 4;  3ZFZ A;  5JPU A;  3OXA A;  3B8L A;  2GSP A;  5TGN A;  1PYL A;  2F86 B;  3LTA A;  2JQ5 A;  3D4A A;  5ELU A;  3MG2 A;  3WOE B;  1W00 A;  3WHO A;  2AAE A;  1SII A;  2SBL A;  5CXO A;  5AIF A;  3CC7 3;  1DMN A;  3CCS 3;  2CW9 A;  4N6V 0;  1BSD A;  3SXX A;  2C10 A;  5A0O B;  2OCT A;  3DGO A;  1BNS A;  2CWU A;  4HBR A;  3S5C A;  3CCM 3;  1BVI A;  1OGX A;  4RNZ A;  2KAA A;  3CU3 A;  4HM7 B;  5G2G A;  1I3I A;  4HM5 B;  3JUQ A;  5IER A;  4KFD A;  4X2O A;  2BHM A;  2E2T A;  3JUM A;  4RNT A;  1X1X A;  1JZO A;  4EW5 A;  1UW1 A;  1NB5 I;  1NB3 I;  4FR9 A;  1NNV A;  1NU3 A;  1FUW A;  1WMP A;  3TDG A;  3ZG0 A;  2XRX B;  3N54 B;  4LYL B;  3T8N A;  1TTO A;  1IQ8 A;  4LEH A;  2B24 B;  1S72 3;  1VZZ A;  1RN7 A;  2E2V A;  1E97 A;  3QK9 A;  4OUQ A;  1UDI I;  2W9Q A;  1JV2 B;  4BTX A;  3Q2P A;  1KD1 4;  3SOY A;  1CYU A;  1EG9 B;  2QGU A;  3MG3 A;  3K63 A;  3SED A;  1VQK 3;  1BNR A;  1JB4 A;  1SIH A;  1N8Q A;  2BU4 A;  4TX4 A;  3X3Z A;  1BNI A;  3ROB A;  1ZS7 A;  1JNQ A;  1OPY A;  1Q42 A;  1BU4 A;  5LC7 A;  4N6O B;  4ILF A;  3CNX A;  3X3Y A;  2CFG A;  1ROV A;  1CEW I;  1TFK A;  1O7P B;  2FXT A;  2H0G A;  1YVB I;  1D6U A;  3F7X A;  5IG0 A;  6STD A;  2Z77 A;  1OGZ A;  5BVB A;  3A5E A;  4MMY B;  5RNT A;  1M90 4;  3X3X A;  2YFL B;  1RJO A;  1HZ1 A;  3NBJ A;  3RGR A;  1WTH A;  2CC3 A;  2PNC A;  3VSY A;  4AEQ A;  3SLU A;  5AYR B;  1W6G A;  1FGT A;  3EQQ B;  2OTJ 3;  1MWS A;  4AKZ A;  1I0X A;  2IUJ A;  2KF5 A;  2CWV A;  1IV7 A;  1B27 A;  3NBR A;  3NV0 B;  3RDE A;  1I2E A;  7GSP A;  1VQP 3;  1HYF A;  3VF1 A;  1X1U A;  1M1X B;  4XDW A;  5HOH A;  3G6E 3;  1LVN A;  3V99 A;  4FCJ A;  3K7C A;  1UGH I;  2CFW A;  5GSP A;  5KP3 A;  2H0H A;  3D5G A;  2KXG A;  3EBT A;  3KFQ C;  1MWT A;  2XGN A;  4JRF A;  1MNL A;  8CHO A;  1E3V A;  1BRK A;  1LNH A;  3AMO B;  3DGM A;  3LTC A;  5IEO A;  3N8B A;  1TIJ A;  3WMD A;  1VQ8 3;  2GU3 A;  3BU4 A;  3LYG A;  4HM4 B;  1LOV A;  1YI2 3;  1BUQ A;  3BNC A;  2ML6 A;  1V57 A;  1GMQ A;  1O7M B;  1W6Y A;  2W6J H;  3PYJ A;  1RGG A;  1WQL B;  1BRI A;  1VQO 3;  2F99 A;  1W7C A;  2V1L A;  3HII A;  5AEU B;  2BT3 A;  3BIR A;  4FCZ A;  4EV5 A;  4STD A;  2RGQ A;  4N6T A;  5M19 A;  5DRE A;  3WR2 A;  1STD A;  3IMA B;  2OWP A;  2ZHX B;  1B2S A;  2INX A;  3HOH A;  2HMN B;  3I0Y A;  3IPT A;  1RDS A;  3NM7 A;  1RHL A;  3FH1 A;  2PZV A;  2UUG C;  1FZU A;  1TU5 A;  3KSP A;  3LH4 A;  1RN1 A;  2CH9 A;  1RCL A;  2K3D A;  3DGL A;  3DXO A;  3FSD A;  3X40 A;  4HM8 B;  1C7H A;  3GZX B;  3CMA 3;  1TRQ A;  1OCV A;  1OAC A;  2F4Y A;  4FCM A;  1DVC A;  1R4Y A;  1RGE A;  2KF3 A;  4FMD A;  4N6L A;  4NHF A;  5IW9 A;  1B2M A;  4FMB A;  4AKY A;  1Q82 4;  1LQM B;  4RNY A;  1W2Z A;  4HM2 B;  3SYU A;  5M18 A;  1X1Y A;  1O7N B;  4O2H A;  5EQL A;  3OX9 A;  4BU4 A;  4CJN A;  1G0T A;  4N6M A;  1N9J A;  2CK3 H;  4H3U A;  1LOY A;  2BIR A;  3HI7 A;  3LZA A;  3WA2 X;  3CCL 3;  1JZD A;  1OH0 A;  3U1W A;  1VQ5 3;  2K0M A;  2MC8 A;  5IG3 A;  2W04 A;  2CX1 A;  2BMO B;  3EF8 A;  1RRL A;  1JN5 A;  1OHO A;  5AIG A;  3FCS B;  2Z7A A;  1UI8 A;  2BNG A;  3RGA A;  1GS3 A;  2D42 A;  3L0R A;  2CG1 A;  2QIY A;  1B20 A;  1UCI A;  1U5O A;  1RN4 A;  2YX9 A;  1M9G A;  5JBS A;  3PCR A;  5IG4 A;  4OVM A;  3UL6 A;  1SJW A;  1FUT A;  1IT7 A;  1NDO B;  1AV4 A;  5FW5 A;  3F14 A;  3B4P A;  3BNE A;  3FG3 A;  1YJW 3;  3K5T A;  1CYV A;  1QAF A;  5AIH A;  1PY3 A;  1RNB A;  1GY6 A;  3MPH A;  1W01 A;  1MWU A;  1UCK A;  2WGQ A;  2QA4 3;  1AVK A;  4MMX B;  3H51 A;  3PZW A;  1BAN A;  2OOV C;  4WWU C;  1RGC A;  1UCL A;  5CLK A;  5BU4 A;  1S5A A;  1OF5 B;  4U13 A;  1RGL A;  5CF1 A;  2LQV A;  3PGB A;  2UX0 A;  2ZL8 A;  1BGS A;  1ASK A;  1BRS A;  4R9L A;  5BXQ A;  1VQQ A;  3U97 A;  4BIR A;  1ULJ B;  2IY2 A;  3WOF B;  4J8T A;  3OWS A;  2L4V A;  5KP4 A;  5DRV A;  1IV9 A;  3GAX A;  3BB9 A;  3F8H A;  2GBX B;  2OTL 3;  2Y73 A;  1JBS A;  1KQS 2;  1B21 A;  3A76 A;  2OOV A;  1T5Y A;  4L8O A;  5JPP A;  1IVV A;  3F7S A;  3MYT A;  1NWW A;  2W2C A;  1EEJ A;  1BRN L;  3KSE D;  1GMR A;  1RGF A;  5EVH A;  1LOX A;  9RNT A;  1I0V A;  1VQ4 3;  2GXF A;  1GD4 A;  1NJI 4;  3MHE A;  1M1K 4;  3NHX A;  1JKG B;  3CPO A;  1N5H A;  3S67 A;  1GY7 A;  2FNQ A;  1K28 A;  2ZDJ A;  4IT7 A;  3LXU X;  4KZ1 A;  4L7K A;  1L5G B;  1TUH A;  2UGI A;  4WYK B;  3UB1 A;  2GBW B;  1A2V A;  4K90 B;  1IQY A;  5D83 A;  3LTD A;  3JVC A;  2HML B;  4NRE A;  4EBG A;  4FMC A;  4NPB A;  2IYJ A;  3EC9 A;  2F56 A;  3LTB A;  2IA7 A;  3EJV A;  2Z6B A;  3V92 A;  4JF8 A;  2Z76 A;  5M1A A;  3CCJ 3;  3DGN A;  3LOY A;  1BRH A;  1OHP A;  4OK0 A;  1BSA A;  5D81 A;  2RFR A;  5IEN A;  1Q40 A;  1LOW A;  1MOL A;  3CCE 3;  1JJ2 2;  3CC4 3;  1T3B A;  1UUV B;  1F8N A;  3CC2 3;  2RBI A;  1QAL A;  4O02 B;  2B1X B;  2W56 A;  4ORL A;  4LMI A;  2MF7 A;  1Q9E A;  4EYC A;  1YGE A;  3KN4 A;  2XGL A;  1US1 A;  3BNB A;  3SOA A;  3X41 A;  2JDI H;  3HIG A;  1BAO A;  2GEY A;  5STD A;  3X42 A;  4CDL A;  1UUG B;  1CH0 A;  3HK4 A;  3JUO A;  4L8P A;  3S27 A;  3URP A;  1GOV A;  3GZY B;  4R1K A;  3ALA A;  2R4I A;  3GSP A;  1PU4 A;  1QAK A;  3CCU 3;  2E2U A;  2C4B A;  2FGT A;  2HMM B;  1IQX A;  4R80 A;  4GL6 A;  3MG1 A;  4R9K A;  1N5P A;  1SAR A;  1BSB A;  3KKG A;  1OHS A;  1UI7 A;  1HKX A;  3K0Z A;  2LYX A;  1BUJ A;  4I5Q A;  2WGO A;  1FA3 A;  5CF2 A;  1GD3 A;  1BRG A;  2W9P A;  4HOH A;  4HZB B;  2WOF A;  3FG4 A;  4KFE A;  1SQW A;  1QVF 2;  1CQS A;  3FZW A;  4GB5 A;  1B2Z A;  1I2G A;  2IMJ A;  1Q86 4;  1BNG A;  2YFJ B;  6GSP A;  7STD A;  4LGQ A;  1BNE A;  3CCQ 3;  2XEP A;  1JBR A;  4QWT A;  1U8C B;  3PXM A;  4XBT A;  4XDV A;  1VQL 3;  3G8Z A;  3DH2 A;  1D6Y A;  1W5Z A;  3EHC A;  1PFP A;  4XM4 A;  1BNF A;  2YFI B;  5ELJ A;  2IUK A;  3MWZ A;  4EV2 A;  1A2P A;  1VQN 3;  2H0I A;  1I2F A;  1VQ9 3;  2F5M A;  2W03 A;  3DUK A;  3WOD G;  1UGI A;  2D1W A;  1V58 A;  2GU1 A;  3CNM A;  4R4K A;  1Q81 4;  3FF0 A;  3SVA A;  2KCD A;  2CG0 A;  1IT8 A;  2W0Q A;  1LQG C;  4HJL B;  1E3R A;  4HM6 B;  4J5K A;  5LC6 A;  3D79 A;  4MJD A;  4ZM8 A;  1FGO A;  5BIR A;  1BOX A;  2KF6 A;  4BL3 A;  3QRD A;  4K61 A;  1R4C A;  3D9R A;  4H61 A;  1A2K A;  2O3O A;  3EB8 A;  1IK3 A;  4I4K A;  1DE3 A;  5G1L A;  2CIU A;  1BRJ A;  1VQM 3;  1IVX A;  4J5G A;  3EBY A;  4HAA A;  1VQ7 3;  1GYB A;  1RLS A;  3I56 3;  2XSO B;  1EKM A;  1G96 A;  1EUI C;  3D3L A;  3KCH A;  4DKI A;  4WP5 A;  4XBX A;  4BL2 A;  5I97 A;  1Y4K A;  3NV0 A;  1QVG 2;  1G02 A;  1X1W A;  1KWI A;  8RNT A;  3VGN A;  1HU9 A;  5AYS C;  4X2H A;  3CCV 3;  3KE7 A;  2HOH A;  1FYS A;  3UJM A;  3WDG B;  3NQY A;  1EQK A;  3DMC A;  3AMO A;  1EA2 A;  1RTU A;  1B2U A;  4HM3 B;  1YJN 3;  1K41 A;  3KII A;  3S29 A;  1MGR A;  2ML5 A;  3DY5 A;  2HMK B;  2AAD A;  5AII A;  2BO9 B;  4O3V A;  1TP6 A;  2K54 A;  2WOH A;  3FGY A;  1W4N A;  3D5I A;  4KT3 B;  1MGW A;  2CFK A;  3MKI A;  1FGR A;  3DM8 A;  4BTY A;  3UNL A;  3CME 3;  1MWR A;  3NUV A;  1WMN A;  2XSH B;  3DGY A;  2CWT A;  3CD6 3;  4Q53 A;  3IJE B;  3NM2 A;  1RSN A;  1QMA A;  4HZ9 B;  3SX1 A;  1BSC A;  4BTW A;  3B7C A;  1B3S A;  2P09 A;  1RRH A;  3NX0 A;  4FMA A;  5FGO A;  4MEI A;  1GY5 A;  1YVS A;  1UCJ A;  3E99 A;  3Q3F A;  3O8Y A;  1N9E A;  3NQZ A;  3BLZ A;  1I3F A;  2CFD A;  4GSP A;  4N6U A;  4XBY A;  4WFO A;  1I8V A;  1O7W B;  3JUP A;  1BNJ A;  1JN5 B;  1RGK A;  5CK6 A;  2CX0 A;  2HMO B;  5D82 A;  3CXC 2;  2F98 A;  1I70 A;  3GWR A;  1LRA A;  1IU7 A;  2R41 A;  4HM1 B;  3ECF A;  1YIT 3;  3PS8 A;  1K9M 4;  1JB2 A;  1KC8 4;  1YGW A;  1RMS A;  2BMQ B;  1NO3 A;  3G16 A;  2ZA4 A;  1IDP A;  3AHW A;  3FLJ A;  4HKV B;  3N9H A;  3M8C A;  4J9A A;  3F9S A;  3WA3 A;  3EX9 A;  1DET A;  1A90 A;  3G0K A;  4N3V A;  3LT8 A;  4HVN A;  2QEX 3;  2C11 A;  1ZX2 A;  3UL5 A;  4IIA A;  3K9M C;  1DYU A;  1VQ6 3;  1WMO A;  2BMR B;  2Y74 A;  1FW7 A;  4HYZ A;  5G1K A;  1O7H B;  4LSO A;  2XFT A;  1JRQ A;  1Q7Y 4;  3OW2 2;  4IPB A;  1IYY A;  4KVH A;  3HZP A;  1T2H A;  4EC6 A;  3I55 3;  1RKY A;  2J8X B;  1DMQ A;  2OQE C;  2F5W A;  2SAR A;  4LZI A;  2L1S A;  3V98 A;  2RCD A;  2WO0 A;  1STF I;  3OWU A;  3ZG5 A;  1AY7 A;  1GOU A;  3DZL A;  3CPW 2;  1BIR A;  1D6Z A;  2XH9 A;  3FF2 A;  2I9W A;  7RNT A;  1DVD A;  1OF5 A;  3JUN A;  4K1V A;  3LML A;  3AGN A;  3GRD A;  1IVU A;  2P0X A;  1ZO2 A;  1KSI A;  1Q7H A;  3KZT A;  4G1M B;  1OUN A;  2P05 A;  1GMP A;  1TJD A;  1FGM A;  3T8U A;  3EN8 A;  4K1U A;  5KP1 A;  2RSX A;  2XFS A;  3J7Y d;  1JBT A;  4O8S A;  3B4O A;  4N6N B;  1YJ9 3;  2OQE A;  1B2X A;  1ZGX A;  2KRT A;  1O7G B;  3S28 A;  3CCR 3;  3F40 A;  5IF6 A;  5IG5 A;  1ISK A;  2HMJ B;  3AHS A;  4CPK A;  1BSE A;  1FUS A;  2KF4 A;  2P0M A;  3NXJ A;  2CHC A;  5IEP A;  1K73 4;  5AI1 A;  2M7O A;  4XB5 A;  1W2B 2;  1AVL A;  1C54 A;  4MMZ B;  4HM0 B;  1DMM A;  3BND A;  3F8X A;  5AEW B;  1JKG A;  4WHA A;  2XR8 B;  1FGQ A;  2RNT A;  3NBB A;  3Q90 A;  3EE1 A;  4PEJ A;  1TRP A;  3GZB A;  3GZR A;  5EEO A;  1YHQ 3;  2Q07 A;  2A15 A;  1J2B A;  4KFF A;  4RZM A;  1TFO A;  1N8R 4;  4WYK A;  5HGR A;  1GSP A;  3STD A;  1W02 A;  1RCK A;  1RGH A;  3RNT A;  3Q1C A;  3FG1 A;  1WNH A;  1QJG A;  6RNT A;  3OV4 A;  1Q40 B;  3FKA A;  1ULI B;  1Z1S A;  1V74 A;  2O9U X;  2STD A;  1AQZ A;  1RGA A;  1SPU A;  1RNT A;  1T2I A;  3HX8 A;  3OWY A;  2W56 B;  3LT9 A;  1LXE A; 
#chains in the Genus database with same CATH homology
 1UUW B;  3PCS A;  3MSO A;  3EN1 B;  1AR0 A;  2GEX A;  3G4S 3;  4CCV A;  2P38 A;  4RBN A;  1YIJ 3;  3ER7 A;  2XF3 A;  1JB5 A;  2CFL A;  4EXR A;  3G71 3;  1A67 A;  3H3H A;  1IVW A;  2CKF B;  3T0U A;  1ROA A;  1W6C A;  1K8A 4;  5JPU A;  3OXA A;  3B8L A;  5TGN A;  2F86 B;  3LTA A;  2JQ5 A;  5ELU A;  3MG2 A;  3WOE B;  1W00 A;  1SII A;  2SBL A;  5CXO A;  5AIF A;  3CC7 3;  1DMN A;  3CCS 3;  2CW9 A;  4N6V 0;  3SXX A;  2C10 A;  5A0O B;  2OCT A;  3DGO A;  2CWU A;  4HBR A;  3CCM 3;  1OGX A;  4RNZ A;  3CU3 A;  4HM7 B;  5G2G A;  4HM5 B;  3JUQ A;  5IER A;  4KFD A;  4X2O A;  2BHM A;  2E2T A;  3JUM A;  1UW1 A;  1NB5 I;  1NB3 I;  4FR9 A;  1NU3 A;  1FUW A;  1WMP A;  3TDG A;  2XRX B;  3N54 B;  3T8N A;  4LEH A;  1IQ8 A;  2B24 B;  1S72 3;  1VZZ A;  1RN7 A;  2E2V A;  1E97 A;  3QK9 A;  4OUQ A;  2W9Q A;  1JV2 B;  4BTX A;  3Q2P A;  1KD1 4;  3SOY A;  1CYU A;  1EG9 B;  2QGU A;  3MG3 A;  3K63 A;  3SED A;  1VQK 3;  1JB4 A;  1SIH A;  1N8Q A;  4TX4 A;  3X3Z A;  3ROB A;  1JNQ A;  1OPY A;  1Q42 A;  5LC7 A;  4N6O B;  3CNX A;  3X3Y A;  2CFG A;  1ROV A;  1CEW I;  1TFK A;  1O7P B;  2FXT A;  3F7X A;  1YVB I;  1D6U A;  5IG0 A;  6STD A;  3OW2 2;  2Z77 A;  1OGZ A;  5BVB A;  4MMY B;  1M90 4;  3X3X A;  2YFL B;  1RJO A;  3RGR A;  3NBJ A;  1WTH A;  2CC3 A;  2PNC A;  3VSY A;  4AEQ A;  3SLU A;  5AYR B;  1W6G A;  1FGT A;  3EQQ B;  2OTJ 3;  4AKZ A;  2IUJ A;  2CWV A;  1IV7 A;  3NBR A;  3NV0 B;  3RDE A;  1VQP 3;  3VF1 A;  1M1X B;  4XDW A;  3G6E 3;  1LVN A;  3V99 A;  4FCJ A;  3K7C A;  2CFW A;  5KP3 A;  2KXG A;  3EBT A;  3KFQ C;  2XGN A;  4JRF A;  1MNL A;  8CHO A;  1E3V A;  1LNH A;  3AMO B;  5IEO A;  3DGM A;  3LTC A;  3N8B A;  1TIJ A;  3WMD A;  1VQ8 3;  2GU3 A;  3LYG A;  4HM4 B;  1YI2 3;  1BUQ A;  3BNC A;  2ML6 A;  3PYJ A;  1O7M B;  2W6J H;  1W6Y A;  1WQL B;  1VQO 3;  2F99 A;  1W7C A;  2V1L A;  3HII A;  5AEU B;  2BT3 A;  4FCZ A;  4EV5 A;  4STD A;  2RGQ A;  4N6T A;  5DRE A;  3I56 3;  1STD A;  3IMA B;  2OWP A;  3IPT A;  2INX A;  3I0Y A;  3NM7 A;  2HMN B;  3FH1 A;  2PZV A;  1TU5 A;  3KSP A;  3LH4 A;  2CH9 A;  3DGL A;  3DXO A;  3FSD A;  3X40 A;  4HM8 B;  1C7H A;  3GZX B;  3CMA 3;  1OCV A;  1OAC A;  4FMD A;  4FCM A;  1DVC A;  4N6L A;  4NHF A;  5IW9 A;  4FMB A;  4AKY A;  1Q82 4;  4RNY A;  1W2Z A;  4HM2 B;  4O2H A;  1O7N B;  5EQL A;  3OX9 A;  4N6M A;  1N9J A;  2CK3 H;  4H3U A;  3HI7 A;  3LZA A;  3CCL 3;  3WA2 X;  1OH0 A;  3U1W A;  1VQ5 3;  2K0M A;  2MC8 A;  5IG3 A;  2W04 A;  2BMO B;  3EF8 A;  1RRL A;  1JN5 A;  1OHO A;  5AIG A;  3FCS B;  2Z7A A;  1UI8 A;  2BNG A;  3RGA A;  1GS3 A;  2D42 A;  3L0R A;  2CG1 A;  2QIY A;  1U5O A;  2YX9 A;  1M9G A;  5JBS A;  3PCR A;  5IG4 A;  4OVM A;  3UL6 A;  1SJW A;  1IT7 A;  1NDO B;  1AV4 A;  5FW5 A;  3F14 A;  3B4P A;  3BNE A;  3FG3 A;  1YJW 3;  3K5T A;  1CYV A;  1QAF A;  5AIH A;  1GY6 A;  3MPH A;  1W01 A;  2WGQ A;  2QA4 3;  1AVK A;  4MMX B;  3H51 A;  3PZW A;  2OOV C;  4WWU C;  5CLK A;  1S5A A;  1OF5 B;  4U13 A;  5CF1 A;  2LQV A;  3PGB A;  2UX0 A;  2ZL8 A;  1ASK A;  4R9L A;  5BXQ A;  3U97 A;  1ULJ B;  3WOF B;  4J8T A;  3OWS A;  2L4V A;  5KP4 A;  5DRV A;  1IV9 A;  3GAX A;  3BB9 A;  3F8H A;  2GBX B;  2OTL 3;  2Y73 A;  1KQS 2;  3A76 A;  2OOV A;  1T5Y A;  4L8O A;  5JPP A;  1IVV A;  3F7S A;  3MYT A;  1NWW A;  2W2C A;  3KSE D;  5EVH A;  1LOX A;  1VQ4 3;  2GXF A;  1GD4 A;  1NJI 4;  3MHE A;  1M1K 4;  3NHX A;  1JKG B;  3CPO A;  1N5H A;  3S67 A;  1GY7 A;  2FNQ A;  1K28 A;  2ZDJ A;  4IT7 A;  3LXU X;  4KZ1 A;  4L7K A;  1L5G B;  1TUH A;  4WYK B;  3UB1 A;  2GBW B;  1A2V A;  4K90 B;  1IQY A;  5D83 A;  3LTD A;  3JVC A;  2HML B;  4NRE A;  4EBG A;  4FMC A;  3EC9 A;  3LTB A;  2IA7 A;  3EJV A;  2Z6B A;  3V92 A;  4JF8 A;  2Z76 A;  3CCJ 3;  3DGN A;  3LOY A;  1OHP A;  4OK0 A;  5D81 A;  2RFR A;  5IEN A;  1Q40 A;  3CCE 3;  1MOL A;  1JJ2 2;  3CC4 3;  1UUV B;  1F8N A;  3CC2 3;  1QAL A;  4O02 B;  2B1X B;  2W56 A;  4ORL A;  4LMI A;  2MF7 A;  4EYC A;  1YGE A;  3KN4 A;  2XGL A;  1US1 A;  3BNB A;  3SOA A;  3X41 A;  2JDI H;  3HIG A;  5STD A;  2GEY A;  3X42 A;  4CDL A;  3HK4 A;  3JUO A;  4L8P A;  3S27 A;  3GZY B;  4R1K A;  3ALA A;  2R4I A;  1PU4 A;  1QAK A;  3CCU 3;  2E2U A;  2FGT A;  2HMM B;  1IQX A;  4R80 A;  4GL6 A;  3MG1 A;  4R9K A;  1N5P A;  3KKG A;  1OHS A;  1UI7 A;  1HKX A;  3K0Z A;  2LYX A;  2WGO A;  1FA3 A;  5CF2 A;  1GD3 A;  2W9P A;  4HZB B;  2WOF A;  3FG4 A;  4KFE A;  1SQW A;  1QVF 2;  1CQS A;  3FZW A;  4GB5 A;  2IMJ A;  1Q86 4;  2YFJ B;  7STD A;  4LGQ A;  3CCQ 3;  2XEP A;  4QWT A;  1U8C B;  3PXM A;  4XBT A;  4XDV A;  1VQL 3;  3G8Z A;  1D6Y A;  1W5Z A;  3EHC A;  1PFP A;  4XM4 A;  5ELJ A;  2YFI B;  2IUK A;  3MWZ A;  4EV2 A;  1VQN 3;  1VQ9 3;  2W03 A;  3DUK A;  3WOD G;  2D1W A;  2GU1 A;  3CNM A;  4R4K A;  1Q81 4;  3FF0 A;  3SVA A;  2KCD A;  2CG0 A;  1IT8 A;  2W0Q A;  4HJL B;  4HM6 B;  1E3R A;  5LC6 A;  4MJD A;  4ZM8 A;  1FGO A;  3QRD A;  4K61 A;  1R4C A;  3D9R A;  4H61 A;  1A2K A;  2O3O A;  3EB8 A;  1IK3 A;  4I4K A;  2CIU A;  1VQM 3;  1IVX A;  3EBY A;  1VQ7 3;  1GYB A;  2XSO B;  1EKM A;  1G96 A;  3D3L A;  1QVG 2;  5I97 A;  4WP5 A;  4XBX A;  1Y4K A;  3NV0 A;  1KWI A;  3VGN A;  1HU9 A;  5AYS C;  4X2H A;  3CCV 3;  3KE7 A;  3UJM A;  3WDG B;  3NQY A;  1EQK A;  3DMC A;  3AMO A;  1EA2 A;  4HM3 B;  1YJN 3;  1K41 A;  3KII A;  3S29 A;  2ML5 A;  3DY5 A;  2HMK B;  5AII A;  2BO9 B;  4O3V A;  1TP6 A;  2K54 A;  2WOH A;  3FGY A;  1W4N A;  3MKI A;  2CFK A;  4BTY A;  1FGR A;  3DM8 A;  3CME 3;  3UNL A;  3NUV A;  1WMN A;  2XSH B;  2CWT A;  3CD6 3;  4Q53 A;  3IJE B;  3NM2 A;  1QMA A;  4HZ9 B;  3SX1 A;  4BTW A;  3B7C A;  2P09 A;  1RRH A;  3NX0 A;  4FMA A;  5FGO A;  4MEI A;  1GY5 A;  3E99 A;  3O8Y A;  1N9E A;  3NQZ A;  3BLZ A;  2CFD A;  4N6U A;  4XBY A;  4WFO A;  3S5C A;  1O7W B;  3JUP A;  1JN5 B;  5CK6 A;  3CXC 2;  2HMO B;  5D82 A;  2F98 A;  3GWR A;  1IU7 A;  4HM1 B;  3ECF A;  1YIT 3;  3PS8 A;  1K9M 4;  1JB2 A;  1KC8 4;  2BMQ B;  1NO3 A;  3G16 A;  1IDP A;  3FLJ A;  4HKV B;  3N9H A;  3M8C A;  4J9A A;  3F9S A;  3WA3 A;  3EX9 A;  1A90 A;  3G0K A;  4N3V A;  3LT8 A;  4HVN A;  2QEX 3;  2C11 A;  1ZX2 A;  3UL5 A;  4IIA A;  3K9M C;  1DYU A;  1VQ6 3;  1WMO A;  2BMR B;  2Y74 A;  4HYZ A;  1O7H B;  4LSO A;  2XFT A;  1JRQ A;  1Q7Y 4;  4IPB A;  4KVH A;  3HZP A;  4EC6 A;  3I55 3;  1RKY A;  1DMQ A;  2OQE C;  4LZI A;  3V98 A;  2RCD A;  2WO0 A;  1STF I;  3OWU A;  3DZL A;  3CPW 2;  1D6Z A;  2XH9 A;  3FF2 A;  2I9W A;  1DVD A;  1OF5 A;  3JUN A;  4K1V A;  3LML A;  3GRD A;  1IVU A;  2P0X A;  1ZO2 A;  1KSI A;  3KZT A;  4G1M B;  1OUN A;  2P05 A;  1FGM A;  3T8U A;  3EN8 A;  4K1U A;  5KP1 A;  2RSX A;  2XFS A;  3J7Y d;  4O8S A;  3B4O A;  4N6N B;  1YJ9 3;  2OQE A;  2KRT A;  1O7G B;  3S28 A;  3CCR 3;  3F40 A;  5IF6 A;  5IG5 A;  1ISK A;  2HMJ B;  2P0M A;  3NXJ A;  2CHC A;  5IEP A;  1K73 4;  5AI1 A;  2M7O A;  4XB5 A;  1W2B 2;  1AVL A;  4MMZ B;  4HM0 B;  1DMM A;  3BND A;  3F8X A;  5AEW B;  1JKG A;  4WHA A;  2XR8 B;  1FGQ A;  3NBB A;  3Q90 A;  3EE1 A;  4PEJ A;  3GZB A;  3GZR A;  5EEO A;  1YHQ 3;  2Q07 A;  2A15 A;  1J2B A;  4KFF A;  4RZM A;  1TFO A;  1N8R 4;  4WYK A;  5HGR A;  3STD A;  1W02 A;  3Q1C A;  3FG1 A;  1WNH A;  1QJG A;  3OV4 A;  1Q40 B;  3FKA A;  1ULI B;  1Z1S A;  1V74 A;  2O9U X;  2STD A;  3HX8 A;  1SPU A;  3OWY A;  2W56 B;  3LT9 A;  1LXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...